WorldWideScience

Sample records for hhh hhh ddd

  1. 40 CFR Appendix: Table 1 to... - List of Hazardous Air Pollutants (HAP) for Subpart HHH

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 11 2010-07-01 2010-07-01 true List of Hazardous Air Pollutants (HAP) for Subpart HHH Table Appendix: Table 1 to Subpart HHH of Part 63 Protection of Environment... HHH of Part 63—List of Hazardous Air Pollutants (HAP) for Subpart HHH CAS Number a Chemical name 75070...

  2. Diagnosis and high incidence of hyperornithinemia-hyperammonemia-homocitrullinemia (HHH) syndrome in northern Saskatchewan.

    Science.gov (United States)

    Sokoro, AbdulRazaq A H; Lepage, Joyce; Antonishyn, Nick; McDonald, Ryan; Rockman-Greenberg, Cheryl; Irvine, James; Lehotay, Denis C

    2010-12-01

    Mutations in the SLC25A15 gene, encoding the human inner mitochondrial membrane ornithine transporter, are thought to be responsible for hyperornithinemia-hyperammonemia-homocitrullinemia (HHH) syndrome, a rare autosomal recessive condition. HHH syndrome has been detected in several small, isolated communities in northern Saskatchewan (SK). To determine the incidence of HHH syndrome in these communities, a PCR method was set up to detect F188Δ, the common French-Canadian mutation. Neonatal blood spots collected from all newborns from the high risk area were genotyped for the F188Δ mutation for seven consecutive years. Using DNA analysis, we estimated that the heterozygote frequency for the mutant allele for HHH syndrome to be about 1 in 19 individuals, predicting one affected child with HHH syndrome for approximately every 1,500 individuals (1 in 1,550 live births; 1 child every 12 years) in this isolated population. The frequency for the mutant allele for HHH syndrome in this isolated community is probably the highest in the world for this rare disorder. We determined that ornithine levels, by tandem mass spectrometry, were not abnormal in newborns with F188Δ mutation, carriers and normals. Ornithine rises to abnormally high levels at some time after birth well past the time that the newborn screening blood spot is collected. The timing or the reasons for the delayed rise of ornithine in affected children with HHH syndrome have not been determined. Newborn screening for HHH Syndrome in this high risk population is only possible by detection of the mutant allele using DNA analysis.

  3. Insights into the mutation-induced HHH syndrome from modeling human mitochondrial ornithine transporter-1.

    Directory of Open Access Journals (Sweden)

    Jing-Fang Wang

    Full Text Available Human mitochondrial ornithine transporter-1 is reported in coupling with the hyperornithinemia-hyperammonemia-homocitrullinuria (HHH syndrome, which is a rare autosomal recessive disorder. For in-depth understanding of the molecular mechanism of the disease, it is crucially important to acquire the 3D structure of human mitochondrial ornithine transporter-1. Since no such structure is available in the current protein structure database, we have developed it via computational approaches based on the recent NMR structure of human mitochondrial uncoupling protein (Berardi MJ, Chou JJ, et al. Nature 2011, 476:109-113. Subsequently, we docked the ligand L-ornithine into the computational structure to search for the favorable binding mode. It was observed that the binding interaction for the most favorable binding mode is featured by six remarkable hydrogen bonds between the receptor and ligand, and that the most favorable binding mode shared the same ligand-binding site with most of the homologous mitochondrial carriers from different organisms, implying that the ligand-binding sites are quite conservative in the mitochondrial carriers family although their sequences similarity is very low with 20% or so. Moreover, according to our structural analysis, the relationship between the disease-causing mutations of human mitochondrial ornithine transporter-1 and the HHH syndrome can be classified into the following three categories: (i the mutation occurs in the pseudo-repeat regions so as to change the region of the protein closer to the mitochondrial matrix; (ii the mutation is directly affecting the substrate binding pocket so as to reduce the substrate binding affinity; (iii the mutation is located in the structural region closer to the intermembrane space that can significantly break the salt bridge networks of the protein. These findings may provide useful insights for in-depth understanding of the molecular mechanism of the HHH syndrome and

  4. Structure-guided mutational analysis of the OB, HhH, and BRCT domains of Escherichia coli DNA ligase.

    Science.gov (United States)

    Wang, Li Kai; Nair, Pravin A; Shuman, Stewart

    2008-08-22

    NAD(+)-dependent DNA ligases (LigAs) are ubiquitous in bacteria and essential for growth. LigA enzymes have a modular structure in which a central catalytic core composed of nucleotidyltransferase and oligonucleotide-binding (OB) domains is linked via a tetracysteine zinc finger to distal helix-hairpin-helix (HhH) and BRCT (BRCA1-like C-terminal) domains. The OB and HhH domains contribute prominently to the protein clamp formed by LigA around nicked duplex DNA. Here we conducted a structure-function analysis of the OB and HhH domains of Escherichia coli LigA by alanine scanning and conservative substitutions, entailing 43 mutations at 22 amino acids. We thereby identified essential functional groups in the OB domain that engage the DNA phosphodiester backbone flanking the nick (Arg(333)); penetrate the minor grove and distort the nick (Val(383) and Ile(384)); or stabilize the OB fold (Arg(379)). The essential constituents of the HhH domain include: four glycines (Gly(455), Gly(489), Gly(521), Gly(553)), which bind the phosphate backbone across the minor groove at the outer margins of the LigA-DNA interface; Arg(487), which penetrates the minor groove at the outer margin on the 3 (R)-OH side of the nick; and Arg(446), which promotes protein clamp formation via contacts to the nucleotidyltransferase domain. We find that the BRCT domain is required in its entirety for effective nick sealing and AMP-dependent supercoil relaxation.

  5. Summary of CARE-HHH Mini-Workshop on LHC Crab Cavity Validation, 21 August 2008

    CERN Document Server

    Calaga, R; Garoby, R; Linnecar, T; Tomás, R; Zimmermann, F; CERN. Geneva. BE Department

    2008-01-01

    A global LHC crab-cavity collaboration is rapidly advancing the R&D of a complete crab cavity cryomodule and performing the associated beam dynamics simulations compatible with a prototype test in the phase 0/I upgrade with the aim of establishing a full crab crossing scheme for the phase II upgrade of the LHC. A one day CARE-HHH mini-workshop was held on August 21, 2008 at CERN to discuss crab crossing in the LHC phase 0/I & II upgrades and this reports summarizes the activities of the four sessions that took place during the workshop. The goals of this crab-cavity workshop were fourfold: (1) to discuss prospects of crab cavities in LHC upgrades (2) to review the status of the cryomodule development and beam dynamics, (3) to establish validity requirements for LHC crab cavities which need to be demonstrated prior to their installation into the LHC, and (4) to provide guidance & coordination for the global collaborators.

  6. CARE-HHH-APD Workshop on Finalizing the Roadmap for the Upgrade of the CERN and GSI Accelerator Complex

    CERN Document Server

    Zimmermann, Frank; BEAM'07; BEAM 2007; Finalizing the Roadmap for the Upgrade of the LHC and GSI Accelerator Complex

    2008-01-01

    This report contains the Proceedings of the CARE-HHH-APD Event BEAM’07, “Finalizing the Roadmap for the Upgrade of the CERN & GSI Accelerator Complex,” which was held at CERN in Geneva, Switzerland, from 1 to 5 October 2007. BEAM’07 was primarily devoted to beam dynamics limitations for the two, or three, alternative baseline scenarios of the LHC luminosity upgrade and to critical design choices for the upgrade of the LHC injector complex at CERN and for the FAIR complex at GSI. It comprised five parts: (1) a Mini-Workshop on LHC+ Beam Performance, (2) a CERN-GSI Meeting on Collective Effects, (3) the Francesco Ruggiero Memorial Symposium, (4) a Mini-Workshop on the LHC Injectors Upgrade, and (5) the BEAM’07 Summaries. Topics addressed in the first mini-workshop of BEAM’07 ranged from the luminosity performance reach of the upgraded LHC in different scenarios, over the generation and stability of the future LHC beams, the turnaround time, beam–beam effects, luminosity levelling methods, and ...

  7. Joint CARE-ELAN, CARE-HHH-APD, and EUROTEV-WP3 Workshop on Electron Cloud Clearing

    CERN Document Server

    Scandale, Walter; Schulte, D; Zimmermann, F; Electron Cloud Effects and Technological Consequences; ECL2

    2007-01-01

    This report contains the Proceedings of the joint CARE-HHH-APD, CARE-ELAN, and EUROTEV-WP3 Mini-Workshop on 'Electron Cloud Clearing - Electron Cloud and Technical Consequences', "ECL2", held at CERN in Geneva, Switzerland, 1-2 March 2007). The ECL2 workshop explored novel technological remedies against electron-cloud formation in an accelerator beam pipe. A primary motivation for the workshop was the expected harmful electron-cloud effects in the upgraded LHC injectors and in future linear colliders, as well as recent beam observations in operating facilities like ANKA, CESR, KEKB, RHIC, and SPS. The solutions discussed at ECL2 included enamel-based clearing electrodes, slotted vacuum chambers, NEG coating, and grooves. Several of the proposed cures were assessed in terms of their clearing efficiency and the associated beam impedance. The workshop also reviewed new simulation tools like the 3D electron-ion build-up 'Faktor', modeling assumptions, analytical calculations, beam experiments, and laboratory meas...

  8. Evidence of CP violation in B -> hhh charmless decays

    CERN Multimedia

    CERN. Geneva

    2012-01-01

    We present the first evidence of CP violation in the B+→ pi+pi-pi+,  B+→ K+pi+pi-, B+→ K+K-pi+ and B+→K+K-K+ decays using the 1.0 fb-1 of data collected by the LHCb experiment during 2011. The results show that the 3pi and Kpipi channels present a positive asymmetry while the KKpi and KKK modes present a negative asymmetry. We also study the variation of the CP violation effects in the phase space of each three-body decay.  We find significant inhomogeneities that reveal regions with particularly large asymmetries in the pipi and KK low mass regions in B+→pi+pi-pi+ and B+→K+K-pi+ respectively.

  9. Improved measurements of the two-body decays B → hh(h = K, π)

    International Nuclear Information System (INIS)

    Mohanty, Gagan

    2013-01-01

    We report improved measurements of the branching fractions and CP violation asymmetries for B → Kπ,ππ and K K decays based on the final data sample 772 million BB pairs collected with the Belle detector. We set a 90% confidence-level upper limit for B 0 →K + K; all other decays are observed with branching fraction ranging from 10 6 to 10 5

  10. Summy of the working groupI of the care HHH LUMI-2005 workshop

    CERN Document Server

    Brüning, Oliver Sim

    2006-01-01

    The working group I of the LUMI-2005 workshop was asked to put together a catalogue of basic design options for the IR solutions for an LHC-upgrade. The goal of the working group was to discuss the different solutions with respect to the maximum beta-functions inside the first focusing quadrupole magnets and the resulting required quadrupole apertures the chromatic aberrations on the one hand and the implications for the magnet technology on the other hand. Such a comparison requires a wide range of input data ranging from the expected loss patterns at the magnetic elements and the resulting peak and average heat deposition to the obtainable peak magnetic field and quench limits for different magnet design options and the correct ability of the chromatic aberrations for a given optics design. Given the wide spectrum of relevant input data the working group could not yet prepare a final ranking of the various design options. Rather the working group succeeded in fixing some of the key boundary conditions in or...

  11. Study of CP violation in the B0 → h+h-(h = π, K) decay by the BaBar detector at SLAC

    International Nuclear Information System (INIS)

    Pivk, Muriel

    2003-01-01

    The absence of antimatter in the universe imposes the study of the CP symmetry violation. This phenomenon first uncovered in the K meson systems has been recently evidenced in the B meson systems. The B factories PEP-II and KEK-B produce e + e - in the Υ(4S) resonance, which undergoes a decay into charged or neutral BB-bar pairs. Evidencing the CP violation requires a measurement of the difference between the B meson decays towards a precise final state and the B-bar meson decay, i.e. of the CP conjugate antiparticle of B. The work described in this thesis has been carried out since January 2001 with the detector BABAR. Namely, the subject matter of the thesis was the study of the neutral B meson decay into two charmless bodies in the final state B 0 /B 0 -bar → h + h - (h = π, K). Since events in these channels are extremely rare a major task of the analysis is to lower the background as much as possible. The decays allow studying the CP violation namely, through the α angle of the unitarity triangle describing the CP violation in the Standard Model. This new information added to the β angle and to other CKM matrix parameters, already measured, permits strengthening the constraints on the Standard Model parameters. This thesis is structured in three parts. The first one deals with the theory. First it presents a general description of the weak interaction within in the frame of the Standard Model, as well as a description of the B 0 /B 0 -bar system. The second chapter presents the B 0 → π + π - decay which is indeed the core of this thesis. Four theoretical models studied for the interpretation of the results are also described. The second part is devoted to the experimental setup. The PEP-II collider and the BABAR detector are described thoroughly to comprehend the key points of the analysis. The third part presents details of the analysis of experimental results from the data acquisition up to extraction of measurement magnitudes. The chapter four gives a general outlook of the analysis particularly of the event selection. The fundamental variables are here defined and exposed is the principle of the likelihood method used for extraction of the information in the last stage of the analysis. The chapter five is devoted to the fight against the background. The following chapter presents the adjustment made to shape the final stage of analysis which allows extraction of the branching ratios and parameters which measure the CP violation. Finally, the last chapter deals with the interpretation of the results in terms of constraints on parameters of CKM matrix of the Standard Model. Also, the results of Belle experiment are discussed. In conclusion, the following values were obtained for the branching ratios: B(B 0 → π + π - ) = 4.7 ± 0.6 ± 0.2 10 -6 ; B(B 0 → K + π - ) = 17.9 ± 0.9 ± 0.7 10 -6 ; B(B 0 → K + K - ) -6 (90%). These values are in good agreement with the data previously published but they have a higher precision. In the last case only an upper limit is given because the signal is as expected very low. The results for the parameters measuring the CP violation are: A Kπ = - 0.10 ± 0.05 ± 0.02; S ππ = 0.02 ± 0.34 ± 0.05; C ππ = - 0.30 ± 0.25 ± 0.04. These three values are compatible with the absence of CP violation. The interpretation of these results show that is still difficult to constrain significantly the alpha angle with the current statistics and isospin symmetry which is the only solid theoretical frame. Hopefully, the statistics of BABAR will increase till 2006 by a factor of five and the B 0 → π 0 π 0 ) decay branching will be measured sufficiently accurately to allow reaching the α angle. To get stronger constraints the theoretical models should be further elaborated and experimentally checked

  12. 40 CFR 129.101 - DDT, DDD and DDE.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 21 2010-07-01 2010-07-01 false DDT, DDD and DDE. 129.101 Section 129... POLLUTANT EFFLUENT STANDARDS Toxic Pollutant Effluent Standards and Prohibitions § 129.101 DDT, DDD and DDE. (a) Specialized definitions. (1) DDT Manufacturer means a manufacturer, excluding any source which is...

  13. MR PROSTATE SEGMENTATION VIA DISTRIBUTED DISCRIMINATIVE DICTIONARY (DDD) LEARNING.

    Science.gov (United States)

    Guo, Yanrong; Zhan, Yiqiang; Gao, Yaozong; Jiang, Jianguo; Shen, Dinggang

    2013-01-01

    Segmenting prostate from MR images is important yet challenging. Due to non-Gaussian distribution of prostate appearances in MR images, the popular active appearance model (AAM) has its limited performance. Although the newly developed sparse dictionary learning method[1, 2] can model the image appearance in a non-parametric fashion, the learned dictionaries still lack the discriminative power between prostate and non-prostate tissues, which is critical for accurate prostate segmentation. In this paper, we propose to integrate deformable model with a novel learning scheme, namely the Distributed Discriminative Dictionary ( DDD ) learning, which can capture image appearance in a non-parametric and discriminative fashion. In particular, three strategies are designed to boost the tissue discriminative power of DDD. First , minimum Redundancy Maximum Relevance (mRMR) feature selection is performed to constrain the dictionary learning in a discriminative feature space. Second , linear discriminant analysis (LDA) is employed to assemble residuals from different dictionaries for optimal separation between prostate and non-prostate tissues. Third , instead of learning the global dictionaries, we learn a set of local dictionaries for the local regions (each with small appearance variations) along prostate boundary, thus achieving better tissue differentiation locally. In the application stage, DDDs will provide the appearance cues to robustly drive the deformable model onto the prostate boundary. Experiments on 50 MR prostate images show that our method can yield a Dice Ratio of 88% compared to the manual segmentations, and have 7% improvement over the conventional AAM.

  14. [Measurement of antimicrobial consumption using DDD per 100 bed-days versus DDD per 100 discharges after the implementation of an antimicrobial stewardship program].

    Science.gov (United States)

    Collado, Roberto; Losa, Juan Emilio; Álvaro, Elena Alba; Toro, Piedad; Moreno, Leonor; Pérez, Montserrat

    2015-12-01

    Monitoring antimicrobial consumption in hospitals is a necessary measure. The indicators commonly employed do not clearly reflect the antibiotic selection pressure. The objective of this study is to evaluate two different methods that analyze antimicrobial consumption based on DDD, per stay and per discharge, before and after the implementation an antimicrobial stewardship program. Comparative pre-post study of antimicrobial consumption with the implementation of an antimicrobial stewardship program using DDD per 100 bed-days and DDD per 100 discharges as indicators. Hospital bed days remained stable and discharges increased slightly along the period of study Antibiotic consumption in DDD per 100 bed-days decreased by 2.5% versus 3.8% when expressed as DDD per 100 discharges. Antifungal consumption decreased by more than 50%. When average hospital stay decreases, reductions in the consumption of antimicrobials with an antimicrobial stewardship program system occur at the expense of reducing the number of patients receiving treatment, while increases occur due to longer durations of treatment.

  15. An AAA-DDD triply hydrogen-bonded complex easily accessible for supramolecular polymers.

    Science.gov (United States)

    Han, Yi-Fei; Chen, Wen-Qiang; Wang, Hong-Bo; Yuan, Ying-Xue; Wu, Na-Na; Song, Xiang-Zhi; Yang, Lan

    2014-12-15

    For a complementary hydrogen-bonded complex, when every hydrogen-bond acceptor is on one side and every hydrogen-bond donor is on the other, all secondary interactions are attractive and the complex is highly stable. AAA-DDD (A=acceptor, D=donor) is considered to be the most stable among triply hydrogen-bonded sequences. The easily synthesized and further derivatized AAA-DDD system is very desirable for hydrogen-bonded functional materials. In this case, AAA and DDD, starting from 4-methoxybenzaldehyde, were synthesized with the Hantzsch pyridine synthesis and Friedländer annulation reaction. The association constant determined by fluorescence titration in chloroform at room temperature is 2.09×10(7)  M(-1) . The AAA and DDD components are not coplanar, but form a V shape in the solid state. Supramolecular polymers based on AAA-DDD triply hydrogen bonded have also been developed. This work may make AAA-DDD triply hydrogen-bonded sequences easily accessible for stimuli-responsive materials. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  16. Deconstructing the mammal species richness pattern in Europe - towards and understanding of the relative importance of climate, biogeographic history, habitat heterogeneity and humans

    DEFF Research Database (Denmark)

    Fløjgaard, Camilla; Normand, Signe; Skov, Flemming

    2011-01-01

    partitioning to assess the importance of macroclimate and HHH variables. The HHH variables included two historical factors, estimated by novel methodologies: (1) ice-age-driven dynamics, represented by accessibility to recolonization from hindcasting-estimated glacial refugia, and (2) biogeographic peninsular...

  17. Data of evolutionary structure change: 1A5CB-2QUUC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 2QUU C 2QUUC ...in>C 2QUUC INKCPLLKPWAence> HHH...>2 2QUU C 2QUUC LKIGE--HTPSA...1A5CB-2QUUC 1A5C 2QUU B C ------LPADVAEELATTAQKLVQAGKGILAADESTQTI.../pdbChain> 1A5CB ence>LFGTK-GLGKFence> HHH -

  18. Data of evolutionary structure change: 1ACLA-1LPOA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available entryIDChain>1ACLA DEQFP-GFSGS > - HHH...O A 1LPOA PEGTYEENLPK ...> HHH> ATOM 474 CA PRO A 65 69.013 60.208 -6.968 1...Chain>A 1LPOA GSASD--KLACL re> --HHHHH...CLA NLNSDEELIHCL > HHHHHHHH

  19. effect of o,p'-DDD on the in vivo incorporation of 3H-thymidine into DNA

    International Nuclear Information System (INIS)

    Lund, B.-O.; Brandt, I.; Busk, L.; Hellmann, B.

    1990-01-01

    The effects of o,p'-DDD on the DNA synthesis in the C57Bl mouse lung and liver were studied. As determined by 3 H-thymidine incorporation into DNA, a selective increase in the lung DNA synthesis (+59%) was observed 2 day after a single intraperiotoneal injection of 100 mg/kg o,p'-DDD. Microautoradiography showed that incorporated 3 H-thymidine was confined to a restricted number of heavily labelled cells, presumably proliferating type II cells. At the most, a 9 times higher rate of cell proliferation was observed in the lung 4 days after an intraperitoneal injection of 500 mg/kg o,p'-DDD. Using mouse lung or liver S-9 as activating system, no mutagenic activity of o,p'-DDD was detected in the Ames test. The induced cell proliferation may indicate a tissue-selective promotor activity of o,p'-DDD in the mouse lung. (author)

  20. Biochemical, Kinetic, and Spectroscopic Characterization of Ruegeria pomeroyi DddW--A Mononuclear Iron-Dependent DMSP Lyase.

    Directory of Open Access Journals (Sweden)

    Adam E Brummett

    Full Text Available The osmolyte dimethylsulfoniopropionate (DMSP is a key nutrient in marine environments and its catabolism by bacteria through enzymes known as DMSP lyases generates dimethylsulfide (DMS, a gas of importance in climate regulation, the sulfur cycle, and signaling to higher organisms. Despite the environmental significance of DMSP lyases, little is known about how they function at the mechanistic level. In this study we biochemically characterize DddW, a DMSP lyase from the model roseobacter Ruegeria pomeroyi DSS-3. DddW is a 16.9 kDa enzyme that contains a C-terminal cupin domain and liberates acrylate, a proton, and DMS from the DMSP substrate. Our studies show that as-purified DddW is a metalloenzyme, like the DddQ and DddP DMSP lyases, but contains an iron cofactor. The metal cofactor is essential for DddW DMSP lyase activity since addition of the metal chelator EDTA abolishes its enzymatic activity, as do substitution mutations of key metal-binding residues in the cupin motif (His81, His83, Glu87, and His121. Measurements of metal binding affinity and catalytic activity indicate that Fe(II is most likely the preferred catalytic metal ion with a nanomolar binding affinity. Stoichiometry studies suggest DddW requires one Fe(II per monomer. Electronic absorption and electron paramagnetic resonance (EPR studies show an interaction between NO and Fe(II-DddW, with NO binding to the EPR silent Fe(II site giving rise to an EPR active species (g = 4.29, 3.95, 2.00. The change in the rhombicity of the EPR signal is observed in the presence of DMSP, indicating that substrate binds to the iron site without displacing bound NO. This work provides insight into the mechanism of DMSP cleavage catalyzed by DddW.

  1. Agent-based Decision Support System for the Third Generation Distributed Dynamic Decision-making (DDD-III) Simulator

    National Research Council Canada - National Science Library

    Meirina, Candra; Ruan, Sui; Yu, Feili; Zhu, Liang; Pattipati, Krishna R; Kleinman, David L

    2004-01-01

    ...) based on the third-generation distributed dynamic decision-making (DDD-III) simulator and contingency theory to increase the organizational cognitive capacity and to facilitate the processes of adaptation...

  2. Unita di consumo dei farmaci e valutazioni farmacoeconomiche: uso e misuso di DDD e PDD

    Directory of Open Access Journals (Sweden)

    Mario Eandi

    2002-12-01

    Full Text Available In pharmacoeconomical evaluations the quantification of drug utilization has to be done on the basis of measurement units that allow comparisons among series of longitudinal and transversal data. The most common techniques used for the analysis and the comparison of drug utilization patterns are based either on the Defined Daily Dose (DDD, a unit system proposed by WHO’s Drug Utilization Research Group, or on the Prescribed Daily Dose (PDD, a statistical parameter obtained from the analysis of drug prescriptions. This article illustrates the meaning of the main indicators of drug consumption that can be build with these techniques, underlining their utility and limitations. The DDD is the conventionally established theoretical mean daily dose of a drug, referred to a way of administration and to its main indication. It is, therefore, a mere technical measurement unit that cannot be interpreted as mean prescribed or consumed dose, and even less as recommended dose. The PDD, on the contrary, is not a measurement unit but a statistical mean value, that expresses the central tendency of the prescription variability in a defined setting. Starting from Italian data on the consumption of wide-spread antibiotics, the use and interpretation of various indicators based on the DDDs and PDDs are discussed. The parameters derived with the DDD technique are suitable for monitoring drug utilization and pharmaceutical expenditure. The PDD method is more direct, indicates the mean quantities actually prescribed and permits the estimation of the total dose consumed per therapeutic cycle and of other clinically relevant parameters, but requires the acquisition of more data than the other technique does. It is also important to remark the fact that both methods can’t be directly used for economical evaluations trying to assess the efficiency of resource allocation, as they are not correlated to the clinical outcomes of the therapy.

  3. Modelling Coastal Cliff Recession Based on the GIM-DDD Method

    Science.gov (United States)

    Gong, Bin; Wang, Shanyong; Sloan, Scott William; Sheng, Daichao; Tang, Chun'an

    2018-04-01

    The unpredictable and instantaneous collapse behaviour of coastal rocky cliffs may cause damage that extends significantly beyond the area of failure. Gravitational movements that occur during coastal cliff recession involve two major stages: the small deformation stage and the large displacement stage. In this paper, a method of simulating the entire progressive failure process of coastal rocky cliffs is developed based on the gravity increase method (GIM), the rock failure process analysis method and the discontinuous deformation analysis method, and it is referred to as the GIM-DDD method. The small deformation stage, which includes crack initiation, propagation and coalescence processes, and the large displacement stage, which includes block translation and rotation processes during the rocky cliff collapse, are modelled using the GIM-DDD method. In addition, acoustic emissions, stress field variations, crack propagation and failure mode characteristics are further analysed to provide insights that can be used to predict, prevent and minimize potential economic losses and casualties. The calculation and analytical results are consistent with previous studies, which indicate that the developed method provides an effective and reliable approach for performing rocky cliff stability evaluations and coastal cliff recession analyses and has considerable potential for improving the safety and protection of seaside cliff areas.

  4. Data of evolutionary structure change: 1EP8B-1FAAA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1EP8B-1FAAA 1EP8 1FAA B A -------------GGSVIVIDSKAAWDAQLAKGKEEHKP...IVVAFTATWCGPCKMIAPLFETLSNDYAGKVIFLKVDVD-AVAAVAEAAGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAAA LELALGT.../pdbChain> 1FAAA KLDCNQENKTL EEE HHH 1 1FAA A 1FAAA

  5. Dicty_cDB: AFH258 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 6. 2 Translated Amino Acid sequence gllxskinikqi*k*kcqvvemvvii*kilaiilkkllfnhqkkqlql*ynkilmilk...vrqfqs*wvlinckl*iqsmvgfhqrcnkqimilkscllvf ywvplmhl*fgkvqerpq*fvdslkihfgvnkiisssirhqaqvmnisplsil*nlvipm vqyws...*nkkkl* Frame B: gllxskinikqi*k*kcqvvemvvii*kilaiilkkllfnhqkkqlql*ynkilmilkq* hhh*SQNPLVAVLVKINHHHHHHVVVVVIK

  6. Comorbid trajectories of substance use as predictors of Antisocial Personality Disorder, Major Depressive Episode, and Generalized Anxiety Disorder.

    Science.gov (United States)

    Brook, Judith S; Zhang, Chenshu; Rubenstone, Elizabeth; Primack, Brian A; Brook, David W

    2016-11-01

    To determine longitudinal associations between patterns of comorbid cigarette, alcohol, and marijuana use and Antisocial Personality Disorder (ASPD), Major Depressive Episode (MDE), and Generalized Anxiety Disorder (GAD) in adulthood. A random community-based sample [X̅ age=36.6 (SD=2.8)] from the Children and Adults in the Community Study, an on-going investigation of substance use and psychiatric disorders. Data were collected at six time waves. Conjoint trajectories of cigarette, alcohol, and marijuana use spanning adolescence to adulthood were determined; multivariable logistic regression analyses assessed associations between trajectory group membership and having ASPD, MDE, or GAD in adulthood. Five conjoint trajectory groups were obtained: HHH (chronic cigarette, alcohol, and marijuana use), DDD (delayed/late-starting cigarette, alcohol, and marijuana use), LML (low/no smoking, moderate alcohol use, occasional marijuana use), HMN (chronic smoking, moderate alcohol use, no marijuana use), and NON (occasional alcohol use only). Compared with members of the NON group, those in the HHH group had significantly greater odds for having ASPD (Adjusted Odds Ratio [AOR]=28.52, 95% Confidence Interval [CI]=9.44-86.17), MDE (AOR=2.67, 95% CI=1.14-6.26), and GAD (AOR=6.39, 95% CI=2.62-15.56). Members of the DDD, LML, and HMN groups had weaker and less consistent associations with the three psychiatric outcomes. In a large, community-based sample, long-term concurrent use of more than one substance was associated with both externalizing and internalizing psychiatric disorders in adulthood. Prevention and treatment programs might target individuals in the community and general clinical populations with comorbid substance use, even if they haven't been identified as having a substance use disorder. Copyright © 2016 Elsevier Ltd. All rights reserved.

  7. The Use of Dexamethasone in Support of High-Altitude Ground Operations and Physical Performance: Review of the Literature

    Science.gov (United States)

    2014-12-01

    rates vary dramatically, the physiological effect of hypobaric high-altitude hypoxia (HHH) is ubiquitous.1,2 Symptoms of less severe cases of HHH...staff member on a quarterly basis at the UHM Fellowship Program and Multiplace Hyperbaric Chamber Wilford Hall San Anto- nio MHS, Texas. Initially...oc- cupational, and undersea hyperbaric medicine. Lt Col (Ret) Wright, PhD, CAsP, is a full-time faculty member at the USAF School of Aerospace

  8. The results of electromagnetic studies of the Bragin-Loev ledge and the Chernihiv block of the DDD

    OpenAIRE

    Kushnir, A. N.; Burakhovich, T. R.

    2017-01-01

    The distribution of geomagnetic variations and the electric field on the Earth’s surface was obtained as a result of the modern experimental observations conducted in 2013 (10 points) in the northwestern part of the Dnieper-Donets depression (DDD) by the methods of magnetotelluric sounding (MTS) and magnetovariation profiling (MVP). It is possible to estimate the value of the electric conductivity and vertical and horizontal geoelectric structure. The processing of these data is done using th...

  9. The Dichotic Digits difference Test (DDdT): Development, Normative Data, and Test-Retest Reliability Studies Part 1.

    Science.gov (United States)

    Cameron, Sharon; Glyde, Helen; Dillon, Harvey; Whitfield, Jessica; Seymour, John

    2016-06-01

    The dichotic digits test is one of the most widely used assessment tools for central auditory processing disorder. However, questions remain concerning the impact of cognitive factors on test results. To develop the Dichotic Digits difference Test (DDdT), an assessment tool that could differentiate children with cognitive deficits from children with genuine dichotic deficits based on differential test results. The DDdT consists of four subtests: dichotic free recall (FR), dichotic directed left ear (DLE), dichotic directed right ear (DRE), and diotic. Scores for six conditions are calculated (FR left ear [LE], FR right ear [RE], and FR total, as well as DLE, DRE, and diotic). Scores for four difference measures are also calculated: dichotic advantage, right-ear advantage (REA) FR, REA directed, and attention advantage. Experiment 1 involved development of the DDdT, including error rate analysis. Experiment 2 involved collection of normative and test-retest reliability data. Twenty adults (aged 25 yr 10 mo to 50 yr 7 mo, mean 36 yr 4 mo) took part in the development study; 62 normal-hearing, typically developing, primary-school children (aged 7 yr 1 mo to 11 yr 11 mo, mean 9 yr 4 mo) and 10 adults (aged 25 yr 0 mo to 51 yr 6 mo, mean 34 yr 10 mo) took part in the normative and test-retest reliability study. In Experiment 1, error rate analysis was conducted on the 36 digit-pair combinations of the DDdT. Normative data collected in Experiment 2 were arcsine transformed to achieve a distribution that was closer to a normal distribution and z-scores calculated. Pearson product-moment correlations were used to determine the strength of relationships between DDdT conditions. The development study revealed no significant differences in the adult population between test and retest on any DDdT condition. Error rates on 36 digit pairs ranged from 1.5% to 16.7%. The most and the least error-prone digits were removed before commencement of the normative data study, leaving 25

  10. Lung Cancer Signature Biomarkers: tissue specific semantic similarity based clustering of Digital Differential Display (DDD data

    Directory of Open Access Journals (Sweden)

    Srivastava Mousami

    2012-11-01

    Full Text Available Abstract Background The tissue-specific Unigene Sets derived from more than one million expressed sequence tags (ESTs in the NCBI, GenBank database offers a platform for identifying significantly and differentially expressed tissue-specific genes by in-silico methods. Digital differential display (DDD rapidly creates transcription profiles based on EST comparisons and numerically calculates, as a fraction of the pool of ESTs, the relative sequence abundance of known and novel genes. However, the process of identifying the most likely tissue for a specific disease in which to search for candidate genes from the pool of differentially expressed genes remains difficult. Therefore, we have used ‘Gene Ontology semantic similarity score’ to measure the GO similarity between gene products of lung tissue-specific candidate genes from control (normal and disease (cancer sets. This semantic similarity score matrix based on hierarchical clustering represents in the form of a dendrogram. The dendrogram cluster stability was assessed by multiple bootstrapping. Multiple bootstrapping also computes a p-value for each cluster and corrects the bias of the bootstrap probability. Results Subsequent hierarchical clustering by the multiple bootstrapping method (α = 0.95 identified seven clusters. The comparative, as well as subtractive, approach revealed a set of 38 biomarkers comprising four distinct lung cancer signature biomarker clusters (panel 1–4. Further gene enrichment analysis of the four panels revealed that each panel represents a set of lung cancer linked metastasis diagnostic biomarkers (panel 1, chemotherapy/drug resistance biomarkers (panel 2, hypoxia regulated biomarkers (panel 3 and lung extra cellular matrix biomarkers (panel 4. Conclusions Expression analysis reveals that hypoxia induced lung cancer related biomarkers (panel 3, HIF and its modulating proteins (TGM2, CSNK1A1, CTNNA1, NAMPT/Visfatin, TNFRSF1A, ETS1, SRC-1, FN1, APLP2, DMBT1

  11. 3D DDD modelling of dislocation-precipitate interaction in a nickel-based single crystal superalloy under cyclic deformation

    Science.gov (United States)

    Lin, Bing; Huang, Minsheng; Zhao, Liguo; Roy, Anish; Silberschmidt, Vadim; Barnard, Nick; Whittaker, Mark; McColvin, Gordon

    2018-06-01

    Strain-controlled cyclic deformation of a nickel-based single crystal superalloy has been modelled using three-dimensional (3D) discrete dislocation dynamics (DDD) for both [0 0 1] and [1 1 1] orientations. The work focused on the interaction between dislocations and precipitates during cyclic plastic deformation at elevated temperature, which has not been well studied yet. A representative volume element with cubic γ‧-precipitates was chosen to represent the material, with enforced periodical boundary conditions. In particular, cutting of superdislocations into precipitates was simulated by a back-force method. The global cyclic stress-strain responses were captured well by the DDD model when compared to experimental data, particularly the effects of crystallographic orientation. Dislocation evolution showed that considerably high density of dislocations was produced for [1 1 1] orientation when compared to [0 0 1] orientation. Cutting of dislocations into the precipitates had a significant effect on the plastic deformation, leading to material softening. Contour plots of in-plane shear strain proved the development of heterogeneous strain field, resulting in the formation of shear-band embryos.

  12. Successful treatment of Cushing's disease with o,p - DDD followed by pituitary irradiation in a 19-year-old male patient

    International Nuclear Information System (INIS)

    Dickerman, Z.; Kaufman, H.; Laron, Z.; Tel Aviv Univ.

    1979-01-01

    A 19-year-old male patient with Cushing's disease was treated for 15 months with a gastric-insoluble preparation of o.p'-DDD. 12 months after the start of the o.p'-DDD therapy, the dose was reduced from 6 to 2 g/day and external pituitary irradiation (4,480 rads) was initiated. No disturbance in the secretion of human growth hormone, thyroid-stimulating hormone, luteinizing hormone, follicle-stimulating hormone or prolactin was revealed. The clinical and laboratory signs of Cushing's disease disappeared gradually, and the patient tolerated the drug well, even at a dose of 12 g/day. At present, two years after the discontinuation of o.p'-DDD therapy and pituitary irradiation, the patient is symptom free and receives no medication. (B.G.)

  13. Immobilization of Deoxyadenosine Kinase from Dictyostelium discoideum (DddAK) and Its Application in the 5’-Phosphorylation of Arabinosyladenine and Arabinosyl-2-fluoroadenine

    DEFF Research Database (Denmark)

    Serra, Immacolata; Ubiali, Daniela; Piskur, Jure

    2017-01-01

    Deoxyadenosine kinase from Dictyostelium discoideum (DddAK) phosphorylates its natural substrate (2’‐deoxyadenosine, dAdo) as well as the arabinosyladenine analogues vidarabine (araA) and fludarabine (F‐araA) to their corresponding 5’‐monophosphates. DddAK has been here immobilized by ionic...... interaction on an aminated epoxy‐functionalized support (SepabeadsTM EC‐EP), and cross‐linked with oxidized dextran. The final activity recovery was 33–42 %, depending on the protein loading. Immobilization enhanced the stability of DddAK at pH 10 and, to a lesser extent, at 45 °C. Phosphorylation of d...

  14. Passive sampling of DDT, DDE and DDD in sediments: accounting for degradation processes with reaction-diffusion modeling.

    Science.gov (United States)

    Tcaciuc, A Patricia; Borrelli, Raffaella; Zaninetta, Luciano M; Gschwend, Philip M

    2018-01-24

    Passive sampling is becoming a widely used tool for assessing freely dissolved concentrations of hydrophobic organic contaminants in environmental media. For certain media and target analytes, the time to reach equilibrium exceeds the deployment time, and in such cases, the loss of performance reference compounds (PRCs), loaded in the sampler before deployment, is one of the common ways used to assess the fractional equilibration of target analytes. The key assumption behind the use of PRCs is that their release is solely diffusion driven. But in this work, we show that PRC transformations in the sediment can have a measurable impact on the PRC releases and even allow estimation of that compound's transformation rate in the environment of interest. We found that in both field and lab incubations, the loss of the 13 C 2,4'-DDT PRC from a polyethylene (PE) passive sampler deployed at the sediment-water interface was accelerated compared to the loss of other PRCs ( 13 C-labeled PCBs, 13 C-labeled DDE and DDD). The DDT PRC loss was also accompanied by accumulation in the PE of its degradation product, 13 C 2,4'-DDD. Using a 1D reaction-diffusion model, we deduced the in situ degradation rates of DDT from the measured PRC loss. The in situ degradation rates increased with depth into the sediment bed (0.14 d -1 at 0-10 cm and 1.4 d -1 at 30-40 cm) and although they could not be independently validated, these rates compared favorably with literature values. This work shows that passive sampling users should be cautious when choosing PRCs, as degradation processes can affect some PRC's releases from the passive sampler. More importantly, this work opens up the opportunity for novel applications of passive samplers, particularly with regard to investigating in situ degradation rates, pathways, and products for both legacy and emerging contaminants. However, further work is needed to confirm that the rates deduced from model fitting of PRC loss are a true reflection of DDT

  15. Study of DDT and its derivatives DDD, DDE adsorption and degradation over Fe-SBA-15 at low temperature

    Institute of Scientific and Technical Information of China (English)

    Hailin Wang; Hua Tian; Zhengping Hao

    2012-01-01

    Mesoporous SBA-15 with different Fe2O3 loading were synthesized by an in-situ coating progress for removals of dichlorodiphenyltrichloroethane(DDT)and its derivatives,i.e.,1,1-dichloro-2,2-bis-(p-chlorophenyl)ethane(DDD)and 1,l-dichloro-2,2-bis-(4-chloro -phenyl)ethane(DDE).The results from XRD(X-ray diffractometer),TEM(transmission electron microscopy)indicated that the iron could be well dispersed on SBA-15 within 6 wt.% Fe2O3 loading.Nitrogen adsorption-desorption tests indicated that the synthesized materials were characterized by ordered meso-structure,high surface area and large pore volume.DDTs were removed from aqueous media in 12-hr treatment and high removal efficiency of DDTs was achieved at over 94%.DDTs could be completely degraded at 350℃ under the existence of SBA-15 with 4 wt.% Fe2O3 loading.The final degradation products of DDT were dichlorobenzophenone (DCB)and bis-(4-chloro-phenyl)methane(DDM),suggesting a complete dechlorination from trichloromethyl.

  16. Occurrences and fate of DDT principal isomers/metabolites, DDA, and o,p'-DDD enantiomers in fish, sediment and water at a DDT-impacted Superfund site.

    Science.gov (United States)

    Garrison, A W; Cyterski, M; Roberts, K D; Burdette, D; Williamson, J; Avants, J K

    2014-11-01

    In the 1950s and 60s, discharges from a DDT manufacturing plant contaminated a tributary system of the Tennessee River near Huntsville, Alabama, USA. Regulatory action resulted in declaring the area a Superfund site which required remediation and extensive monitoring. Monitoring data collected from 1988, after remediation, through 2011 showed annual decreases approximating first-order decay in concentrations of total DDT and its six principal congeners (p,p'-DDT, o,p'-DDT, p,p'-DDD, o,p'-DDD, p,p'-DDE and o,p'-DDE) in filets from three species of fish. As of 2013, these concentrations met the regulatory requirements of 5 mg/kg or less total DDT for each fish tested. The enantiomer fractions (EF) of chiral o,p'-DDD in smallmouth buffalo and channel catfish were always below 0.5, indicating preferential decay of the (+)-enantiomer of this congener; this EF did not change significantly over 15 years. The often-neglected DDT metabolite p,p'-DDA was found at a concentration of about 20 μg/l in the ecosystem water. Published by Elsevier Ltd.

  17. Higgs boson pair production at the photon linear collider in the two Higgs doublet model

    International Nuclear Information System (INIS)

    Asakawa, Eri; Harada, Daisuke; Okada, Yasuhiro; Kanemura, Shinya; Tsumura, Koji

    2009-02-01

    We calculate the cross section of the lightest Higgs boson pair production at the Photon Linear Collider in the two Higgs doublet model. We focus on the scenario in which the lightest Higgs boson has the standard model like couplings to gauge bosons. We take into account the one-loop correction to the hhh coupling as well as additional one-loop diagrams due to charged bosons to the γγ → hh helicity amplitudes. We discuss the impact of these corrections on the hhh coupling measurement at the Photon Linear Collider. (author)

  18. Identification of Quantitative Trait Loci That Determine Plasma Total-Cholesterol and Triglyceride Concentrations in DDD/Sgn and C57BL/6J Inbred Mice

    Directory of Open Access Journals (Sweden)

    Jun-ichi Suto

    2017-01-01

    Full Text Available DDD/Sgn mice have significantly higher plasma lipid concentrations than C57BL/6J mice. In the present study, we performed quantitative trait loci (QTL mapping for plasma total-cholesterol (CHO and triglyceride (TG concentrations in reciprocal F2 male intercross populations between the two strains. By single-QTL scans, we identified four significant QTL on chromosomes (Chrs 1, 5, 17, and 19 for CHO and two significant QTL on Chrs 1 and 12 for TG. By including cross direction as an interactive covariate, we identified separate significant QTL on Chr 17 for CHO but none for TG. When the large phenotypic effect of QTL on Chr 1 was controlled by composite interval mapping, we identified three additional significant QTL on Chrs 3, 4, and 9 for CHO but none for TG. QTL on Chr 19 was a novel QTL for CHO and the allelic effect of this QTL significantly differed between males and females. Whole-exome sequence analysis in DDD/Sgn mice suggested that Apoa2 and Acads were the plausible candidate genes underlying CHO QTL on Chrs 1 and 5, respectively. Thus, we identified a multifactorial basis for plasma lipid concentrations in male mice. These findings will provide insight into the genetic mechanisms of plasma lipid metabolism.

  19. The Fanconi anemia associated protein FAAP24 uses two substrate specific binding surfaces for DNA recognition

    NARCIS (Netherlands)

    Wienk, H.L.J.; Slootweg, J.C.; Speerstra, S.; Kaptein, R.; Boelens, R.; Folkers, G.E.

    2013-01-01

    To maintain the integrity of the genome, multiple DNA repair systems exist to repair damaged DNA. Recognition of altered DNA, including bulky adducts, pyrimidine dimers and interstrand crosslinks (ICL), partially depends on proteins containing helix-hairpin-helix (HhH) domains. To understand how ICL

  20. Accelerator Physics Code Web Repository

    CERN Document Server

    Zimmermann, Frank; Bellodi, G; Benedetto, E; Dorda, U; Giovannozzi, Massimo; Papaphilippou, Y; Pieloni, T; Ruggiero, F; Rumolo, G; Schmidt, F; Todesco, E; Zotter, Bruno W; Payet, J; Bartolini, R; Farvacque, L; Sen, T; Chin, Y H; Ohmi, K; Oide, K; Furman, M; Qiang, J; Sabbi, G L; Seidl, P A; Vay, J L; Friedman, A; Grote, D P; Cousineau, S M; Danilov, V; Holmes, J A; Shishlo, A; Kim, E S; Cai, Y; Pivi, M; Kaltchev, D I; Abell, D T; Katsouleas, Thomas C; Boine-Frankenheim, O; Franchetti, G; Hofmann, I; Machida, S; Wei, J

    2006-01-01

    In the framework of the CARE HHH European Network, we have developed a web-based dynamic acceleratorphysics code repository. We describe the design, structure and contents of this repository, illustrate its usage, and discuss our future plans, with emphasis on code benchmarking.

  1. Solution structure and DNA-binding properties of the C-terminal domain of UvrC from E.coli

    NARCIS (Netherlands)

    Singh, S.; Folkers, G.E.; Bonvin, A.M.J.J.; Boelens, R.; Wechselberger, R.W.; Niztayev, A.; Kaptein, R.

    2002-01-01

    The C-terminal domain of the UvrC protein (UvrC CTD) is essential for 5' incision in the prokaryotic nucleotide excision repair process. We have determined the three-dimensional structure of the UvrC CTD using heteronuclear NMR techniques. The structure shows two helix±hairpin±helix (HhH) motifs

  2. Data of evolutionary structure change: 1VL8A-2UVDE [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1VL8A-2UVDE 1VL8 2UVD A E FDLRGRVALVTGGSRGLGFGIAQGLAEAGCSVVVASRN-...eq1> -MLKGKVALVTGASRGIGRAIAIDLAKQGANVVVNYAGNEQKANEVVDEIKKL-GSDAIAVRADVANAED...>E 2UVDE VNYAGNEQKAN EEE H...in>E 2UVDE EIKKL-GSDAI HHH...yChain> 2UVD E 2UVDE VGVTG-NPGQA<

  3. Data of evolutionary structure change: 1A5CB-2QUTC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 8 2QUT C 2QUTC ...ain>C 2QUTC ence>INKCPLLKPWA HH...T C 2QUTC ence>LKIGE--HTPSA...1A5CB-2QUTC 1A5C 2QUT B C ------LPADVAEELATTAQKLVQAGKGILAADESTQTI... 1A5CB LFGTK-GLGKFence> HHH - <

  4. Data of evolutionary structure change: 1CG5A-2QU0C [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available D> C 2QU0C ence>YFPHF-DLSHGence> 0 A C VLSSQNKKAIEELGNLIKANAEAWGADALARLFELHPQT...n> 1CG5 A 1CG5A ence>VNLQA-FTPVT...line> THR CA 269 2QU0 C 2QU...0C ence>CHLPNDFTPAVence> HHHH HHH

  5. Data of evolutionary structure change: 1CG8A-2QU0A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available /pdbChain> 2QU0A ence>YFPHF-DLSHGence> G - 0 A A VLSSQNKKAIEELGNLIKANAEAWGADALARLFELHPQT...hain> 1CG8 A 1CG8A ence>VNLQA-FTPVT...ine>THR CA 278 2QU0 A 2QU...0A ence>CHLPNDFTPAV HH HHHH HHH

  6. Data of evolutionary structure change: 1A5CB-2QUVA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available n14> 2QUV A 2QUVA ...V A 2QUVA ... 2QUVA LKIGE--HTPSAence> E -- H...1A5CB-2QUVA 1A5C 2QUV B A ------LPADVAEELATTAQKLVQAGKGILAADESTQTI... 1A5CB ence>LFGTK-GLGKFence> HHH -

  7. Data of evolutionary structure change: 2QU0A-2DXMB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available n>A 2QU0A WGKVGGNAGAYGence> HHH...2QU0A-2DXMB 2QU0 2DXM A B -VLSAADKSNVKAAWGKVGGNAGAYGAEALERMFLSFPT...ID> 0 2DXM B 2DXMB ...ence>WGKVN--VDEVGence> GGG --HHHHH VAL CA 716 GLY CA 753 2QU0

  8. Data of evolutionary structure change: 1A5CB-2QUTA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 4> 2QUT A 2QUTA ...yChain> 2QUT A 2QUTA ...hain>A 2QUTA ence>LKIGE--HTPSAence> ...1A5CB-2QUTA 1A5C 2QUT B A ------LPADVAEELATTAQKLVQAGKGILAADESTQTI...entryIDChain>1A5CB ence>LFGTK-GLGKFence> HHH -

  9. Data of evolutionary structure change: 1BYPA-1FA4A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available dbChain>A 1BYPA SVTLT---EKGTY cture...>EEEE --- EEE> ATOM 522 CA SER A ...n> STTFPADAPAGEY ucture>EE ture...ucture> -- cture> ATOM 860 CA LYS A 57 7.87...yIDChain> TKISMPEEDLLN >HHH >

  10. Safety of Mixed Model Access Control in a Multilevel System

    Science.gov (United States)

    2014-06-01

    42  H.  FIREWALL AND IPS LANGUAGES...Research Laboratory AIS automated information system ANOA advance notice of arrival APT advanced persistent threat BFM boundary flow modeling...of Investigation FW firewall GENSER general service xvi GUI graphical user interface HAG high-assurance guard HGS high-grade service H-H-H High

  11. Data of evolutionary structure change: 1PVDA-2VBIA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1PVDA-2VBIA 1PVD 2VBI A A SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKGMSCIITTFGVGELSALNGIAGSYAEHVG.../ss_2> 0 1PVD A 1PVDA SFNDN-SKIRM HHH ... 1PVD A 1PVD...A 233 ARG CA 308 GLN CA 388 1PVD

  12. Data of evolutionary structure change: 1PVDA-2VBIG [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1PVDA-2VBIG 1PVD 2VBI A G SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKGMSCIITTFGVGELSALNGIAGSYAEHVG.../ss_2> 0 1PVD A 1PVDA SFNDN-SKIRM HHH ...ine>PRO CA 225 GLU CA 183 1PVD... A 1PVDA LQTPIDMSLKP

  13. ACCELERATION PHYSICS CODE WEB REPOSITORY.

    Energy Technology Data Exchange (ETDEWEB)

    WEI, J.

    2006-06-26

    In the framework of the CARE HHH European Network, we have developed a web-based dynamic accelerator-physics code repository. We describe the design, structure and contents of this repository, illustrate its usage, and discuss our future plans, with emphasis on code benchmarking.

  14. Data of evolutionary structure change: 1EWOA-5PADA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1EWOA-5PADA 1EWO 5PAD A A APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWF...ryChain> 5PAD A 5PADA...>5PAD A 5PADA KRGTGNSYGVCGLY ...>A 5PADA LVAQY---GIHYR HHH...Chain>A 5PADA TYPYE---GVQRY

  15. Prevalence of E/A wave fusion and A wave truncation in DDD pacemaker patients with complete AV block under nominal AV intervals.

    Directory of Open Access Journals (Sweden)

    Wolfram C Poller

    Full Text Available Optimization of the AV-interval (AVI in DDD pacemakers improves cardiac hemodynamics and reduces pacemaker syndromes. Manual optimization is typically not performed in clinical routine. In the present study we analyze the prevalence of E/A wave fusion and A wave truncation under resting conditions in 160 patients with complete AV block (AVB under the pre-programmed AVI. We manually optimized sub-optimal AVI.We analyzed 160 pacemaker patients with complete AVB, both in sinus rhythm (AV-sense; n = 129 and under atrial pacing (AV-pace; n = 31. Using Doppler analyses of the transmitral inflow we classified the nominal AVI as: a normal, b too long (E/A wave fusion or c too short (A wave truncation. In patients with a sub-optimal AVI, we performed manual optimization according to the recommendations of the American Society of Echocardiography.All AVB patients with atrial pacing exhibited a normal transmitral inflow under the nominal AV-pace intervals (100%. In contrast, 25 AVB patients in sinus rhythm showed E/A wave fusion under the pre-programmed AV-sense intervals (19.4%; 95% confidence interval (CI: 12.6-26.2%. A wave truncations were not observed in any patient. All patients with a complete E/A wave fusion achieved a normal transmitral inflow after AV-sense interval reduction (mean optimized AVI: 79.4 ± 13.6 ms.Given the rate of 19.4% (CI 12.6-26.2% of patients with a too long nominal AV-sense interval, automatic algorithms may prove useful in improving cardiac hemodynamics, especially in the subgroup of atrially triggered pacemaker patients with AV node diseases.

  16. A CSMP Commutation Model for Design Study of a Brushless DC Motor Power Conditioner for a Cruise Missile Fin Control Actuator.

    Science.gov (United States)

    1985-06-01

    miU PICJ 4- 00 OH ~0HH tiiI~ H L10 iP. iiiiUiiIIL’ Of 04 c HHHHHH go) 0000 MM3M M M HHII 1:0P 000000 01011 k-4 -4 000 ..44muWNWmu-4MU HHHHH H...14343(. HL4OH Qu).. "-(UI ) 06-40 k-iHU2(./24HUHw HHHHHHQ 71 H NO %0 00HNN 004H Hw* *4 HAQ* -4- 04W34 0104 c FIH EM *Ln2M N rz + 8 -14 Im HHHHHH ...HHH U) * * 02TC4 r4 A 4r1my (𔃾(N1 01010 wM1 ; -0w= .4 mm W004r rzl p HHHHHH P 110 pw Mm22 01 + + 0193 CDJ~ D CD 04 C00000 Q HHH -H" 0 00+0 Z: 010’ )CaM

  17. A Comparison between the Rhesus Monkey and the Human on the Effect of Atropine on the Electroencephalogram. Volume 2. Preliminary Statistical Analysis of Spectral EEG Waveforms in Rhesus Monkeys Exposed to Atropine.

    Science.gov (United States)

    1994-11-01

    000000 000000 000000 000000 000000 C) H rHI HHHH HHHHH - rIr- - rIr H HHHHH 1 1 l H HHHHH- rIr- -I ri - HHHHHH H E-1~~ o~o ~ N H W~r ~ ~ W~MqU) co ýH H aiI...NMlCMMH’DHOO I-NNNMNIr- I- NNNNOnMH U) toH H H z. 000000000 000000000 Cl) H HHHHHH HHHHHHqHHH H- E-4 N MWr-N H Mr- N wMn0~r-oMMN Wl MNHOMM0O’ ro m olq~w H...ý C4k 44 4 ýL 4C 00000 HHH.-4 1- HH H HHHH HHHH U) /u) co* o nvr r-IO NOHM H0(-if0 m i c4 HooD- 00 Z 0000 000000000 00000 VI) H HHHHHH HHHHH HHHH 1

  18. Higgs Pair Production in the $H(\\rightarrow \\tau\\tau)H(\\rightarrow b\\bar{b})$ channel at the High-Luminosity LHC

    CERN Document Server

    The ATLAS collaboration

    2015-01-01

    Prospects studies are presented for the observation of double Higgs production in the channel $H(\\rightarrow b \\overline{b})H(\\rightarrow \\tau \\tau)$ for a total integrated luminosity of 3000~fb$ ^{-1}$ of $\\sqrt{s}=$14~TeV proton-proton collisions at the HL-LHC. A cut-based analysis strategy using MC data and a parametrisation of the ATLAS detector provide assessment to the measurement prospects performed under different assumptions for the trilinear Higgs couplings values. Assuming SM background and SM signal, we expect to set an upper limit of the cross section for the di-Higgs production of $4.3 \\times \\sigma(HH \\rightarrow b\\bar{b}\\tau^+\\tau^-)$ at 95\\% Confidence Level. Using an effective Lagrangian for the Higgs potential, and allowing its trilinear coupling to vary, we can project an exclusion of $\\lambda_{HHH}/\\lambda_{SM} \\leq -4$ and $\\lambda_{HHH}/\\lambda_{SM} \\geq 12$.

  19. Coronary Arteries Segmentation Based on the 3D Discrete Wavelet Transform and 3D Neutrosophic Transform

    OpenAIRE

    Shuo-Tsung Chen; Tzung-Dau Wang; Wen-Jeng Lee; Tsai-Wei Huang; Pei-Kai Hung; Cheng-Yu Wei; Chung-Ming Chen; Woon-Man Kung

    2015-01-01

    Purpose. Most applications in the field of medical image processing require precise estimation. To improve the accuracy of segmentation, this study aimed to propose a novel segmentation method for coronary arteries to allow for the automatic and accurate detection of coronary pathologies. Methods. The proposed segmentation method included 2 parts. First, 3D region growing was applied to give the initial segmentation of coronary arteries. Next, the location of vessel information, HHH subband c...

  20. Development of a Distributed Breach for the Conical Shock Tube.

    Science.gov (United States)

    1983-01-01

    Ti - «<M’»<Mosm —vocvicocviosm —VO(VI cr»—vo •*— ro cvi ro • * m m is. vo N OO CO OS <c<c<c<c<r<c<coc<c<E<c«<c<c<coc<coi hht-HHI-1-Khhhl- hHhhHh

  1. Estimulação DDD com eletrodo único usando estimulação atrial bifásica simultânea: primeiros resultados clínicos

    Directory of Open Access Journals (Sweden)

    Fernando A LUCCHESE

    1997-01-01

    Full Text Available A estimulação de dupla câmara (DDD com eletrodo único usando eletrodo atrial flutuante está limitada em função dos altos limiares encontrados para captura atrial. Avaliamos um sistema novo de cabo eletrodo para estimulação atrial que utiliza dois anéis atriais com pulsos de onda quadrada simultâneos unipolares lançados com polaridade oposta. O primeiro pulso é aplicado ao pólo distal do eletrodo e é positivo, o segundo pulso é aplicado ao pólo proximal do eletrodo e é negativo, ambos em relação à carcaça do gerador. O atraso entre os dois pulsos é programável entre 0,0 ms e 1,0 ms. A distância entre os anéis a nível atrial é de 10 mm e a distância entre o pólo distal atrial e o eletrodo ventricular unipolar pode ser selecionado entre 11, 13 e 15 cm. O posicionamento dos anéis a nível atrial é selecionado de acordo com a medida do limiar de estimulação do pulso bifásico simultâneo, incluindo manobras respiratórias para confirmar a captura/sense contínuos. O gerador de pulso tem uma única conexão para o eletrodo e a capacidade de aplicar os pulsos programáveis de onda quadrada com polaridades opostas, com atrasos programáveis de 0,0 a 1,0 ms. O gerador pode ser programado para estimulação VDD com eletrodo único. Este sistema foi implantado em 4 pacientes com bloqueio AV total e função sinusal normal. Os limiares de estimulação atrial e diafragmático foram medidos com várias configurações do pulso, larguras e atrasos, intra e pós-operatórios. A porção média do átrio direito foi selecionada como a melhor posição para os anéis atriais com captura contínua durante inspiração profunda. As medidas intra-operatórias e pós-operatórias (48 horas foram: Limiar Intra-operatório Pós-operatório atrial unipolar 3,2 + 0,47 V não realizada atrial (bifásico simultâneo 1,6 + 0,37 V 3,37 + 0,84 V diafragmático acima de 7 V 5,21 + 0,3 V sense de onda P 2,35 + 1,3 mV 1,27 + 0,8 mV Os pacientes

  2. The global quantum duality principle: theory, examples, and applications

    OpenAIRE

    Gavarini, Fabio

    2003-01-01

    Let R be an integral domain, h non-zero in R such that R/hR is a field, and HA the category of torsionless (or flat) Hopf algebras over R. We call any H in HA "quantized function algebra" (=QFA), resp. "quantized (restricted) universal enveloping algebra" (=QrUEA), at h if H/hH is the function algebra of a connected Poisson group, resp. the (restricted, if R/hR has positive characteristic) universal enveloping algebra of a (restricted) Lie bialgebra. We establish an "inner" Galois' correspond...

  3. Quimera de ADN polimerasa del fago ϕ29

    OpenAIRE

    Salas, Margarita; Vega, Miguel de; Lázaro, José M.; Blanco, Luis; Mencía, Mario

    2010-01-01

    Quimera de ADN polimerasa del fago 29. La presente invención se encuadra dentro del campo de la biotecnología. Específicamente, se refiere a una quimera de ADN polimerasa que comprende una región aminoterminal (N-terminal), que codifica para una ADN polimerasa del tipo 29, y una región carboxilo-terminal (C-terminal), que comprende, al menos, un dominio HhH, que se encuentran unidas mediante una secuencia aminoacídica conectora y a su uso para la replicación, amplifi...

  4. The neutral Higgs self-couplings in the (h)MSSM

    Science.gov (United States)

    Chalons, G.; Djouadi, A.; Quevillon, J.

    2018-05-01

    We consider the Minimal Supersymmetric extension of the Standard Model in the regime where the supersymmetric breaking scale is extremely large. In this MSSM, not only the Higgs masses will be affected by large radiative corrections, the dominant part of which is provided by the third generation quark/squark sector, but also the various self-couplings among the Higgs states. In this note, assuming that squarks are extremely heavy, we evaluate the next-to-leading order radiative corrections to the two neutral CP-even Higgs self-couplings λHhh and λhhh and to the partial decay width Γ (H → hh) that are most relevant at the LHC. The calculation is performed using an effective field theory approach that resums the large logarithmic squark contributions and allows to keep under control the perturbative expansion. Since the direct loop vertex corrections are generally missing in this effective approach, we have properly renormalised the effective theory to take them into account. Finally, we perform a comparison of the results in this effective MSSM with those obtained in a much simpler way in the so-called hMSSM approach in which the mass value for the lightest Higgs boson Mh = 125 GeV is used as an input. We show that the hMSSM provides a reasonably good approximation of the corrected self-couplings and H → hh decay rate and, hence, it can be used also in these cases.

  5. Terminal Area Forecasts, FY 1993-2005

    Science.gov (United States)

    1993-07-01

    4 6 0 H -4 ~ M 0~) mo~io oo o o moo- ~ ~ 7~I~~ HHHHH HHHH H H HHHHHH H H C~6HHHHHHH- HHHH H H 0 I Iv En 6O 01~0 0 0HH H HH H H H0 HHHNHHHH 0H0H H H Ci...OD o IWWWn W 0no-D A % MMH NM ww H mo 1-4IHr- i14 4H - ’ H~~ H. HOHOHHH 444 HHH N H r, In~o- v v𔃺wr, - - C4~~4CC( C44Ce (4 C4C M4 C NMVMV NNNm HHHHHH ...HHHH H ei I ~ u~o- O~0H a)I 4 HHHHHH HHHH r-4 Nl H xmoHmm virewee o In HHnw Hwm0H HHH H HnW 0 H 0C4lHO 1HH H HM M M MMMMO 0 0 0 0 4HHHH-OHHHHHN N

  6. Cooperation between catalytic and DNA binding domains enhances thermostability and supports DNA synthesis at higher temperatures by thermostable DNA polymerases.

    Science.gov (United States)

    Pavlov, Andrey R; Pavlova, Nadejda V; Kozyavkin, Sergei A; Slesarev, Alexei I

    2012-03-13

    We have previously introduced a general kinetic approach for comparative study of processivity, thermostability, and resistance to inhibitors of DNA polymerases [Pavlov, A. R., et al. (2002) Proc. Natl. Acad. Sci. U.S.A.99, 13510-13515]. The proposed method was successfully applied to characterize hybrid DNA polymerases created by fusing catalytic DNA polymerase domains with various sequence-nonspecific DNA binding domains. Here we use the developed kinetic analysis to assess basic parameters of DNA elongation by DNA polymerases and to further study the interdomain interactions in both previously constructed and new chimeric DNA polymerases. We show that connecting helix-hairpin-helix (HhH) domains to catalytic polymerase domains can increase thermostability, not only of DNA polymerases from extremely thermophilic species but also of the enzyme from a faculatative thermophilic bacterium Bacillus stearothermophilus. We also demonstrate that addition of Topo V HhH domains extends efficient DNA synthesis by chimerical polymerases up to 105 °C by maintaining processivity of DNA synthesis at high temperatures. We found that reversible high-temperature structural transitions in DNA polymerases decrease the rates of binding of these enzymes to the templates. Furthermore, activation energies and pre-exponential factors of the Arrhenius equation suggest that the mechanism of electrostatic enhancement of diffusion-controlled association plays a minor role in binding of templates to DNA polymerases.

  7. Cooperation between Catalytic and DNA-binding Domains Enhances Thermostability and Supports DNA Synthesis at Higher Temperatures by Thermostable DNA Polymerases

    Science.gov (United States)

    Pavlov, Andrey R.; Pavlova, Nadejda V.; Kozyavkin, Sergei A.; Slesarev, Alexei I.

    2012-01-01

    We have previously introduced a general kinetic approach for comparative study of processivity, thermostability, and resistance to inhibitors of DNA polymerases (Pavlov et. al., (2002) Proc. Natl. Acad. Sci. USA 99, 13510–13515). The proposed method was successfully applied to characterize hybrid DNA polymerases created by fusing catalytic DNA polymerase domains with various non-specific DNA binding domains. Here we use the developed kinetic analysis to assess basic parameters of DNA elongation by DNA polymerases and to further study the interdomain interactions in both previously constructed and new chimeric DNA polymerases. We show that connecting Helix-hairpin-Helix (HhH) domains to catalytic polymerase domains can increase thermostability, not only of DNA polymerases from extremely thermophilic species, but also of the enzyme from a faculatative thermophilic bacterium Bacillus stearothermophilus. We also demonstrate that addition of TopoV HhH domains extends efficient DNA synthesis by chimerical polymerases up to 105°C by maintaining processivity of DNA synthesis at high temperatures. We also found that reversible high-temperature structural transitions in DNA polymerases decrease the rates of binding of these enzymes to the templates. Furthermore, activation energies and pre-exponential factors of the Arrhenius equation suggest that the mechanism of electrostatic enhancement of diffusion-controlled association plays a minor role in binding templates to DNA polymerases. PMID:22320201

  8. Changing man-land interrelations in China's farming area under urbanization and its implications for food security.

    Science.gov (United States)

    Long, Hualou; Ge, Dazhuan; Zhang, Yingnan; Tu, Shuangshuang; Qu, Yi; Ma, Li

    2018-03-01

    The Huang-Huai-Hai Plain (HHH) is typical of China's farming area, and was predicted as one of the fastest growing areas of urbanization in the world. Since the turn of the new millennium, construction land and farmland transitions in this region driven by rapid urbanization have resulted in dramatic loss of farmland, which triggered a serious threat to regional even national food security. In this paper, the coupling relationships between per capita construction land transition (PCCT) and per capita farmland transition (PCFT) in the HHH and their implications for regional food security are analyzed. During 2000-2015, the farmland decreased by 8.59%, 72.25% of which were occupied by construction land. There are two major coupling types between PCCT and PCFT, one is the double increasing of per capita construction land area (PCCA) and per capita farmland area (PCFA); another is the increasing of PCCA and the decreasing of PCFA. The fluctuant increasing of PCCT and decreasing of PCFT coexisted and presented symmetrical coupling characteristics in space. Physical, location, transportation and socio-economic factors play significantly different roles in driving PCCT and PCFT. The implications for ensuring food security involve promoting the reclamation and redevelopment of inefficient and unused urban-rural construction land, reducing inefficient occupation of farmland resources, developing appropriate scale management of agriculture, and establishing a better social security system to smoothly settle down the floating rural population in the city. Copyright © 2017 Elsevier Ltd. All rights reserved.

  9. DDT, DDD, AND DDE DECHLORINATION BY ZERO-VALENT IRON

    Science.gov (United States)

    Traditionally, destruction of DDT [1,1,1-trichIoro-2,2-bis(p-chlorophenyl)ethane] for environmental remediation required high-energy processes such as incineration. Here, the capability of powdered zero-valent iron to dechlorinate DDT and related compounds at room tempera...

  10. Synchrotron measurement of the 3D shape of X-ray reflections from the {gamma}/{gamma}{sup '}-microstructure of nickel-base superalloys

    Energy Technology Data Exchange (ETDEWEB)

    Epishin, Alexander; Link, Thomas; Ulbricht, Alexander; Bansal, Mamta [Technical Univ. of Berlin (Germany). Inst. of Material Science and Technology; Zizak, Ivo [Helmholtz-Zentrum Berlin for Materials and Energy BESSY II, Berlin (Germany)

    2011-12-15

    The 3D shape of X-ray reflections from the {gamma}/{gamma}{sup '}-microstructure of a nickel-base superalloy was investigated using synchrotron X-ray radiation and a position sensitive area detector. The measurements were performed on the 4{sup th} generation single-crystal nickel-base superalloy TMS138. The results show that X-ray reflections from non-cubic crystallographic planes have a complex 3D shape which changes during rafting. The 3D intensity distributions contain information about the spacing of the planes and their orientation as well. Whereas h00 reflections show the usual splitting into a {gamma}{sup '} and one {gamma}-subreflection, the hh0 and hhh reflections show two and three {gamma}-peaks respectively, resulting from the different types of {l_brace}100{r_brace} matrix channels. Therefore, these 3D diffraction measurements supply additional information about the spatial distribution of microstrains. (orig.)

  11. Calculations of multi-particle processes at the one-loop level: precise predictions for the LHC

    International Nuclear Information System (INIS)

    Karg, Stefan

    2007-01-01

    We present a calculation of the loop-induced processes gg→HH and gg→HHH, and investigate the observability of multi-Higgs boson production at the LHC in the Standard Model and beyond. While the SM cross sections are too small to allow observation at the LHC, we demonstrate that physics beyond the SM can lead to amplified, observable cross sections. Furthermore, the applicability of the heavy top quark approximation in two- and three-Higgs boson production is investigated. The calculation of the process PP→VV+jet at NLO is an important background process to Higgs production in association with a jet at the LHC. We compute the virtual corrections to this process which form the ''bottleneck'' for obtaining a complete NLO prediction. The resulting analytic expressions are generated with highly automated computer routines and translated into a flexible Fortran code, which can be employed in the computation of differential cross sections of phenomenological interest. (orig.)

  12. CARE07 Coordinated Accelerator Research in Europe

    CERN Multimedia

    2007-01-01

    Annual Meeting, at CERN, 29-31 October 2007 The CARE project started on 1st January 2004 and will end on 31st December 2008. At the end of each year, the progress and status of its activities are reported in a general meeting. This year, the meeting takes place at CERN. The CARE objective is to generate structured and integrated European cooperation in the field of accelerator research and related R&D. The programme includes the most advanced scientific and technological developments, relevant to accelerator research for particle physics. It is articulated around three Networking Activities and four Joint Activities. The Networking Activities ELAN, BENE and HHH aim to better coordinate R&D efforts at the European level and to strengthen Europe’s ability to produce intense and high-energy particle beams (electrons and positrons, muons and neutrinos, protons and ions, respectively). The Joint Activities, SRF, PHIN, HIPPI and NED, aim at technical developments on s...

  13. CARE07 Coordinated Accelerator Research in Europe

    CERN Multimedia

    2007-01-01

    Annual Meeting, at CERN, 29-31 October 2007 The CARE project started on 1st January 2004 and will end on 31st December 2008. At the end of each year, the progress and status of its activities are reported in a general meeting. This year, the meeting is taking place at CERN. The CARE objective is to generate structured and integrated European cooperation in the field of accelerator research and related R&D. The programme includes the most advanced scientific and technological developments, relevant to accelerator research for particle physics. It is articulated around three Networking Activities and four Joint Activities. The Networking Activities ELAN, BENE and HHH aim to better coordinate R&D efforts at the European level and to strengthen Europe’s ability to produce intense and high-energy particle beams (electrons and positrons, muons and neutrinos, protons and ions, respectively). The Joint Activities, SRF, PHIN, HIPPI and NED, aim at technical developments ...

  14. Probing anomalous couplings using di-Higgs production in electron–proton collisions

    Directory of Open Access Journals (Sweden)

    Mukesh Kumar

    2017-01-01

    Full Text Available A proposed high energy Future Circular Hadron-Electron Collider would provide sufficient energy in a clean environment to probe di-Higgs production. Using this channel we show that the azimuthal angle correlation between the missing transverse energy and the forward jet is a very good probe for the non-standard hhh and hhWW couplings. We give the exclusion limits on these couplings as a function of integrated luminosity at a 95% C.L. using the fiducial cross sections. With appropriate error fitting methodology we find that the Higgs boson self coupling could be measured to be ghhh(1=1.00−0.17(0.12+0.24(0.14 of its expected Standard Model value at s=3.5(5.0 TeV for an ultimate 10 ab−1 of integrated luminosity.

  15. The Higgs vacuum uplifted. Revisiting the electroweak phase transition with a second Higgs doublet

    Energy Technology Data Exchange (ETDEWEB)

    Dorsch, G.C. [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany); Huber, S.J. [Sussex Univ., Brighton (United Kingdom). Dept. of Physics and Astronomy; Mimasu, K. [Sussex Univ., Brighton (United Kingdom). Dept. of Physics and Astronomy; Louvain Univ. Catholique, Louvain-la-Neuve (Belgium). Center for Cosmology, Particle Physics and Phenomenology; No, J.M. [King' s College, London (United Kingdom). Dept. of Physics; Sussex Univ., Brighton (United Kingdom). Dept. of Physics and Astronomy

    2017-05-25

    The existence of a second Higgs doublet in Nature could lead to a cosmological first order electroweak phase transition and explain the origin of the matter-antimatter asymmetry in the Universe. We explore the parameter space of such a two-Higgs-doublet-model and show that a first order electroweak phase transition strongly correlates with a significant uplifting of the Higgs vacuum w.r.t. its Standard Model value. We then obtain the spectrum and properties of the new scalars H{sub 0}, A{sub 0} and H{sup ±} that signal such a phase transition, showing that the decay A{sub 0}→H{sub 0}Z at the LHC and a sizable deviation in the Higgs self-coupling λ{sub hhh} from its SM value are sensitive indicators of a strongly first order electroweak phase transition in the 2HDM.

  16. Survey of Foods to Improve Logistic Support and Extend Mission Endurance of Submarines

    Science.gov (United States)

    1981-12-01

    OrfiioKiM-<njrvj(Mio»o , jj o o 3 I * » X 30333-*HHHH-< HHHHHH ^l|rl|K1J.l|^ IJ V _! OvJ iM -• <\\ t\\ >- < <’JH J/IOJSH’J J £ <v <o (M...3x»N""»"""io«"io»x»<ij»po»"""ioiO""ir>"""H""<\\i-"-"»"Oj""""fij«"Cij-"»"<\\jcij-"<\\jio*"io»"«"»"Ki»0""p"> loooooooHHH-Hrt- HHHHHH

  17. General/Flag Officer Worldwide Roster, December 1986

    Science.gov (United States)

    1986-12-01

    H O t- ON O o O H 00 H J" 00 00 00 cO H ON O ^r CO t>*- in ITN o o o O vH NO VD vo ^t CO CO CO CO 8 S § § o HHHHHH ^HHHH OOOOOOOOOOO...8 e § u. OS r.% ̂ l^J^,^^ a üJ H (0 O DC UJ a i D -I a O $ a UJ ü o -J < cc UJ z UJ o 8 HHHHHH <MHHr-»r-(HHH...4h-HN r4 r4 r4 T4 CM H O O OOOO o o CM <n t- H o m H H H O O H H O lT\\\\f\\)0 CM CO CO CO CO \\0 CM H H CO 00 CO GO HHHHHH -SON-H OOOOOOCMHHO

  18. Workshop on Accelerator Magnet Superconductors, Design and Optimization

    CERN Document Server

    WAMSDO Workshop

    2009-01-01

    This report contains the proceedings of the CARE-HHH-AMT Workshop on Accelerator Magnet Superconductors, Design and Optimization (WAMSDO) held at CERN from 19 to 23 May 2008. The needs in terms of superconducting magnets for the accelerator projects were discussed, mainly for the LHC interaction regions and injector upgrades, and for the GSI FAIR complex. The first part of the workshop focused on the development of superconductor and cables, i.e., low-loss Nb-Ti cables, Nb$_{3}$Sn and high-temperature superconductors. An industry session summarized the actual plans and status of the activities in the main European industries. Then, a worldwide status of the high field magnets programme was presented. A special session was devoted to fast cycled magnets, including FAIR facilities and LHC injector upgrades. A final session focused on the optimization methods and numerical tools for magnet design.

  19. Effect of Thickener and Gasoline Quality on the Properties of Napalm Fuels

    Science.gov (United States)

    1945-01-01

    6 ’ So H S3 lOCDCCtDOnroO) )««0 0)<E«DO «Hf-IG)IQ|Q0l*-<OO«[> P"iS OOONQHC O «3 IO HHO ’ »O «TOO «XOHCOOilNHIOIOOOIOC- 1’ 01 CD...OOO0JC0O’OCDtf> Cpl0rHl0*OtQlGDtH£CUO>Q O^CUi-KO .O »tOO» »on feCDOl HH(«niQ9 »HHH(0 HHO « I l«KJB* ©HN«(Dlf^V®Ct

  20. GIS-measured walkability, transit, and recreation environments in relation to older Adults' physical activity: A latent profile analysis.

    Science.gov (United States)

    Todd, Michael; Adams, Marc A; Kurka, Jonathan; Conway, Terry L; Cain, Kelli L; Buman, Matthew P; Frank, Lawrence D; Sallis, James F; King, Abby C

    2016-12-01

    An infrequently studied question is how diverse combinations of built environment (BE) features relate to physical activity (PA) for older adults. We derived patterns of geographic information systems- (GIS) measured BE features and explored how they accounted for differences in objective and self-reported PA, sedentary time, and BMI in a sample of older adults. Senior Neighborhood Quality of Life Study participants (N=714, aged 66-97years, 52.1% women, 29.7% racial/ethnic minority) were sampled in 2005-2008 from the Seattle-King County, WA and Baltimore, MD-Washington, DC regions. Participants' home addresses were geocoded, and net residential density, land use mix, retail floor area ratio, intersection density, public transit density, and public park and private recreation facility density measures for 1-km network buffers were derived. Latent profile analyses (LPAs) were estimated from these GIS-based measures. In multilevel regression models, profiles were compared on accelerometer-measured moderate-to-vigorous PA (MVPA) and sedentary time and self-reported PA, adjusting for covariates and clustering. Analyses were conducted in 2014-2015. LPAs yielded three profiles: low walkability/transit/recreation (L-L-L); mean walkability/transit/recreation (M-M-M); and high walkability/transit/recreation (H-H-H). Three PA outcomes were more favorable in the HHH than the LLL profile group (difference of 7.2min/day for MVPA, 97.8min/week for walking for errands, and 79.2min/week for walking for exercise; all pswalkability index, suggesting that diverse BE features are important for healthy aging. Copyright © 2016 Elsevier Inc. All rights reserved.

  1. Patterns of Walkability, Transit, and Recreation Environment for Physical Activity.

    Science.gov (United States)

    Adams, Marc A; Todd, Michael; Kurka, Jonathan; Conway, Terry L; Cain, Kelli L; Frank, Lawrence D; Sallis, James F

    2015-12-01

    Diverse combinations of built environment (BE) features for physical activity (PA) are understudied. This study explored whether patterns of GIS-derived BE features explained objective and self-reported PA, sedentary behavior, and BMI. Neighborhood Quality of Life Study participants (N=2,199, aged 20-65 years, 48.2% female, 26% ethnic minority) were sampled in 2001-2005 from Seattle / King County WA and Baltimore MD / Washington DC regions. Their addresses were geocoded to compute net residential density, land use mix, retail floor area ratio, intersection density, public transit, and public park and private recreation facility densities using a 1-km network buffer. Latent profile analyses (LPAs) were estimated from these variables. Multilevel regression models compared profiles on accelerometer-measured moderate to vigorous PA (MVPA) and self-reported PA, adjusting for covariates and clustering. Analyses were conducted in 2013-2014. Seattle region LPAs yielded four profiles, including low walkability/transit/recreation (L-L-L); mean walkability/transit/recreation (M-M-M); moderately high walkability/transit/recreation (MH-MH-MH); and high walkability/transit/recreation (H-HH). All measures were higher in the HHH than the LLL profile (difference of 17.1 minutes/day for MVPA, 146.5 minutes/week for walking for transportation, 58.2 minutes/week for leisure-time PA, and 2.2 BMI points; all pwalkability index. Copyright © 2015 American Journal of Preventive Medicine. Published by Elsevier Inc. All rights reserved.

  2. One-loop radiative correction to the triple Higgs coupling in the Higgs singlet model

    Directory of Open Access Journals (Sweden)

    Shi-Ping He

    2017-01-01

    Full Text Available Though the 125 GeV Higgs boson is consistent with the standard model (SM prediction until now, the triple Higgs coupling can deviate from the SM value in the physics beyond the SM (BSM. In this paper, the radiative correction to the triple Higgs coupling is calculated in the minimal extension of the SM by adding a real gauge singlet scalar. In this model there are two scalars h and H and both of them are mixing states of the doublet and singlet. Provided that the mixing angle is set to be zero, namely the SM limit, h is the pure left-over of the doublet and its behavior is the same as that of the SM at the tree level. However the loop corrections can alter h-related couplings. In this SM limit case, the effect of the singlet H may show up in the h-related couplings, especially the triple h coupling. Our numerical results show that the deviation is sizable. For λΦS=1 (see text for the parameter definition, the deviation δhhh(1 can be 40%. For λΦS=1.5, the δhhh(1 can reach 140%. The sizable radiative correction is mainly caused by three reasons: the magnitude of the coupling λΦS, light mass of the additional scalar and the threshold enhancement. The radiative corrections for the hVV, hff couplings are from the counter-terms, which are the universal correction in this model and always at O(1%. The hZZ coupling, which can be precisely measured, may be a complementarity to the triple h coupling to search for the BSM. In the optimal case, the triple h coupling is very sensitive to the BSM physics, and this model can be tested at future high luminosity hadron colliders and electron–positron colliders.

  3. What Factors Affect Voluntary Uptake of Community-Based Health Insurance Schemes in Low- and Middle-Income Countries? A Systematic Review and Meta-Analysis.

    Directory of Open Access Journals (Sweden)

    David Mark Dror

    Full Text Available This research article reports on factors influencing initial voluntary uptake of community-based health insurance (CBHI schemes in low- and middle-income countries (LMIC, and renewal decisions.Following PRISMA protocol, we conducted a comprehensive search of academic and gray literature, including academic databases in social science, economics and medical sciences (e.g., Econlit, Global health, Medline, Proquest and other electronic resources (e.g., Eldis and Google scholar. Search strategies were developed using the thesaurus or index terms (e.g., MeSH specific to the databases, combined with free text terms related to CBHI or health insurance. Searches were conducted from May 2013 to November 2013 in English, French, German, and Spanish. From the initial search yield of 15,770 hits, 54 relevant studies were retained for analysis of factors influencing enrolment and renewal decisions. The quantitative synthesis (informed by meta-analysis and the qualitative analysis (informed by thematic synthesis were compared to gain insight for an overall synthesis of findings/statements.Meta-analysis suggests that enrolments in CBHI were positively associated with household income, education and age of the household head (HHH, household size, female-headed household, married HHH and chronic illness episodes in the household. The thematic synthesis suggests the following factors as enablers for enrolment: (a knowledge and understanding of insurance and CBHI, (b quality of healthcare, (c trust in scheme management. Factors found to be barriers to enrolment include: (a inappropriate benefits package, (b cultural beliefs, (c affordability, (d distance to healthcare facility, (e lack of adequate legal and policy frameworks to support CBHI, and (f stringent rules of some CBHI schemes. HHH education, household size and trust in the scheme management were positively associated with member renewal decisions. Other motivators were: (a knowledge and understanding of

  4. Neutron scattering investigations of frustated magnets

    Science.gov (United States)

    Fennell, Tom

    This thesis describes the experimental investigation of frustrated magnetic systems based on the pyrochlore lattice of corner-sharing tetrahedra. Ho2Ti207 and Dy2Ti207 are examples of spin ices, in which the manifold of disordered magnetic groundstates maps onto that of the proton positions in ice. Using single crystal neutron scattering to measure Bragg and diffuse scattering, the effect of applying magnetic fields along different directions in the crystal was investigated. Different schemes of degeneracy removal were observed for different directions. Long and short range order, and the coexistence of both could be observed by this technique.The field and temperature dependence of magnetic ordering was studied in Ho2Ti207 and Dy2Ti207. Ho2Ti2()7 has been more extensively investigated. The field was applied on [00l], [hh0], [hhh] and [hh2h]. Dy2Ti207 was studied with the field applied on [00l] and [hho] but more detailed information about the evolution of the scattering pattern across a large area of reciprocal space was obtained.With the field applied on [00l] both materials showed complete degeneracy removal. A long range ordered structure was formed. Any magnetic diffuse scattering vanished and was entirely replaced by strong magnetic Bragg scattering. At T =0.05 K both materials show unusual magnetization curves, with a prominent step and hysteresis. This was attributed to the extremely slow dynamics of spin ice materials at this temperature.Both materials were studied in greatest detail with the field applied on [hh0]. The coexistence of long and short range order was observed when the field was raised at T = 0.05 K. The application of a field in this direction separated the spin system into two populations. One could be ordered by the field, and one remained disordered. However, via spin-spin interactions, the field restricted the degeneracy of the disordered spin population. The neutron scattering pattern of Dy2Ti207 shows that the spin system was separated

  5. What Factors Affect Voluntary Uptake of Community-Based Health Insurance Schemes in Low- and Middle-Income Countries? A Systematic Review and Meta-Analysis

    Science.gov (United States)

    Hossain, S. A. Shahed; Pérez Koehlmoos, Tracey Lynn; John, Denny

    2016-01-01

    Introduction This research article reports on factors influencing initial voluntary uptake of community-based health insurance (CBHI) schemes in low- and middle-income countries (LMIC), and renewal decisions. Methods Following PRISMA protocol, we conducted a comprehensive search of academic and gray literature, including academic databases in social science, economics and medical sciences (e.g., Econlit, Global health, Medline, Proquest) and other electronic resources (e.g., Eldis and Google scholar). Search strategies were developed using the thesaurus or index terms (e.g., MeSH) specific to the databases, combined with free text terms related to CBHI or health insurance. Searches were conducted from May 2013 to November 2013 in English, French, German, and Spanish. From the initial search yield of 15,770 hits, 54 relevant studies were retained for analysis of factors influencing enrolment and renewal decisions. The quantitative synthesis (informed by meta-analysis) and the qualitative analysis (informed by thematic synthesis) were compared to gain insight for an overall synthesis of findings/statements. Results Meta-analysis suggests that enrolments in CBHI were positively associated with household income, education and age of the household head (HHH), household size, female-headed household, married HHH and chronic illness episodes in the household. The thematic synthesis suggests the following factors as enablers for enrolment: (a) knowledge and understanding of insurance and CBHI, (b) quality of healthcare, (c) trust in scheme management. Factors found to be barriers to enrolment include: (a) inappropriate benefits package, (b) cultural beliefs, (c) affordability, (d) distance to healthcare facility, (e) lack of adequate legal and policy frameworks to support CBHI, and (f) stringent rules of some CBHI schemes. HHH education, household size and trust in the scheme management were positively associated with member renewal decisions. Other motivators were: (a

  6. The biomechanical assessment of the cervical inter-vertebral kinematics, between DDD patients ICR based study

    Science.gov (United States)

    Saveh, Amir Hossein; Zali, Ali Reza; Seddighi, Amir Saeed; Zarghi, Afsaneh; Chizari, Mahmoud; Hanafiah, Yussof

    2012-01-01

    Abstract: It is very important to pay more attention to spine from the biomechanical perspective. It would allow the analysis of initial conditions of the vertebral disc degeneration syndrome and adopting of normal spine kinematics to compare and match it with a degenerated disc and providing a biomechanical index as an indicator for the conduct of any surgical intervention including arthroplasty to maximize restoring spinal biomechanical motion. It is clear that the head movement is possible with the help of muscles. However, the shape and type of motion depends on the structure and shape of the cervical spine and the interaction between them. Cervical spine kinematics depends on the anatomy of the bones and joints. Bazhdok et al (2000) investigated the cervical kinematics and mechanical behavior of the spine and its anatomical connections. They have examined the atlanto- occipital joint motion during flexion-extension and rotation as well as the mechanism of paradoxical motion of atlanto- axial joint by radiography. Bifalkou et al (2011) studied the inter-vertebral motion based on arc kinematic commentary of video fluoroscopy. They showed that the diagnosis of biomechanical instability can be done based on the kinematic examination of the spine obtained in sagittal images. They also declared that the fluoroscopy can be used as a tool for study. Using an automated algorithm, image adaption was carried out and the motion direction of vertebrae was tracked. In the present study, some patients were selected among patients with cervical disc degeneration. Following imaging by fluoroscopy, the instantaneous center of the spinal action was calculated. It was used as a biomechanical criterion and the treatment group was compared with the healthy group. The loci of the instantaneous centers of the two groups were compared and its difference with the value of healthy group was calculated. A biomechanical criterion was introduced as a basis for comparison of normal and degenerated discs. Keywords: Cervical, Degeneration, Cases selection

  7. Levels of PCBs, DDT, DDE and DDD in Italian human blood samples

    Energy Technology Data Exchange (ETDEWEB)

    Rocca, C. La; Abate, V.; Alivernini, S.; Iacovella, N.; Mantovani, A.; Turrio-Baldassarri, L. [Ist. Superiore di Sanita, Roma (Italy); Silvestroni, L.; Spera, G. [Dept. of Medical Pathophysiology, Univ. (Italy)

    2004-09-15

    The environmental contamination from polychlorinated biphenyls (PCBs) is effecting the exposure of the general population in a direct way through air inhalation, ingestion of particulate matter and dermal absorption and, most of all, in an indirect way through diet. Diet represents, in fact, the main way of human exposure to PCBs. PCBs have potential teratogenic, carcinogenic, hormonal and immunological effects. An association between endometriosis and high levels of PCB in plasma has also been reported3. Moreover, some congeners (PCB 105, PCB 118, PCB 153) have effects on thyroid hormones in animal models, although the PCB dose used in these experiments was an order of magnitude higher than the estimated human exposure. Humans are, however, exposed to a complex mixtures of PCB congeners. In this study identification and quantification of 60 PCB congeners and 3 chlorinated pesticides in human whole blood samples are presented. The subjects examined in this pilot study were a small group of patients with possible endocrine-related problems and unknown specific exposure. The aim of this study was to increase the present understanding about the distribution of the PCBs in human whole blood. The levels of DDT and metabolites were measured as well, since these compounds are consistently reported to contribute to the whole body burden of persistent chlorinated compounds, together with PCBs.

  8. Mammary sensitivity to protein restriction and re-alimentation.

    Science.gov (United States)

    Goodwill, M G; Jessop, N S; Oldham, J D

    1996-09-01

    The present study tested the influence of protein undernutrition and re-alimentation on mammary gland size and secretory cell activity in lactating rats. During gestation, female Sprague-Dawley rats were offered a high-protein diet (215 g crude protein (N x 6.25; CP)/kg DM; H); litters were standardized to twelve pups at parturition. During lactation, two diets were offered ad libitum, diet H and a low-protein diet (90 g CP/kg DM; L). Lactational dietary treatments were the supply ad libitum of either diet H (HHH) or diet L (LLL) for the first 12 d of lactation, or diet L transferring to diet H on either day 6 (LHH) or 9 (LLH) of lactation. On days 1, 6, 9 and 12 of lactation, rats from each group (n > or = 6) were used to estimate mammary dry mass, fat, protein, DNA and RNA; the activities of lactose synthetase (EC 2.4.1.22) enzyme and Na+,K(+)-ATPase (EC 3.6.1.37) were also measured. Rats offered a diet considered protein sufficient (H) from day 1 of lactation showed a decrease in mammary dry mass and fat but an increase in DNA, RNA and protein on day 6, after which there was no further change, except for mammary protein which continued to increase. However, rats offered diet L showed a steady loss in mammary mass and fat throughout the 12 d lactation period and no change in mammary DNA, RNA or protein. Rats previously protein restricted for either the first 6 or 9 d of lactation had their mammary dry mass and mammary fat loss halted and showed a rapid increase in mammary DNA, RNA and protein on re-alimentation. Lactose production in group HHH, as measured by lactose synthetase activity, was similar on days 1 and 6 of lactation, after which a significant increase was seen. Protein-restricted rats showed no change in lactose synthetase activity during the 12 d experimental period. Changing from diet L to diet H led to a significant increase in lactose synthetase activity to levels comparable with those offered diet H from day 1. These results show that rats

  9. Special structures and properties of hydrogen nanowire confined in a single walled carbon nanotube at extreme high pressure

    Directory of Open Access Journals (Sweden)

    Yueyuan Xia

    2012-06-01

    Full Text Available Extensive ab initio molecular dynamics simulations indicate that hydrogen can be confined in single walled carbon nanotubes to form high density and high pressure H2 molecular lattice, which has peculiar shell and axial structures depending on the density or pressure. The band gap of the confined H2 lattice is sensitive to the pressure. Heating the system at 2000K, the H2 lattice is firstly melted to form H2 molecular liquid, and then some of the H2 molecules dissociate accompanied by drastic molecular and atomic reactions, which have essential effect on the electronic structure of the hydrogen system. The liquid hydrogen system at 2000K is found to be a particular mixed liquid, which consists of H2 molecules, H atoms, and H-H-H trimers. The dissociated H atoms and the trimers in the liquid contribute resonance electron states at the Fermi energy to change the material properties substantially. Rapidly cooling the system from 2000K to 0.01 K, the mixed liquid is frozen to form a mixed solid melt with a clear trend of band gap closure. It indicates that this solid melt may become a superconducting nanowire when it is further compressed.

  10. Scenarios for the LHC Upgrade

    CERN Document Server

    Scandale, Walter

    2008-01-01

    The projected lifetime of the LHC low-beta quadrupoles, the evolution of the statistical error halving time, and the physics potential all call for an LHC luminosity upgrade by the middle of the coming decade. In the framework of the CARE-HHH network three principal scenarios have been developed for increasing the LHC peak luminosity by more than a factor of 10, to values above 1035 cm−2s−1. All scenarios imply a rebuilding of the high-luminosity interaction regions (IRs) in combination with a consistent change of beam parameters. However, their respective features, bunch structures, IR layouts, merits and challenges, and luminosity variation with β∗ differ substantially. In all scenarios luminosity leveling during a store would be advantageous for the physics experiments. An injector upgrade must complement the upgrade measures in the LHC proper in order to provide the beam intensity and brightness needed as well as to reduce the LHC turnaround time for higher integrated luminosity.

  11. High-pressure structure of Pb-based relaxor ferroelectrics

    Energy Technology Data Exchange (ETDEWEB)

    Maier, Bernd J.; Mihailova, Boriana; Paulmann, Carsten; Welsch, Anna-Maria; Bismayer, Ulrich [Mineralogisch-Petrographisches Institut, Universitaet Hamburg (Germany); Angel, Ross J. [Crystallography Laboratory, Virgina Tech, Blacksburg (United States); Marshall, William G. [ISIS Neutron Facility, STFC Rutherford Appleton Laboratory, Chilton, Didcot, Oxon (United Kingdom); Engel, Jens M. [Institut fuer Werkstoffwissenschaft, Technische Universitaet Dresden (Germany); Gospodinov, Marin [Institute of Solid State Physics, Bulgarian Academy of Sciences, Sofia (Bulgaria); Petrova, Dimitrina [Institute of Solid State Physics, Bulgarian Academy of Sciences, Sofia (Bulgaria); South-West University Neofit Rilski, Blagoevgrad (Bulgaria)

    2010-07-01

    The pressure-induced phase transitions that occur in the perovskite-type relaxor ferroelectric PbSc{sub 0.5}Ta{sub 0.5}O{sub 3} (PST) and Pb{sub 0.78}Ba{sub 0.22}Sc{sub 0.5}Ta{sub 0.5}O{sub 3} (PST-Ba) were studied with combined neutron powder diffraction and single-crystal X-ray diffraction. An increase in the intensities of h,k,l=all odd reflections is observed while the intensity of h,h,h peaks, h=2n+1, does not change with pressure, indicating a glide-plane pseudo-symmetry of the structural distortion along the left angle 111 right angle cubic directions. Rietveld refinement to the neutron powder data shows that the high-pressure phase has either R anti 3c or R anti 3 symmetry, depending on whether the presence of 1:1 octahedral cation ordering is neglected or taken into account, and comprises anti-phase octahedral tilts of type a{sup -}a{sup -}a{sup -} that continuously evolve with pressure.

  12. CARE05 coordinated accelerator research in Europe

    CERN Multimedia

    2005-01-01

    Annual Meeting at CERN, 23-25 November 2005 CARE started on 1st January 2004 and will last for five years. At the end of each year it holds a general meeting to report on the progress and status of its activities. This year, the CARE annual meeting is taking place at CERN The objective of the CARE project is to generate structured and integrated European cooperation in the field of accelerator research and related R&D. The program includes the most advanced scientific and technological developments, relevant to accelerator research for Particle Physics. It is articulated around three Networking Activities and four Joint Activities. The Networking Activities ELAN, BENE and HHH aim to better coordinate R&D efforts at the European level and to strengthen Europe's ability to evaluate and develop methods of producing intense and high energy beams of electrons, protons, muons and neutrinos. These activities are embedded in world-wide efforts towards future e+e- linear colliders, superior neutrino beam fa...

  13. Coronary Arteries Segmentation Based on the 3D Discrete Wavelet Transform and 3D Neutrosophic Transform

    Directory of Open Access Journals (Sweden)

    Shuo-Tsung Chen

    2015-01-01

    Full Text Available Purpose. Most applications in the field of medical image processing require precise estimation. To improve the accuracy of segmentation, this study aimed to propose a novel segmentation method for coronary arteries to allow for the automatic and accurate detection of coronary pathologies. Methods. The proposed segmentation method included 2 parts. First, 3D region growing was applied to give the initial segmentation of coronary arteries. Next, the location of vessel information, HHH subband coefficients of the 3D DWT, was detected by the proposed vessel-texture discrimination algorithm. Based on the initial segmentation, 3D DWT integrated with the 3D neutrosophic transformation could accurately detect the coronary arteries. Results. Each subbranch of the segmented coronary arteries was segmented correctly by the proposed method. The obtained results are compared with those ground truth values obtained from the commercial software from GE Healthcare and the level-set method proposed by Yang et al., 2007. Results indicate that the proposed method is better in terms of efficiency analyzed. Conclusion. Based on the initial segmentation of coronary arteries obtained from 3D region growing, one-level 3D DWT and 3D neutrosophic transformation can be applied to detect coronary pathologies accurately.

  14. Coronary arteries segmentation based on the 3D discrete wavelet transform and 3D neutrosophic transform.

    Science.gov (United States)

    Chen, Shuo-Tsung; Wang, Tzung-Dau; Lee, Wen-Jeng; Huang, Tsai-Wei; Hung, Pei-Kai; Wei, Cheng-Yu; Chen, Chung-Ming; Kung, Woon-Man

    2015-01-01

    Most applications in the field of medical image processing require precise estimation. To improve the accuracy of segmentation, this study aimed to propose a novel segmentation method for coronary arteries to allow for the automatic and accurate detection of coronary pathologies. The proposed segmentation method included 2 parts. First, 3D region growing was applied to give the initial segmentation of coronary arteries. Next, the location of vessel information, HHH subband coefficients of the 3D DWT, was detected by the proposed vessel-texture discrimination algorithm. Based on the initial segmentation, 3D DWT integrated with the 3D neutrosophic transformation could accurately detect the coronary arteries. Each subbranch of the segmented coronary arteries was segmented correctly by the proposed method. The obtained results are compared with those ground truth values obtained from the commercial software from GE Healthcare and the level-set method proposed by Yang et al., 2007. Results indicate that the proposed method is better in terms of efficiency analyzed. Based on the initial segmentation of coronary arteries obtained from 3D region growing, one-level 3D DWT and 3D neutrosophic transformation can be applied to detect coronary pathologies accurately.

  15. A study of the picostructure of sputtered ZrN films

    International Nuclear Information System (INIS)

    Perry, A.J.; Schaffer, J.P.; Brunner, J.; Sproul, W.D.

    1991-01-01

    Stoichiometric zirconium nitride films deposited onto cemented carbide and stainless steel substrates as a function of the applied substrate bias were studied by X-ray diffraction (XRD Bragg-Brentano goniometer) and positron annihilation spectroscopy (PAS). Microhardness and color measurements were also carried out. The results at low bias levels show that the crystal lattice has no deviant behavior in the strain distribution or lattice parameters; such differences which are observed in the latter are due to the X-ray elastic constants. Shear stresses are found on the (h00) family of planes and probably on the (hhh) family at bias levels more negative than -70 V. The microhardness and residual stress are then constant. The PAS data indicate that the vacancy defect fraction is below the limit of detection at bias levels less negative than approximately -80 V; a low concentration of vacancies exists at more negative bias values. The color of the films is not affected by the bias applied during deposition, and is only slightly affected by annealing when deposited at low bias values. In view of the change in lattice parameters on annealing, it is concluded that the results do not correspond with those expected from the simple ionic model. (orig.)

  16. Radiative corrections to the triple Higgs coupling in the inert Higgs doublet model

    International Nuclear Information System (INIS)

    Arhrib, Abdesslam; Benbrik, Rachid; Falaki, Jaouad El; Jueid, Adil

    2015-01-01

    We investigate the implication of the recent discovery of a Higgs-like particle in the first phase of the LHC Run 1 on the Inert Higgs Doublet Model (IHDM). The determination of the Higgs couplings to SM particles and its intrinsic properties will get improved during the new LHC Run 2 starting this year. The new LHC Run 2 would also shade some light on the triple Higgs coupling. Such measurement is very important in order to establish the details of the electroweak symmetry breaking mechanism. Given the importance of the Higgs couplings both at the LHC and e + e − Linear Collider machines, accurate theoretical predictions are required. We study the radiative corrections to the triple Higgs coupling hhh and to hZZ, hWW couplings in the context of the IHDM. By combining several theoretical and experimental constraints on parameter space, we show that extra particles might modify the triple Higgs coupling near threshold regions. Finally, we discuss the effect of these corrections on the double Higgs production signal at the e + e − LC and show that they can be rather important.

  17. Radiative corrections to the Higgs couplings in the triplet model

    International Nuclear Information System (INIS)

    KIKUCHI, M.

    2014-01-01

    The feature of extended Higgs models can appear in the pattern of deviations from the Standard Model (SM) predictions in coupling constants of the SM-like Higgs boson (h). We can thus discriminate extended Higgs models by precisely measuring the pattern of deviations in the coupling constants of h, even when extra bosons are not found directly. In order to compare the theoretical predictions to the future precision data at the ILC, we must evaluate the theoretical predictions with radiative corrections in various extended Higgs models. In this paper, we give our comprehensive study for radiative corrections to various Higgs boson couplings of h in the minimal Higgs triplet model (HTM). First, we define renormalization conditions in the model, and we calculate the Higgs coupling; gγγ, hWW, hZZ and hhh at the one loop level. We then evaluate deviations in coupling constants of the SM-like Higgs boson from the predictions in the SM. We find that one-loop contributions to these couplings are substantial as compared to their expected measurement accuracies at the ILC. Therefore the HTM has a possibility to be distinguished from the other models by comparing the pattern of deviations in the Higgs boson couplings.

  18. Evaluation of halothane as stressor agent in poultry / Avaliação do halotano como agente estressor em frangos

    Directory of Open Access Journals (Sweden)

    Massami Shimokomaki

    2010-07-01

    Full Text Available Studies have been demonstrating in poultry, the existence of at least two causes for the formation of PSE meat: genetic through the sensibility towards halothane and the environmental factor in particular the temperature as the main factor. Thus the objective of this work was to evaluate halothane as stressor agent for broiler concomitantly to evaluating the PSE incidence by submitting these birds to thermal stress. In this experiment, 24 broilers of commercial lineage were divided in 6 animals for 4 treatments: HHH, broilers submitted to halothane test and slaughtered 1h after this test; HET broilers submitted to halothane at 35°C/1h after 48h of halothane test followed by the birds slaughtering; EET, broilers submitted to thermal stress and slaughtered immediately after this treatment, and finally the control treatment (CCC where broilers were not submitted to halothane test nor to thermal stress as control. The initial pH of Pectoralis major m, was evaluated 30 min post mortem and the pH final, color, (L*, a*, b* water holding capacity (WHC, and R value analysis were carried out after 24h of storage of fillet samples at 40C. The pH24h was higher (p ? 0.05 for CCC samples in comparison to other treatments and R value was higher for birds under HET and EET treatments in comparison to CCC (p ? 0.05 suggesting that the rigor mortis was more rapid in samples from birds submitted to thermal stress. The HHH, HET, and EET treatments presented 4 birds each with PSE meat and 2 broilers from CCC treatment originated PSE meat showing the influence not only halothane but also the thermal stress over broilers welfare. Finally, results demonstrated that halothane is a stressor agent as well as the thermal stress and both promoted dramatic biochemical changes bringing about the formation of broiler PSE meat. Resultados vêm mostrando uma direta relação entre a sensibilidade ao halotano e a ocorrência de filés PSE em aves, que pode ser originado pela

  19. Resistance and Stock Propulsion on the High Speed Sealift (HSS) Hybrid Contra-Rotating Shaft-Pod (HCRSP) Concept, Model 5653-3A

    Science.gov (United States)

    2008-09-01

    34 0N mD " ’ H 0 WMaH MW0WN N m 1-4 ~ ~ ~ Hq H4- 4 4r4 H H H H H mN( OD.D o t-)(~(aHr(arC0~)N(HAa((NLH ri) H 0~~ W-- HHHHHH "HHH(m((N(N m 1-4CC’ C ) LA...34 0000000000000000000000000000 OO OO HH HH HHHHHH iH H r,cl NC14ONmO W. M~ W W WWMWWkD-4IDM V-Wr-M 0WW W -4r- - MM C ; a) 000000000000000000000000000 w N mNwom- o oo0...82174HNO.~O.LflWN(4LAO.OW.4 + 0 - HHHHHHHHH HHHHHH H 00 ~~~~~1 ~ ~ r 0;c A bIDH~.L ~C C 0’ M,IDO r- 0(1 M - H W 0 M* 0 ~H H H H H H4 H 0 MU C AW4W 00 D WV

  20. Threefold rotational symmetry in hexagonally shaped core-shell (In,Ga)As/GaAs nanowires revealed by coherent X-ray diffraction imaging.

    Science.gov (United States)

    Davtyan, Arman; Krause, Thilo; Kriegner, Dominik; Al-Hassan, Ali; Bahrami, Danial; Mostafavi Kashani, Seyed Mohammad; Lewis, Ryan B; Küpers, Hanno; Tahraoui, Abbes; Geelhaar, Lutz; Hanke, Michael; Leake, Steven John; Loffeld, Otmar; Pietsch, Ullrich

    2017-06-01

    Coherent X-ray diffraction imaging at symmetric hhh Bragg reflections was used to resolve the structure of GaAs/In 0.15 Ga 0.85 As/GaAs core-shell-shell nanowires grown on a silicon (111) substrate. Diffraction amplitudes in the vicinity of GaAs 111 and GaAs 333 reflections were used to reconstruct the lost phase information. It is demonstrated that the structure of the core-shell-shell nanowire can be identified by means of phase contrast. Interestingly, it is found that both scattered intensity in the (111) plane and the reconstructed scattering phase show an additional threefold symmetry superimposed with the shape function of the investigated hexagonal nanowires. In order to find the origin of this threefold symmetry, elasticity calculations were performed using the finite element method and subsequent kinematic diffraction simulations. These suggest that a non-hexagonal (In,Ga)As shell covering the hexagonal GaAs core might be responsible for the observation.

  1. Calculations of multi-particle processes at the one-loop level: precise predictions for the LHC

    Energy Technology Data Exchange (ETDEWEB)

    Karg, Stefan

    2007-07-01

    We present a calculation of the loop-induced processes gg{yields}HH and gg{yields}HHH, and investigate the observability of multi-Higgs boson production at the LHC in the Standard Model and beyond. While the SM cross sections are too small to allow observation at the LHC, we demonstrate that physics beyond the SM can lead to amplified, observable cross sections. Furthermore, the applicability of the heavy top quark approximation in two- and three-Higgs boson production is investigated. The calculation of the process PP{yields}VV+jet at NLO is an important background process to Higgs production in association with a jet at the LHC. We compute the virtual corrections to this process which form the ''bottleneck'' for obtaining a complete NLO prediction. The resulting analytic expressions are generated with highly automated computer routines and translated into a flexible Fortran code, which can be employed in the computation of differential cross sections of phenomenological interest. (orig.)

  2. Proton Radiation Effects on Dark Signal Distribution of PPD CMOS Image Sensors: Both TID and DDD Effects.

    Science.gov (United States)

    Xue, Yuanyuan; Wang, Zujun; Chen, Wei; Liu, Minbo; He, Baoping; Yao, Zhibin; Sheng, Jiangkun; Ma, Wuying; Dong, Guantao; Jin, Junshan

    2017-11-30

    Four-transistor (T) pinned photodiode (PPD) CMOS image sensors (CISs) with four-megapixel resolution using 11µm pitch high dynamic range pixel were radiated with 3 MeV and 10MeV protons. The dark signal was measured pre- and post-radiation, with the dark signal post irradiation showing a remarkable increase. A theoretical method of dark signal distribution pre- and post-radiation is used to analyze the degradation mechanisms of the dark signal distribution. The theoretical results are in good agreement with experimental results. This research would provide a good understanding of the proton radiation effects on the CIS and make it possible to predict the dark signal distribution of the CIS under the complex proton radiation environments.

  3. 40 CFR Appendix A to Subpart Ddd... - Free Formaldehyde Analysis of Insulation Resins by the Hydroxylamine Hydrochloride Method

    Science.gov (United States)

    2010-07-01

    ... values should conform to the following statistical precision: Variance = 0.005 Standard deviation = 0.07... example levels: Expected percent free formaldehyde Sample size, grams 2 30.0 5 12.0 8 7.5 10 6.0 12 5.0 15... 30 0.5 60 ii. If the milliliters of titrant are less than 5 mL or greater than 30 mL, reestimate the...

  4. Aminoacidopathies: Prevalence, Etiology, Screening, and Treatment Options.

    Science.gov (United States)

    Wasim, Muhammad; Awan, Fazli Rabbi; Khan, Haq Nawaz; Tawab, Abdul; Iqbal, Mazhar; Ayesha, Hina

    2018-04-01

    Inborn errors of metabolism (IEMs) are a group of inherited metabolic disorders which are caused by mutations in the specific genes that lead to impaired proteins or enzymes production. Different metabolic pathways are perturbed due to the deficiency or lack of enzymes. To date, more than 500 IEMs have been reported with most of them being untreatable. However, fortunately 91 such disorders are potentially treatable, if diagnosed at an earlier stage of life. IEMs have been classified into different categories and one class of IEMs, characterized by the physiological disturbances of amino acids is called as aminoacidopathies. Out of 91 treatable IEM, thirteen disorders are amino acid related. Aminoacidopathies can be detected by chromatography and mass spectrometry based analytical techniques (e.g., HPLC, GC-MS, LC-MS/MS) for amino acid level changes, and through genetic assays (e.g., PCR, TaqMan Genotyping, DNA sequencing) at the mutation level in the corresponding genes. Hence, this review is focused to describe thirteen common aminoacidopathies namely: Phenylketonuria (PKU), Maple Syrup Urine Disease (MSUD), Homocystinuria/Methylene Tetrahydrofolate Reductase (MTHFR) deficiency, Tyrosinemia type II, Citrullinemia type I and type II, Argininosuccinic aciduria, Carbamoyl Phosphate Synthetase I (CPS) deficiency, Argininemia (arginase deficiency), Hyperornithinemia-Hyperammonemia-Homocitrullinuria (HHH) syndrome, N-Acetylglutamate Synthase (NAGS) deficiency, Ornithine Transcarbamylase (OTC) deficiency, and Pyruvate Dehydrogenase (PDH) complex deficiency. Furthermore, the etiology, prevalence and commonly used analytical techniques for screening of aminoacidopathies are briefly described. This information would be helpful to researchers and clinicians especially from developing countries to initiate newborn screening programs for aminoacidopathies.

  5. Higgs particles in the standard model and supersymmetric theories

    International Nuclear Information System (INIS)

    Muehlleitner, M.M.

    2000-08-01

    This thesis presents a theoretical analysis of the properties of the Higgs bosons in the standard model (SM) and the minimal supersymmetric extension (MSSM), which can be investigated at the LHC and e + e - linear colliders. The final goal is the reconstruction of the Higgs potential and thus the verification of the Higgs mechanism. MSSM Higgs boson production processes at future γγ colliders are calculated in several decay channels. Heavy scalar and pseudoscalar Higgs bosons can be discovered in the bb final state in the investigated mass range 200 to 800 GeV for moderate and large values of tanβ. The τ + τ - channel provides a heavy Higgs boson discovery potential for large values of tanβ. Several mechanisms that can be exploited at e + e - linear colliders for the measurement of the lifetime of a SM Higgs boson in the intermediate mass range are analysed. In the WW mode, the lifetime of Higgs scalars with masses below ∝160 GeV can be determined with an error less than 10%. The reconstruction of the Higgs potential requires the measurement of the Higgs self-couplings. The SM and MSSM trilinear Higgs self-couplings are accessible in double and triple Higgs production. A theoretical analysis is presented in the relevant channels at the LHC and e + e - linear colliders. For high luminosities, the SM trilinear Higgs self-coupling can be measured with an accuracy of 20% at a 500 GeV e + e - linear collider. The MSSM coupling among three light Higgs bosons has to be extracted from continuum production. The other trilinear Higgs couplings are measurable in a restricted range of the MSSM parameter space. At the LHC, the Hhh coupling can be probed in resonant decays. (orig.)

  6. Search for Double Higgs Production in the Final State with Two Photons and Two Bottom Quarks at the CMS Detector

    Science.gov (United States)

    Hebda, Philip Robert

    A search for the production of Higgs pairs in the decay channel with two photons and two bottom quarks is reported for both resonant and nonresonant cases. The data corresponds to an integrated luminosity of 19.7 /fb of proton-proton collisions at a center-of-mass energy of 8 TeV collected by the CMS detector at the CERN Large Hardron Collider. The candidate events are selected by requiring two photons and two jets and are classified according to the number of jets tagged as coming from the hadronization of a bottom quark. The search for resonance production of two Higgs bosons through a new particle as hypothesized in extensions to the Standard Model involving a Radion or KK-graviton from models with warped extra dimensions or involving a heavy Higgs from models with supersymmetry, is performed on the resonant mass range from 260 GeV to 1100 GeV. The search for Standard Model nonresonant production of two Higgs bosons is performed; in addition a theoretical framework is explored for the analysis of anomalous values of the couplings tt¯H, HHH, and tt¯HH. The observations are consistent with background expectations. Upper limits at the 95% confidence level are extracted on the production cross section of resonant and SM nonresonant production. In particular, the Radion with a vacuum expectation of 1 TeV is observed (expected) to be excluded with masses below 0.97 TeV (0.88 TeV), while the analysis is not sensitive to the Radion with a vacuum expectation of 3 TeV. The nonresonant double Higgs cross section is observed (expected) to be excluded at 1.91 fb (1.59 fb) or 72.9 (60.7) times the NNLO Standard Model value.

  7. Occurences and Fate of DDT Principal Isomers/Metabolites, DDA, and o,p'-DDD Enantiomers in Fish, Sediment and Water at a DDT-Impacted Superfund Site

    Science.gov (United States)

    In the 1950s and 60s, discharges from a DDT manufacturing plant contaminated a tributary system of the Tennessee River near Huntsville, Alabama, USA. Regulatory action resulted in declaring the area a Superfund site which required remediation and extensive monitoring. Monitoring ...

  8. Randomized controlled trials of COX-2 inhibitors

    DEFF Research Database (Denmark)

    Stefansdottir, Gudrun; De Bruin, Marie L; Knol, Mirjam J

    2011-01-01

    trials after the 2004 market withdrawal of rofecoxib were excluded. RESULTS: Median defined daily dose (DDD) of celecoxib (2.00) was higher than the median DDD of rofecoxib (1.00; p ... celecoxib after the withdrawal of rofecoxib because the overall median DDD of celecoxib was substantially higher than the median DDD of rofecoxib, while non-selective NSAID DDDs were comparable....

  9. MR imaging of degenerative disc disease

    International Nuclear Information System (INIS)

    Farshad-Amacker, Nadja A.; Farshad, Mazda; Winklehner, Anna; Andreisek, Gustav

    2015-01-01

    Highlights: • This systematic literature review summarizes the current knowledge on MR imaging in degenerative disc disease. • Different classification systems for segmental spine degeneration are summarized. • It outlines the diagnostic limitations of MR imaging. - Abstract: Magnet resonance imaging (MRI) is the most commonly used imaging modality for diagnosis of degenerative disc disease (DDD). Lack of precise observations and documentation of aspects within the complex entity of DDD might partially be the cause of poor correlation of radiographic findings to clinical symptoms. This literature review summarizes the current knowledge on MRI in DDD and outlines the diagnostic limitations. The review further sensitizes the reader toward awareness of potentially untended aspects of DDD and the interaction of DDD and endplate changes. A summary of the available classifications for DDD is provided

  10. MR imaging of degenerative disc disease

    Energy Technology Data Exchange (ETDEWEB)

    Farshad-Amacker, Nadja A., E-mail: nadja.farshad@usz.ch [Institute of Diagnostic and Interventional Radiology, University Hospital of Zurich, Zurich (Switzerland); Farshad, Mazda [Department of Orthopaedic Surgery, Balgrist University Hospital, Zurich (Switzerland); Winklehner, Anna; Andreisek, Gustav [Institute of Diagnostic and Interventional Radiology, University Hospital of Zurich, Zurich (Switzerland)

    2015-09-15

    Highlights: • This systematic literature review summarizes the current knowledge on MR imaging in degenerative disc disease. • Different classification systems for segmental spine degeneration are summarized. • It outlines the diagnostic limitations of MR imaging. - Abstract: Magnet resonance imaging (MRI) is the most commonly used imaging modality for diagnosis of degenerative disc disease (DDD). Lack of precise observations and documentation of aspects within the complex entity of DDD might partially be the cause of poor correlation of radiographic findings to clinical symptoms. This literature review summarizes the current knowledge on MRI in DDD and outlines the diagnostic limitations. The review further sensitizes the reader toward awareness of potentially untended aspects of DDD and the interaction of DDD and endplate changes. A summary of the available classifications for DDD is provided.

  11. Documentation Driven Development for Complex Real-Time Systems

    Science.gov (United States)

    2004-12-01

    This paper presents a novel approach for development of complex real - time systems , called the documentation-driven development (DDD) approach. This... time systems . DDD will also support automated software generation based on a computational model and some relevant techniques. DDD includes two main...stakeholders to be easily involved in development processes and, therefore, significantly improve the agility of software development for complex real

  12. Impact of pacing modality and biventricular pacing on cardiac output and coronary conduit flow in the post-cardiotomy patient.

    LENUS (Irish Health Repository)

    Healy, David G

    2012-02-03

    We have previously demonstrated the role of univentricular pacing modalities in influencing coronary conduit flow in the immediate post-operative period in the cardiac surgery patient. We wanted to determine the mechanism of this improved coronary conduit and, in addition, to explore the possible benefits with biventricular pacing. Sixteen patients undergoing first time elective coronary artery bypass grafting who required pacing following surgery were recruited. Comparison of cardiac output and coronary conduit flow was performed between VVI and DDD pacing with a single right ventricular lead and biventricular pacing lead placement. Cardiac output was measured using arterial pulse waveform analysis while conduit flow was measured using ultrasonic transit time methodology. Cardiac output was greatest with DDD pacing using right ventricular lead placement only [DDD-univentricular 5.42 l (0.7), DDD-biventricular 5.33 l (0.8), VVI-univentricular 4.71 l (0.8), VVI-biventricular 4.68 l (0.6)]. DDD-univentricular pacing was significantly better than VVI-univentricular (P=0.023) and VVI-biventricular pacing (P=0.001) but there was no significant advantage to DDD-biventricular pacing (P=0.45). In relation to coronary conduit flow, DDD pacing again had the highest flow [DDD-univentricular 55 ml\\/min (24), DDD-biventricular 52 ml\\/min (25), VVI-univentricular 47 ml\\/min (23), VVI-biventricular 50 ml\\/min (26)]. DDD-univentricular pacing was significantly better than VVI-univentricular (P=0.006) pacing but not significantly different to VVI-biventricular pacing (P=0.109) or DDD-biventricular pacing (P=0.171). Pacing with a DDD modality offers the optimal coronary conduit flow by maximising cardiac output. Biventricular lead placement offered no significant benefit to coronary conduit flow or cardiac output.

  13. Fate of DDT in grape juice when fermented and distilled into arak

    International Nuclear Information System (INIS)

    Kawar, N.S.

    1975-01-01

    Since DDT is still used on grapevines to control insect pests, the fate of this insecticide in grape juice fermented and distilled into arak was investigated. Fermentation of the juice resulted in extensive conversion of DDT to DDD. Distillation of the fermented juice resulted in further conversion of DDT to DDD. Moreover, the major portion of both DDT and DDD remained in the undistilled fraction. The second distillation resulted in further distribution of DDT and DDD among the four fractions, thus leaving very low levels of both compounds in the finished product. DDT residue in arak constituted only 2% of the amount added to the fresh juice. (author)

  14. Communication Strategy: Proper Structure Necessary but not Sufficient

    Science.gov (United States)

    2010-12-01

    Information, (1998), http://www.ncbi.nlm.nih.gov/ bookshelf /br.fcgi?book=nap6200&part=a20006484ddd00073 (accessed November 12, 2010). “The multidimensional...Biotechnology Information (1998). http://www.ncbi.nlm.nih.gov/ bookshelf /br.fcgi?book=nap6200&part=a20006484ddd000 73 (accessed November 12, 2010

  15. 47 CFR 80.324 - Transmission of distress message by station not itself in distress.

    Science.gov (United States)

    2010-10-01

    ... authorities who may be able to assist. (b) Transmission must be made on the international distress frequencies... radiotelegraphy is used: (i) The signal DDD SOS SOS SOS DDD: (ii) The word DE; (iii) The call sign of the... three times; (ii) The words THIS IS; (iii) The call sign or other identification of the transmitting...

  16. Enantiomeric ratios as an indicator of exposure processes for persistent pollutants in human placentas

    DEFF Research Database (Denmark)

    Shen, Heqing; Virtanen, H E; Main, Katharina M

    2006-01-01

    The enantiomeric ratios (ER) of alpha-HCH and o,p'-DDT ((+)-isomer concentration/(-)-isomer concentration) and o,p'-DDD (first eluting enantiomer/second enantiomer) were investigated in 112 human placentas from Finnish boys collected 1997-2001. Both o,p'-DDD and alpha-HCH showed changes in their ER...

  17. Microstructurally Based Cross-slip Mechanisms and Their Effects on Dislocation Microstructure Evolution in fcc Crystals

    Science.gov (United States)

    2015-01-01

    incorporated into DDD simulations. Accordingly, the motivation of the current work is to incorporate an atomistically informed cross-slip model into DDD... nudged elastic band method, Acta Mater. 59 (19) (2011) 7135–7144. [54] S.I. Rao, D.M. Dimiduk, J.A. El-Awady, T.A. Parthasarathy, M.D. Uchic, C. Woodward

  18. L. Sumera: Symphony No. 5 / Michael Scott Rohan

    Index Scriptorium Estoniae

    Rohan, Michael Scott

    1997-01-01

    L. Sumera: Symphony No. 5; Music for Chamber Orchestra, In memorian. Malmö Symphony Orchestra / Paavo Järvi. BIS CD-770. 64-35 DDD; Various. Searching for Roots - music from Estonia. Virgin VC 5 43242 2; 71: 34 DDD

  19. Analgetikaforbrug, -overdosering og -dødsfald i Danmark 1979-1986

    DEFF Research Database (Denmark)

    Ott, P; Hansen, P B; Dalhoff, K P

    1990-01-01

    During 1978-1987 the annual sale of analgetics increased by 28% to 164 millions defined daily doses (mDDD) per year. Paracetamol changed status to over-the-counter drug by 1.1.1984 as did combinations of acetylicsalicylic acid and codein 14.5.1984. The consumption of paracetamol increased rapidly...... to 47 mDDD/-year, the mortality steadily decreasing to 0.07 deaths/mDDD in 1986. The consumption of salicylics decreased from 113 to 94 mDDD, of which the salicylic/codein combination constituted an increasing fraction. The mortality of salicylics increased from 0.05 death/mDDD in 1983 to 0.27/m...

  20. Treatment practices and quantification of antimicrobial drug usage in conventional and organic dairy farms in Wisconsin.

    Science.gov (United States)

    Pol, M; Ruegg, P L

    2007-01-01

    The objective of this study was to develop a method to quantify antimicrobial drug usage and treatment practices on conventional and organic dairy farms that had been recruited to represent a broad spectrum of potential exposure to antimicrobial drugs. Data on disease prevalence and treatment practices of organic (n = 20) and conventional (n = 20) farms were obtained during a farm visit using a survey instrument. A standardized estimate of antimicrobial drug usage was developed using a defined daily dose (DDD) of selected compounds. Density of antimicrobial drug usage was expressed as the number of DDD per adult cow per year. Differences in prevalence and management of selected diseases between conventional and organic farms were identified. The overall estimated prevalence of selected diseases was greater for conventional farms compared with organic farms. Organic farmers reported use of a variety of nonantimicrobial compounds for treatment and prevention of disease. Conventional farmers reported that penicillin was the compound most commonly used for dry cow therapy and cephapirin was most commonly used for treatment of clinical mastitis. On conventional farms, the estimated overall exposure to antimicrobial drugs was 5.43 DDD per cow per year composed of 3.58 and 1.85 DDD of intramammary and parenteral antimicrobial drugs, respectively. Of total intramammary antimicrobial drug usage, treatment of clinical mastitis contributed 2.02 DDD compared with 1.56 DDD attributed to the use of dry cow therapy. Of total parenteral treatments, the distribution of exposure was 0.52 (dry cow therapy), 1.43 (clinical mastitis treatment), 0.39 (treatment of foot disease), 0.14 (treatment of respiratory disease), and 0.32 (treatment of metritis) DDD. For treatments of foot infections (0.33 DDD), respiratory infections (0.07 DDD), and metritis (0.19 DDD), the mean density of ceftiofur usage was significantly greater compared with other compounds.

  1. Multicenter, prospective, randomized safety and efficacy study of a new atrial-based managed ventricular pacing mode (MVP) in dual chamber ICDs.

    Science.gov (United States)

    Sweeney, Michael O; Ellenbogen, Kenneth A; Casavant, David; Betzold, Robert; Sheldon, Todd; Tang, Feng; Mueller, Megan; Lingle, John

    2005-08-01

    Ventricular desynchronization caused by right ventricular pacing may impair ventricular function and increase risk of heart failure (CHF), atrial fibrillation (AF), and death. Conventional DDD/R mode often results in high cumulative percentage ventricular pacing (Cum%VP). We hypothesized that a new managed ventricular pacing mode (MVP) would safely provide AAI/R pacing with ventricular monitoring and DDD/R during AV block (AVB) and reduce Cum%VP compared to DDD/R. MVP RAMware was downloaded in 181 patients with Marquis DR ICDs. Patients were initially randomized to either MVP or DDD/R for 1 month, then crossed over to the opposite mode for 1 month. ICD diagnostics were analyzed for cumulative percentage atrial pacing (Cum%AP), Cum%VP, and duration of DDD/R pacing for spontaneous AVB. Baseline characteristics included age 66 +/- 12 years, EF 36 +/- 14%, and NYHA Class II-III 36%. Baseline PR interval was 190 +/- 53 msec and programmed AV intervals (DDD/R) were 216 +/- 50 (paced)/189 +/- 53 (sensed) msec. Mean Cum%VP was significantly lower in MVP versus DDD/R (4.1 +/- 16.3 vs 73.8 +/- 32.5, P MVP were 85.0 and 99.9, respectively. Mean Cum%AP was not different between MVP versus DDD/R (48.7 +/- 38.5 vs 47.3 +/- 38.4, P = 0.83). During MVP overall time spent in AAI/R was 89.6% (intrinsic conduction), DDD/R 6.7% (intermittent AVB), and DDI/R 3.7% (AF). No adverse events were attributed to MVP. MVP safely achieves functional atrial pacing by limiting ventricular pacing to periods of intermittent AVB and AF in ICD patients, significantly reducing Cum%VP compared to DDD/R. MVP is a universal pacing mode that adapts to AVB and AF, providing both atrial pacing and ventricular pacing support when needed.

  2. Adrenal metabolism of mitotane and related compounds

    International Nuclear Information System (INIS)

    Djanegara, T.K.S.

    1989-01-01

    Mitotane (o,p'-DDD; 1-[2-chlorophenyl]-1-[4-chlorophenyl]-2,2-dichloroethane) has been used in the treatment of Cushing's syndrome due to adrenal hyperfunction and it the drug of choice for adrenocortical carcinoma. The object of this investigation is to study the biotransformation of o,p'-DDD and p,p'-DDD in dogs and bovine adrenal cortex to explain its selective toxicity and mechanism of action. The in vitro biotransformation of 14 C-labeled o,p'-DDD and p,p'-DDD by dog and bovine adrenal cortex as studied. Of the cortex subcellular fractions, the cytosol fraction was found to be the most active in metabolizing the substrates, followed by the mitochondrial fraction. This metabolism including that in cytosolic fractions, did not take place with boiled enzyme preparations and required an NADPH generating system. This study has been directed towards establishing the metabolic activation mechanism which may account for the adrenocorticolytic effect of mitotane in contrast to detoxication by the liver. HPLC and TLC metabolic profiles have been generated from incubations of bovine and dog adrenal cortex homogenates and their subfractions for 14 C-labeled p,p'-DDD, o,p'-DDD and its monochloroethylene derivative, o,p'-DDMU

  3. Diversity of bacterial dimethylsulfoniopropionate degradation genes in surface seawater of Arctic Kongsfjorden.

    Science.gov (United States)

    Zeng, Yin-Xin; Qiao, Zong-Yun; Yu, Yong; Li, Hui-Rong; Luo, Wei

    2016-09-08

    Dimethylsulfoniopropionate (DMSP), which is the major source of organic sulfur in the world's oceans, plays a significant role in the global sulfur cycle. This compound is rapidly degraded by marine bacteria either by cleavage to dimethylsulfide (DMS) or demethylation to 3-methylmercaptopropionate (MMPA). The diversity of genes encoding bacterial demethylation (dmdA) and DMS production (dddL and dddP) were measured in Arctic Kongsfjorden. Both dmdA and dddL genes were detected in all stations along a transect from the outer to the inner fjord, while dddP gene was only found in the outer and middle parts of the fjord. The dmdA gene was completely confined to the Roseobacter clade, while the dddL gene was confined to the genus Sulfitobacter. Although the dddP gene pool was also dominated by homologs from the Roseobacter clade, there were a few dddP genes showing close relationships to both Alphaproteobacter and Gammaproteobacter. The results of this study suggest that the Roseobacter clade may play an important role in DMSP catabolism via both demethylation and cleavage pathways in surface waters of Kongsfjorden during summer.

  4. Subband structure comparison between n- and p- type double delta-doped Ga As quantum wells

    International Nuclear Information System (INIS)

    Rodriguez V, I.; Gaggero S, L.M.

    2004-01-01

    We compute the electron level structure (n-type) and the hole subband structure (p-type) of double -doped GaAs (DDD) quantum wells, considering exchange effects. The Thomas-Fermi (TF), and Thomas-Fermi-Dirac (TFD) approximations have been applied in order to describe the bending of the conduction and valence band, respectively. The electron and the hole subband structure study indicates that exchange effects are more important in p-type DDD quantum wells than in n-type DDD Also our results agree with the experimental data available. (Author) 33 refs., 2 tabs., 5 figs

  5. Sibelius: Der Sturm, Op. 109, Neeme Järvi / Gerhard Pätzig

    Index Scriptorium Estoniae

    Pätzig, Gerhard

    1990-01-01

    Uuest heliplaadist "Sibelius: Der Sturm, Op. 109, (Vorspiel und Konzertsuiten zu Shakespeares Drama), Cassazione, Op.6, Preludio, Tiera. Sinfonieorchester Göteborg, Neeme Järvi". BIS/ Disco-Center CD 448 71'43") DDD

  6. Pärt, Arvo: Seven Magnificat Antiphons / Barry Witherden

    Index Scriptorium Estoniae

    Witherden, Barry

    1996-01-01

    Uuest heliplaadist "Pärt, Arvo: Seven Magnificat Antiphons. Magnificat. Summa; Tormis, Veljo: The Curse Upon Iron. Karelian Destiny. BBC Singers, Bo Holton". Collins Classics 1472-2 (61 minutes: DDD)

  7. Pärt: Berliner Messe / Rob Cowan

    Index Scriptorium Estoniae

    Cowan, Rob

    1998-01-01

    Uuest heliplaadist "Pärt: Berliner Messe. The Beatitudes. Annum per Annum. Magnificat. Seven Magnificat Antiphons. De profundis. Polyphony / Steven Layton with Andrew Lucas" Hyperion CDA66960 (74 minutes:DDD)

  8. Prognosis of intervertebral disc loss from diagnosis of degenerative disc disease

    Science.gov (United States)

    Li, S.; Lin, A.; Tay, K.; Romano, W.; Osman, Said

    2015-03-01

    Degenerative Disc Disease (DDD) is one of the most common causes of low back pain, and is a major factor in limiting the quality of life of an individual usually as they enter older stages of life, the disc degeneration reduces the shock absorption available which in turn causes pain. Disc loss is one of the central processes in the pathogenesis of DDD. In this study, we investigated whether the image texture features quantified from magnetic resonance imaging (MRI) could be appropriate markers for diagnosis of DDD and prognosis of inter-vertebral disc loss. The main objective is to use simple image based biomarkers to perform prognosis of spinal diseases using non-invasive procedures. Our results from 65 subjects proved the higher success rates of the combination marker compared to the individual markers and in the future, we will extend the study to other spine regions to allow prognosis and diagnosis of DDD for a wider region.

  9. Bartok: Concerto for Orchestra Sz 116 / Edward Seckerson

    Index Scriptorium Estoniae

    Seckerson, Edward

    1992-01-01

    Uuest heliplaadist "Bartok: Concerto for Orchestra Sz 116; Enescu: Romanian Rhapsodies Op. 11-No. 1 in A major No. 2 in D major. Royal Scottish Orchestra / Neeme Järvi" Chandos CHAN8947 (66 minutes:DDD)

  10. Prokofiev: Cantata for the 20th Anniversary of the October Revolution / David J. Fanning

    Index Scriptorium Estoniae

    Fanning, David J.

    1993-01-01

    Uuest heliplaadist "Prokofiev: Cantata for the 20th Anniversary of the October Revolution, Op. 74 a. The Tale of the Stone Flower - experts. Philharmonia Chorus and Orchestra / Neeme Järvi" Chandos ABTD 1597; CHAN9095 (75 minutes:DDD)

  11. Pärt, Arvo: Litany. Psalom. Trisagion / Robert Cowan

    Index Scriptorium Estoniae

    Cowan, Robert

    1996-01-01

    Uuest heliplaadist "Pärt, Arvo: Litany. Psalom. Trisagion. Hilliard Ensemble, Estonian Philharmonic Chamber Choir, Tallinn Chamber Orchestra, Tõnu Kaljuste; Lithuanian Chamber Orchestra, Saulius Sondeckis" ECM New Series 449 810-4; 449 810-2 (42 minutes: DDD)

  12. Tüür, Erkki-Sven: Architectonics VI. Passion. Illusion / Guy S. Rickards

    Index Scriptorium Estoniae

    Rickards, Guy S.

    1996-01-01

    Uuest heliplaadist "Tüür, Erkki-Sven: Architectonics VI. Passion. Illusion. Crystallisatio. Requiem. Estonian Philharmonic Chamber Choir, Tallinn Chamber Orchestra, Tõnu Kaljuste. ECM New Series 449 459-2 (64 minutes: DDD)

  13. Stravinsky: The Rite of Spring / Hartmut, Lück

    Index Scriptorium Estoniae

    Lück, Hartmut

    1996-01-01

    Uuest heliplaadist "Stravinsky: The Rite of Spring. Canticum Sacrum. Requiem Canticles. Choral Variations on "Vom Himmel hoch". Lausanne Pro Arte Choir, Suisse Romande Chamber Choir and Orchestra, Neeme Järvi. Chandos CHAN 9408 (75 minutes:DDD)

  14. Schmidt. Sinfonie Nr. 1 E-Dur; Strauss. Vier sinfonische Zwischenspiele aus Intermezzo. Detroit Symphony Orchestra, Neeme Järvi / Helge Grünewald

    Index Scriptorium Estoniae

    Grünewald, Helge

    1996-01-01

    Uuest heliplaadist "Schmidt. Sinfonie Nr. 1 E-Dur; Strauss. Vier sinfonische Zwischenspiele aus Intermezzo. Detroit Symphony Orchestra, Neeme Järvi. Chandos/Koch CD 9357 (WD: 68'20") DDD (WD:114'36")

  15. Pärt: Fratres in sechs Versionen. Festina lente. Summa / C. S.

    Index Scriptorium Estoniae

    C. S.

    1997-01-01

    Uuest heliplaadist "Pärt: Fratres in sechs Versionen. Festina lente. Summa. Cantus in memoriam Benjamin Britten. Orchester der Ungarischen Staatsoper, Tamas Benedek". Naxos CD 8 553 750 (WD:79'06") DDD

  16. Bernstein: Prelude, Fugue and Riffs / Edward Greenfield

    Index Scriptorium Estoniae

    Greenfield, Edward

    1998-01-01

    Uuest heliplaadist "Bernstein: Prelude, Fugue and Riffs. Facsimile. West Side Story - Symphonic Dances. Divertimento. City of Birmingham Symphony Orchestra / Paavo Järvi. Virgin Classics VC5 45295-2 (68 minutes:DDD)

  17. Bernstein: Prelude, Fugue and Riffs / Michel Parouty

    Index Scriptorium Estoniae

    Parouty, Michel

    1998-01-01

    Uuest heliplaadist "Bernstein: Prelude, Fugue and Riffs. Facsimile. West Side Story - Symphonic Dances. Divertimento. City of Birmingham Symphony Orchestra / Paavo Järvi" Virgin Classics VC5 45295-2 (68 minutes:DDD)

  18. Chopin: Concerto for piano and orchestra No. 2 in F minor / Christopher Headington

    Index Scriptorium Estoniae

    Headington, Christopher

    1992-01-01

    Uuest heliplaadist "Chopin: Concerto for piano and orchestra No. 2 in F minor, Op. 21; Schumann: Concerto for piano and orchestra in A minor Op. 54. Philharmonia Orchestra, Neeme Järvi". Chandos CHAN9061 (62 minutes:DDD)

  19. Prokofiev: The Fiery Angel.Gösta Ohlin Vocal Ensemble / David J. Fanning

    Index Scriptorium Estoniae

    Fanning, David J.

    1991-01-01

    Uuest heliplaadist "Prokofiev: The Fiery Angel.Gösta Ohlin Vocal Ensemble, Gothenburg Pro Musica Chamber Choir and Symphony Orchestra, Neeme Järvi" DG CD 431 669-2 GH2 (two discs, nas:118 minutes:DDD)

  20. Prokofiev: War and Peace - Symphonic Suite (arr. Palmer) / Ivan March

    Index Scriptorium Estoniae

    March, Ivan

    1993-01-01

    Uuest heliplaadist "Prokofiev: War and Peace - Symphonic Suite (arr. Palmer), Summer Night, Op. 123. Russian Overture, Op. 72. Philharmonia Orchestra / Neeme Järvi. Chandos ABTD 1598 CHAN9096 (64 minutes:DDD) Igor - Polovtsian Dances

  1. Various / Barry Witherden

    Index Scriptorium Estoniae

    Witherden, Barry

    1996-01-01

    Uuest heliplaadist "Various. John Keys (organ), Andrew Angus (bass). Vasari Singers / Jeremy Backhouse". EMI Eminence 7243 5 65 903 2. 74:09 DDD. Plaadil ka A. Pärdi "Summa", "The Beautitudes", "Seven Magnificat Antiphons"

  2. Jolivet: Complete Flute Music, Vol. 2 / Guy S. Rickards

    Index Scriptorium Estoniae

    Rickards, Guy S.

    1996-01-01

    Uuest heliplaadist "Jolivet: Complete Flute Music, Vol. 2. Kroumata Percussion Ensemble, Tapiola Sinfonietta, Paavo Järvi". BIS CD 739 (64 minutes: DDD). Item marked from CD630 (6/94), CD272, remainder new to UK

  3. Pärt, Arvo: "Summa". Collage sur BACH. Fratres / Patric Wiklacz

    Index Scriptorium Estoniae

    Wiklacz, Patric

    1997-01-01

    Uuest heliplaadist "Pärt, Arvo: "Summa". Collage sur BACH. Fratres. Cantus in Memoriam Benjamin Britten. Summa. Festina Lente. Tabula rasa. Tapiola Sinfonietta / Jean-Jacques Kantorow". BIS-CD-834. 62:30 DDD

  4. Stravinsky: The Rite of Spring. Canticum sacrum

    Index Scriptorium Estoniae

    1996-01-01

    Uuest heliplaadist "Stravinsky: The Rite of Spring. Canticum sacrum. Requiem canticles. Choral Variations on "Vom Himmel hoch". Lausanne Pro Arte Choir, Suisse Romande Chamber Choir and Orchestra, Neeme Järvi" Chandos CHAN 9408 (75 minutes:DDD)

  5. Raid, Kaljo: Symphony No. 2, "Stockholm" / Guy S. Rickards

    Index Scriptorium Estoniae

    Rickards, Guy S.

    1996-01-01

    Uuest heliplaadist "Raid, Kaljo: Symphony No. 2, "Stockholm"; Tubin, Eduard: Elegy for Strings (arr. Raid). Symphony No. 11 (orch. Raid). Estonian State Symphony Orchestra, Arvo Volmer". Koch International Classics 37291-2 (48 minutes:DDD)

  6. Kalinnikov: Sinfonie Nr.2 A-Dur, Ouvertüre Zar Boris / Hanspeter Krellmann

    Index Scriptorium Estoniae

    Krellmann, Hanspeter

    1990-01-01

    Uuest heliplaadist "Kalinnikov: Sinfonie Nr.2 A-Dur, Ouvertüre Zar Boris, Die Zeder und die Palme. Scottish National Orchestra, Neeme Järvi" (AD: 1989) Chandos / Koch Records CD 8805 (WD: 59'40") DDD

  7. Bartok: Der holzgeschnitzte Prinz / Bernhard Uske

    Index Scriptorium Estoniae

    Uske, Bernhard

    1991-01-01

    Uuest heliplaadist "Bartok: Der holzgeschnitzte Prinz [The Wooden Prince complete ballet] op. 13. Ungarische Bilder [Hungarian Pictures]. Philharmonia Orchestra [The Philharmonia] Neeme Järvi". Chandos/Koch Records CD 8895 (WD:65'51") DDD

  8. Sibelius: Pohjola's Daughter; Night Ride and Sunrise; Four Legends from Kalevala (Lemminkäinen Suite). Gothenburg Symphony Orchestra, Neeme Järvi / Brian Hunt

    Index Scriptorium Estoniae

    Hunt, Brian

    1997-01-01

    Uuest heliplaadist "Sibelius: Pohjola's Daughter; Night Ride and Sunrise; Four Legends from Kalevala (Lemminkäinen Suite). Gothenburg Symphony Orchestra / Neeme Järvi. Deutsche Grammophon 453 426-2; 70:37 DDD

  9. Trendy ve spotřebě léčiv z ATC skupiny A10 za období 2005-2009: porovnání situace v České a Slovenské republice

    OpenAIRE

    Písaříková, Zuzana

    2009-01-01

    This thesis describes a methodology for expressing the consumption of drugs, a system of ATC/DDD, ATC classification and DDD recommended daily dose assigment. It acquaints readers with the most appropriate data source for consumption determining and also inform about diabetes mellitus. This involves also recommended standards of medical care in diabetes by the Czech Diabetes Association, with which is comparethe actual consumption of drugs in the Czech Republic and Slovakia at the conclusion....

  10. [Variations in antihypertensive drug utilization among primary care areas in the autonomous region of Valencia (Spain)].

    Science.gov (United States)

    Sanfélix-Gimeno, Gabriel; Peiró, Salvador; Librero, Julián

    2010-01-01

    To estimate consumption of five subgroups of antihypertensive drugs by primary care areas and to analyze its variation. We performed an ecological, descriptive study of antihypertensive consumption in 239 primary care areas in the autonomous region of Valencia in 2005 followed by analysis of the variability observed. The 239 primary care areas were studied by descriptive analysis of dispensation [defined daily dose (DDD) per 1,000 inhabitants/day in pensioners (DDD/1000p/day) and in the active population (DDD/1000a/day)] and standardized consumption ratios. Small-area variation analysis was used to analyze the observed variability. Associations among dispensations of the distinct therapeutic subgroups were also analyzed. Overall antihypertensive use in the autonomous region of Valencia in 2005 was 235.6DDD/1000/day. This consumption was concentrated in pensioners (800DDD/1000p/day vs. 73DDD/1000a/day). Consumption of antihypertensive subgroups oscillated from 442DDD/1000p/day for drugs with action on the renin-angiotensin system to 32DDD/1000p/day for doxazosin. The active population showed similar patterns. Variation in consumption was moderate, with coefficients of variation from 0.20 to 0.40 (slightly greater for the active population). Associations among dispensations of the different therapeutic subgroups were strong. This study shows major variations in the overall consumption of antihypertensive drugs among primary care areas of the autonomous region of Valencia. These results suggest that variation may be associated with problems of underutilization in areas with lower consumption. Copyright © 2010 SESPAS. Published by Elsevier Espana. All rights reserved.

  11. Elucidating Turnover Pathways of Bioactive Small Molecules by Isotopomer Analysis: The Persistent Organic Pollutant DDT

    Science.gov (United States)

    Ehlers, Ina; Betson, Tatiana R.; Vetter, Walter; Schleucher, Jürgen

    2014-01-01

    The persistent organic pollutant DDT (1,1,1-trichloro-2,2-bis(4-chlorophenyl)ethane) is still indispensable in the fight against malaria, although DDT and related compounds pose toxicological hazards. Technical DDT contains the dichloro congener DDD (1-chloro-4-[2,2-dichloro-1-(4-chlorophenyl)ethyl]benzene) as by-product, but DDD is also formed by reductive degradation of DDT in the environment. To differentiate between DDD formation pathways, we applied deuterium NMR spectroscopy to measure intramolecular deuterium distributions (2H isotopomer abundances) of DDT and DDD. DDD formed in the technical DDT synthesis was strongly deuterium-enriched at one intramolecular position, which we traced back to 2H/1H fractionation of a chlorination step in the technical synthesis. In contrast, DDD formed by reductive degradation was strongly depleted at the same position, which was due to the incorporation of 2H-depleted hydride equivalents during reductive degradation. Thus, intramolecular isotope distributions give mechanistic information on reaction pathways, and explain a puzzling difference in the whole-molecule 2H/1H ratio between DDT and DDD. In general, our results highlight that intramolecular isotope distributions are essential to interpret whole-molecule isotope ratios. Intramolecular isotope information allows distinguishing pathways of DDD formation, which is important to identify polluters or to assess DDT turnover in the environment. Because intramolecular isotope data directly reflect isotope fractionation of individual chemical reactions, they are broadly applicable to elucidate transformation pathways of small bioactive molecules in chemistry, physiology and environmental science. PMID:25350380

  12. Gaas Displacement Damage Dosimeter Based on Diode Dark Currents

    Directory of Open Access Journals (Sweden)

    Warner Jeffrey H.

    2017-01-01

    Full Text Available GaAs diode dark currents are correlated over a very large proton energy range as a function of displacement damage dose (DDD. The linearity of the dark current increase with DDD over a wide range of applied voltage bias deems this device an excellent candidate for a displacement damage dosimeter. Additional proton testing performed in situ enabled error estimate determination to within 10% for simulated space use.

  13. Twenty-year trends in benzodiazepine dispensing in the Australian population.

    Science.gov (United States)

    Islam, M M; Conigrave, K M; Day, C A; Nguyen, Y; Haber, P S

    2014-01-01

    Considerable concern has been expressed about overprescribing of benzodiazepines and related harms. Past analyses have relied on World Health Organization-defined daily doses (DDD) which are sometimes out of keeping with clinical usage. This study examines 20-year (1992-2011) trends of benzodiazepine dispensing in Australia using both DDD and Ashton equivalent dose. Data from the Drug Utilisation Sub-Committee and the Pharmaceutical Benefits Scheme (PBS) website were analysed. Trends in number of prescriptions, DDD/1000 people/day and DDD/prescription were examined over time, and between states/territories. In the 20-year period, 174 080 904 scripts were recorded, with temazepam the most dispensed benzodiazepine (35% of scripts), followed by diazepam (23%). Overall recorded utilisation fell from 27.7 DDD/1000 people/day in 1992 to 20.8 in 2011 (24.9% decrease). There were striking changes in use of individual benzodiazepines over time, with reductions in oxazepam and flunitrazepam and dramatic increases in alprazolam. Since 1998, there has been a steady increase, albeit modest, in per script DDD. The DDD/1000 people/day for items dispensed through PBS/Repatriaton-PBS was highest in Tasmania and lowest in Northern Territory. Despite a modest overall decline in the amount of benzodiazepine dispensed, the level of use is still likely to reflect relative over-prescribing given the paucity of accepted indications for long-term use. Since 1998, there was a polynomial increase in quantity dispensed per script. The WHO-defined DDD for clonazepam seems inappropriate and could impede monitoring of its abuse. Other problems include lack of national data for medications not subsidised on PBS/Repatriation PBS. A broad policy approach is required, not one which targets only one particular benzodiazepine. © 2013 The Authors; Internal Medicine Journal © 2013 Royal Australasian College of Physicians.

  14. Does football cause an increase in degenerative disease of the lumbar spine?

    Science.gov (United States)

    Gerbino, Peter G; d'Hemecourt, Pierre A

    2002-02-01

    Degenerative disease of the lumbar spine is exceedingly common. Whether any specific activity increases the likelihood of developing degenerative disc disease (DDD) or facet degeneration (FD) has enormous implications. Within the field of occupational medicine there are specific activities, occupations, and morphologic characteristics that have been related to low back pain. Several specific risk factors have been conclusively linked to low back pain, and in particular DDD and FD. Within the sport of American football, there has long been the feeling that many athletes have or will develop low back pain, DDD, and FD. Proving that certain risk factors present in football will predictably lead to an increase in LBP, DDD, and FD is more difficult. At this time, it can be said that football players, in general, increase their risk of developing low back pain, DDD, and FD as their years of involvement with their sport increase. Because specific spine injuries like fracture, disc herniation, and spondylolysis are more frequent in football players, the resulting DDD and FD are greater than that of the general population. The weightlifting and violent hyperextension that are part of American football are independent risk factors for degenerative spine disease.

  15. A Precise Drunk Driving Detection Using Weighted Kernel Based on Electrocardiogram.

    Science.gov (United States)

    Wu, Chung Kit; Tsang, Kim Fung; Chi, Hao Ran; Hung, Faan Hei

    2016-05-09

    Globally, 1.2 million people die and 50 million people are injured annually due to traffic accidents. These traffic accidents cost $500 billion dollars. Drunk drivers are found in 40% of the traffic crashes. Existing drunk driving detection (DDD) systems do not provide accurate detection and pre-warning concurrently. Electrocardiogram (ECG) is a proven biosignal that accurately and simultaneously reflects human's biological status. In this letter, a classifier for DDD based on ECG is investigated in an attempt to reduce traffic accidents caused by drunk drivers. At this point, it appears that there is no known research or literature found on ECG classifier for DDD. To identify drunk syndromes, the ECG signals from drunk drivers are studied and analyzed. As such, a precise ECG-based DDD (ECG-DDD) using a weighted kernel is developed. From the measurements, 10 key features of ECG signals were identified. To incorporate the important features, the feature vectors are weighted in the customization of kernel functions. Four commonly adopted kernel functions are studied. Results reveal that weighted feature vectors improve the accuracy by 11% compared to the computation using the prime kernel. Evaluation shows that ECG-DDD improved the accuracy by 8% to 18% compared to prevailing methods.

  16. Pengembangan Media Pembelajaran Fisika Menggunakan Lectora Inspire pada Materi Usaha dan Energi SMA

    Directory of Open Access Journals (Sweden)

    Inggrid Ayu Putri

    2016-12-01

    Full Text Available Abstract The development of instructional media aims to help students to do independent learning outside the classroom but still under the supervision of teachers. This study uses Research and Development (R & D DDD-E type developed by Ivers and Barron. The steps of DDD-E developing method method consist of Decide, Design, Develop, and Evaluate. Decide is determination of the project objectives, design determines the structure of the media contents to be developed, develop step is developing a media that is already planned. The evaluation exist on DDD steps, so the instructional media can be controlled. The software used in this research is Lectora Inspire. Lectora Inspire used on this research because the software user friendly or easy to use. Keywords: Lectora Inspire, media, work, energy Abstrak Pengembangan media pembelajaran ini bertujuan untuk membantu siswa dalam melakukan pembelajaran mandiri diluar kelas tetapi masih dalam pengawasan guru. Penelitian ini menggunakan metode penelitian dan pengembangan atau Research and Development (R&D tipe DDD-E yang dikembangkan oleh Ivers dan Barron. Langkah – langkah metode pengembangan DDD-E terdiri dari tahap decide, yaitu penentuan tujuan proyek, design, yaitu menentukan struktur isi dari media yang akan dikembangkan, develop adalah tahap untuk mengembangkan media pembelajaran yang sudah direncanakan. Tahap Evaluate adalah tahap evaluasi pengembangan media, dimana langkah ini terdapat pada seluruh tahapan DDD. Perangkat lunak yang digunakan adalah Lectora Inspire. Software ini dipilih karena langkah penggunaan yang user friendly atau mudah digunakan. Kata-kata kunci:Lectora Inspire, media, usaha, energi

  17. A Precise Drunk Driving Detection Using Weighted Kernel Based on Electrocardiogram

    Directory of Open Access Journals (Sweden)

    Chung Kit Wu

    2016-05-01

    Full Text Available Globally, 1.2 million people die and 50 million people are injured annually due to traffic accidents. These traffic accidents cost $500 billion dollars. Drunk drivers are found in 40% of the traffic crashes. Existing drunk driving detection (DDD systems do not provide accurate detection and pre-warning concurrently. Electrocardiogram (ECG is a proven biosignal that accurately and simultaneously reflects human’s biological status. In this letter, a classifier for DDD based on ECG is investigated in an attempt to reduce traffic accidents caused by drunk drivers. At this point, it appears that there is no known research or literature found on ECG classifier for DDD. To identify drunk syndromes, the ECG signals from drunk drivers are studied and analyzed. As such, a precise ECG-based DDD (ECG-DDD using a weighted kernel is developed. From the measurements, 10 key features of ECG signals were identified. To incorporate the important features, the feature vectors are weighted in the customization of kernel functions. Four commonly adopted kernel functions are studied. Results reveal that weighted feature vectors improve the accuracy by 11% compared to the computation using the prime kernel. Evaluation shows that ECG-DDD improved the accuracy by 8% to 18% compared to prevailing methods.

  18. Use of and barriers to access to opioid analgesics: a worldwide, regional, and national study.

    Science.gov (United States)

    Berterame, Stefano; Erthal, Juliana; Thomas, Johny; Fellner, Sarah; Vosse, Benjamin; Clare, Philip; Hao, Wei; Johnson, David T; Mohar, Alejandro; Pavadia, Jagjit; Samak, Ahmed Kamal Eldin; Sipp, Werner; Sumyai, Viroj; Suryawati, Sri; Toufiq, Jallal; Yans, Raymond; Mattick, Richard P

    2016-04-16

    Despite opioid analgesics being essential for pain relief, use has been inadequate in many countries. We aim to provide up-to-date worldwide, regional, and national data for changes in opioid analgesic use, and to analyse the relation of impediments to use of these medicines. We calculated defined daily doses for statistical purposes (S-DDD) per million inhabitants per day of opioid analgesics worldwide and for regions and countries from 2001 to 2013, and we used generalised estimating equation analysis to assess longitudinal change in use. We compared use data against the prevalence of some health disorders needing opioid use. We surveyed 214 countries or territories about impediments to availability of these medicines, and used regression analyses to establish the strength of associations between impediments and use. The S-DDD of opioid analgesic use more than doubled worldwide between 2001-03 and 2011-13, from 1417 S-DDD (95% CI -732 to 3565; totalling about 3.01 billion defined daily doses per annum) to 3027 S-DDD (-1162 to 7215; totalling about 7.35 billion defined daily doses per annum). Substantial increases occurred in North America (16,046 S-DDD [95% CI 4032-28,061] to 31,453 S-DDD [8121-54,785]), western and central Europe (3079 S-DDD [1274-4883] to 9320 S-DDD [3969-14,672]), and Oceania (2275 S-DDD [763-3787] to 9136 S-DDD [2508-15,765]). Countries in other regions have shown no substantial increase in use. Impediments to use included an absence of training and awareness in medical professionals, fear of dependence, restricted financial resources, issues in sourcing, cultural attitudes, fear of diversion, international trade controls, and onerous regulation. Higher number of impediments reported was significantly associated with lower use (unadjusted incidence rate ratio 0.39 [95% CI 0.29-0.52]; p<0.0001), but not when adjusted for gross domestic product and human development index (0.91 [0.73-1.14]; p=0.4271). Use of opioid analgesics has increased, but

  19. Trends in the Outpatient Utilization of Antipsychotic Drugs in the City of Zagreb in the Ten-Year Period as a Tool to Assess Drug Prescribing Rationality.

    Science.gov (United States)

    Polić-Vižintin, Marina; Tripković, Ingrid; Štimac, Danijela; Šostar, Zvonimir; Orban, Mirjana

    2016-12-01

    The aim was to determine distribution and trends in the outpatient utilization of antipsychotics to evaluate the rationality of antipsychotic drug prescribing during the ten year period. The epidemiological method of descriptive and analytical observation was used. Data on drug utilization from Zagreb Municipal Pharmacy were used to calculate the number of defined daily doses (DDD) and DDD per 1000 inhabitants per day (DDD/TID) using the World Health Organization Anatomical-Therapeutic-Chemical methodology. The ratio of typical versus atypical antipsychotics served as an indicator on assessing the rationality of the utilization. Data on the use of anticholinergics in the treatment of neuroleptic side effects were also included. Outpatient utilization of antipsychotics showed a declining pattern from 14.17 in 2001 to 8.42 DDD/TID in 2010. The utilization of atypical antipsychotics increased by 60% (from 3.68 to 5.89 DDD/TID), while the utilization of typical antipsychotics decreased by 76% (from 10.49 to 2.53 DDD/TID). The drugs showing the largest increase were olanzapine (from 1.21 to 2.78 DDD/TID) and quetiapine (from 0 to 0.68 DDD/TID). The typical/atypical antipsychotic ratio changed from 1:0.4 in 2001 to 1:2.3 in 2010. A 2.3-fold decrease was recorded in the utilization of anticholinergics (from 2.05 to 0.91 DDD/TID). Total consumption of neuroleptics significantly decreased. A decrease was also recorded in the utilization of anticholinergics. Study results pointed to two favorable features, i.e. low use of typical antipsychotics and the ratio of typical and atypical antipsychotics. Implementation of the new clinical guidelines for nervous system disorders and updating of the list of reimbursable drugs with the addition of new ones contributed to the observed improvement in the prescribing patterns during the study period. Using the WHO ATC/DDD methodology and rationality indicators in the assessment of trends in the outpatient utilization of

  20. Degenerative inter-vertebral disc disease osteochondrosis intervertebralis in Europe: prevalence, geographic variation and radiological correlates in men and women aged 50 and over.

    Science.gov (United States)

    Armbrecht, Gabriele; Felsenberg, Dieter; Ganswindt, Melanie; Lunt, Mark; Kaptoge, Stephen K; Abendroth, Klaus; Aroso Dias, Antonio; Bhalla, Ashok K; Cannata Andia, Jorge; Dequeker, Jan; Eastell, Richard; Hoszowski, Krzysztof; Lyritis, George; Masaryk, Pavol; van Meurs, Joyce; Miazgowski, Tomasz; Nuti, Ranuccio; Poór, Gyula; Redlund-Johnell, Inga; Reid, David M; Schatz, Helmut; Todd, Christopher J; Woolf, Anthony D; Rivadeneira, Fernando; Javaid, Muhammad K; Cooper, Cyrus; Silman, Alan J; O'Neill, Terence W; Reeve, Jonathan

    2017-07-01

    To assess the prevalences across Europe of radiological indices of degenerative inter-vertebral disc disease (DDD); and to quantify their associations with, age, sex, physical anthropometry, areal BMD (aBMD) and change in aBMD with time. In the population-based European Prospective Osteoporosis Study, 27 age-stratified samples of men and women from across the continent aged 50+ years had standardized lateral radiographs of the lumbar and thoracic spine to evaluate the severity of DDD, using the Kellgren-Lawrence (KL) scale. Measurements of anterior, mid-body and posterior vertebral heights on all assessed vertebrae from T4 to L4 were used to generate indices of end-plate curvature. Images from 10 132 participants (56% female, mean age 63.9 years) passed quality checks. Overall, 47% of men and women had DDD grade 3 or more in the lumbar spine and 36% in both thoracic and lumbar spine. Risk ratios for DDD grades 3 and 4, adjusted for age and anthropometric determinants, varied across a three-fold range between centres, yet prevalences were highly correlated in men and women. DDD was associated with flattened, non-ovoid inter-vertebral disc spaces. KL grade 4 and loss of inter-vertebral disc space were associated with higher spine aBMD. KL grades 3 and 4 are often used clinically to categorize radiological DDD. Highly variable European prevalences of radiologically defined DDD grades 3+ along with the large effects of age may have growing and geographically unequal health and economic impacts as the population ages. These data encourage further studies of potential genetic and environmental causes. © The Author 2017. Published by Oxford University Press on behalf of the British Society for Rheumatology. All rights reserved. For Permissions, please email: journals.permissions@oup.com

  1. Degenerative Inter-Vertebral Disc Disease (Osteochondrosis Intervertebralis) in Europe: Prevalence, Geographic Variation, and Radiological Correlates in Men and Women Aged 50 and Over

    Science.gov (United States)

    Armbrecht, Gabriele; Felsenberg, Dieter; Ganswindt, Melanie; Lunt, Mark; Kaptoge, Stephen K; Abendroth, Klaus; Aroso Dias, Antonio; Bhalla, Ashok K; Cannata Andia, Jorge; Dequeker, Jan; Eastell, Richard; Hoszowski, Krysztoff; Lyritis, George; Masaryk, Pavol; van Meurs, Joyce; Miazgowski, Tomasz; Nuti, Ranuccio; Poór, Gyula; Redlund-Johnell, Inga; Reid, David M; Schatz, Helmut; Todd, Christopher J; Woolf, Anthony D; Rivadeneira, Fernando; Javaid, Muhammad K; Cooper, Cyrus; Silman, Alan J; O’Neill, Terence W; Reeve, Jonathan

    2017-01-01

    Objectives To assess the prevalence across Europe of radiological indices of degenerative inter-vertebral disc disease (DDD); and to quantify their associations with, age, sex, physical anthropometry, areal bone mineral density (aBMD) and change in aBMD with time. Methods In the population-based European Prospective Osteoporosis Study 27 age-stratified samples of men and women from across the continent aged 50+ had standardized lateral radiographs of the lumbar and thoracic spine to evaluate the severity of DDD, using the Kellgren-Lawrence (KL) scale. Measurements of anterior, mid-body and posterior vertebral heights on all assessed vertebrae from T4 to L4 were used to generate indices of end-plate curvature. Results Images from 10,132 participants (56% female, mean age 63.9 years) passed quality checks. Overall, 47% of men and women had DDD grade 3 or more in the lumbar spine and 36% in both thoracic and lumbar spine. Risk ratios for DDD grades 3 and 4, adjusted for age and anthropometric determinants, varied across a three-fold range between centres, yet prevalences were highly correlated in men and women. DDD was associated with flattened, non-ovoid inter-vertebral disc spaces. KL grade 4 and loss of inter-vertebral disc space were associated with higher spine aBMD. Discussion KL Grades 3 and 4 are often used clinically to categorise radiological DDD. Highly variable European prevalences of radiologically-defined DDD Grades 3+ along with the large effects of age may have growing and geographically unequal health and economic impacts as the population ages. These data encourage further studies of potential genetic and environmental causes. PMID:28398504

  2. Comparison of Long-Term Effect of Dual-Chamber Pacing and Alcohol Septal Ablation in Patients with Hypertrophic Obstructive Cardiomyopathy

    Directory of Open Access Journals (Sweden)

    Jan Krejci

    2013-01-01

    Full Text Available Introduction. Nonpharmacological treatment of patients with hypertrophic obstructive cardiomyopathy (HOCM comprises surgical myectomy (SME, alcohol septal ablation (ASA, and dual-chamber (DDD pacing. The aim of the study was to compare the long-term effect of DDD pacing and ASA in symptomatic HOCM patients. Patients and Methods. We evaluated retrospective data from three cardiocenters; there were 24 patients treated with DDD pacing included and 52 treated with ASA followed for 101 ± 49 and 87 ± 23 months, respectively. Results. In the group treated with DDD pacing, the left ventricle outflow tract gradient (LVOTG decreased from 82 ± 44 mmHg to 21 ± 21 mmHg, and NYHA class improved from 2.7 ± 0.5 to 2.1 ± 0.6 (both P<0.001. In the ASA-treated group, a decline in LVOTG from 73 ± 38 mmHg to 24 ± 26 mmHg and reduction in NYHA class from 2.8 ± 0.5 to 1.7 ± 0.8 were observed (both P<0.001. The LVOTG change was similar in both groups (P=0.264, and symptoms were more affected by ASA (P=0.001. Conclusion. ASA and DDD pacing were similarly effective in reducing LVOTG. The symptoms improvement was more expressed in patients treated with ASA.

  3. Familial history, age and smoking are important risk factors for disc degeneration disease in Arabic pedigrees

    International Nuclear Information System (INIS)

    Livshits, Gregory; Cohen, Zvi; Higla, Orabi; Yakovenko, Konstantin

    2001-01-01

    The present study used computed tomography imaging to evaluate the extent and pattern of the intergenerational transmission of spinal disc degeneration disease (DDD) in complex pedigrees. Contribution of a number of the potential covariates was also studied using univariate and multivariate logistic regression analysis, as well as two types of complex segregation analysis models. Among 161 individuals studied, DDD was diagnosed in 60 individuals. The number of protruded discs varied from 1 to 4, mostly in lumbar or lumbosacral regions. The average age at onset of the disease was similar for both women (36.0 years) and men (34.8 years). The proportion of the individuals affected by the DDD status of their parents ranged from 10% in families of two healthy parents to 55.5% of two affected parents (p < 0.01). The results of the logistic regression analyses and complex segregation analysis were qualitatively the same: DDD status of parents, age and smoking were the main risk factors for disc herniation in the Arabic families we examined. All analyses showed a predominating role of the family history as a risk factor for DDD in offsprings. It showed, for example, four times higher risk at age 50 for individuals with two affected parents vs. those who have two non-affected parents. However, the results of models-fitting genetic analysis, did not confirm a monogenic Mendelian pattern of inheritance

  4. Outpatient utilization of psychopharmaceuticals: comparison between the cities of Zagreb and Sarajevo (2006-2009).

    Science.gov (United States)

    Catić, Tarik; Stimac, Danijela; Zivković, Krešimir; Zelić, Ana

    2012-08-01

    To determine the real outpatient utilization of psychiatric drugs in Zagreb (Croatia) and Sarajevo (Bosnia and Herzegovina) and to compare the outpatient utilization of psychiatric drugs between this two cities. Data on the outpatient utilization of psycholpetics and psychoanaleptics (N05 and N06) in both cities were received from pharmacies and collected during 2006-2009. Based on the data obtained, a number of DDD and DDD per 1000 inhabitants perday (DDD/1000/day) has been calculated. The data in Zagreb were received from all pharmacies in Zagreb, whereas only 50% of pharmacies in Sarajevo participated, thus an extrapolation of data for Sarajevo was required and accomplished. All drugs were classified according to the ATC system. Based on the data obtained, a number of DDD and DDD/1000/day was calculated for all N05 and N06 drugs. Overall utilization trend was similar between the cities Sarajevo and Zagreb and followed trends in other neighbouring countries. Total consumption of psycholeptics and psychoanaleptics in Sarajevo was 22.6% (on average) lower than in Zagreb, during the 4-year period. During the 2006-2009 period the total consumption of psychopharmaceuticals showed increasing trend with peak in 2008 with similar trend between Zagreb and Sarajevo. It is necessary to implement systematic approach to drug utilization monitoring in Sarajevo and Bosnia and Herzegovina in general in order to improve prescribing quality as it is done in Croatia.

  5. Clinical and pathological features of dense deposit disease in Chinese patients.

    Science.gov (United States)

    Wang, Jinquan; Tang, Zheng; Luo, Chunlei; Hu, Yanglin; Zeng, Caihong; Chen, Huiping; Liu, Zhihong

    2012-09-01

    Dense deposit disease (DDD) is a rare disease that has no universally effective treatment. Herein we explore the clinical and pathological features of DDD in Chinese patients and the therapeutic effect of Tripterygium wilfordii (TW). Clinical and pathological data of 10 Chinese patients with biopsy-proved DDD were collected and analyzed retrospectively. The patients consisted of 6 males and 4 females. All of them had heavy proteinuria and microscopic hematuria. Gross hematuria, renal insufficiency, anemia, hypertension and low serum complement 3 (C3) occurred in 3, 3, 5, 6 and 8 cases, respectively. Under light microscopy (LM), 8 cases exhibited membranoproliferative glomerulonephritis (MPGN). Periodic acid-Schiff (PAS) stain disclosed intense PAS-positive bright ribbon-like thickening of glomerular basement membranes (GBM). Immunofluorescence mainly showed diffuse fine granular and short linear deposition of C3 along the glomerular capillary wall. Under electron microscopy, ribbon-like electrondense intramembranous deposits were identified in the lamina densa of the GBM, along the tubule basement membranes (TBM) and wall of Bowman's capsule. Before admission, 6 cases were treated with prednisone, cyclophosphamide and/or cyclosporin A with no response. Proteinuria in 8 cases who received TW during the course decreased at different degrees. The clinical and pathological features in DDD patients were various. The effect of TW in patients with DDD merits further investigation.

  6. [Resistance of uropathogenic strains of Escherichia coli in pregnant women and other women in generative ages in comparison with antibiotics consumption in Zagreb].

    Science.gov (United States)

    Culig, Josip; Mlinarić-Dzepina, Ana; Leppée, Marcel; Vranes, Jasmina

    2010-02-01

    To compare resistance of uropathogenic strains of Escherichia coli (UPEC) to antibiotics in women in generative ages and pregnant women during two year period (2004 and 2008) in Zagreb, and comparison of resistance and the consumption of antibiotics. The standard disk-diffusion method was used for sensitivity testing to 16 different antibiotics. Data on antibiotic utilization were used to calculate the number of defined daily doses (DDD) and DDD per 1000 inhabitants using Anatomical-Therapeutic-Chemical/DDD methodology. Data on antibiotic consumption during pregnancy were collected using a questionnaire filled in by 893 women after delivery. During 2004 resistance of UPEC to antimicrobial drugs was not different in pregnant and in non-pregnant women, with the exception of amoxicillin and nitrofurantoin, with statistically higher resistance in pregnant women (p drugs in Zagreb increased significantly, from 32 to 39 DDD/1000 inhabitants per day. The most used antibiotic was co-amoxiclav, and its utilization increased from 9.6 to 12.2 DDD/1000/day. Amoxicillin and co-amoxiclav were used during pregnancy by 9.6% interviewed women. The observed significant decrease of resistance to cefalexin makes that antibiotic the drug of choice for treatment of urinary tract infections in women in generative ages, and together with coamoxiclav can be administered in pregnancy. Constant monitoring of urinary tract pathogens resistance to antimicrobial agents ensures the effectiveness of empirical therapy, whose versatile use is limited due the potentially harmful effects of antimicrobial drugs on fetus.

  7. The use of antibiotics in hospitalized adult typhoid patients in an Indonesian hospital

    Directory of Open Access Journals (Sweden)

    Anggita Bunga Anggraini

    2014-08-01

    Full Text Available AbstrakLatar belakang:Demam tifoid menduduki peringkat ke tiga dari 10 besar penyakit terbanyak pada pasien rawat inap di rumah sakit (RS di Indonesia pada tahun 2010. Selain itu terdapat peningkatan resistensi dan kasus-kasus karier, dan relaps. Penelitian ini menyajikan hasil analisis data tentang penggunaan antibiotik pada pasien tifoid dewasa rawat inap di suatu RS di Indonesia. Metode: Data penelitian diekstrak dari rekam medik pasien tifoid dewasa yang dirawat inap di RS PMI Bogor periode Juli-Desember 2012. Analisis dilakukan dengan kualitatif (DU90% dan kuantitatif (DDD/shr dengan menggunakan metode ATC/DDD. Hasil: Dari 459 pasien tifoid dewasa rawat inap diperoleh DDD/shr pasien tifoid dewasa rawat inap yang menggunakan antibiotik selama dari Juli sampai Desember 2012 sebesar 6,35 DDD/shr. Seftriakson merupakan antibiotika yang dipakai tertinggi yang setara 4,10 DDD/shr, yang berarti bahwa di antara 100 pasien tifoid, 4 pasien memakai seftriakson 2 g setiap hari. Selanjutnya, obat pada segmen 10% lebih banyak dibandingkan pada segmen 90%. Di antara 26 jenis antibiotika, 7 jenis di antaranya termasuk pada segmen DU 90% yaitu seftriakson (64,54%; levofloksasin (13,90%; ciprofloksasin (3,57%; meropenem (2,80%; metronidazol (2,52%; ampisilin-sulbaktam (1,65%; dan sefditoren pivoksil (1,60%.Kesimpulan:Antibiotik seftriakson yang paling banyak digunakan pada perawatan tifoid pasien dewasa rawat inap di rumah sakit. (Health Science Indones 2014;1:40-3Kata kunci:antibiotik, tifoid, ATC/DDD, DU 90%AbstractBackground: Typhoid fever was the third ranked disease among the top 10 diseases in hospitalized patients in Indonesia in 2011. There were increased drug resistance, increased number of carrier, and number of relapse cases. This study aimed to analyze the use of antibiotics in hospitalized adult typhoid patients in a hospital in Indonesia. Methods: The data were extracted from medical records of drug use in adult typhoid patients hospitalized

  8. Increased heart rate caused by atrial pacing with the closed-loop stimulation function prevented micturition syncope

    Directory of Open Access Journals (Sweden)

    Tatsuo Haraki, MD,PhD

    2013-10-01

    Full Text Available A 70-year-old man had been experiencing syncope several times a year. We implanted a DDD pacemaker with closed-loop stimulation (CLS function. When he urinated early in the morning, his increased atrial pacing rates elevated his heart rate (HR during and after micturition. After implantation of the DDD-CLS mode, he did not experience symptoms. In contrast, in the DDD-R mode, his intrinsic HR changed to atrial pacing after micturition but decreased to the basal rate within 2 min, and he experienced a sense of cold perspiration and presyncope. Increased HRs caused by atrial pacing with the CLS function were useful in the prevention of micturition syncope.

  9. Efficacy of Management for Rational Use of Antibiotics in Surgical Departments at a Multi-Disciplinary Hospital: Results of a 7-year Pharmacoepidemiological Research.

    Science.gov (United States)

    Korableva, A A; Yudina, E V; Ziganshina, L E

    Irrational medicine use including excessive use and abuse of antibiotics remains a crucial problem for the healthcare systems. In this regard, studies examining approaches to improving the clinical use of medicines are highly important. to assess the efficacy rate of management for the rational use of antibiotics in surgical departments of a multi-disciplinary hospital. The intervention complex combined the research, educational, and methodological activities: local protocols for perioperative antibiotic prophylaxis (PABP) for various surgical departments were developed; local PABP protocols were discussed with the physicians of specialized surgical departments; official order on implementation of PABP was issued; the list of drug prescriptions for registration of the first pre-operative antibiotic dose was changed; audit and feedback processes were introduced as well as consultations of a clinical pharmacologist were implemented. We assessed the efficacy rate of the interventions basing on the changes in consumption of antibiotics (both quantitatively and qualitatively) at surgical departments of a hospital using ATC/DDD methodology. Comparison of the studied outcomes was performed before and after the intervention implementation and between the departments (vascular and abdominal surgery). The consumption of antibacterial agents (ATCJ01) was measured as a number of defined daily doses (DDD) per 100 bed-days (DDD/100 bed-days, indicator recommended by the World Health Organization, WHO) and DDD per 100 treated patients (DDD/100 treated patients). From 2006 to 2012, a decrease in antibacterial consumption in surgical departments by 188 DDD/100 treated patients was observed. We obtained the opposite results when using an indicator of DDD/100 bed-days (increase by 2.5 DDD/100 bed-days) which could be explained by the dependence on indices of overall hospital work and its changes during the examined period. Observed changes in antibacterial consumption varied in

  10. A novel multiple-stage antimalarial agent that inhibits protein synthesis

    Science.gov (United States)

    Baragaña, Beatriz; Hallyburton, Irene; Lee, Marcus C. S.; Norcross, Neil R.; Grimaldi, Raffaella; Otto, Thomas D.; Proto, William R.; Blagborough, Andrew M.; Meister, Stephan; Wirjanata, Grennady; Ruecker, Andrea; Upton, Leanna M.; Abraham, Tara S.; Almeida, Mariana J.; Pradhan, Anupam; Porzelle, Achim; Martínez, María Santos; Bolscher, Judith M.; Woodland, Andrew; Norval, Suzanne; Zuccotto, Fabio; Thomas, John; Simeons, Frederick; Stojanovski, Laste; Osuna-Cabello, Maria; Brock, Paddy M.; Churcher, Tom S.; Sala, Katarzyna A.; Zakutansky, Sara E.; Jiménez-Díaz, María Belén; Sanz, Laura Maria; Riley, Jennifer; Basak, Rajshekhar; Campbell, Michael; Avery, Vicky M.; Sauerwein, Robert W.; Dechering, Koen J.; Noviyanti, Rintis; Campo, Brice; Frearson, Julie A.; Angulo-Barturen, Iñigo; Ferrer-Bazaga, Santiago; Gamo, Francisco Javier; Wyatt, Paul G.; Leroy, Didier; Siegl, Peter; Delves, Michael J.; Kyle, Dennis E.; Wittlin, Sergio; Marfurt, Jutta; Price, Ric N.; Sinden, Robert E.; Winzeler, Elizabeth A.; Charman, Susan A.; Bebrevska, Lidiya; Gray, David W.; Campbell, Simon; Fairlamb, Alan H.; Willis, Paul A.; Rayner, Julian C.; Fidock, David A.; Read, Kevin D.; Gilbert, Ian H.

    2015-06-01

    There is an urgent need for new drugs to treat malaria, with broad therapeutic potential and novel modes of action, to widen the scope of treatment and to overcome emerging drug resistance. Here we describe the discovery of DDD107498, a compound with a potent and novel spectrum of antimalarial activity against multiple life-cycle stages of the Plasmodium parasite, with good pharmacokinetic properties and an acceptable safety profile. DDD107498 demonstrates potential to address a variety of clinical needs, including single-dose treatment, transmission blocking and chemoprotection. DDD107498 was developed from a screening programme against blood-stage malaria parasites; its molecular target has been identified as translation elongation factor 2 (eEF2), which is responsible for the GTP-dependent translocation of the ribosome along messenger RNA, and is essential for protein synthesis. This discovery of eEF2 as a viable antimalarial drug target opens up new possibilities for drug discovery.

  11. Widespread increase of empirical carbapenem use in acute care hospitals in Catalonia, Spain.

    Science.gov (United States)

    Grau, Santiago; Fondevilla, Esther; Echeverría-Esnal, Daniel; Alcorta, Amaia; Limon, Enric; Gudiol, Francesc

    2018-04-24

    The overall increase in the use of carbapenems could lead to the selection of carbapenem-resistant bacteria. The objectives of this study were to analyze carbapenem use from 2008 to 2015 and their prescription profile in 58 hospitals affiliated to the VINCat Programme (nosocomial infection vigilance system). Retrospective, longitudinal and descriptive study of carbapenem use. Consecutive case-series study, looking for carbapenem prescription characteristics, conducted in January 2016. Use was calculated in defined daily doses (DDD)/100 patient-days (PD); prescription profiles were assessed using a standardized survey. Carbapenem use increased 88.43%, from 3.37 DDD/100-PD to 6.35 DDD/100-PD (pCatalonia. Stewardship interventions are required to prevent carbapenem overuse. Copyright © 2018 Elsevier España, S.L.U. and Sociedad Española de Enfermedades Infecciosas y Microbiología Clínica. All rights reserved.

  12. Medication usage in Majuro, Marshall Islands.

    Science.gov (United States)

    Harding, Andrew

    2005-03-01

    To conduct a drug utilisation study to determine the top 50 drugs by prescription count, top 50 drugs by cost to government and the top 30 drugs by consumption for Majuro Atoll, Marshall Islands for the year 2003. Data was collected from the Majuro Hospital computer dispensing system. All outpatient prescriptions dispensed in the year 2003 were included. The defined daily dose (DDD) methodology was employed. Drug consumption was presented as DDD/1000 population/day. The top 5 drugs by consumption in Majuro for 2003 were glibenclamide (glyburide), enalapril, ferrous sulphate, amoxycillin and ascorbic acid. Values for the DDD/1000 population/day were on average lower than many other countries. This is the first local study of medication usage in the Marshall Islands. It provided some useful baseline data.

  13. The generation and functional characterization of induced pluripotent stem cells from human intervertebral disc nucleus pulposus cells.

    Science.gov (United States)

    Zhu, Yanxia; Liang, Yuhong; Zhu, Hongxia; Lian, Cuihong; Wang, Liang; Wang, Yiwei; Gu, Hongsheng; Zhou, Guangqian; Yu, Xiaoping

    2017-06-27

    Disc degenerative disease (DDD) is believed to originate in the nucleus pulposus (NP) region therefore, it is important to obtain a greater number of active NP cells for the study and therapy of DDD. Human induced pluripotent stem cells (iPSCs) are a powerful tool for modeling the development of DDD in humans, and have the potential to be applied in regenerative medicine. NP cells were isolated from DDD patients following our improved method, and then the primary NP cells were reprogramed into iPSCs with Sendai virus vectors encoding 4 factors. Successful reprogramming of iPSCs was verified by the expression of surface markers and presence of teratoma. Differentiation of iPSCs into NP-like cells was performed in a culture plate or in hydrogel, whereby skin fibroblast derived-iPSCs were used as a control. Results demonstrated that iPSCs derived from NP cells displayed a normal karyotype, expressed pluripotency markers, and formed teratoma in nude mice. NP induction of iPSCs resulted in the expression of NP cell specific matrix proteins and related genes. Non-induced NP derived-iPSCs also showed some NP-like phenotype. Furthermore, NP-derived iPSCs differentiate much better in hydrogel than that in a culture plate. This is a novel method for the generation of iPSCs from NP cells of DDD patients, and we have successfully differentiated these iPSCs into NP-like cells in hydrogel. This method provides a novel treatment of DDD by using patient-specific NP cells in a relatively simple and straightforward manner.

  14. Coronary grafts flow and cardiac pacing modalities: how to improve perioperative myocardial perfusion.

    LENUS (Irish Health Repository)

    D'Ancona, Giuseppe

    2012-02-03

    OBJECTIVE: Aim of this study was to investigate modifications of coronary grafts flow during different pacing modalities after CABG. MATERIALS AND METHODS: Two separate prospective studies were conducted in patients undergoing CABG and requiring intraoperative epicardial pacing. In a first study (22 patients) coronary grafts flows were measured during dual chamber pacing (DDD) and during ventricular pacing (VVI). In a second study (10 patients) flows were measured during DDD pacing at different atrio-ventricular (A-V) delay periods. A-V delay was adjusted in 25 ms increments from 25 to 250 ms and flow measurements were performed for each A-V delay increment. A transit time flowmeter was used for the measurements. RESULTS: An average of 3.4 grafts\\/patient were performed. In the first study, average coronary graft flow was 47.4+\\/-20.8 ml\\/min during DDD pacing and 41.8+\\/-18.2 ml\\/min during VVI pacing (P = 0.0004). Furthermore average systolic pressure was 94.3+\\/-10.1 mmHg during DDD pacing and 89.6+\\/-12.2 mmHg during VVV pacing (P = 0.0007). No significant differences in diastolic pressure were recorded during the two different pacing modalities. In the second study, maximal flows were achieved during DDD pacing with an A-V delay of 175 ms (54+\\/-9.6 ml\\/min) and minimal flows were detected at 25 ms A-V delay (38.1+\\/-4.7 ml\\/min) (P=ns). No significant differences in systolic or diastolic blood pressure were noticed during the different A-V delays. CONCLUSION: Grafts flowmetry provides an extra tool to direct supportive measures such as cardiac pacing after CABG. DDD mode with A-V delay around 175 ms. should be preferred to allow for maximal myocardial perfusion via the grafts.

  15. [Evaluation of antimicrobial consumption en 15 Chilean hospitals: Results of a collaborative work, 2013].

    Science.gov (United States)

    Domínguez, Isabel; Rosales, Ruth; Cabello, Ángela; Bavestrello, Luis; Labarca, Jaime

    2016-06-01

    Surveillance of antimicrobial consumption is a central part in programs of antibiotic stewardship. However, in Chile there are no national data on antibiotic consumption representing a significant number of hospitals by clinical services. In 2013 a survey was sent to multiple Chilean hospitals to evaluate antimicrobial consumption in medical services (MS), surgery services (SS) and critical care units (ICU). We used the standardized methodology recommended by the WHO, using the number of DDD/100 days beds. In the MS and SS beta-lactam and no beta-lactam antibiotics commonly used were evaluated. In the ICU consumption vancomycin, linezolid, imipenem, merope-nem, colistin and tigecycline was evaluated. Fifteen hospitals reported the density of antimicrobial consumption. Ceftriaxone and cloxacillin were the most commonly used antibiotics in general services (average cloxacillin 4,9 DDD/100 bed days in MS and 8,0 DDD/100 in SS; ceftriaxone 13,5 DDD/100 in MS and 16,7 DDD/100 in SS). In the SS there was also a significant consumption of metronidazole (average 14,5 DDD/100 bed days). In the ICU there was an important variability of consumption of selected antibiotics. This study reports the average and range of antibiotic consumption in MS, SS, and ICU from a significant number of hospitals in the country, during 2013. This information allows hospitals to compare their consumption of antibiotics with a significant sample of Chilean hospitals. Analysis of this information should consider a careful interpretation according to the sample shown here and the reality of each hospital.

  16. Factors influencing anti-asthmatic generic drug consumption in Morocco: 1999-2010.

    Science.gov (United States)

    Ghanname, Imane; Ahid, Samir; Berrada, Ghizlane; Belaiche, Abdelmjid; Hassar, Mohammed; Cherrah, Yahia

    2014-01-01

    The increasing availability of generic drugs (GD) resulted in a remarkable reduction in treatment costs that allowed a better access to health care.The aim of this study is to evaluate the share of anti-asthmatic generic drugs during the period 1999-2010 in Morocco and to look at the factors influencing generic development. In this study, we used Moroccan sales data from IMS Health (Intercontinental Marketing Services). The consumption of the drugs was expressed in DDD/1000 inhabitants/day according to the WHO ATC/DDD methodology. Between 1999 and 2010, anti-asthmatic consumption increased from 3.91 to 14.43 DDD/1000 inhabitants/day. The market of anti-asthmatic generic drugs progressed from 1.83 (47%) to 2.18 (23%) DDD/1000 inhabitants/day from 1999 to 2010. In 2010, inhaled glucocorticosteroids ranked first (0.83 DDD/1000 inhabitants/day), followed by inhaled short acting beta agonists (0.73 DDD/1000 inhabitants/day). The number of brands went from 27 in 1999 to 34 in 2010, with a generic share increasing from 55.55% to 70.59%. The number of anti-asthmatic pharmaceutical preparations increased from 57 to 64 during the same period, of which 31 and 42 were generic preparations. In 2010, the total cost of anti-asthmatic dugs was about 22 million euro, the generics representing 14 million euro. Despite the introduction of a compulsory insurance scheme called "AMO", that allows a refund for 69.5% of anti-asthmatic specialties marketed in Morocco, anti-asthmatic generic drug consumption remains limited. The Moroccan market is still largely dominated by the originator drugs with still valid patents.

  17. A critique of the molecular target-based drug discovery paradigm based on principles of metabolic control: advantages of pathway-based discovery.

    Science.gov (United States)

    Hellerstein, Marc K

    2008-01-01

    Contemporary drug discovery and development (DDD) is dominated by a molecular target-based paradigm. Molecular targets that are potentially important in disease are physically characterized; chemical entities that interact with these targets are identified by ex vivo high-throughput screening assays, and optimized lead compounds enter testing as drugs. Contrary to highly publicized claims, the ascendance of this approach has in fact resulted in the lowest rate of new drug approvals in a generation. The primary explanation for low rates of new drugs is attrition, or the failure of candidates identified by molecular target-based methods to advance successfully through the DDD process. In this essay, I advance the thesis that this failure was predictable, based on modern principles of metabolic control that have emerged and been applied most forcefully in the field of metabolic engineering. These principles, such as the robustness of flux distributions, address connectivity relationships in complex metabolic networks and make it unlikely a priori that modulating most molecular targets will have predictable, beneficial functional outcomes. These same principles also suggest, however, that unexpected therapeutic actions will be common for agents that have any effect (i.e., that complexity can be exploited therapeutically). A potential operational solution (pathway-based DDD), based on observability rather than predictability, is described, focusing on emergent properties of key metabolic pathways in vivo. Recent examples of pathway-based DDD are described. In summary, the molecular target-based DDD paradigm is built on a naïve and misleading model of biologic control and is not heuristically adequate for advancing the mission of modern therapeutics. New approaches that take account of and are built on principles described by metabolic engineers are needed for the next generation of DDD.

  18. Pitfalls associated with the therapeutic reference pricing practice of asthma medication.

    Science.gov (United States)

    Kalo, Zoltan; Abonyi-Toth, Zsolt; Bartfai, Zoltan; Voko, Zoltan

    2012-07-20

    Therapeutic reference pricing (TRP) based on the WHO daily defined dose (DDD) is a method frequently employed for the cost-containment of pharmaceuticals. Our objective was to compare average drug use in the real world with DDD and to evaluate whether TRP based on DDD could result in cost savings on maintenance medication and the total direct health expenditures for asthma patients treated with Symbicort Turbuhaler (SYT) and Seretide Diskus (SED) in Hungary. Real-world data were derived from the Hungarian National Health Insurance Fund database. Average doses and costs were compared between the high-dose and medium-dose SYT and SED groups. Multiple linear regressions were employed to adjust the data for differences in the gender and age distribution of patients. 27,779 patients with asthma were included in the analysis. Average drug use was lower than DDD in all groups, 1.38-1.95 inhalations in both SED groups, 1.28-1.97 and 1.74-2.49 inhalations in the medium and high-dose SYT groups, respectively. Although the cost of SED based on the DDD would be much lower than the cost of SYT in the medium-dose groups, no difference was found in the actual cost of the maintenance therapy. No significant differences were found between the groups in terms of total medical costs. Cost-containment initiatives by payers may influence clinical decisions. TRP for inhalation asthma drugs raises special concern, because of differences in the therapeutic profile of pharmaceuticals and the lack of proven financial benefits after exclusion of the effect of generic price erosion. Our findings indicate that the presented TRP approach of asthma medications based on the daily therapeutic costs according to the WHO DDD does not result in reduced public healthcare spending in Hungary. Further analysis is required to show whether TRP generates additional expenditures by inducing switching costs and reducing patient compliance. Potential confounding factors may limit the generalisability of our

  19. Use of antibacterial agents in an intensive care unit in a hospital in Brazil.

    Science.gov (United States)

    dos Santos, E F; Lauria-Pires, L; Pereira, M G; Silva, A E; Rodrigues, I P; Maia, M O

    2007-06-01

    It is essential to monitor the utilisation of antibacterial drugs in order to establish appropriate measures for their control. The pattern of usage of antibacterial drugs, and its association with indicators of hospital infection, has been investigated in a non-specialized adult intensive care unit (ICU) located in Santa Luzia Hospital (Brasília, DF, Brazil). The study was conducted between January 2001 and June 2004. Data concerning the utilisation of systemic antibacterial drugs, classified according to the Anatomical Therapeutic Chemical/Defined Daily Dose (ATC/DDD) system, and indicators of hospital infection, defined according to the National Nosocomial Infections Surveillance (NNIS) system, were obtained from appropriate hospital archives. During the study period, the average utilisation of antibacterial drugs was 1918.5 DDD units per 1000 patient-day (DDD(1000)). The three most used drugs were penicillins/beta-lactamase inhibitors (535.3 DDD(1000)), third generation cephalosporins (239.1 DDD(1000)) and quinolones (212.5 DDD(1000)). The total utilisation of antibacterial drugs was correlated significantly with the incidence of hospital infection (R = 0.62; p < 0.01) and the index of invasive procedures (R = 0.41; p < 0.01). Furthermore, the latter two indicators were significantly and positively correlated with the use of recently commercialized, broad spectrum antibacterial drugs (except for carbapenems). It is concluded that improved infection control procedures, together with more rigorous criteria regarding the use of invasive procedures, should be implemented by the ICU studied in order to diminish the utilisation of antibacterial drugs.

  20. Detection of DDT and its metabolites in two estuaries of South China using a SPME-based device: First report of p,p'-DDMU in water column

    International Nuclear Information System (INIS)

    Xing Yuanna; Guo Ying; Xie Mei; Shen Rulang; Zeng, Eddy Y.

    2009-01-01

    A solid-phase microextration-based sampling method was employed to determine the concentrations of 1,1,1-trichloro-2,2-bis(p-chlorophenyl)ethane (DDT) and its metabolites, 1,1-dichloro-2,2-bis(p-chlorophenyl)ethane (DDD), 1,1-dichloro-2,2-bis(p-chlorophenyl)ethene (DDE) and 1-chloro-2,2-bis(p-chlorophenyl)ethene (DDMU), in two estuarine bays, Daya Bay and Hailing Bay, of South China. Six DDT components including p,p'-DDT, o,p'-DDD, p,p'-DDD, o,p'-DDE, p,p'-DDE, and p,p'-DDMU were detected in Hailing Bay, while only p,p'-DDD was found in Daya Bay. p,p'-DDD was the most abundant DDT component in both bays, sharply different from the previous finding in the water column of the Palos Verdes Shelf, California, USA that p,p'-DDE was prevalent. In addition, the occurrence of p,p'-DDMU (with a range of 0.047-0.21 ng/L in Hailing Bay) has not been reported around the globe, and its presence in our study region appeared to stem from dehydrochlorination of p,p'-DDD, favored under aerobic conditions, but further investigations are clearly needed to confirm the mechanism for generation of DDMU in estuarine environments. - DDT and its metabolites, particularly p,p'-DDMU, are detected in the water column of two estuarine bays in South China using a SPME-based sampler

  1. Characterization of a direct detection device imaging camera for transmission electron microscopy

    Energy Technology Data Exchange (ETDEWEB)

    Milazzo, Anna-Clare, E-mail: amilazzo@ncmir.ucsd.edu [University of California at San Diego, 9500 Gilman Dr., La Jolla, CA 92093 (United States); Moldovan, Grigore [Department of Materials, University of Oxford, Parks Road, Oxford OX1 3PH (United Kingdom); Lanman, Jason [Department of Molecular Biology, The Scripps Research Institute, La Jolla, CA 92037 (United States); Jin, Liang; Bouwer, James C. [University of California at San Diego, 9500 Gilman Dr., La Jolla, CA 92093 (United States); Klienfelder, Stuart [University of California at Irvine, Irvine, CA 92697 (United States); Peltier, Steven T.; Ellisman, Mark H. [University of California at San Diego, 9500 Gilman Dr., La Jolla, CA 92093 (United States); Kirkland, Angus I. [Department of Materials, University of Oxford, Parks Road, Oxford OX1 3PH (United Kingdom); Xuong, Nguyen-Huu [University of California at San Diego, 9500 Gilman Dr., La Jolla, CA 92093 (United States)

    2010-06-15

    The complete characterization of a novel direct detection device (DDD) camera for transmission electron microscopy is reported, for the first time at primary electron energies of 120 and 200 keV. Unlike a standard charge coupled device (CCD) camera, this device does not require a scintillator. The DDD transfers signal up to 65 lines/mm providing the basis for a high-performance platform for a new generation of wide field-of-view high-resolution cameras. An image of a thin section of virus particles is presented to illustrate the substantially improved performance of this sensor over current indirectly coupled CCD cameras.

  2. Characterization of a direct detection device imaging camera for transmission electron microscopy

    International Nuclear Information System (INIS)

    Milazzo, Anna-Clare; Moldovan, Grigore; Lanman, Jason; Jin, Liang; Bouwer, James C.; Klienfelder, Stuart; Peltier, Steven T.; Ellisman, Mark H.; Kirkland, Angus I.; Xuong, Nguyen-Huu

    2010-01-01

    The complete characterization of a novel direct detection device (DDD) camera for transmission electron microscopy is reported, for the first time at primary electron energies of 120 and 200 keV. Unlike a standard charge coupled device (CCD) camera, this device does not require a scintillator. The DDD transfers signal up to 65 lines/mm providing the basis for a high-performance platform for a new generation of wide field-of-view high-resolution cameras. An image of a thin section of virus particles is presented to illustrate the substantially improved performance of this sensor over current indirectly coupled CCD cameras.

  3. Recent Progress in Discrete Dislocation Dynamics and Its Applications to Micro Plasticity

    KAUST Repository

    Po, Giacomo; Mohamed, Mamdouh S.; Crosby, Tamer; Erel, Can; El-Azab, Anter; Ghoniem, Nasr

    2014-01-01

    We present a self-contained review of the discrete dislocation dynamics (DDD) method for the numerical investigation of plasticity in crystals, focusing on recent development and implementation progress. The review covers the theoretical foundations of DDD within the framework of incompatible elasticity, its numerical implementation via the nodal method, the extension of the method to finite domains and several implementation details. Applications of the method to current topics in micro-plasticity are presented, including the size effects in nano-indentation, the evolution of the dislocation microstructure in persistent slip bands, and the phenomenon of dislocation avalanches in micro-pillar compression.

  4. Estimation of flow stress of radiation induced F/M steels using molecular dynamics and discrete dislocation dynamics approach

    International Nuclear Information System (INIS)

    More, Ameya; Dutta, B.K.; Durgaprasad, P.V.; Arya, A.K.

    2012-01-01

    Fe-Cr based Ferritic/Martensitic (F/M) steels are the candidate structural materials for future fusion reactors. In this work, a multi-scale approach comprising atomistic Molecular Dynamics (MD) simulations and Discrete Dislocation Dynamics (DDD) simulations are used to model the effect of irradiation dose on the flow stress of F/M steels. At the atomic scale, molecular dynamics simulations are used to study the dislocation interaction with irradiation induced defects, i.e. voids and He bubbles. Whereas, the DDD simulations are used to estimate the change in flow stress of the material as a result of irradiation hardening. (author)

  5. V. Tormis: "Bridge of Song / Brian Hunt

    Index Scriptorium Estoniae

    Hunt, Brian

    1997-01-01

    Uuest heliplaadist "V. Tormis: "Bridge of Song" - Bridge of Song; Singing aboard ship; Brides Farewell; Kihnu Island Wedding Songs; 17 Estonian Wedding Songs; Three Estonian Game Songs; Four Estonian Lullabies. Estonian Radio Choir / Toomas Kapten. Finlandia 4509 96937-2; 56:52 DDD; "People of Kalevala" - God protect us from war; Vespian Winter; Eagle Flew From the North East; Plague Memory; Vainamoinen's Words of Wisdom; The Seventeenth Rune of Kalevala. National Male Choir of Estonia. Finlandia 0630 12245-2; 56:52 DDD

  6. Distribution and trends in outpatient utilization of generic versus brand name psychopharmaceuticals during a ten-year period in Croatia.

    Science.gov (United States)

    Polić-ViŽintin, Marina; Stimac, Danijela; Sostar, Zvonimir; Tripković, Ingrid

    2014-08-15

    Drug costs increasingly pose a burden upon the otherwise inadequate health care resources and rational drug utilization is an important segment of every national health policy. Optimal patient care should be the goal of rational pharmacotherapy, whereby the economic burden of treatment is just one of the elements to be considered on choosing appropriate therapy.The aim of this study was to determine distribution and trends in the outpatient utilization of generic versus brand name psychopharmaceuticals and to evaluate the rationality of prescribing psychopharmaceuticals during a ten-year period. Using the World Health Organization Anatomical-Therapeutic-Chemical classification/Defined Daily Doses (ATC/DDD) methodology, the number of DDD was calculated from data collected from pharmacies on the number and size of drug packages. The ratio of generic and brand name drug costs served as an indicator on assessing the rationality of drug utilization. Total cost for psychopharmaceuticals increased by 20.1%, more for brand name than for generic agents (32.7% vs. 7.4%). The highest share of generic psychopharmaceuticals as compared with brand name drugs according to DDD per 1000 inhabitants per day (DDD/1000/day) was in the group of psycholeptics (83.6% in 2001 vs. 82.2% in 2010), most in hypnotics and sedatives, and least in antipsychotics. The share of generic psychopharmaceuticals in total drug utilization according to financial indicators decreased by 9.6% and according to DDD/1000/day by 12%. The greatest decrease was in antidepressants, i.e. by 33.8% according to financial indicators and by 46% according to DDD/1000/day; and in antipsychotics by 30.9% according to DDD/1000/day, while showing an increase by 8.5% according to financial indicators. In the therapeutic subgroup of mood stabilizers, the share of generic drugs in total drug utilization declined by 32% according to DDD/1000/day, but increased by 25.1% according to financial indicators. The lack of uniform

  7. Recent Progress in Discrete Dislocation Dynamics and Its Applications to Micro Plasticity

    KAUST Repository

    Po, Giacomo

    2014-09-27

    We present a self-contained review of the discrete dislocation dynamics (DDD) method for the numerical investigation of plasticity in crystals, focusing on recent development and implementation progress. The review covers the theoretical foundations of DDD within the framework of incompatible elasticity, its numerical implementation via the nodal method, the extension of the method to finite domains and several implementation details. Applications of the method to current topics in micro-plasticity are presented, including the size effects in nano-indentation, the evolution of the dislocation microstructure in persistent slip bands, and the phenomenon of dislocation avalanches in micro-pillar compression.

  8. Impact of over-the-counter restrictions on antibiotic consumption in Brazil and Mexico.

    Directory of Open Access Journals (Sweden)

    Yared Santa-Ana-Tellez

    Full Text Available BACKGROUND: In Latin American countries over-the-counter (OTC dispensing of antibiotics is common. In 2010, both Mexico and Brazil implemented policies to enforce existing laws of restricting consumption of antibiotics only to patients presenting a prescription. The objective of the present study is therefore to evaluate the impact of OTC restrictions (2010 on antibiotics consumption in Brazil and Mexico. METHODS AND FINDINGS: Retail quarterly sales data in kilograms of oral and injectable antibiotics between January 2007 and June 2012 for Brazil and Mexico were obtained from IMS Health. The unit of analysis for antibiotics consumption was the defined daily dose per 1,000 inhabitants per day (DDD/TID according to the WHO ATC classification system. Interrupted time series analysis was conducted using antihypertensives as reference group to account for changes occurring independently of the OTC restrictions directed at antibiotics. To reduce the effect of (a seasonality and (b autocorrelation, dummy variables and Prais-Winsten regression were used respectively. Between 2007 and 2012 total antibiotic usage increased in Brazil (from 5.7 to 8.5 DDD/TID, +49.3% and decreased in Mexico (10.5 to 7.5 DDD/TID, -29.2%. Interrupted time series analysis showed a change in level of consumption of -1.35 DDD/TID (p<0.01 for Brazil and -1.17 DDD/TID (p<0.00 for Mexico. In Brazil the penicillins, sulfonamides and macrolides consumption had a decrease in level after the intervention of 0.64 DDD/TID (p = 0.02, 0.41 (p = 0.02 and 0.47 (p = 0.01 respectively. While in Mexico it was found that only penicillins and sulfonamides had significant changes in level of -0.86 DDD/TID (p<0.00 and -0.17 DDD/TID (p = 0.07. CONCLUSIONS: Despite different overall usage patterns of antibiotics in Brazil and Mexico, the effect of the OTC restrictions on antibiotics usage was similar. In Brazil the trend of increased usage of antibiotics was tempered after the OTC restrictions; in

  9. Correlation of radiographic and MRI parameters to morphological and biochemical assessment of intervertebral disc degeneration

    OpenAIRE

    Benneker, Lorin M.; Heini, Paul F.; Anderson, Suzanne E.; Alini, Mauro; Ito, Keita

    2004-01-01

    Degenerative disc disease (DDD) is a common finding in MRI scans and X-rays. However, their correlation to morphological and biochemical changes is not well established. In this study, radiological and MRI parameters of DDD were assessed and compared with morphological and biochemical findings of disc degeneration. Thirty-nine human lumbar discs (L1–S1), age 19–86 years, were harvested from eight cadavers. Within 48 h postmortem, MRIs in various spin-echo sequences and biplanar radiographs of...

  10. Oxidation of 5,6-diamino-1,3-dimethyl-2,4-dioxopyrimidine by perrhenate: the crystal structure of 1,3,6,8-tetramethylpyrimidopteridine-2,4,5,7-tetrone

    International Nuclear Information System (INIS)

    Booysen, Irvin; Gerber, Thomas I.A.; Mayer, Peter

    2008-01-01

    The oxidation of 5,6-diamino-1,3-dimethyl-2,4-dioxopyrimidine (H 2 ddd) by perrhenate (ReO 4 - ) led to the formation of 1,3-dimethylalloxan, which condenses with unoxidized H 2 ddd to yield the product 1,3,6,8-tetramethylpyrimidopteridine-2,4,5,7-tetrone (tppt). The structure of tppt consists of a central pyrazine ring and two terminal pyrimidine rings in cis positions. The dihedral angles between the pyrazine and pyrimidine rings are 1.08 deg and 1.20 deg. (author)

  11. Shostakovich: Six Romances on Japanese Poems, Op. 21 / David Nice

    Index Scriptorium Estoniae

    Nice, David

    1996-01-01

    Uuest heliplaadist "Shostakovich: Six Romances on Japanese Poems, Op. 21. Six Poems of Marina Tsvetayeva, Op. 143. Suite on Verses of Michelangelo, Op. 145. Gothenburg Symphony Orchestra, Neeme Järvi. DG 447 085-2GH (71 minutes:DDD)

  12. Searching for Roots. Pärt: Symphony No. 1, "Polyphonic" / Guy S. Rickards

    Index Scriptorium Estoniae

    Rickards, Guy S.

    1997-01-01

    Uuest heliplaadist "Searching for Roots. Pärt: Symphony No. 1, "Polyphonic". Nekrolog, Op. 3; Tubin: Symphony No. 11; Tüür: Searching for Roots. Insula deserta. Zeitraum. Royal Stockholm Philharmonic Orchestra / Paavo Järvi. Virgin Classics VC5 45212-2 (72 min.:DDD)

  13. Tubin: Sinfonie nr. 11 (ergänzt von Kaljo Raid) / Christoph Schlüren

    Index Scriptorium Estoniae

    Schlüren, Christoph

    1997-01-01

    Uuest heliplaadist "Tubin: Sinfonie nr. 11 (ergänzt von Kaljo Raid); Pärt: Nekrolog op. 5, Sinfonie nr. 1; Tüür: Searching for Roots, Insula deserta, Zeitraum. Königliches Philharmonisches Orchester Stockholm, Paavo Järvi". Virgin/EMI CD 5 45212 2 (WD:71'34") DDD

  14. Institutional profile: the national Swedish academic drug discovery & development platform at SciLifeLab.

    Science.gov (United States)

    Arvidsson, Per I; Sandberg, Kristian; Sakariassen, Kjell S

    2017-06-01

    The Science for Life Laboratory Drug Discovery and Development Platform (SciLifeLab DDD) was established in Stockholm and Uppsala, Sweden, in 2014. It is one of ten platforms of the Swedish national SciLifeLab which support projects run by Swedish academic researchers with large-scale technologies for molecular biosciences with a focus on health and environment. SciLifeLab was created by the coordinated effort of four universities in Stockholm and Uppsala: Stockholm University, Karolinska Institutet, KTH Royal Institute of Technology and Uppsala University, and has recently expanded to other Swedish university locations. The primary goal of the SciLifeLab DDD is to support selected academic discovery and development research projects with tools and resources to discover novel lead therapeutics, either molecules or human antibodies. Intellectual property developed with the help of SciLifeLab DDD is wholly owned by the academic research group. The bulk of SciLifeLab DDD's research and service activities are funded from the Swedish state, with only consumables paid by the academic research group through individual grants.

  15. Schostakowitsch. Orchesterlieder (Vol. 2), Neeme Järvi / Werner Pfister

    Index Scriptorium Estoniae

    Pfister, Werner

    1996-01-01

    Uuest heliplaadist "Schostakowitsch. Orchesterlieder (Vol. 2): Sechs Romanzen op. 21, Sechs Gedichte op. 143a, Suite auf Verse von Michelangelo Buonarroti op. 145a. Göteborger Sinfoniker, Neeme Järvi". DG CD 447 085-2 (WD: 71'06") DDD

  16. Clinical features, diagnosis, treatment and molecular studies in paediatric Cushing's syndrome due to primary nodular adrenocortical hyperplasia

    DEFF Research Database (Denmark)

    Storr, Helen L; Mitchell, J H; Swords, F M

    2004-01-01

    0.2-0.8 years) from diagnosis. Hypercortisolaemia was treated preoperatively by metyrapone alone 0.50-0.75 g/day (n = 4), metyrapone 0.75-1.50 g/day + o'p'DDD/mitotane 1-2 g/day (n = 1), or ketoconazole (n = 1). Adrenal histology showed nodular cortical hyperplasia with shrinkage of intervening...

  17. Original Article

    African Journals Online (AJOL)

    Arab Journal of Nephrology and Transplantation. 2013 Sep;6(3):153-60. Original Article. AJNT. Abstract. Introduction: Dense Deposit Disease (DDD) is a devastating renal disease that leads to renal failure within. 10 years of diagnosis in about half of affected patients. In this study, we evaluated the relative prevalence and.

  18. Sibelius. Lemminkäinen-Legenden op. 22 Nr. 1-4 / Christoph Schlüren

    Index Scriptorium Estoniae

    Schlüren, Christoph

    1997-01-01

    Uuest heliplaadist "Sibelius: Lemminkäinen-Legenden op. 22 Nr. 1-4, Nächtlicher Ritt und Sonnenaufgang op. 55, Luonnotar op. 70. Stockholm Philharmoniker / Paavo Järvi. Virgin/EMI CD 545213 2 (WD:70'22")DDD

  19. Biotransformation of dichlorodiphenyltrichloroethane in the benthic polychaete, Nereis succinea: quantitative estimation by analyzing the partitioning of chemicals between gut fluid and lipid.

    Science.gov (United States)

    Wang, Fei; Pei, Yuan-yuan; You, Jing

    2015-02-01

    Biotransformation plays an important role in the bioaccumulation and toxicity of a chemical in biota. Dichlorodiphenyltrichloroethane (DDT) commonly co-occurs with its metabolites (dichlorodiphenyldichloroethane [DDD] and dichlorodiphenyldichloroethylene [DDE]), in the environment; thus it is a challenge to accurately quantify the biotransformation rates of DDT and distinguish the sources of the accumulated metabolites in an organism. The present study describes a method developed to quantitatively analyze the biotransformation of p,p'-DDT in the benthic polychaete, Nereis succinea. The lugworms were exposed to sediments spiked with DDT at various concentrations for 28 d. Degradation of DDT to DDD and DDE occurred in sediments during the aging period, and approximately two-thirds of the DDT remained in the sediment. To calculate the biotransformation rates, residues of individual compounds measured in the bioaccumulation testing (after biotransformation) were compared with residues predicted by analyzing the partitioning of the parent and metabolite compounds between gut fluid and tissue lipid (before biotransformation). The results suggest that sediment ingestion rates decreased when DDT concentrations in sediment increased. Extensive biotransformation of DDT occurred in N. succinea, with 86% of DDT being metabolized to DDD and biotransformation, and the remaining 30% was from direct uptake of sediment-associated DDD. In addition, the biotransformation was not dependent on bulk sediment concentrations, but rather on bioaccessible concentrations of the chemicals in sediment, which were quantified by gut fluid extraction. The newly established method improved the accuracy of prediction of the bioaccumulation and toxicity of DDTs. © 2014 SETAC.

  20. Drug usage by outpatients in Croatia during an 8-year period: Influence of changes in pricing policy.

    Science.gov (United States)

    Vitezic, Dinko; Madjarevic, Tomislav; Gantumur, Monja; Buble, Tonci; Vitezic, Miomira; Kovacevic, Miljenko; Mrsic-Pelcic, Jasenka; Sestan, Branko

    2012-07-01

    The aim of our study was to investigate the changes in drug usage and financial expenditure according to legal changes in Croatia during the period 2001 - 2008, especially considering pricing policy. The data on outpatient drug usage during the studied period was obtained from the Croatian National Health Insurance (CNHI). CNHI maintains a database on drugs prescribed by primary health care physicians and dispensed by pharmacies. The data was calculated and presented in defined daily doses (DDD) per inhabitant per year for antibiotics and in DDD/1,000 inhabitants/day for other drugs. The data is also presented in Euro/DDD and the financial expenditures are presented in Euros. During the investigated period drug usage increased 81.33%, while financial expenditure increased 77.23%. While total DDD/1,000 increased ~ 10% every year, financial expenditure increased 10 - 20% annually until 2006, but since then there have been no significant changes. Pricing policy changes could influence drug financial expenditure considerably in the short-term, but it is also important to apply a combination of measures for drug expenditure control. Numerous interventions from authorities from different countries all over the world, prove that there is still no so called "gold standard" which could restrain growing usage and expenditure of drugs. Clinical pharmacologists and clinical pharmacists should be included in these processes.

  1. [The outpatient use of beta lactam antibiotics in Montenegro before the introduction of new reform strategy on drug market].

    Science.gov (United States)

    Duborija-Kovacević, Natasa

    2006-01-01

    The study represents the first investigation of outpatient use of beta lactam antibiotics in Montenegro carried out in accordance with internationally approved methodology (DDD/ATC). The objective of our study was to establish both the scope and overall use of beta lactam antibiotics, and to assess their compatibility with current pharmacotherapeutic guidelines and their use in developed countries. The retrospective pharmaco-epidemiological study comprised a 100%-sample of beta lactams that were used in the period prior to introduction of new reform strategy on drug market. Beta lactam antibiotics (J01C, J01D) were the most frequently applied anti-infectives for systemic use (ATC group J) in 2000 (11.3 DDD/1000 inh./day, 61%). Penicillins (J01C) were the most utilized (8.0 DDD/1000 inh./day, 71%). Cephalosporin derivatives (cephalexin and cefaclor) accounted for the remaining 29% (3.3 DDD/1000 inh./day). Aminopenicillins were prevailing among penicillins (85%). Beta lactamase sensitive penicillins were in the second place and approximately accounted for 14%. The results of our study showed that the use of beta lactam antibacterials could be estimated as partially satisfactory. There is a need to make additional efforts with a view of further rationalization.

  2. Cost-minimization analysis of antimicrobial therapy in a tertiary ...

    African Journals Online (AJOL)

    The mean cost per defined daily dosage (DDD) of generic and branded for each antibacterial was computed. These were compared using Student's t-test. The outcome measure was potential eradication of bacterial in question by the respective antibacterial drug. The analyses showed that the use of expensive branded ...

  3. Stem-cell treatment in disc degeneration: What is the evidence?

    Directory of Open Access Journals (Sweden)

    Manuela Peletti-Figueiró

    2013-01-01

    Full Text Available To review the potential role of stem cells in treating degenerative disc disease of the intervertebral disc (IVD. A review was performed of articles from the Medline database concerning stem cells and degenerative disc disease (DDD. To discuss the data, the papers were classified as: review, in vitro, experimental, and clinical. The currently available treatments were basically for symptom reduction, not to revert the IVD degenerative process. The use of mesenchymal stem cells (MSC is being proposed as an option of treatment for DDD. In vitro studies have shown that the MSC are able to differentiate into NP cells and that the MSC also reduce the inflammatory levels of the degenerated IVD. Besides, experimental studies demonstrated that the MSC remained viable when injected into the IVD, and that they were able to regenerate partially from the degenerated IVD and its structure. The few clinical studies found in the literature presented diverging results. The use of MSC is being widely studied and shows promising results for the treatment of DDD. Although many advances are being achieved in studies in vitro and experimental, there is a lack of clinical studies to prove the role of MSC in DDD management.

  4. Ligeti: Ricercare per organo / M. K.

    Index Scriptorium Estoniae

    M. K.

    1991-01-01

    Uuest heliplaadist "Ligeti: Ricercare per organo, Vivier, Les Communiantes, Cavana, Jodl; Scelsi: In nomine Lucis; Lennot: Livre d'Orgue-extrait; Richer: Orgue 88; Pärt: Pari intervallo, Pierre Bousseau (Orgel)" (AD:1990). Adda/TIS CD 581 240 (WD:59'45") DDD

  5. Sibelius. Karelia Suite, Op. 11 / Robert Layton

    Index Scriptorium Estoniae

    Layton, Robert

    1996-01-01

    Uuest heliplaadist "Sibelius. Karelia Suite, Op. 11. Luonnotar, Op. 70 a. Andante festivo. The Oceanides, Op. 73. King Christian II, Op. 27-Suite. Finlandia, Op. 26a. Gothenburg Symphony Orchester, Neeme Järvi" DG 447 760-2GH (72 minutes: DDD)

  6. Mutations in POGLUT1, Encoding Protein O-Glucosyltransferase 1, Cause Autosomal-Dominant Dowling-Degos Disease

    DEFF Research Database (Denmark)

    Basmanav, F Buket; Oprisoreanu, Ana-Maria; Pasternack, Sandra M

    2014-01-01

    Dowling-Degos disease (DDD) is an autosomal-dominant genodermatosis characterized by progressive and disfiguring reticulate hyperpigmentation. We previously identified loss-of-function mutations in KRT5 but were only able to detect pathogenic mutations in fewer than half of our subjects. To ident...

  7. Effect of polychlorinated biphenyls (PCBs) and 1,1,1-trichloro-2,2,-bis (4-chlorophenyl)-ethane (DDT) in follicular fluid on the results of in vitro fertilization-embryo transfer (IVF-ET) programs

    Czech Academy of Sciences Publication Activity Database

    Jirsová, S.; Mašata, J.; Jech, L.; Zvárová, Jana

    2010-01-01

    Roč. 93, č. 6 (2010), s. 1831-1836 ISSN 0015-0282 Institutional research plan: CEZ:AV0Z10300504 Keywords : DDD * DDE * DDT * embryos * oocytes * PCB * pregnancy rate Subject RIV: FK - Gynaecology, Childbirth Impact factor: 3.122, year: 2010

  8. Evaluation of ecological risk limits for DDT and drins in soil : Assessment of direct toxicity and food chain transfer

    NARCIS (Netherlands)

    Smit CE; Verbruggen EMJ; MSP; M&V

    2015-01-01

    Het RIVM heeft onderzocht of de ecologische risicogrenzen in bodem voor twee groepen bestrijdingsmiddelen veilig zijn voor roofvogels. Dit betreft zogeheten drins (dieldrin, aldrin, endrin) en DDT, inclusief de bijbehorende afbraakproducten DDD en DDE. Voor endrin en het totaal aan DDT-verbindingen

  9. Toxaphene and Other Organochlorine Pesticides in Fish and Sediment from Lake Xolotlán, Nicaragua

    DEFF Research Database (Denmark)

    Calero, S.; Fomsgaard, Inge S.; Lacayo, M. L.

    1993-01-01

    and in all the sediment samples analyzed. α-BHC, heptachlor, heptachlor-epoxide, aldrin and dieldrin were detected neither in fish nor in sediment samples. DDT or its metabolites DDE or DDD (∊DDT) were present in almost all the fish and sediment samples but in low concentrations. The presence of β...

  10. Schostakowitsch: Sinfonie Nr. 12 op. 112 (Das Jahr 1917) / Hans-Christian Dadelsen

    Index Scriptorium Estoniae

    Dadelsen, Hans-Christian

    1991-01-01

    Uuest heliplaadist "Schostakowitsch: Sinfonie Nr. 12 op. 112 (Das Jahr 1917). Hamlet-Suite op. 32a. Das goldene Zeitalter [The Age of Gold] (Suite) op. 22a. Göteborger Symphoniker, Neeme Järvi". DG CD 431 688-2 (WD:77'21") DDD

  11. Comparison of adherence to generic multi-tablet regimens vs. brand multi-tablet and brand single-tablet regimens likely to incorporate generic antiretroviral drugs by breaking or not fixed-dose combinations in HIV-infected patients.

    Science.gov (United States)

    Rwagitinywa, Joseph; Lapeyre-Mestre, Maryse; Bourrel, Robert; Montastruc, Jean-Louis; Sommet, Agnès

    2018-03-05

    Adherence to antiretroviral (ARV) is crucial to achieve viral load suppression in HIV-infected patients. This study aimed to compare adherence to generic multi-tablet regimens (MTR) vs. brand MTR likely to incorporate ARV drugs without breaking fixed-dose combinations (FDC) and brand single-tablet regimens (STR) likely to incorporate generics by breaking the FDC. Patients aged of 18 years or over exposed to one of the generic or the brand of lamivudine (3TC), zidovudine/lamivudine (AZT/TC), nevirapine (NVP), or efavirenz (EFV), or the brand STR of efavirenz/emtricitabine/tenofovir (EFV/FTC/TDF). Adherence was measured by medication possession ratio (MPR) using both defined daily dose (DDD) and daily number of tablet recommended for adults (DNT). Adherence to generic MTR vs. brand MTR and brand STR was compared using Kruskal-Wallis. The overall median adherence was 0.97 (IQR 0.13) by DNT method and 0.97 (0.14) by DDD method. Adherence in patients exposed to generic MTR (n = 165) vs. brand MTR (n = 481) and brand STR (n = 470) was comparable by DNT and DDD methods. In conclusion, adherence to generic MTR was high and comparable with adherence to brand MTR and to STR. Utilization of DDD instead DNT to measure the MPR led to small but nonsignificant difference that has no clinical impact. © 2018 Société Française de Pharmacologie et de Thérapeutique.

  12. Wave Transformation Over Reefs: Evaluation of One-Dimensional Numerical Models

    Science.gov (United States)

    2009-01-01

    level estimates. DISCLAIMER: The contents of this report are not to be used for advertising , publication, or promotional purposes. Citation of trade...better with data for wave heights and mean water levels obtained with the DDD85 formula for these mono- chromatic waves. The RMSE values (rms errors

  13. Electronic Interplay between TTF and Extended-TCNQ Electrophores along a Ruthenium Bis(acetylide) Linker.

    Science.gov (United States)

    Vacher, Antoine; Auffray, Morgan; Barrière, Frédéric; Roisnel, Thierry; Lorcy, Dominique

    2017-11-17

    A bis(TTF-butadiynyl) ruthenium D-D'-D complex, with intramolecular electronic interplay between the three electron-donating electrophores, was easily converted through a cycloaddition-retroelectrocyclization with TCNQ into a D-A-D'-A-D pentad complex, which exhibits an intense intramolecular charge transfer together with an electronic interplay between the two acceptors along the conjugated organometallic bridge.

  14. From my Home: Dvarionas: Elegie; Pärt: Fratres / Patric Wiklacz

    Index Scriptorium Estoniae

    Wiklacz, Patric

    1997-01-01

    Uuest heliplaadist "From my Home: Dvarionas: Elegie; Pärt: Fratres; Barkauskas: Partita; Vasks: Musica Dolorosa; Pelecis: Concerto for Violin, Piano and String Orchestra, "Neverthless"; Plakidis: Two Grasshopper Dances; Tüür: Conversio. Deutsche Kammerphilharmonie, Gidon Kremer (violon), Vadim Sacharov (piano)" Teldec 0630-14654-2 (79 minutes:DDD)

  15. Facet joint orientation and tropism in lumbar degenerative disc disease and spondylolisthesis.

    Science.gov (United States)

    Pichaisak, Witchate; Chotiyarnwong, Chayaporn; Chotiyarnwong, Pojchong

    2015-04-01

    Although degenerative disc disease (DDD) and degenerative spondylolisthesis (DS) are two common causes of back pain in elderly, the association between the lumbarfacet joint angle and tropism in these conditions are still unclear. To evaluate the difference in facet joint angles between normal population and lumbar degenerative disc disease and spondylolisthesis patient. The angle of lumbar facet joints were retrospectively measured with magnetic resonance imaging (MRI) to determine whether there was a difference between degenerative diseases. MRI of patients with DDD, DS, and control group at facet joint between L3-4, L4-5 and L5-S1 level were measured in axial view (60 subjects in each group). There was no difference infacetjoint angle in DDD (44.1 ± 11.9) and control (45.6 ± 8.9), but differed in DS (40.1 ± 10. 7) and control group (p = 0.010) at L4-5 level. Facet tropism showed difference between degenerative groups and control group at L4-5 level. DS group showed difference in facet joints angle and tropism when compared with control population, while DDD showed difference only in facet tropism. In addition, longitudinal studies are needed to understand the clinical significant between facet joint angle and tropism in spinal degenerative diseases.

  16. Opioid consumption before and after the establishment of a palliative medicine unit in an Egyptian cancer centre.

    Science.gov (United States)

    Alsirafy, Samy A; Ibrahim, Noha Y; Abou-Elela, Enas N

    2012-01-01

    Opioid consumption before and after the establishment of a palliative medicine unit (PMU) in an Egyptian cancer centre was reviewed. A comparison of consumption during the year before the PMU was established to consumption during the third year after the PMU's establishment revealed that morphine consumption increased by 698 percent, fentanyl by 217 percent, and tramadol by 230 percent. Expressed in defined daily dose (DDD) and adjusted for 1,000 new cancer patients, consumption increased by 460 percent, from 4,678 DDD/1,000 new patients to 26,175 DDD/1,000 new patients. Expressed in grams of oral morphine equivalent (g OME), consumption increased by 644 percent, from 233 g OME/1,000 new patients to 1,731 g OME/1,000 new patients. The establishment of the PMU was associated with an increase in opioid consumption, especially morphine, which is an indicator of improvement in cancer pain control. The expression of opioid consumption in OME in addition to DDD may provide further information, especially when weak opioids are included in the analysis.

  17. Berwald. Symphonies - No. 1 in G minor, "Sinfonie serieuse" / Robert Layton

    Index Scriptorium Estoniae

    Layton, Robert

    1996-01-01

    Uuest heliplaadist "Berwald. Symphonies - No. 1 in G minor, "Sinfonie serieuse". No. 2 in D, "Sinfonie singuliere". No. 4 in E flat. Gothenburg Symphony Orchestra, Neeme Järvi. DG Masters 445 581-26 MA2 (two discs: 112 minutes: DDD)

  18. From my Home: Dvarionas: Elegie / Rob Cowan

    Index Scriptorium Estoniae

    Cowan, Rob

    1997-01-01

    Uuest heliplaadist "From my Home: Dvarionas: Elegie; Pärt: Fratres; Barkauskas: Partita; Vasks: Musica Dolorosa; Pelecis: Concerto for Violin, Piano and String Orchestra, "Neverthless"; Plakidis: Two Grasshopper Dances; Tüür: Conversio. Deutsche Kammerphilharmonie. Teldec 0630-14654-2 (79 minutes:DDD)

  19. Organochlorine pesticides and polychlorinated biphenyls in herring from the southern Baltic, 1983

    Energy Technology Data Exchange (ETDEWEB)

    Falandysz, J

    1986-02-01

    Hexachlorobenzene (HCB), alpha-, beta-, gamma- and delta-benzenehexachloride (BHC, HCH), p,p'-DDE, o,p'-DDD, o,p'-DDT, p,p'-DDD and p,p'-DDT (sigma DDT) and polychlorinated biphenyls (PCB) levels have been determined in muscle tissue of 187 herring (Clupea harengus) netted during 1983 in a different regions in the southern part of the Baltic Sea. The mean levels found for herring muscle tissue related to wet weight (microgram/kg) were: 14 HCB, 18 alpha-BHC, 23 beta-BHC, 14 gamma-BHC, delta-BHC remained undetected, 56 sigma BHC, 115 p,p'-DDE, o,p'-DDD and o,p'-DDT remained undetected, 84 p,p'-DDD, 51 p,p'-DDT, 250 sigma DDT and 530 PCB. The levels of organochlorine pesticides determined in wet muscles or extractable lipids of herring are nearly 2-3 times as high as those noted in fish sampled in the same area in two years before, while for PCBs the wet weight levels were comparable, and when based on a lipid weight are somewhat higher. The results are compared with levels found in herring collected in different regions of the Baltic Sea during 1965-1983, and reported previously by other authors.

  20. Roussel. Sinfonien Nr. 3 g-Moll op. 42 und Nr. 4 A-Dur op. 5, Neeme Järvi / Christoph Schlüren

    Index Scriptorium Estoniae

    Schlüren, Christoph

    1995-01-01

    Uuest heliplaadist "Roussel. Sinfonien Nr. 3 g-Moll op. 42 und Nr. 4 A-Dur op. 53, Bacchus et Ariane op. 43 (Zweite Orchestersuite). Sinfonietta für Streichorchester d-Moll op. 52. Detroit Symphony Orchester, N. Järvi". Chandos/Koch CD 7007(WD: 70'10") DDD

  1. Consumption, overdose and death from analgesics during a period of over-the-counter availability of paracetamol in Denmark

    DEFF Research Database (Denmark)

    Ott, P; Dalhoff, K; Hansen, P B

    1990-01-01

    During the period 1978-1986, annual sales of paracetamol in Denmark increased from 1 million defined daily doses (DDD) (3 g) to 47 million DDD, while the number of admissions and deaths from overdose increased from 26 to 202 and from 1 to 3-4, respectively. The corresponding figures for salicylates...... are a decrease in sales from 113 to 94 million DDD, an increase in admissions from 282 to 595, and an increase in deaths from 5 to 22. From 1 January 1984 paracetamol became available on an over-the-counter basis. The figures for 1983 and 1984 were an increase in sales from 14 to 28 million DDD, an increase...... in admissions from 114 to 198, and an increase in deaths from 0 to 4. The number of deaths from opioid overdose remained constant at a value of about fifty during this period, the mortality per dose being about 20-fold higher than for paracetamol and salicylates. Dextropropoxyphene-related deaths increased...

  2. Sibelius: Karelia Suite, Op. 11. Luonnotar, Op. 70 a. Andante festivo. The Oceanides, Op. 73. King Christian II, Op. 27-Suite. Finlandia, Op. 26a. Gothenburg Symphony Orchester, Neeme Järvi / Michael Scott Rohan

    Index Scriptorium Estoniae

    Rohan, Michael Scott

    1996-01-01

    Sibelius: Karelia Suite, Op. 11. Luonnotar, Op. 70 a. Andante festivo. The Oceanides, Op. 73. King Christian II, Op. 27-Suite. Finlandia, Op. 26a. Gothenburg Symphony Orchester, Neeme Järvi. 1 CD Deutsche Grammophon 447 760-2GH (72 minutes: DDD)

  3. Residues of Organochlorinated Pesticides in Soil from Tomato ...

    African Journals Online (AJOL)

    This work presents the concentrations of five pesticide residues, lindane, chlorpyrifos, endosulfan, p, p'-DDE and p, p'-DDD in soil samples collected from tomato fields in Ngarenanyuki, Tanzania. Endosulfan sulphate was detected in 100 % of the sample analysed with mean concentration of 0.2407 mg/kg dw. Chlorpyrifos ...

  4. Shostakovich: The Orchestral Songs Vol. 2 / Michael Tanner

    Index Scriptorium Estoniae

    Tanner, Michael

    1996-01-01

    Uuest heliplaadist "Shostakovich: The Orchestral Songs Vol. 2: Six Romances on texts by Japanese poets, Op. 21. Six Poems on Marina Tsvetayeva, Op. 143. Suite on Verses of Michelangelo, Op. 145. Gothenburg Symphony Orchestra, Neeme Järvi". DG 447 085-2GH (71 minutes:DDD)

  5. A novel multiple-stage antimalarial agent that inhibits protein synthesis

    NARCIS (Netherlands)

    Baragana, B.; Hallyburton, I.; Lee, M.C.; Norcross, N.R.; Grimaldi, R.; Otto, T.D.; Proto, W.R.; Blagborough, A.M.; Meister, S.; Wirjanata, G.; Ruecker, A.; Upton, L.M.; Abraham, T.S.; Almeida, M.J.; Pradhan, A.; Porzelle, A.; Martinez, M.S.; Bolscher, J.M.; Woodland, A.; Norval, S.; Zuccotto, F.; Thomas, J.; Simeons, F.; Stojanovski, L.; Osuna-Cabello, M.; Brock, P.M.; Churcher, T.S.; Sala, K.A.; Zakutansky, S.E.; Jimenez-Diaz, M.B.; Sanz, L.M.; Riley, J.; Basak, R.; Campbell, M.; Avery, V.M.; Sauerwein, R.W.; Dechering, K.J.; Noviyanti, R.; Campo, B.; Frearson, J.A.; Angulo-Barturen, I.; Ferrer-Bazaga, S.; Gamo, F.J.; Wyatt, P.G.; Leroy, D.; Siegl, P.; Delves, M.J.; Kyle, D.E.; Wittlin, S.; Marfurt, J.; Price, R.N.; Sinden, R.E.; Winzeler, E.A.; Charman, S.A.; Bebrevska, L.; Gray, D.W.; Campbell, S.; Fairlamb, A.H.; Willis, P.A.; Rayner, J.C.; Fidock, D.A.; Read, K.D.; Gilbert, I.H.

    2015-01-01

    There is an urgent need for new drugs to treat malaria, with broad therapeutic potential and novel modes of action, to widen the scope of treatment and to overcome emerging drug resistance. Here we describe the discovery of DDD107498, a compound with a potent and novel spectrum of antimalarial

  6. Coding and classification in drug statistics – From national to global application

    Directory of Open Access Journals (Sweden)

    Marit Rønning

    2009-11-01

    Full Text Available  SUMMARYThe Anatomical Therapeutic Chemical (ATC classification system and the defined daily dose (DDDwas developed in Norway in the early seventies. The creation of the ATC/DDD methodology was animportant basis for presenting drug utilisation statistics in a sensible way. Norway was in 1977 also thefirst country to publish national drug utilisation statistics from wholesalers on an annual basis. Thecombination of these activities in Norway in the seventies made us a pioneer country in the area of drugutilisation research. Over the years, the use of the ATC/DDD methodology has gradually increased incountries outside Norway. Since 1996, the methodology has been recommended by WHO for use ininternational drug utilisation studies. The WHO Collaborating Centre for Drug Statistics Methodologyin Oslo handles the maintenance and development of the ATC/DDD system. The Centre is now responsiblefor the global co-ordination. After nearly 30 years of experience with ATC/DDD, the methodologyhas demonstrated its suitability in drug use research. The main challenge in the coming years is toeducate the users worldwide in how to use the methodology properly.

  7. Sibelius: Scaramouche op. 71, Neeme Järvi / Rainer Wagner

    Index Scriptorium Estoniae

    Wagner, Rainer

    1991-01-01

    Uuest heliplaadist "Sibelius: Scaramouche op. 71 [World Premiere REcording of the Complete Score]. Hochzeitmarsch aus der Musik zum Drama Die Sprache der Vögel [Wedding March "The Language of the Birds"]. Göteborger Sinfoniker, Neeme Järvi. BIS/Disco-Ccenter CD 502 (WD:68'28") DDD

  8. Pärt, Arvo: De profundis / Barry Witherden

    Index Scriptorium Estoniae

    Witherden, Barry

    1997-01-01

    Uuest heliplaadist "Pärt, Arvo: De profundis. Missa Sillabica. Solfeggio. And one of the Pharisees. Cantate Domino. Summa. Seven Magnificat Antiphons. The Beautitudes. Magnificat. Christopher Bowers-Broadbent (org.), Daniel Kennedy (perc.). Theatre of Voices / Paul Hillier (bass)". Harmonia Mundi HMU40 7182; HMU90 7182 (76 minutes:DDD)

  9. Pärt, Arvo: De profundis. Missa Sillabica. Solfeggio / Marc Rochester

    Index Scriptorium Estoniae

    Rochester, Marc

    1997-01-01

    Uuest heliplaadist "Pärt, Arvo: De profundis. Missa Sillabica. Solfeggio. And one of the Pharisees. Cantate Domino. Summa. Seven Magnificat Antiphons. The Beautitudes. Magnificat. Christopher Bowers-Broadbent (org.), Daniel Kennedy (perc.). Theatre of Voices / Paul Hillier (bass). Harmonia Mundi HMU40 7182; HMU90 7182 (76 minutes:DDD)"

  10. Medical Surveillance Monthly Report. Volume 19, Number 5

    Science.gov (United States)

    2012-05-01

    Intervertebral disc disorders DDD-related ICD-9-CM codes 723.0 Spinal stenosis , cervical 724.00, 724.01, 724.02, 724.09 Spinal stenosis ,other 723.1...4,6,7 Tick vectors of Rocky Mountain Spotted Fever (RMSF) and other diseases Dermacentor variabilis, the American dog tick or wood tick, is found in

  11. Tobias, Rudolf: Jonah's Mission / Warrack, John

    Index Scriptorium Estoniae

    Warrack, John

    1996-01-01

    Uuest heliplaadist "Tobias, Rudolf: Jonah's Mission. Pille Lill (sop), Urve Tauts (mez), Peter Svensson (ten), Raimo Laukka (bar), Mati Palm (bass); Tallinn Boys' Choir, Estonian Philharmonic Chamber Choir, Oratorio Choir, Estonian State Symphony Orchestra, Neeme Järvi" BIS CD 731/2 (two discs: 114 minutes: DDD)

  12. Spine research in companion animals

    NARCIS (Netherlands)

    Kranenburg, H.C.

    2012-01-01

    The present thesis consists of two parts. Part I consists of Chapters 3, 4, 5, 6 and 7. The aim of these chapters was to increase the knowledge of three spinal disorders (i.e., diffuse idiopathic skeletal hyperostosis (DISH), spondylosis deformans, and degenerative disc disease (DDD) due to

  13. An ethical assessment model for digital disease detection technologies.

    Science.gov (United States)

    Denecke, Kerstin

    2017-09-20

    Digital epidemiology, also referred to as digital disease detection (DDD), successfully provided methods and strategies for using information technology to support infectious disease monitoring and surveillance or understand attitudes and concerns about infectious diseases. However, Internet-based research and social media usage in epidemiology and healthcare pose new technical, functional and formal challenges. The focus of this paper is on the ethical issues to be considered when integrating digital epidemiology with existing practices. Taking existing ethical guidelines and the results from the EU project M-Eco and SORMAS as starting point, we develop an ethical assessment model aiming at providing support in identifying relevant ethical concerns in future DDD projects. The assessment model has four dimensions: user, application area, data source and methodology. The model supports in becoming aware, identifying and describing the ethical dimensions of DDD technology or use case and in identifying the ethical issues on the technology use from different perspectives. It can be applied in an interdisciplinary meeting to collect different viewpoints on a DDD system even before the implementation starts and aims at triggering discussions and finding solutions for risks that might not be acceptable even in the development phase. From the answers, ethical issues concerning confidence, privacy, data and patient security or justice may be judged and weighted.

  14. 75 FR 40729 - Residues of Quaternary Ammonium Compounds, N-Alkyl (C12-14

    Science.gov (United States)

    2010-07-14

    ... the Daily Dietary Dose (DDD) and the Estimated Daily Intake (EDI) using modified Food and Drug... survey days. The Estimated Daily Intake (EDI) calculations presented in this assessment for treated... is 0.0103 lbs a.i per gallon of treatment solution. EDI values were calculated using an approach...

  15. Liszt. Concertos for Piano and Orchestra / Bryce Morrison

    Index Scriptorium Estoniae

    Morrison, Bryce

    1993-01-01

    Uuest heliplaadist "Pärt: Te Deum. Silouans Song. "My soul yearns after the Lord...". Magnificat. Berliner Messe. Estonian Philharmonic Chamber Choir, Tallinn Chamber Orchestra/Tõnu Kaljuste." ECM New Series 439 162-2 (66 minutes: DDD). Texts and translations included

  16. 40 CFR 413.02 - General definitions.

    Science.gov (United States)

    2010-07-01

    ... techniques such as pH adjustment followed by clarification or filtration. (g) The term control authority is...) Aldrin Dieldrin Chlordane (technical mixture and metabolites) 4,4-DDT 4,4-DDE (p,p-DDX) 4,4-DDD (p,p-TDE...

  17. Penderecki: Konzert für Flöte und Kammerorchester; Eespere: Konzert für Flöte und Kammerorchester / Gero Schliess

    Index Scriptorium Estoniae

    Schliess, Gero

    1997-01-01

    Uuest heliplaadist "Penderecki: Konzert für Flöte und Kammerorchester; Eespere: Konzert für Flöte und Kammerorchester; Bartok: Suite paysanne hongroise für Flöte und Streichorchester. Estonian National Symphony Orchestra / Arvo Volmer". Signum/Note 1 CD X72-00 (WD:54'30")DDD

  18. Nielsen: Aladdin-Suite, FS89. Maskarade-Overture / Robert Layton

    Index Scriptorium Estoniae

    Layton, Robert

    1996-01-01

    Uuest heliplaadist "Nielsen: Aladdin-Suite, FS89. Maskarade-Overture, Prelude, Act 2. The Cockerels' Dance. Rhapsody Overture: An imaginary journey to the Faroe Islands, FS123. Helios Overture, FS32. Saga-Drom, FS46. Pan and Syrinx, FS87. Gothenburg Symphony Orchestra, Neeme Järvi" DG 447 757-2GH (72 minutes: DDD)

  19. Real-time display of flow-pressure-volume loops.

    Science.gov (United States)

    Morozoff, P E; Evans, R W

    1992-01-01

    Graphic display of respiratory waveforms can be valuable for monitoring the progress of ventilated patients. A system has been developed that can display flow-pressure-volume loops as derived from a patient's respiratory circuit in real time. It can also display, store, print, and retrieve ventilatory waveforms. Five loops can be displayed at once: current, previous, reference, "ideal," and previously saved. Two components, the data-display device (DDD) and the data-collection device (DCD), comprise the system. An IBM 286/386 computer with a graphics card (VGA) and bidirectional parallel port is used for the DDD; an eight-bit microprocessor card and an A/D convertor card make up the DCD. A real-time multitasking operating system was written to control the DDD, while the DCD operates from in-line assembly code. The DCD samples the pressure and flow sensors at 100 Hz and looks for a complete flow waveform pattern based on flow slope. These waveforms are then passed to the DDD via the mutual parallel port. Within the DDD a process integrates the flow to create a volume signal and performs a multilinear regression on the pressure, flow, and volume data to calculate the elastance, resistance, pressure offset, and coefficient of determination. Elastance, resistance, and offset are used to calculate Pr and Pc where: Pr[k] = P[k]-offset-(elastance.V[k]) and Pc[k] = P[k]-offset-(resistance.F[k]). Volume vs. Pc and flow vs. Pr can be displayed in real time. Patient data from previous clinical tests were loaded into the device to verify the software calculations. An analog waveform generator was used to simulate flow and pressure waveforms that validated the system.(ABSTRACT TRUNCATED AT 250 WORDS)

  20. Outpatient utilization of psychopharmaceuticals in the City of Zagreb 2001-2006.

    Science.gov (United States)

    Stimac, Danijela; Culig, Josip

    2009-03-01

    A comprehensive insight into drug utilization as an economic and primarily a public health issue can only be acquired in the context of overall health state of the respective population. The objectives of the study were: 1) to determine the real outpatient utilization of psychopharmaceuticals in Zagreb, 2) to determine the psychopharmaceutical prescribing quality during the study period; and 3) to propose appropriate interventions in Zagreb on the basis of the results obtained. Data on drug utilization were obtained from all Zagreb pharmacies. The number of defined daily doses (DDD) and number of DDD per 1000 inhabitants per day (DDD/1000/day) were calculated from the number of particular drug packages. The Drug Utilization 90% (DU90%) method was used as a criterion of prescribing quality. Outpatient utilization of psychopharmaceuticals showed a declining pattern from 115.40 DDD/1000/day in 2001 to 93.15 DDD/1000/day in 2006. Anxiolytics accounted for the majority of this drug group utilization in the City of Zagreb, although the anxiolytic/antidepressant ratio decreased from 7.19 in 2001 to 3.86 in 2006. The utilization of selective serotonin reuptake inhibitors showed a 2.5-fold increase and accounted for 90% of overall antidepressant utilization. A 2.5-fold decrease was recorded in the utilization of antipsychotics, while the atypical/typical antipsychotic ratio changed from 1:2 in 2001 to 1.1:1 in 2006. Despite some improvement observed in the prescribing quality, the predominance of benzodiazepines in the utilization of psychopharmaceuticals points to the need of additional rationalization in the field.

  1. [Pharmacoeconomic indicators of cardiovascular drug utilization in the Republic of Croatia and city of Zagreb in 2008].

    Science.gov (United States)

    Stimac, Danijela; Stambuk, Ivanka

    2010-12-01

    In comparison with original drugs, generic drugs have the same efficacy but considerably lower price and should therefore be preferred to original drugs on prescribing. The aim of the present study was to assess outpatient utilization and rationality of cardiovascular drug prescribing in the City of Zagreb and Republic of Croatia based on the generic to original drug prescribing ratio. Data on the financial indicators and number of cardiovascular drug packages issued in 2008 were obtained from the Croatian Institute of Health Insurance. These data were used to calculate the number of defined daily doses (DDD) and number of DDD per 1000 inhabitants per day (DDD/1000/day). The index of generic/original drug utilization was determined for Zagreb and Croatia as a measure for assessment of prescribing rationality; the significance of difference was determined by X2-test. The rate of prescribing original cardiovascular drugs was significantly higher in Zagreb as compared with Croatia as a whole. The index of prescribing generic versus original drugs was 1.20 (249/208 DDD/1000/day) in Zagreb and 1.65 (249/151 DDD/1000/day) in Croatia. Difference in the utilization of generic drugs between Zagreb and Croatia as determined by X2-test (the level of statistical significance was set at PZagreb and 2.02 in Croatia; and hypolipemics with the generic/original drug index of 0.96 in Zagreb and 1.34 in Croatia. According to financial indicators, the generic/original drug index was 1.44 in Croatia and only 0.96 in Zagreb. The significantly greater influence of pharmaceutical industry marketing in Zagreb entailed the significantly higher rate of original drug prescribing, which is associated with considerably greater drug expenses. Measures to stimulate prescribing generic drugs should be launched at the national level.

  2. Comparison of Psychotropic Drug Prescribing Quality between Zagreb, Croatia and Sarajevo, B&H.

    Science.gov (United States)

    Polić-Vižintin, Marina; Štimac, Danijela; Čatić, Tarik; Šostar, Zvonimir; Zelić, Ana; Živković, Krešimir; Draganić, Pero

    2014-12-01

    The purpose of this paper was to compare outpatient consumption and quality of psychotropic drug prescribing between Croatia and Bosnia & Herzegovina 2006-2010. Data on drug utilization from Zagreb Municipal Pharmacy and Sarajevo Public Pharmacy were used to calculate the number of defined daily doses (DDD) and DDD per 1000 inhabitants per day (DDD/TID) using the WHO Anatomical-Therapeutic-Chemical methodology. Total utilization of psychopharmaceuticals increased in both cities; however, it was higher in Zagreb than in Sarajevo throughout the study period. The utilization of psycholeptics increased in Zagreb by 2.4% (from 74.5 to 76.3 DDD/TID) and in Sarajevo by 3.8% (from 62.4 to 64.8 DDD/TID). The utilization of anxiolytics decreased in Zagreb by 2.1% and in Sarajevo by even 18.7%. The utilization of antidepressants increased in both cities with predominance of SSRI over TCA utilization, greater in Sarajevo (96.6%) than in Zagreb (10.2%). The anxiolytic/antidepressant ratio decreased by 11.1% in Zagreb (from 2.87 to 2.55) and by 58.7% in Sarajevo (from 5.66 to 2.34). Outpatient utilization of antipsychotics increased significantly in Sarajevo, predominated by typical ones, whereas in Zagreb the utilization of antipsychotics was stable, predominated by atypical ones. In Croatia and Bosnia & Herzegovina, there was an obvious tendency to follow western trends in drug prescribing, as demonstrated by the increased use of antidepressants and reduced use of anxiolytics. Despite some improvement observed in the prescribing quality, high use of antipsychotics with dominance of typical antipsychotics in Sarajevo points to the need of prescribing guidelines for antipsychotics.

  3. Resistance of uropathogenic strains of Escherichia coli in pregnant women and other women in generative ages in comparison with antibiotics consumption in Zagreb

    Directory of Open Access Journals (Sweden)

    Marcel Leppée,

    2010-02-01

    Full Text Available Aim To compare resistance of uropathogenic strains of Escherichia coli (UPEC to antibiotics in women in generative ages and pregnant women during two year period (2004 and 2008 in Zagreb, andcomparison of resistance and the consumption of antibiotics. Methods The standard disk-diffusion method was used for sensitivity testing to 16 different antibiotics.Data on antibiotic utilization were used to calculate the number of defined daily doses (DDD and DDD per 1000 inhabitants using Anatomical-Therapeutic-Chemical/DDD methodology.Data on antibiotic consumption during pregnancy were collected using a questionnaire filled in by 893 women after delivery.Results During 2004 resistance of UPEC to antimicrobial drugs was not different in pregnant and in non-pregnant women, with the exception of amoxicillin and nitrofurantoin, with statistically higher resistance in pregnant women (p <0.01. Four years later the statistically higher resistance to norfloxacin was observed in non-pregnant women (p <0.01. Comparing the resistance in 2004 and 2008, in the both groups of women a statistically significant decrease of resistance to cefalexin and nitrofurantoin was detected (p <0.01. Outpatient utilization of antimicrobial drugs in Zagreb increased significantly, from 32 to 39 DDD/1000 inhabitants per day. The most used antibiotic was co-amoxiclav, and its utilization increased from 9.6 to 12.2 DDD/1000/day. Amoxicillin and co-amoxiclav were used during pregnancy by 9.6% interviewed women. Conclusion The observed significant decrease of resistance to cefalexin makes that antibiotic the drug of choice for treatment of urinary tract infections in women in generative ages, and together with coamoxiclavcan be administered in pregnancy. Constant monitoring of urinary tract pathogens resistance to antimicrobial agents ensures the effectiveness of empirical therapy, whose versatile use is limited due the potentially harmful effects of antimicrobial drugs on fetus.

  4. Does reducing unnecessary right ventricular pacing improve sympathetic activity and innervation of heart in sinus node disease patients? MVP and SafeR study.

    Science.gov (United States)

    Miyamoto, Mihoko; Kimura, Yuichiro; Hosoda, Junya; Matsumoto, Katsumi; Matsushita, Kohei; Ishikawa, Toshiyuki; Umemura, Satoshi

    2012-01-01

    Ventricular desynchronization imposed by ventricular pacing causes regional disturbances of adrenergic innervation in the left ventricular myocardium and increases the risk of heart failure and atrial fibrillation (AF) in patients with sinus node disease (SND). As a result, decreased iodine-123 metaiodobenzylguanidine (I-(123 )MIBG) uptake occurs in patients with an implanted permanent pacemaker. Fourteen SND patients with an implanted pacemaker equipped with an algorithm for reducing unnecessary right ventricular pacing (RURVP) were enrolled. Pacemakers were programmed to RURVP mode for the first 12 weeks, and then reprogrammed to DDD for the last 12 weeks. At the end of each mode, data on cumulative percent ventricular pacing (%Vp), atrial high rate episodes (%AHR), I-(123 )MIBG myocardial scintigraphy, brain natriuretic peptide (BNP), human atrial natriuretic peptide (hANP), and myocardial damage indices typified by troponin T and C-reactive protein (CRP) were collected. %Vp was lower in RURVP than in DDD (0.2% versus 95.7%, P = 0.00098). BNP, hANP, troponin T, and CRP did not differ significantly between the pacing modes. However, I-(123 )MIBG findings of patients with full ventricular pacing in DDD improved in RURVP. In contrast, among patients without full ventricular pacing in DDD, their I-(123 )MIBG findings did not differ significantly between the pacing modes. In SND patients with normal cardiac function and intact atrioventricular conduction, the reduction of %Vp in RURVP was due to the reduction of ineffective pacing and fusion pacing in DDD. Therefore, these 2 types of pacing do not affect cardiac pump function.

  5. Determination of DDT and metabolites in surface water and sediment using LLE, SPE, ACE and SE.

    Science.gov (United States)

    Sibali, Linda L; Okonkwo, Jonathan O; Zvinowanda, Caliphs

    2009-12-01

    Surface water and sediment samples collected from Jukskei River in South Africa, were subjected to different extraction techniques, liquid-liquid (LLE), solid-phase extraction (SPE), activated carbon extraction (ACE) and soxhlet extraction (SE) for sediment. The samples were extracted with dichloromethane, cleaned in a silica gel column and the extracts quantified using a Varian 3800 GC-ECD. The percentage recovery test for 2,4'DDT, DDE and DDD and 4,4'DDT, DDE and DDD in water ranged from 80%-96% and 76%-95% (LLE); 56%-76% and 56%-70% (SPE) and 75%-84% (ACE), respectively; while that recoveries for sediment samples varied from 65%-95% for 2,4'DDT, DDE and DDD and 80%-91% for 4,4'DDT, DDE and DDD. The high recoveries exhibited by ACE compared very well with LLE and SE. This was not the case with SPE which exhibited the lowest value of recoveries for both 2,4 and 4,4'DDD, DDE and DDT standard samples. The mean concentrations of DDT and metabolites ranged from nd-1.10 μg/L, nd-0.80 μg/L, nd-1.21 μg/L and 1.92 μg/L for LLE, SPE, ACE and SE, respectively. The total DDT (2,4' and 4,4'-DDT) in water and sediment samples ranged from 1.20-3.25 μg/L and 1.82-5.24 μg/L, respectively. The low concentrations of the DDT metabolites obtained in the present study may suggest a recent contamination of the river by DDT.

  6. Trends in the use of antiasthmatic medications in Morocco (1999-2010).

    Science.gov (United States)

    Ghanname, Imane; Ahid, Samir; Berrada, Ghizlane; Belaiche, Abdelmjid; Hassar, Mohamed; Cherrah, Yahya

    2013-12-01

    Asthma is a big public health problem in Morocco. The drug therapy existing in Morocco is currently insufficient because of the low purchasing power and the low health insurance coverage available to the average citizen in Morocco. In this study we evaluated the consumption of antiasthmatics in Morocco during the period 1999-2010, the classes of used drugs and the generics' market share. We used sales data from the Moroccan subsidiaries of the IMS Health "Intercontinental Marketing Service". The consumption volume was converted to Defined Daily Doses (DDDs). During 1999-2010, antiasthmatics's consumption increased from 3.91 to 14.47 DDD per 1000 inhabitants per day. In 2010, the association Beta-2-mimetic-Glucocorticosteroids were the most consumed (8.53 DDD/1000 Inhabitants/day) followed by the short-acting inhaled Beta-2-mimetic (4 DDD/1000 Inhabitants/day) and inhaled Glucocorticosteroids alone accounted for 1.13 DDD/1000 Inhabitants/day. The largest consumption share in volume was held by the short-acting inhaled Beta-2-mimetic (42%) followed by the combination Beta-2-mimetic-Glucocorticosteroids (38%). Between 1999 and 2010, the market for generic antiasthmatics increased from 1.84 to 2.18 DDD/1000 Inhabitants/day. The ratio of the monthly average cost of treatment to the minimum wage in Morocco decreased from 10.8% in 1999 to 7.11% in 2010. Antiasthmatics' consumption in Morocco has undergone significant changes between 1999 and 2010. However, the availability of these drugs expressed as the Average Monthly Expenditure/Guaranteed Minimum Wage ratio improved. Despite this, the use of antiasmathics in Morocco remains low.

  7. An Overview of Starfish: A Table-Centric Tool for Interactive Synthesis

    Science.gov (United States)

    Tsow, Alex

    2008-01-01

    Engineering is an interactive process that requires intelligent interaction at many levels. My thesis [1] advances an engineering discipline for high-level synthesis and architectural decomposition that integrates perspicuous representation, designer interaction, and mathematical rigor. Starfish, the software prototype for the design method, implements a table-centric transformation system for reorganizing control-dominated system expressions into high-level architectures. Based on the digital design derivation (DDD) system a designer-guided synthesis technique that applies correctness preserving transformations to synchronous data flow specifications expressed as co- recursive stream equations Starfish enhances user interaction and extends the reachable design space by incorporating four innovations: behavior tables, serialization tables, data refinement, and operator retiming. Behavior tables express systems of co-recursive stream equations as a table of guarded signal updates. Developers and users of the DDD system used manually constructed behavior tables to help them decide which transformations to apply and how to specify them. These design exercises produced several formally constructed hardware implementations: the FM9001 microprocessor, an SECD machine for evaluating LISP, and the SchemEngine, garbage collected machine for interpreting a byte-code representation of compiled Scheme programs. Bose and Tuna, two of DDD s developers, have subsequently commercialized the design derivation methodology at Derivation Systems, Inc. (DSI). DSI has formally derived and validated PCI bus interfaces and a Java byte-code processor; they further executed a contract to prototype SPIDER-NASA's ultra-reliable communications bus. To date, most derivations from DDD and DRS have targeted hardware due to its synchronous design paradigm. However, Starfish expressions are independent of the synchronization mechanism; there is no commitment to hardware or globally broadcast clocks

  8. Application of electronic business in monitoring marketing and consumption of human medicines in the Republic of Serbia

    Directory of Open Access Journals (Sweden)

    Tešić Danka

    2011-01-01

    Full Text Available The paper describes the application of electronic business (e-business in monitoring marketing and consumption of medicines, as one of e-government services (e-services of the Republic of Serbia (Serbia. It shows methodological framework for development of e-services, through use of RUP (Rational Unified Process methodology. The Unified Modelling Language (UML notation was used for description of the system model. The paper presents modeling of the process of marketing of medications for human use, as well as development of the information subsystem underpinning it. The analysis of the marketing of medications in Serbia was carried out in 2006, 2007, 2008 and 2009, by the Medicines and Medical Devices Agency of Serbia, which was authorized to collect and analyze data on the marketing and consumption of medicines and medical devices. Data gathered for a particular time period were analyzed using Anatomical Therapeutic Chemical Classification and the Defined Daily Doses methodology. The amount of medicines consumed was translated into the DDD by 1000 individuals per day, and gave an insight into the number of individuals (out of 1000 who used the medicine under observation and were under its effect during a single day. The data extracted are correlated with the number of individuals who took the medication during the period under observation. In the year 2006 total marketing of medications for human use amounted to € 510.833.609,54, in 2007 it stood at € 687.588.174,80, in 2008 it was € 799.082.221,05, while the overall marketing of medicines in the year 2009 was € 741.981.960,19. By processing the data by methodology of DDD, the following results were obtained: 1013,70 DDD/1000 individuals/day in year 2006; in year 2007, 1084,34 DDD/1000 individuals/day; in year 2008, 1219,57 DDD/1000 individuals/day and in year 2009, 1177,72 DDD/1000 individuals/day. The implementation of such system produces a series of technological, functional and

  9. Association between promoter -1607 polymorphism of MMP1 and Lumbar Disc Disease in Southern Chinese

    Directory of Open Access Journals (Sweden)

    Leong John CY

    2008-04-01

    Full Text Available Abstract Background Matrix metalloproteinases (MMPs are involved in the degradation of the extracellular matrix of the intervertebral disc. A SNP for guanine insertion/deletion (G/D, the -1607 promoter polymorphism, of the MMP1 gene was found significantly affecting promoter activity and corresponding transcription level. Hence it is a good candidate for genetic studies in DDD. Methods Southern Chinese volunteers between 18 and 55 years were recruited from the population. DDD in the lumbar spine was defined by MRI using Schneiderman's classification. Genomic DNA was isolated from the leukocytes and genotyping was performed using the Sequenom® platform. Association and Hardy-Weinberg equilibrium checking were assessed by Chi-square test and Mann-Whitney U test. Results Our results showed substantial evidence of association between -1607 promoter polymorphism of MMP1 and DDD in the Southern Chinese subjects. D allelic was significantly associated with DDD (p value = 0.027, odds ratio = 1.41 with 95% CI = 1.04–1.90 while Genotypic association on the presence of D allele was also significantly associated with DDD (p value = 0.046, odds ratio = 1.50 with 95% CI = 1.01–2.24. Further age stratification showed significant genotypic as well as allelic association in the group of over 40 years (genotypic: p value = 0.035, odds ratio = 1.617 with 95% CI = 1.033–2.529; allelic: p value = 0.033, odds ratio = 1.445 with 95% CI = 1.029–2.029. Disc bulge, annular tears and the Schmorl's nodes were not associated with the D allele. Conclusion We demonstrated that individuals with the presence of D allele for the -1607 promoter polymorphism of MMP1 are about 1.5 times more susceptible to develop DDD when compared with those having G allele only. Further association was identified in individuals over 40 years of age. Disc bulge, annular tear as well as Schmorl's nodes were not associated with this polymorphism.

  10. DDT Analysis of Wetland Sediments in Upper Escambia Bay, Florida

    Science.gov (United States)

    Hopko, M. N.; Wright, J.; Liebens, J.; Vaughan, P.

    2017-12-01

    Dichlorodiphenyltrichloroethane (DDT) was a commonly used pesticide from World War II through the 1960's. DDT is generally used to control mosquito populations and as an agricultural insecticide. The pesticide and its degradation products (DDD and DDE) can bioaccumulate within ecosystems having negative implications for animal and human health. Consequently, DDT usage was banned in the United States in 1973. In a contaminant study performed in Escambia Bay, Florida, in 2009, DDT was present in 25% of study sites, most of which were located in the upper bay wetlands. Concentrations were well above the Florida Department of Environmental Protection's (FDEP) Probable Effect Level (PEL) and ratios of DDT and its metabolites indicated a recent introduction to the system. A follow-up study performed in 2016 found no DDT, but did show DDE at several sites. The current study repeated sampling in May 2017 at sites from the 2009 and 2016 studies. Sediment samples were collected in triplicate using a ponar sampler and DDT, DDD and DDE were extracted using EPA methods 3540c and 3620c. Extracts were analyzed using a gas chromatograph with electron capture detection (GC-ECD) as per EPA method 8081c. Sediment was also analyzed for organic carbon and particle size using an elemental NC analyzer and a laser diffraction particle sizer. Results show the presence of breakdown products DDE and DDD at multiple sites, but no detectable levels of DDT at any site. Sampling sites with high levels of DDT contamination in 2009 show only breakdown products in both 2016 and 2017. Particle size has little influence on DDD or DDE concentrations but OC is a controlling factor as indicated for contaminated sites by Pearson correlations between OC and DDE and DDD of 0.82 and 0.92, respectively. The presence of only DDD and/or DDE in the 2016 and 2017 studies indicates that the parent, DDT, has not been re-introduced into the watershed since 2009 but is degrading in the environment.

  11. [Impact of regulatory measures in the trends of community consumption of antibiotics in Chile].

    Science.gov (United States)

    Bavestrello, Luis; Cabello, Angela; Casanova, Dunny

    2002-11-01

    The indiscriminate use of antibiotics increases the appearance of bacterial resistance and forces the use of more expensive alternatives. The Chilean Ministry of Health is regulating the consumption of antibiotics since September 1999. These regulatory measures restricted the sale of antibiotics only when these were prescribed by an MD or an DS. To study the impact of these regulatory measures on antibiotics sales in pharmacies. A retrospective analysis of antibiotics sales in pharmacies from 1996 to 2000. The information was obtained from the International Marketing System (IMS Health), an auditing system of pharmacy sales. The consumption unit used was the Defined Daily Dose per 1000 inhabitants/day (DDD). There was an important reduction in DDD, after the introduction of regulatory measures, for amoxicillin, ampicillin, erythromycin, trimethoprim/sulpha, chroramphenicol, cloxacillin and phenoxymethylpenicillin. There was also a important fall in sales, expressed in dollars. The regulatory measures of the Ministry of Health, had an immediate and great impact on antibiotics sales in Chile.

  12. Persistent pesticides in human breast milk and cryptorchidism

    DEFF Research Database (Denmark)

    Damgaard, Ida N; Skakkebaek, Niels E; Toppari, Jorma

    2006-01-01

    ,1,1-trichloro-2,2-bis(4-chlorophenyl) ethane (p,p -DDT) : 4.6/4.0; dieldrin: 4.1/3.1 ; cis-heptachloroepoxide (cis-HE) : 2.5/2.2. Five compounds [octachlorostyrene (OCS); pentachlorobenzene, 1,1-dichloro-2,2-bis(4-chlorophenyl) ethane(p,p -DDD) ; o,p -DDT ; mirex] were measurable in most samples (detection...... delta, epsilon), aldrin, beta-endosulfan and trans-heptachloroepoxide were detected at negligible concentrations and low detection rates and were not analyzed further. Seventeen of 21 organochlorine pesticides [p,p -DDT, p,p-DDE, p,p-DDD, o,p-DDT, HCH (alpha, beta, gamma), HCB, PCA, alpha...

  13. Antimicrobial consumption on Austrian dairy farms: an observational study of udder disease treatments based on veterinary medication records.

    Science.gov (United States)

    Firth, Clair L; Käsbohrer, Annemarie; Schleicher, Corina; Fuchs, Klemens; Egger-Danner, Christa; Mayerhofer, Martin; Schobesberger, Hermann; Köfer, Josef; Obritzhauser, Walter

    2017-01-01

    Antimicrobial use in livestock production is an important contemporary issue, which is of public interest worldwide. Antimicrobials are not freely available to Austrian farmers and can only be administered to livestock by veterinarians, or by farmers who are trained members of the Animal Health Service. Since 2015, veterinarians have been required by law to report antimicrobials dispensed to farmers for use in food-producing animals. The study presented here went further than the statutory framework, and collected data on antimicrobials dispensed to farmers and those administered by veterinarians. Seventeen veterinary practices were enrolled in the study via convenience sampling. These veterinarians were asked to contact interested dairy farmers regarding participation in the study (respondent-driven sampling). Data were collected from veterinary practice software between 1st October 2015 and 30th September 2016. Electronic data (89.4%) were transferred via an online interface and paper records (10.6%) were entered by the authors. Antimicrobial treatments with respect to udder disease were analysed by number of defined daily doses per cow and year (nDDD vet /cow/year), based on the European Medicines Agency technical unit, Defined Daily Dose for animals (DDD vet ). Descriptive statistics and the Wilcoxon rank sum test were used to analyse the results. Antimicrobial use data from a total of 248 dairy farms were collected during the study, 232 of these farms treated cows with antibiotics; dry cow therapy was excluded from the current analysis. The mean number of DDD vet /cow/year for the antimicrobial treatment of all udder disease was 1.33 DDD vet /cow/year. Of these treatments, 0.73 DDD vet /cow/year were classed as highest priority critically important antimicrobials (HPCIAs), according to the World Health Organization (WHO) definition. The Wilcoxon rank sum test determined a statistically significant difference between the median number of DDD vet /cow/year for

  14. The Indian Ocean tsunami and private donations to NGOs.

    Science.gov (United States)

    Kim, Youngwan; Nunnenkamp, Peter; Bagchi, Chandreyee

    2016-10-01

    Non-governmental organisations (NGOs) are widely believed to raise their flag in humanitarian hotspots with a strong media presence in order to attract higher private donations. We assess this hypothesis by comparing the changes in donations between US-based NGOs with and without aid operations in the four countries most affected by the tsunami in the Indian Ocean in 2004. Simple before-after comparisons tend to support the hypothesis that 'flying the flag' helps attract higher private donations. However, performing a difference-in-difference-in-differences (DDD) approach, we find only weak indications that private donors systematically and strongly preferred NGOs with operations in the region. Extended specifications of the baseline regressions reveal that our major findings are robust. NGO heterogeneity matters in some respects, but the DDD results hold when accounting for proxies of the NGOs' reputation and experience. © 2016 The Author(s). Disasters © Overseas Development Institute, 2016.

  15. Stand-alone XLIF

    DEFF Research Database (Denmark)

    Hansen, E. J.; Simony, A.; Hummel, Stefan

    2015-01-01

    and clinical/radiological results in 22 patients treated with XLIF procedure for DS or degenerative disc disease (DDD). Material and methods: 22 consecutive patients with DS underwent surgery with the XLIF stand-alone procedure, with follow-up of 24 months. Clinical outcome scores were collected. Complications......Introduction: Adult thoracolumbar degeneration is an increasing challenge in the aging population. With age the progressive degeneration of the discs leads to an asymmetric collapse and a thoracolumbar coronal plane deformity, a degenerative scoliosis (DS). Aim: To evaluate the complication rate......-year follow-up, with a 31.8% revision rate. Due to the high revision rate we recommend supplementary posterior instrumentation, to achieve a higher fusion rate. When considering XLIF-stand-alone procedure for DS or DDD without supplemental posterior instrumentation, only single-level disease should...

  16. Dissociation and Alterations in Brain Function and Structure: Implications for Borderline Personality Disorder.

    Science.gov (United States)

    Krause-Utz, Annegret; Frost, Rachel; Winter, Dorina; Elzinga, Bernet M

    2017-01-01

    Dissociation involves disruptions of usually integrated functions of consciousness, perception, memory, identity, and affect (e.g., depersonalization, derealization, numbing, amnesia, and analgesia). While the precise neurobiological underpinnings of dissociation remain elusive, neuroimaging studies in disorders, characterized by high dissociation (e.g., depersonalization/derealization disorder (DDD), dissociative identity disorder (DID), dissociative subtype of posttraumatic stress disorder (D-PTSD)), have provided valuable insight into brain alterations possibly underlying dissociation. Neuroimaging studies in borderline personality disorder (BPD), investigating links between altered brain function/structure and dissociation, are still relatively rare. In this article, we provide an overview of neurobiological models of dissociation, primarily based on research in DDD, DID, and D-PTSD. Based on this background, we review recent neuroimaging studies on associations between dissociation and altered brain function and structure in BPD. These studies are discussed in the context of earlier findings regarding methodological differences and limitations and concerning possible implications for future research and the clinical setting.

  17. Pharmacoepidemiological Data from Drug Dispensing Charities as a Measure of Health Patterns in a Population not Assisted by the Italian National Health Service.

    Science.gov (United States)

    Bini, Silvia; Cerri, Cesare; Rigamonti, Antonello E; Bertazzi, Pietro A; Fiorini, Gianfrancesco; Cella, Silvano G

    2016-08-19

    We analysed drug dispensation by charitable organisations in a year time. Drugs were grouped according to the Anatomic Therapeutic Chemical classification and the amount dispensed was calculated with the system of the Daily Defined Dose (DDD) and expressed as DDD/1000 subjects/day. A number of 87,550 subjects were studied (13,308 Italians; 74,242 Immigrants). Though we noticed a great sesonal variability, the drugs most frequently dispensed were those for the respiratory, cardiovascular and gastrointestinal system and antibiotics, which is different from the rest of the Italian population and the immigrant population assisted by our National Health Service (NHS). We also found that chronic diseases are increasing in these subjects. We conclude that the subjects not receiving NHS assitance have, at least in part, different health patterns and requirements. This should be considered when planning tailored interventions.

  18. Pharmacoepidemiological data from drug dispensing charities as a measure of health patterns in a population not assisted by the Italian National Health Service

    Directory of Open Access Journals (Sweden)

    Silvia Bini

    2016-08-01

    Full Text Available We analysed drug dispensation by charitable organisations in a year time. Drugs were grouped according to the Anatomic Therapeutic Chemical classification and the amount dispensed was calculated with the system of the Daily Defined Dose (DDD and expressed as DDD/1000 subjects/day. A number of 87,550 subjects were studied (13,308 Italians; 74,242 Immigrants. Though we noticed a great sesonal variability, the drugs most frequently dispensed were those for the respiratory, cardiovascular and gastrointestinal system and antibiotics, which is different from the rest of the Italian population and the immigrant population assisted by our National Health Service (NHS. We also found that chronic diseases are increasing in these subjects. We conclude that the subjects not receiving NHS assitance have, at least in part, different health patterns and requirements. This should be considered when planning tailored interventions.

  19. POLA PERESEPAN ANTIBIOTIK PADA MANAJEMEN FARINGITIS AKUT DEWASA DI PUSKEMAS

    Directory of Open Access Journals (Sweden)

    Dewi Puspita Apsari

    2017-10-01

    Full Text Available Acute pharyngitis is one of the most common diseases in primary health care, Bali. However, the best management to control the number of antibiotics prescribing in acute pharyngitis is not known. This study aims to determine the best management to control antibiotics prescribing in adult who has acute pharyngitis. This prospective cohort study involved 93 patients aged 12-45 years who had been diagnosed with acute pharyngitis by a physician. Measurements were made on the number of drugs per prescription, frequency antibiotic, quantity antibiotic and DDD antibiotics. Centor Criteria and RADT can reduce the number of antibiotic prescriptions than empirical management in primary health care district X, Bali. Decrease occurred on the the number of drugs per prescription, frequency antibiotic, quantity antibiotic and DDD antibiotics. Management centor criteria and RADT are the best strategies to reduce antibiotic prescription in primary health care distict X, Bali. 

  20. Mesoscopic scale thermal fatigue damage

    International Nuclear Information System (INIS)

    Robertson, C.; Fissolo, A.; Fivel, M.

    2001-01-01

    In an attempt to better understand damage accumulation mechanisms in thermal fatigue, dislocation substructures forming in 316L steel during one specific test were examined and simulated. Hence, thin foils taken out of massive, tested specimens were first observed in transmission electron microscopy (TEM). These observations help in determining one initial dislocation configuration to be implemented in a 3-D model combining 3D discrete dislocation dynamics simulation (DDD) and finite element method computations (FEM). It was found that the simulated mechanical behaviour of the DDD microstructure is compatible with FEM and experimental data. The numerically generated dislocation microstructure is similar to ladder-like dislocation arrangements as found in many fatigued f.c.c. materials. Distinct mechanical behaviour for the two active slip systems was shown and deformation mechanisms were proposed. (authors)

  1. Mesoscopic scale thermal fatigue damage

    Energy Technology Data Exchange (ETDEWEB)

    Robertson, C.; Fissolo, A. [CEA Saclay, Dept. des Materiaux pour le Nucleaire, DMN, 91 - Gif sur Yvette (France); Fivel, M. [Centre National de la Recherche Scientifique, CNRS-GPM2, 38 - Saint Martin d' Heres (France)

    2001-07-01

    In an attempt to better understand damage accumulation mechanisms in thermal fatigue, dislocation substructures forming in 316L steel during one specific test were examined and simulated. Hence, thin foils taken out of massive, tested specimens were first observed in transmission electron microscopy (TEM). These observations help in determining one initial dislocation configuration to be implemented in a 3-D model combining 3D discrete dislocation dynamics simulation (DDD) and finite element method computations (FEM). It was found that the simulated mechanical behaviour of the DDD microstructure is compatible with FEM and experimental data. The numerically generated dislocation microstructure is similar to ladder-like dislocation arrangements as found in many fatigued f.c.c. materials. Distinct mechanical behaviour for the two active slip systems was shown and deformation mechanisms were proposed. (authors)

  2. Dowling–Degos disease with reticulate acropigmentation of Kitamura: Extended spectrum of a single entity

    Directory of Open Access Journals (Sweden)

    Shyam Govind Rathoriya

    2016-01-01

    Full Text Available Dowling–Degos disease (DDD and reticulate acropigmentation of Kitamura (RAK are rare genodermatoses inherited as an autosomal dominant trait with variable penetrance. They are considered to be part of a spectrum of reticulate pigmentary dermatoses, characterized by the presence of hyperpigmented macules coalescing in a reticular fashion. The authors describe a 28-year-old male patient having hyperpigmented macules on the axillae, neck and face, reticulate acropigmentation of dorsum of the hands, forearms and feet, palmar pitting, and comedo-like lesions over back. The patient showed the unique clinical as well as histopathological overlap of both the rare diseases (DDD and RAK, substantiating the hypothesis that they represent two different features of a single entity with variable phenotypic expression.

  3. The Danish Depression Database

    DEFF Research Database (Denmark)

    Videbech, Poul Bror Hemming; Deleuran, Anette

    2016-01-01

    AIM OF DATABASE: The purpose of the Danish Depression Database (DDD) is to monitor and facilitate the improvement of the quality of the treatment of depression in Denmark. Furthermore, the DDD has been designed to facilitate research. STUDY POPULATION: Inpatients as well as outpatients...... with depression, aged above 18 years, and treated in the public psychiatric hospital system were enrolled. MAIN VARIABLES: Variables include whether the patient has been thoroughly somatically examined and has been interviewed about the psychopathology by a specialist in psychiatry. The Hamilton score as well...... as an evaluation of the risk of suicide are measured before and after treatment. Whether psychiatric aftercare has been scheduled for inpatients and the rate of rehospitalization are also registered. DESCRIPTIVE DATA: The database was launched in 2011. Every year since then ~5,500 inpatients and 7,500 outpatients...

  4. Towards an Understanding of Microservices

    OpenAIRE

    Shadija, Dharmendra; Rezai, Mo; Hill, Richard

    2017-01-01

    Microservices architectures are a departure from\\ud traditional Service Oriented Architecture (SOA). Influenced by Domain Driven Design (DDD), microservices\\ud architectures aim to help business analysts and enterprise architects develop scalable applications that embody flexibility for new functionalities as businesses develop, such as scenarios in the Internet of Things (IoT) domain. This article compares microservices architecture with SOA and identifies key characteristics that will assis...

  5. Sibelius. Lemminkäinen-Legenden op. 22 Nr. 1-4 / Christoph Schlüren

    Index Scriptorium Estoniae

    Schlüren, Christoph

    1997-01-01

    Uuest heliplaadist "Sibelius. Lemminkäinen-Legenden op. 22 Nr. 1-4, Pohjolas Tochter op. 49, Nächtlicher Ritt und Sonnenaufgang op. 55; Göteborger Sinfoniker, Neeme Järvi; DG CD 453 426-2 (WD: 70'37") DDD Võrreldud: Opus 22: Segerstam (Ondine 852-2); op. 22 und 55; Paavo Järvi" (Virgin 545 213-2); op. 49: Segerstam (Chandos 8965)

  6. Operations NEW LIFE/NEW ARRIVALS. US Army Support to the Indochina Refugee Program, 1 April 1975-1 June 1976

    Science.gov (United States)

    1977-01-25

    large numbers of refugees materialized. This plan, tentatively called Operation COMPASSION , envisioned that the refugees would at first be evacuated...Mptg ... —nex,- ■>• -g| ._ *M * UNCLASSIFIED * THIS MIGHT INVOLVE OVERNIGHT HOUSING FOR UP TO SDG TRANSIENT PERSONNEL. b- SUBP1IT...DDD REFUGEES AT FT CHAFFEE AND FT INDIANTOUN GAP UAS ACCOMPLISHED WITH COMPASSION AND EFFICIENCY BY THE ARMY TEAMS- ADDITIONALLY-. THE ORDERLY

  7. Distribution, regional sources and deposition fluxes of organochlorine pesticides in precipitation in Guangzhou, South China

    Science.gov (United States)

    Huang, De-Yin; Peng, Ping'an; Xu, Yi-Gang; Sun, Cui-Xiang; Deng, Hong-Mei; Deng, Yun-Yun

    2010-07-01

    We analyzed rainwater collected from multiple sites, Guangzhou, China, from March to August 2005, with the aim to characterize the distribution, regional sources and deposition fluxes of organochlorine pesticides (OCPs) in South China. Eight species of organochlorine pesticide were detected, including hexachlorocyclohexanes (HCHs), dichlorodiphenyltrichloroethanes (DDTs), and endosulfans. Volume-weighted mean monthly total concentrations varied from 3.65 ± 0.95 to 9.37 ± 2.63 ng L - 1 , and the estimated total wet deposition flux was about 11.43 ± 3.27 µg m - 2 during the monitoring period. Pesticides were mainly detected in the dissolved phase. Distribution coefficients between particulate and dissolved phases in March and April were generally higher than in other months. HCHs, p,p'-DDD and p,p'-DDT in precipitation were attributed to both the residues and present usage of insecticides in Pearl River Delta. The concentrations of p,p'-DDD + p,p'-DDT were relatively high from April to August, which were related to the usage of antifouling paints containing DDT for fishing ships in seaports of the South China Sea in summer. In contrast, endosulfans were relatively high in March, which was related to their seasonal atmospheric transport from cotton fields in eastern China by the Asian winter monsoon. The consistency of the variation of endosulfans, p,p'-DDD and p,p'-DDT concentrations with the alternation of summer and winter monsoon suggested that the Asian monsoon played an important role in the long-range transport of OCPs. In addition, the wet deposition of OCPs may influence not only Pearl River water but also the surface land distributions of pesticides in the Guangzhou area, especially for endosulfans, p,p'-DDD and p,p'-DDT.

  8. Correlation analysis of the relationship between B-type natriuretic peptide and selected echocardiographic parameters in patients with permanent pacemakers

    Directory of Open Access Journals (Sweden)

    Janusz Sielski

    2016-01-01

    Full Text Available Introduction: The present study was undertaken to evaluate the practical value of BNP measurements and echocardiographic left ventricular volume index in patients with permanent pacemakers because there are no such reports in the literature. Aim of the research: The aim of the study was to reveal multiple correlations between BNP levels and selected echocardiographic parameters of the left atrium in patients with permanent pacemakers. In the literature there are reports on the significance of BNP values and left atrial size in patients with permanent pacemakers. The results of the present study appear to be of value in the outpatient assessment of these patients. Material and methods: We analysed a group of 117 patients with permanent pacemakers (AAI/R 21 patients, DDD/R 59 patients, VVI/R 37 patients and 48 healthy volunteers serving as the control group. BNP measurements were performed on venous blood samples using Triage meters. The Simpson method and the ellipse method were used to assess the left atrium on echocardiography. Results: There was a significant correlation between BNP and maximum left atrial volume, minimum left atrial volume, and left atrial volume index in patients with AAI/R, DDD/R, and VVI/R pacemakers at 3 and 6 months after the implantation. Conclusions : In patients after implantation of permanent pacemakers there are correlations between BNP values and echocardiographic left atrial parameters, especially in patients with DDD/R pacemakers. Left atrial function improves in patients with DDD/R pacemakers. Pacemaker check-up should be extended to include BNP measurements and echocardiographic assessment of the left atrium.

  9. Elastoplasticity: A link between giant vibrations and overdamped motion

    International Nuclear Information System (INIS)

    Noerenberg, W.

    1984-08-01

    Elastoplasticity of finite Fermi systems results from a non-markovian coupling between collective and intrinsic degrees of freedom and subsequent equilibration essentially due to two-body collisions. Within a transport-theoretical approach referred to as dissipative diabatic dynamics (DDD), elastoplasticity forms the link between giant vibrations and overdamped motion of nuclei. Observable effects resulting from this non-markovian behaviour in nucleus-nucleus collisions are discussed. (orig.)

  10. Occurrence of chlorinated pesticides in mussels of Guanabara Bay, Rio de Janeiro, Brazil

    International Nuclear Information System (INIS)

    Xavier de Brito, A.P.; De Andrade Bruening, I.M.R.; Moreira, I.; Loureiro, I.

    1999-01-01

    Present work investigates the contamination of some chlorinated pesticides in common mussels (Perna perna) from the Guanabara Bay. These mussels can be found in several points near the entrance of the Bay, where they either grow naturally or are cultivated by fishermen which make their living of this activity. Five collecting areas were studied and the concentrations of eight pesticides, namely HCB, γ-HCH, total DDT, DDD and DDE, Aldrin, Dieldrin and Endrin were determined

  11. Drug Use Evaluation of Three Widely Prescribed Antibiotics in a

    Directory of Open Access Journals (Sweden)

    Mehdi Mohammadi

    2015-10-01

    Full Text Available Background: Drug utilization studies are helpful in understanding the current practice. We have conducted a retrospective study to evaluate the relevant use of a group of most commonly prescribed antibiotics in a teaching hospital in Iran.  The results of this study may be of help for clinicians to improve the patient care.Methods: Patients who received parenteral ceftazidim, vancomycin and amikacin from December2010 to May 2011 were enrolled in this study. Patient’s data including demographic, length of Hospital stay, drug allergy, first and final diagnosis were recorded in a predesigned data collection form. American Hospital Formulary Services (AHFS book were used as a reference for evaluation of study drug indication and dosing according to diagnosis and microbiological culture. Defined Daily Dose (DDD of each drug extracted from Anatomic and Therapeutic Chemical classification system (ATC/DDD and drug usage data evaluated by calculating the ratio of prescribed drug to its DDD.Results: The ratio of prescribed daily dose to DDD was 0.78, 0.95 and 0.86 for amikacin, ceftazidime and vancomycin respectively. Between amikacin group, 43 patients (86% received drug empirically, the number of empiric treatments for ceftazidim and vancomycin were 45(90% and 44 patients (88%. The renal function tests (Blood Urea Nitrogen, Serum Creatinin were evaluated in 56% of amikacin group, 64% in ceftazidime group and 78% in vancomycin group.Conclusion: The results of this study indicate the need to establish continuing medical education (CME courses for physicians to familiarize them with standards required to use and monitor these agents.

  12. Theory of and effects from elastoplasticity in nucleus-nucleus collisions

    International Nuclear Information System (INIS)

    Noerenberg, W.; Technische Hochschule Darmstadt

    1985-02-01

    Elastoplasticity of finite Fermi systems results from a coherent coupling between collective and intrinsic degrees of freedom and subsequent equilibration essentially due to two-body collisions. Within a non-markovian transport-theoretical approach referred to as dissipative diabatic dynamics (DDD), elastoplastical forms the link between giant vibrations and overdamped motion of nuclear. Obersvable effects resulting from this non-markovian behaviour in nucleus-nucleus collisions are discussed. (orig.)

  13. Development of a Thermal Desorption Gas Chromatography-Mass Spectrometry Analysis Method for Airborne Dichlorodiphenyltrichloroethane

    Science.gov (United States)

    2013-05-28

    efficiencies of ≤ 100% for DDT-related compounds from homogenized fish (68%-71%) (52), soil (82%- 94%) (38), and air sampling media (77%-100%) (40...for DDT, DDE, and DDD. U.S. Department of Health and Human Services 22. Fish D. 2008. Why we do not understand the ecological connections between... Hamburg MA, Relman DA, Choffnes ER, Mack A. 2008. Vector-Borne Diseases: Understanding the Environmental, Human Health, and Ecological Connections

  14. IMMEDIATE RECIPROCAL CHANGES AT ADJACENT LEVEL FOLLOWING SINGLE-LEVEL ALIF

    OpenAIRE

    Uribe, Enrique Vargas; Amaral, Rodrigo; Marchi, Luis; Jensen, Rubens; Oliveira, Leonardo; Fortti, Fernanda; Coutinho, Etevaldo; Pimenta, Luiz

    2015-01-01

    Objective : To assess the segmental sagittal parameters and the adjacent mobile segment after interbody fusion by anterior approach in single-level L5-S1. Methods : Retrospective study. Inclusion: Interbody fusion by anterior approach (10°/15° angle), due to DDD, low-grade spondylolisthesis and/or stenosis without prior lumbar fusion. Thirty-five cases were included (25 women; mean age 47±15 years). Analysis of lumbar radiographs were performed preoperatively and 3 months after surgery. The ...

  15. Detection and quantification of beef and pork materials in meat products by duplex droplet digital PCR

    OpenAIRE

    Cai, Yicun; He, Yuping; Lv, Rong; Chen, Hongchao; Wang, Qiang; Pan, Liangwen

    2017-01-01

    Meat products often consist of meat from multiple animal species, and inaccurate food product adulteration and mislabeling can negatively affect consumers. Therefore, a cost-effective and reliable method for identification and quantification of animal species in meat products is required. In this study, we developed a duplex droplet digital PCR (dddPCR) detection and quantification system to simultaneously identify and quantify the source of meat in samples containing a mixture of beef (Bos t...

  16. Seasonal variation in penicillin use in Mexico and Brazil: analysis of the impact of over-the-counter restrictions.

    Science.gov (United States)

    Santa-Ana-Tellez, Yared; Mantel-Teeuwisse, Aukje K; Leufkens, Hubert G M; Wirtz, Veronika J

    2015-01-01

    During 2010, Mexico and Brazil implemented policies to enforce existing laws of restricting over-the-counter sales of antibiotics. We determined if the enforcement led to more appropriate antibiotic use by measuring changes in seasonal variation of penicillin use. We used retail quarterly sales data in defined daily doses per 1,000 inhabitant-days (DDD/TID) from IMS Health from the private sector in Mexico and Brazil from the first quarter of 2007 to the first quarter of 2013. This database contains information on volume of antibiotics sold in retail pharmacies using information from wholesalers. We used interrupted time-series models controlling for external factors with the use of antihypertensives with interaction terms to assess changes in trend, level, and variation in use between quarters for total penicillin use and by active substance. The most used penicillin was amoxicillin, followed by amoxicillin-clavulanic acid and ampicillin (minimal use in Brazil). Before the restrictions, the seasonal variation in penicillin use was 1.1 DDD/TID in Mexico and 0.8 DDD/TID in Brazil. In Mexico, we estimated a significant decrease in the seasonal variation of 0.4 DDD/TID after the restriction, mainly due to changes in seasonal variation of amoxicillin and ampicillin. In Brazil, the seasonal variation did not change significantly, overall and in the breakdown by individual active substances. For Mexico, inappropriate penicillin use may have diminished after the restrictions were enforced. For Brazil, increasing use and no change in seasonal variation suggest that further efforts are needed to reduce inappropriate penicillin use. Copyright © 2015, American Society for Microbiology. All Rights Reserved.

  17. An intervertebral disc whole organ culture system to investigate proinflammatory and degenerative disc disease condition.

    Science.gov (United States)

    Lang, Gernot; Liu, Yishan; Geries, Janna; Zhou, Zhiyu; Kubosch, David; Südkamp, Norbert; Richards, R Geoff; Alini, Mauro; Grad, Sibylle; Li, Zhen

    2018-04-01

    The aim of this study was to compare the effect of different disease initiators of degenerative disc disease (DDD) within an intervertebral disc (IVD) organ culture system and to understand the interplay between inflammation and degeneration in the early stage of DDD. Bovine caudal IVDs were cultured within a bioreactor for up to 11 days. Control group was cultured under physiological loading (0.02-0.2 MPa; 0.2 Hz; 2 hr/day) and high glucose (4.5 g/L) medium. Detrimental loading (0.32-0.5 MPa, 5 Hz; 2 hr/day) and low glucose (2 g/L) medium were applied to mimic the condition of abnormal mechanical stress and limited nutrition supply. Tumour necrosis factor alpha (TNF-α) was injected into the nucleus pulposus (100 ng per IVD) as a proinflammatory trigger. TNF-α combined with detrimental loading and low glucose medium up-regulated interleukin 1β (IL-1β), IL-6, and IL-8 gene expression in disc tissue, nitric oxide, and IL-8 release from IVD, which indicate a proinflammatory effect. The combined initiators up-regulated matrix metalloproteinase 1 gene expression, down-regulated gene expression of Type I collagen in annulus fibrosus and Type II collagen in nucleus pulposus, and reduced the cell viability. Furthermore, the combined initiators induced a degradative effect, as indicated by markedly higher glycosaminoglycan release into conditioned medium. The combination of detrimental dynamic loading, nutrient deficiency, and TNF-α intradiscal injection can synergistically simulate the proinflammatory and degenerative disease condition within DDD. This model will be of high interest to screen therapeutic agents in further preclinical studies for early intervention and treatment of DDD. Copyright © 2018 John Wiley & Sons, Ltd.

  18. Seasonal Variation in Penicillin Use in Mexico and Brazil: Analysis of the Impact of Over-the-Counter Restrictions

    Science.gov (United States)

    Santa-Ana-Tellez, Yared; Mantel-Teeuwisse, Aukje K.; Leufkens, Hubert G. M.

    2014-01-01

    During 2010, Mexico and Brazil implemented policies to enforce existing laws of restricting over-the-counter sales of antibiotics. We determined if the enforcement led to more appropriate antibiotic use by measuring changes in seasonal variation of penicillin use. We used retail quarterly sales data in defined daily doses per 1,000 inhabitant-days (DDD/TID) from IMS Health from the private sector in Mexico and Brazil from the first quarter of 2007 to the first quarter of 2013. This database contains information on volume of antibiotics sold in retail pharmacies using information from wholesalers. We used interrupted time-series models controlling for external factors with the use of antihypertensives with interaction terms to assess changes in trend, level, and variation in use between quarters for total penicillin use and by active substance. The most used penicillin was amoxicillin, followed by amoxicillin-clavulanic acid and ampicillin (minimal use in Brazil). Before the restrictions, the seasonal variation in penicillin use was 1.1 DDD/TID in Mexico and 0.8 DDD/TID in Brazil. In Mexico, we estimated a significant decrease in the seasonal variation of 0.4 DDD/TID after the restriction, mainly due to changes in seasonal variation of amoxicillin and ampicillin. In Brazil, the seasonal variation did not change significantly, overall and in the breakdown by individual active substances. For Mexico, inappropriate penicillin use may have diminished after the restrictions were enforced. For Brazil, increasing use and no change in seasonal variation suggest that further efforts are needed to reduce inappropriate penicillin use. PMID:25313222

  19. U.S. Navy Regional Climatic Study of the Central East Asian Coast and Associated Waters

    Science.gov (United States)

    1990-01-01

    and provide many bays and excellent harbors. Much of the volcanic soil is rich and suitable for raising a wide variety of farm products . On the portion...INSNN Amway STNNN.. - N OOANOO .000 Rh ~ ~ ~ ~ ddd 42NOoEM!’MsbmEi O NOO1N M YS.,0 A;z~Soots- 1:§0’zN ; j;EQ~ 1210 12I1 AM M AN MA - wag- 4,004 a 91 V

  20. [Antibiotics utilization in the Intensive Care Unit of the Hospital Dr, Guillermo Rawson-San Juan, Argentina].

    Science.gov (United States)

    Vega, Elena María; Fontana, Daniela; Iturrieta, Martha; Segovia, Liliana; Rodríguez, Gabriela; Agüero, Sandra

    2015-06-01

    To achieve rational use of antibiotics (ATB), is necessary to know its use and prescription patterns over time, Objective: To describe and analyze the characteristics of the use of ATB in the Guillermo Rawson Hospital (GRH) adult intensive care unit (ICU). Observational, descriptive, longitudinal and retrospective study (2008-2011). Pharmacy and Statistics records were consulted, ATC code was used, the group analyzed was J01, Oral or parenteral DDD were assigned, Data was processed with Excel 2007, Unit of measure: DDD/100 bed-days, for each ATB per year and an average of use. Over 4 years, 48 different medicines were dispensed (33 drugs), The average consumption of ATB was 177,07 DDD/100 bed-days and distribution per year was: 183,10, 165,90, 180,94, 178,34, The DDD/100 bed-days average for treatment groups more used were: penicillin (57.10), other β-lactam antibacterials (48.01), other antibacterials (21.07), trimethoprim and sulfonamides (19,54), quinolones (15,64), macrolides/azalides and lincosamides (6,53), aminoglycosides (5,65) and tetracyclines (3,53), There were changes in consumption without clear pattern of increase or decrease. ATB used in the ICU and its variation in use between 2008-2011 were described, The ATB most used were penicillins and other β-lactams and 2008 was the year that more ATB was dispensed. Understanding these patterns of consumption will be useful to develop a founded antibiotic policy reached by consensus and beneficial to the patients.

  1. Metformin Use Correlates with Reduced Risk of Gallstones in Diabetic Patients: A 12-Year Follow-up Study

    OpenAIRE

    Liao, Kuan-Fu; Chuang, Hsun-Yang; Lai, Shih-Wei

    2017-01-01

    Objective: Few studies are available on the association between gallstones and metformin use. The objective of the study was to determine whether metformin use is associated with gallstones. Methods: A population-based retrospective cohort study was conducted using the database of the Taiwan National Health Insurance Program. Subjects of newly diagnosed diabetes mellitus were included from 2002 to 2013. The metformin-exposure group was defined as ≥29 cumulative defined daily dose (DDD) of met...

  2. Metformin Use Correlates with Reduced Risk of Gallstones in Diabetic Patients: A 12-Year Follow-up Study

    OpenAIRE

    Kuan-Fu Liao; Kuan-Fu Liao; Hsun-Yang Chuang; Shih-Wei Lai; Shih-Wei Lai

    2017-01-01

    Objective: Few studies are available on the association between gallstones and metformin use. The objective of the study was to determine whether metformin use is associated with gallstones.Methods: A population-based retrospective cohort study was conducted using the database of the Taiwan National Health Insurance Program. Subjects of newly diagnosed diabetes mellitus were included from 2002 to 2013. The metformin-exposure group was defined as ≥29 cumulative defined daily dose (DDD) of metf...

  3. Results of Amultidisciplinary Antimicrobial Stewardship Program

    Directory of Open Access Journals (Sweden)

    Letícia Gomes Lobo

    2017-01-01

    Full Text Available Background and Objectives: The aim of this study was to evaluate the results of the PCA developed by the Infection Control Service of a university hospital in southern Brazil from January / 2013 to July / 2014. Methods: The PCA is developed by two doctors and a pharmacist infectious disease. They are evaluated all prescriptions carbapenems, vancomycin, polymyxin B, daptomycin, tigecycline, linezolid, voriconazole, micafungin and amphotericin b lipid complex. In need of intervention the same is conducted by telephone with guidance to prescribers or alert in the electronic medical record. Moreover, they are made rounds with teams of cardiac intensive care unit (ICU-CV for case discussion. Results and Conclusion: 5118 requirements were evaluated with an average of 297 prescriptions month. The percentage of crops request in half 1 (January to June / 13, 2 (July to December / 13 and 3 (January to July / 14 was respectively 25%, 35% and 83%. on average they were performed 70 operations / month, where the percentage of accepted interventions in the semester 1,2 and 3 was respectively 61%, 70% and 84%. The defined daily dose (DDD of meropenem in UTI-CV for the period was 231.4 DDD / 1000 patient-days in semestre1, 108.13 DDD / 1000 patient-days in semester 2 and 83.79 DDD / 1000-patient -day in half 3.Nossos data allow to conclude that actions such as encouraging the targeted treatment (culture collection, education and feedback to prescribers (guiding the rational use and active participation in rounds together the care teams can be strategies in the fight against the resistance. KEY WORDS: Infection control. Anti-Infective Agents. Interdisciplinary research.

  4. Evolución de la utilización de antidepresivos, ansiolíticos e hipnóticos en la Comunitat Valenciana. Período 2000-2010

    Directory of Open Access Journals (Sweden)

    Ermengol Sempere Verdú

    2014-10-01

    Conclusiones: La utilización de AD en la CV ha experimentado un gran incremento entre 2000-2010, mientras que el de A e H ha sido moderado, aunque su consumo todavía está por encima del de AD. A pesar de la reducción en el coste de la DDD en ambos grupos, el importe global de la factura en antidepresivos en la CV sigue en aumento.

  5. Importance of ventricular rate after mode switching during low intensity exercise as assessed by clinical symptoms and ventilatory gas exchange.

    Science.gov (United States)

    Brunner-La Rocca, H P; Rickli, H; Weilenmann, D; Duru, F; Candinas, R

    2000-01-01

    Automatic mode switching from DDD(R) to DDI(R) or VVI(R) pacing modes has improved dual chamber pacing in patients at high risk for supraventricular tachyarrhythmias. However, little is known about the effect of ventricular pacing rate adaptation after mode switching. We conducted a single-blinded, crossover study in 15 patients (58 +/- 21 years) with a DDD pacemaker who had AV block and normal sinus node function to investigate the influence of pacing rate adaptation to intrinsic heart rate during low intensity exercise. Patients performed two tests (A/B) of low intensity treadmill exercise (0.5 W/kg) in randomized order. They initially walked for 6 minutes while paced in DDD mode. The pacing mode was then switched to VVI with a pacing rate of either 70 beats/min (test A) or matched to the intrinsic heart rate (95 +/- 11 beats/min test B). Respiratory gas exchange variables were determined and patients classified the effort before and after mode switching on a Borg scale from 6 to 20. Percentage changes of respiratory gas exchange measurements were significantly larger (O2 consumption: -8.2 +/- 5.0% vs. -0.6 +/- 7.2%; ventilatory equivalent of CO2 exhalation: 5.3 +/- 4.9% vs. 1.5 +/- 4.3%; respiratory exchange ratio: 7.0 +/- 2.2% vs. 3.5 +/- 3.0%; end-tidal CO2: -5.7 +/- 2.9% vs. -1.8 +/- 2.7%; all P rate unadjusted than after adjusted mode switching. Mode switching from DDD to VVI pacing is better tolerated and gas exchange measurements are less influenced if ventricular pacing rate is adjusted to the level of physical activity. Thus, pacing rate adjustment should be considered as part of automatic mode switch algorithms.

  6. Enhanced reductive dechlorination of DDT in an anaerobic system of dissimilatory iron-reducing bacteria and iron oxide

    International Nuclear Information System (INIS)

    Li, F.B.; Li, X.M.; Zhou, S.G.; Zhuang, L.; Cao, F.; Huang, D.Y.; Xu, W.; Liu, T.X.; Feng, C.H.

    2010-01-01

    The transformation of DDT was studied in an anaerobic system of dissimilatory iron-reducing bacteria (Shewanella decolorationis S12) and iron oxide (α-FeOOH). The results showed that S. decolorationis could reduce DDT into DDD, and DDT transformation rate was accelerated by the presence of α-FeOOH. DDD was observed as the primary transformation product, which was demonstrated to be transformed in the abiotic system of Fe 2+ + α-FeOOH and the system of DIRB + α-FeOOH. The intermediates of DDMS and DBP were detected after 9 months, likely suggesting that reductive dechlorination was the main dechlorination pathway of DDT in the iron-reducing system. The enhanced reductive dechlorination of DDT was mainly due to biogenic Fe(II) sorbed on the surface of α-FeOOH, which can serve as a mediator for the transformation of DDT. This study demonstrated the important role of DIRB and iron oxide on DDT and DDD transformation under anaerobic iron-reducing environments. - This is the first case reporting the reductive dechlorination of DDT in an anaerobic system of dissimilatory iron-reducing bacteria and iron oxide.

  7. Association between nutritional status and Modic classification in degenerative disc disease.

    Science.gov (United States)

    Seyithanoglu, Hakan; Aydin, Teoman; Taşpınar, Ozgur; Camli, Adil; Kiziltan, Huriye; Eris, Ali Hikmet; Hocaoglu, Ilknur Turk; Ozder, Aclan; Denizli, Ebru; Kepekci, Muge; Keskin, Yasar; Mutluer, Ahmet Serdar

    2016-04-01

    [Purpose] This study was conducted to examine the association between Modic classification and the eating habits in patients with degenerative disc disease (DDD) and to determine the influence of nutrition on disease severity. [Subjects and Methods] Sixty patients with DDD visiting a low back pain outpatient clinic were enrolled. Through face-to-face interviews, they completed questionnaires regarding their demographics, disease activity, smoking and alcohol use, concomitant diseases, disease duration, and nutritional status.Exclusion criteria were age 65 years, other comorbidities, missing MRI data, and inability to speak Turkish. [Results] Forty patients were finally included in the study. The frequency with which they consumed water, salt, fast food, eggs, milk, yogurt, cheese, whole wheat bread, white bread, butter, and margarine was recorded. A weak negative correlation was observed between the Modic types and fish and egg consumption. [Conclusion] Modic changes, which indicate the severity of DDD, seem to be correlated to patients' dietary habits. However, studies with comparison groups and larger samples are needed to confirm our promising results before any cause-and-effect relationship can be proposed.

  8. I-123 metaiodobenzylguanidine cardiac scintigraphy in patients with an implanted permanent pacemaker

    International Nuclear Information System (INIS)

    Nakata, Akio; Hirota, Satoshi; Tsuji, Hiroshi; Takazakura, Eisuke

    1995-01-01

    Tl scintigraphic abnormalities have been reported in patients with an implanted permanent pacemaker, but little is known about the MIBG scintigraphic findings in such patients. This study was performed to assess the MIBG scintigraphic findings in patients with an implanted permanent pacemaker, and to test the hypothesis that imaging characteristics of MIBG scintigraphy differ according to its mode. Twelve patients (4 men and 8 women, mean age: 72.4±9.5 years), who had undergone the implantation of a permanent pacemaker for bradyarrhythmias, underwent MIBG scintigraphy. The patients were divided into VVI pacemaker and DDD pacemaker groups. The tomograms were divided into nine segments and the MIBG defect in each segment scored on a scale ranging from 0 (normal uptake) to 3 (no uptake). Total MIBG defect scores were generated by summing the scores for the nine segments in each patient. MIBG scintigraphic abnormalities were found in ten of the twelve patients. The six patients with the VVI pacemaker manifested MIBG scintigraphic abnormalities. These MIBG scintigraphic abnormalities were observed in all segments, particularly in the posterior segments. The mean total defect score of the VVI group was higher than that of the DDD group (14.8±9.8 vs 3.0±3.5, respectively p<0.05). Therefore, we conclude that despite several limitations of the study, MIBG scintigraphic abnormalities occur in patients with implanted permanent pacemakers, and that such abnormalities are more prominent with the VVI than DDD pacemaker. (author)

  9. Organo-halogenated contaminants (OHCs) in the sediments from the Soan River, Pakistan: OHCs(adsorbed TOC) burial flux, status and risk assessment.

    Science.gov (United States)

    Malik, Riffat Naseem; Mehboob, Fouzia; Ali, Usman; Katsoyiannis, Athanasios; Schuster, Jasmin K; Moeckel, Claudia; Jones, Kevin C

    2014-05-15

    In this study, regression analysis revealed that TOC is the principal factor in controlling the fate of organo-halogenated contaminants (OHCs: PCBs, PBDEs, OCPs) in Soan River, Pakistan. The OHCs(adsorbed TOC) burial flux (OHCs(adsorbed TOC)Bf; mg/cm(2)·yr) was calculated in the following ranges: ∑PCBs (0.07-0.31), ∑PBDEs (0.005-0.029), ∑HCHs (0.015-0.046) and ∑DDTs (0.007-0.039). Apart from OHCs(adsorbed TOC)Bf, the levels of OHCs were in the following order: PCBs>DDTs>PBDEs>HCH>Chlordane>HCB. PBDEs and PCB congener patterns showed following order respectively: BDE-149>-153>-18>-138>-44 and PCB-149>-153>-18>-138>-44. DDT isomers and metabolites' pattern were p,p'-DDT>p,p'-DDD>p,p'-DDE>o,p'-DDT>o,p'-DDD>o,p'-DDE and HCHs were β-HCH>α-HCH>γ-HCH>δ-HCH. PBDE composition had similarities to penta-BDE and DE-71 mixtures and PCBs with commercial products Aroclor-1254 and -1260. (DDE+DDD)/∑DDTs and p,p'-DDT/p,p'-DDE suggested the recent input of DDTs in sediments while α/γ-HCH indicated past usage of lindane and technical mixtures. Risk assessment suggested that Soan River and its tributaries are potentially at risk against most of the OHCs. Copyright © 2014 Elsevier B.V. All rights reserved.

  10. The First Report of KRT5 Mutation Underlying Acantholytic Dowling-Degos Disease with Mottled Hypopigmentation in an Indian Family

    Science.gov (United States)

    Verma, Shyam; Pasternack, Sandra M.; Rütten, Arno; Ruzicka, Thomas; Betz, Regina C.; Hanneken, Sandra

    2014-01-01

    Galli Galli disease (GGD) is the name given to a rare form of acantholytic Dowling-Degos disease. (DDD), the latter itself being a rare condition. We believe we are describing for the first time in Indian dermatologic literature a case of GGD in a family where 25 persons have DDD and have been able to document a KRT5 mutation in four members of the family. Whereas reticulate pigmentation is a hallmark of DDD there are rare reports of mottled pigmentation with multiple asymptomatic hypopigmented macules scattered diffusely along with the pigmentation. All the cases described here show a mottled pigmentation comprising hypo and hyperpigmented asymptomatic macules. After the clinical diagnosis was made by one of the authors (SV) in India, the German authors repeated histological examination and successfully demonstrated a heterozygous nonsense mutation, c.C10T (p.Gln4X), in exon 1 of the KRT5 gene, from various centers in Munich, Bonn, Dusseldorf and Friedrichschafen in Germany. PMID:25284854

  11. EVALUASI KUANTITAS PENGGUNAAN OBAT ANTIASMA PADA PASIEN ASMA SERANGAN AKUT DI RUMAH SAKIT PARU RESPIRA YOGYAKARTA

    Directory of Open Access Journals (Sweden)

    Lolita

    2017-10-01

    Full Text Available Asthma is a chronic airway inflammatory disease characterized by wheezing, coughing, and tightness in the chest due to airway obstruction. Asthma attacks has variation from mild to severe and can even be fatal or life-threatening (Rai and Artana, 2016. ATC / DDD system means the evaluation methods of the drug use to improve the quality of the use of drug. This study aims to determine the quantity of the use of antiasma’s drug in acute asthma attack patients at RS Paru Respira Yogyakarta in 2016 by the ATC/DDD method. This study was an observational study with retrospective data collection in 2016. The data analysis was done by calculating the percentage of the quantity of drug use by Defined Daily Dose (DDD per 1000 KPRJ. The result was found that there were 82 patients with inclusion criteria of 129 cases in RS Paru Respira Yogyakarta in 2016. There are 62,20% women and 37,80% men. Age characteristics of 36-45 years old more frequently got acute attacks of asthma (52,40% compared with the age of 26-35 years amount of 47.60%. The quantity evaluation of antiasma usage in the acute attack asthma patients was formoterol 70.7 / 1000 KPRJ higher than Hbr phenoterol of 0.02 / 1000 KPRJ.

  12. Preconceptional motivational interviewing interventions to reduce alcohol-exposed pregnancy risk.

    Science.gov (United States)

    Ingersoll, Karen S; Ceperich, Sherry D; Hettema, Jennifer E; Farrell-Carnahan, Leah; Penberthy, J Kim

    2013-04-01

    Alcohol exposed pregnancy (AEP) is a leading cause of preventable birth defects. While randomized controlled trials (RCTs) have shown that multi-session motivational interviewing-based interventions reduce AEP risk, a one-session intervention could facilitate broader implementation. The purposes of this study were to: (1) test a one-session motivational AEP prevention intervention for community women and (2) compare outcomes to previous RCTs. Participants at risk for AEP (N=217) were randomized to motivational interviewing+assessment feedback (EARLY), informational video, or informational brochure conditions. Outcomes were drinks per drinking day (DDD), ineffective contraception rate, and AEP risk at 3 and 6 months. All interventions were associated with decreased DDD, ineffective contraception rate, and AEP risk. Participants who received EARLY had larger absolute risk reductions in ineffective contraception and AEP risk, but not DDD. Effect sizes were compared to previous RCTs. The one-session EARLY intervention had less powerful effects than multi-session AEP prevention interventions among community women, but may provide a new option in a continuum of preventive care. Copyright © 2013 Elsevier Inc. All rights reserved.

  13. Influence of arsenic co-contamination on DDT breakdown and microbial activity

    International Nuclear Information System (INIS)

    Zwieten, Lukas van; Ayres, Matthew R.; Morris, Stephen G.

    2003-01-01

    Co-occurrence of arsenic and DDT in soil may result increased persistence of DDT. - The impacts of arsenic co-contamination on the natural breakdown of 1,1,1-trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) in soil are investigated in a study of 12 former cattle dip sites located in northeastern NSW, Australia. This study examines the relationship between the intrinsic breakdown of DDT to 1,1-dichloro-2,2-bis(4-chlorophenyl)ethane (DDD) and 1,1-dichloro-2,2-bis(4-chlorophenyl)ethylene (DDE), and the impacts of arsenic co-contamination on this breakdown. Between-site analysis demonstrated that arsenic at 2000 mg/kg gave a 50% reduction in the concentration of DDD compared to background arsenic of 5 mg/kg. Within-site analysis also showed the ratio of DDT:DDD increased in soils as arsenic concentrations increased. This within-site trend was also apparent with the DDT:DDE ratio, suggesting inhibition of DDT breakdown by arsenic co-contamination. Microbial activity was inhibited as residues of total DDTs and arsenic increased. Hence arsenic co-contamination and high concentrations of DDT in soil may result in an increased persistence of DDT in the environment studied

  14. Cardiovascular drugs consumption--comparison between two Croatian regions, City of Zagreb and Lika-Senj County.

    Science.gov (United States)

    Jurković, Drazen; Stimac, Danijela; Bajramović, Dubravko; Tiljak, Hrvoje; Stevanović, Ranko

    2014-06-01

    The aim of this paper is to determine the differences in the outpatient consumption of cardiovascular drugs between Croatian regions: the City of Zagreb and Lika-Senj County. The data on the number of packages and the purchase price for each drug have been obtained from all pharmacies in Lika-Senj County and all pharmacies in the City of Zagreb. Defined daily doses/1000 inhabitants/day (DDD/1000/day) was calculated for every drug in accordance with its code name and Anatomical Therapeutic Chemical/Defined Daily Dose (ATC/DDD) index of the World Health Organization (WHO) for 2007. For drug combinations without defined daily doses, equivalent doses (ED) were used. The quality of drug prescribing within the group of cardiovascular drugs was assessed using the Drug Utilization (DU90%) method and the adherence of the DU90% segment to the guidelines for prescribing individual drug groups. The statistical significance of differences in results between the City of Zagreb and Lika-Senj County was tested using the chi-square test at the level of statistical significance p Zagreb (chi2 = 28.93, df = 4, p Zagreb and Lika-Senj County differs significantly. The consumption, quality of prescribing drugs and cost/DDD in the City of Zagreb is higher than in Lika-Senj County; in the City of Zagreb, newer and more expensive drugs are prescribed to a higher extent.

  15. Enhanced reductive dechlorination of DDT in an anaerobic system of dissimilatory iron-reducing bacteria and iron oxide

    Energy Technology Data Exchange (ETDEWEB)

    Li, F.B., E-mail: cefbli@soil.gd.c [Guangdong Key Laboratory of Agricultural Environment Pollution Integrated Control, Guangdong Institute of Eco-Environmental and Soil Sciences, Guangzhou 510650 (China); Li, X.M. [Guangdong Key Laboratory of Agricultural Environment Pollution Integrated Control, Guangdong Institute of Eco-Environmental and Soil Sciences, Guangzhou 510650 (China); Guangzhou Institute of Geochemistry, Chinese Academy of Sciences, Guangzhou 510640 (China); Graduate School of Chinese Academy of Sciences, Beijing 100039 (China); Zhou, S.G.; Zhuang, L. [Guangdong Key Laboratory of Agricultural Environment Pollution Integrated Control, Guangdong Institute of Eco-Environmental and Soil Sciences, Guangzhou 510650 (China); Cao, F. [Guangdong Key Laboratory of Agricultural Environment Pollution Integrated Control, Guangdong Institute of Eco-Environmental and Soil Sciences, Guangzhou 510650 (China); Guangzhou Institute of Geochemistry, Chinese Academy of Sciences, Guangzhou 510640 (China); Graduate School of Chinese Academy of Sciences, Beijing 100039 (China); Huang, D.Y.; Xu, W.; Liu, T.X. [Guangdong Key Laboratory of Agricultural Environment Pollution Integrated Control, Guangdong Institute of Eco-Environmental and Soil Sciences, Guangzhou 510650 (China); Feng, C.H. [School of Chemistry and Chemical Engineering, South China University of Technology, Guangzhou 510641 (China)

    2010-05-15

    The transformation of DDT was studied in an anaerobic system of dissimilatory iron-reducing bacteria (Shewanella decolorationis S12) and iron oxide (alpha-FeOOH). The results showed that S. decolorationis could reduce DDT into DDD, and DDT transformation rate was accelerated by the presence of alpha-FeOOH. DDD was observed as the primary transformation product, which was demonstrated to be transformed in the abiotic system of Fe{sup 2+} + alpha-FeOOH and the system of DIRB + alpha-FeOOH. The intermediates of DDMS and DBP were detected after 9 months, likely suggesting that reductive dechlorination was the main dechlorination pathway of DDT in the iron-reducing system. The enhanced reductive dechlorination of DDT was mainly due to biogenic Fe(II) sorbed on the surface of alpha-FeOOH, which can serve as a mediator for the transformation of DDT. This study demonstrated the important role of DIRB and iron oxide on DDT and DDD transformation under anaerobic iron-reducing environments. - This is the first case reporting the reductive dechlorination of DDT in an anaerobic system of dissimilatory iron-reducing bacteria and iron oxide.

  16. [Systemic Antimicrobials Consumption and Expenditures in Departments of Surgery of Multi-Profile Hospitals in the Russian Federation and the Republic of Belarus: Results of Multicentre Pharmacoepidemiological Study].

    Science.gov (United States)

    Belkova, Yu A; Rachina, S A; Kozlov, R S; Mishchenko, V M; Pavlukov, R A; Abubakirova, A I; Berezhanskiy, B V; Eliseeva, E V; Zubareva, N A; Karpov, I A; Kopylova, I A; Palyutin, Sh Kh; Portnyagina, U S; Pribytkova, O V; Samuylo, E K

    2016-01-01

    The results of the systemic antimicrobials (AM) consumption and expenditures assessment in the departments of surgery of multi-profile hospitals in different regions of the Russian Federation and the Republic of Belarus in 2009-2010 based on retrospective collection and analysis of the data from the hospital expenditure notes using ATC/DDD methodology are presented. The average AM consumption and expenditure rates in the above mentioned departments varied from 24.9 DDD/100 bed-days to 61.7 DDD/100 bed-days depending on the department profile, with beta-lactams (cephalosporins and penicillins) share in the consumption being as high as 70-90%, followed by fluoroquinolones and aminoglycosides. Only 55-70% of the consumed AM belonged to the drugs of choice, whereas the improper AM consumption and expenditure rates amounted up to 10-18%. The study outputs can be used for the budget allocation and AM distribution improvement in the departments of surgery, as well as for the development and efficacy control of the local antimicrobial stewardship programs.

  17. Antimicrobial use in Belgian broiler production.

    Science.gov (United States)

    Persoons, Davy; Dewulf, Jeroen; Smet, Annemieke; Herman, Lieve; Heyndrickx, Marc; Martel, An; Catry, Boudewijn; Butaye, Patrick; Haesebrouck, Freddy

    2012-08-01

    The use of antimicrobials in production animals has become a worldwide concern in the face of rising resistance levels in commensal, pathogenic and zoonotic bacteria. In the years 2007 and 2008 antimicrobial consumption records were collected during two non consecutive production cycles in 32 randomly selected Belgian broiler farms. Antimicrobials were used in 48 of the 64 monitored production cycles, 7 farms did not use any antimicrobials in both production cycles, 2 farms only administered antimicrobials in one of the two production cycles, the other 23 farms applied antimicrobial treatment in both production cycles. For the quantification of antimicrobial drug use, the treatment incidences (TI) based on the defined daily doses (the dose as it should be applied: DDD) and used daily doses (the actual dose applied: UDD) were calculated. A mean antimicrobial treatment incidence per 1000 animals of 131.8 (standard deviation 126.8) animals treated daily with one DDD and 121.4 (SD 106.7) animals treated daily with one UDD was found. The most frequently used compounds were amoxicillin, tylosin and trimethoprim-sulphonamide with a mean TI(UDD) of 37.9, 34.8, and 21.7, respectively. The ratio of the UDD/DDD gives an estimate on correctness of dosing. Tylosin was underdosed in most of the administrations whereas amoxicillin and trimethoprim-sulphonamide were slightly overdosed in the average flock. Copyright © 2012 Elsevier B.V. All rights reserved.

  18. Radical cystectomy: Analysis of postoperative course

    Directory of Open Access Journals (Sweden)

    Jeremić Dimitrije

    2010-01-01

    Full Text Available Background/Aim. Radical cystectomy is a method of choice in the therapy of infiltrative bladder cancer. The aim of this research was to analyze postoperative course after radical cystectomy (length of hospitalization, most frequent complications and utilization of antibiotics and transfusions. Methods. We analyzed the records of 82 patients operated on in the Department of Urology, Clinical Center of Vojvodina, in a three-year period. In order to aquire data World Health Organization (WHO has developed Anatomical Therapeutic Chemical/Defined Daily Dose (ATC/DDD methodology. Defined daily dose (DDD is the assumed average maintenance dose per day for a drug use for its main indication. Results. Continent urinary derivation was preformed in 23.15% cases. Postoperative complications occurred in 18.29% of patients. Average blood utilization was 2.19 units. Blood utilization for continent derivations (n = 48 was 4.6 units, and incontinent ones 3.36 units. Totally 159.33 DDD/100 bed days were used. Conclusion. When preforming continent derivation there is a significant increase in blood utilization. Frequency of postoperative complications correlates to those reported in the literature.

  19. Molecular Therapy for Degenerative Disc Disease: Clues from Secretome Analysis of the Notochordal Cell-Rich Nucleus Pulposus

    Science.gov (United States)

    Matta, Ajay; Karim, M. Zia; Isenman, David E.; Erwin, W. Mark

    2017-01-01

    Degenerative disc disease (DDD) is associated with spinal pain often leading to long-term disability. However, the non-chondrodystrophic canine intervertebral disc is protected from the development of DDD, ostensibly due to its retention of notochordal cells (NC) in the nucleus pulposus (NP). In this study, we hypothesized that secretome analysis of the NC-rich NP will lead to the identification of key proteins that delay the onset of DDD. Using mass-spectrometry, we identified 303 proteins including components of TGFβ- and Wnt-signaling, anti-angiogeneic factors and proteins that inhibit axonal ingrowth in the bioactive fractions of serum free, notochordal cell derived conditioned medium (NCCM). Ingenuity Pathway Analysis revealed TGFβ1 and CTGF as major hubs in protein interaction networks. In vitro treatment with TGFβ1 and CTGF promoted the synthesis of healthy extra-cellular matrix proteins, increased cell proliferation and reduced cell death in human degenerative disc NP cells. A single intra-discal injection of recombinant TGFβ1 and CTGF proteins in a pre-clinical rat-tail disc injury model restored the NC and stem cell rich NP. In conclusion, we demonstrate the potential of TGFβ1 and CTGF to mitigate the progression of disc degeneration and the potential use of these molecules in a molecular therapy to treat the degenerative disc. PMID:28358123

  20. [Generic drugs and the consumption trends of antihypertensives in Morocco].

    Science.gov (United States)

    Berrada El Azizi, Ghizlane; Ahid, Samir; Ghanname, Imane; Ghannam, Imane; Belaiche, Abdelmajid; Hassar, Mohammed; Cherrah, Yahia

    2013-01-01

    To evaluate the evolution of consumption of antihypertensive drugs generic among 1991-2010, to assess the impacts after the institution of Mandatory Health Insurance and the marketing of generic drugs. We used sales data from the Moroccan subsidiary of IMS Health Intercontinental Marketing Service. Consumption of generic antihypertensive drugs increased from 0.08 to 10.65 DDD/1 000 inhabitants/day between 1991 and 2010. In 2010, generic of the calcium channel blockers (CCBs) represented 4.08 DDD/1 000 inhabitants/day (82.09%), followed by angiotensin converting enzyme inhibitors (ACEI) by 2.40 DDD/1 000 inhabitants/day (48.29%). The generics market of CCBs is the most dominant and represented in 2010, 79.21% in volume and 62.58% in value. In developing countries like Morocco, the generic drug is a key element for access to treatment especially for the poor population. © 2013 Société Française de Pharmacologie et de Thérapeutique.

  1. Design and implementation of an XML based object-oriented detector description database for CMS

    International Nuclear Information System (INIS)

    Liendl, M.

    2003-04-01

    This thesis deals with the development of a detector description database (DDD) for the compact muon solenoid (CMS) experiment at the large hadron collider (LHC) located at the European organization for nuclear research (CERN). DDD is a fundamental part of the CMS offline software with its main applications, simulation and reconstruction. Both are in need of different models of the detector in order to efficiently solve their specific tasks. In the thesis the requirements to a detector description database are analyzed and the chosen solution is described in detail. It comprises the following components: an XML based detector description language, a runtime system that implements an object-oriented transient representation of the detector, and an application programming interface to be used by client applications. One of the main aspects of the development is the design of the DDD components. The starting point is a domain model capturing concisely the characteristics of the problem domain. The domain model is transformed into several implementation models according to the guidelines of the model driven architecture (MDA). Implementation models and appropriate refinements thereof are foundation for adequate implementations. Using the MDA approach, a fully functional prototype was realized in C++ and XML. The prototype was successfully tested through seamless integration into both the simulation and the reconstruction framework of CMS. (author)

  2. A case of regression of atypical dense deposit disease without C3 deposition in a child.

    Science.gov (United States)

    Kim, Min Sun; Hwang, Pyoung Han; Kang, Mung Jae; Lee, Dae-Yeol

    2010-07-01

    Dense deposit disease (DDD) is a rare disorder characterized by the deposition of abnormal electron-dense material within the glomerular basement membrane of the kidneys. The diagnosis is made in most patients between 5 and 15 years of age, and within 10 years, approximately half of the affected patients progress to end-stage renal disease. We report a rare case of regressive DDD without C3 deposition after steroid therapy in an 11-year-old boy. The patient presented with edema, gross hematuria, and nephrotic-range proteinuria. Laboratory testing revealed a serum creatinine level of 1.17 mg/dL, albumin level of 2.3 g/dL, and serum C3 level of 125 mg/dL (range 90-180 mg/dL). The results of the renal biopsy were consistent with DDD without C3 deposition. After 6 weeks of steroid therapy, the nephrotic syndrome completely resolved. The follow-up renal biopsy showed a significant reduction in mesangial proliferation and disappearance of electron-dense deposits in the GBM.

  3. Improving signal to noise in labeled biological specimens using energy-filtered TEM of sections with a drift correction strategy and a direct detection device.

    Science.gov (United States)

    Ramachandra, Ranjan; Bouwer, James C; Mackey, Mason R; Bushong, Eric; Peltier, Steven T; Xuong, Nguyen-Huu; Ellisman, Mark H

    2014-06-01

    Energy filtered transmission electron microscopy techniques are regularly used to build elemental maps of spatially distributed nanoparticles in materials and biological specimens. When working with thick biological sections, electron energy loss spectroscopy techniques involving core-loss electrons often require exposures exceeding several minutes to provide sufficient signal to noise. Image quality with these long exposures is often compromised by specimen drift, which results in blurring and reduced resolution. To mitigate drift artifacts, a series of short exposure images can be acquired, aligned, and merged to form a single image. For samples where the target elements have extremely low signal yields, the use of charge coupled device (CCD)-based detectors for this purpose can be problematic. At short acquisition times, the images produced by CCDs can be noisy and may contain fixed pattern artifacts that impact subsequent correlative alignment. Here we report on the use of direct electron detection devices (DDD's) to increase the signal to noise as compared with CCD's. A 3× improvement in signal is reported with a DDD versus a comparably formatted CCD, with equivalent dose on each detector. With the fast rolling-readout design of the DDD, the duty cycle provides a major benefit, as there is no dead time between successive frames.

  4. Stem-cell treatment in disc degeneration: What is the evidence? Células madre en el tratamiento de degeneración de disco: ¿Cual es la evidencia? Células tronco no tratamento de doença degenerativa discal: Qual é a evidência?

    Directory of Open Access Journals (Sweden)

    Manuela Peletti-Figueiró

    2013-01-01

    Full Text Available To review the potential role of stem cells in treating degenerative disc disease of the intervertebral disc (IVD. A review was performed of articles from the Medline database concerning stem cells and degenerative disc disease (DDD. To discuss the data, the papers were classified as: review, in vitro, experimental, and clinical. The currently available treatments were basically for symptom reduction, not to revert the IVD degenerative process. The use of mesenchymal stem cells (MSC is being proposed as an option of treatment for DDD. In vitro studies have shown that the MSC are able to differentiate into NP cells and that the MSC also reduce the inflammatory levels of the degenerated IVD. Besides, experimental studies demonstrated that the MSC remained viable when injected into the IVD, and that they were able to regenerate partially from the degenerated IVD and its structure. The few clinical studies found in the literature presented diverging results. The use of MSC is being widely studied and shows promising results for the treatment of DDD. Although many advances are being achieved in studies in vitro and experimental, there is a lack of clinical studies to prove the role of MSC in DDD management.Revisar el papel potencial de las células madre en el tratamiento de la enfermedad degenerativa del disco intervertebral (IVD. Se realizó una revisión de los artículos de la base de datos Medline sobre células madre y la enfermedad degenerativa del disco (DDD. Para fines de discusión de los datos, los trabajos se dividieron en: revisión, in vitro, experimentales y clínicos. Los tratamientos disponibles actualmente enfocan básicamente la reducción de los síntomas, y no la reversión del proceso degenerativo del IVD. El uso de células madre mesenquimales (MSC se propone como una opción de tratamiento para DDD. Estudios in vitro demostraron que las MSC son capaces de diferenciarse en células NP y que las MSC también reducen los niveles

  5. Sequestration of organochlorine pesticides in soils of distinct organic carbon content

    International Nuclear Information System (INIS)

    Zhang Na; Yang Yu; Tao Shu; Liu Yan; Shi Kelu

    2011-01-01

    In the present study, five soil samples with organic carbon contents ranging from 0.23% to 7.1% and aged with technical dichlorodiphenyltrichloroethane (DDT) and hexachlorocyclohexane (HCH) for 15 months were incubated in a sealed chamber to investigate the dynamic changes of the OCP residues. The residues in the soils decreased over the incubation period and finally reached a plateau. Regression analysis showed that degradable fractions of OCPs were negatively correlated with soil organic carbon (SOC) except for α-HCH, while no correlation was found between degradation rate and SOC, which demonstrated that SOC content determines the OCP sequestration fraction in soil. Analysis of the ratio of DDT and its primary metabolites showed that, since it depends on differential sequestration among them, magnitude of (p,p'-DDE + p,p'-DDD)/p,p'-DDT is not a reliable criterion for the identification of new DDT sources. - Research highlights: → Soil organic carbon content determines the OCP sequestration fraction in soil. → Magnitude of (p,p'-DDE + p,p'-DDD)/p,p'-DDT is not a reliable criterion for the identification of new DDT sources. → The more hydrophobic compounds have relatively higher sequestration fractions in soils with SOC contents >2%. → DDD may have higher sorption by soil organic matter than DDE. - The effect of soil organic matter on the sequestration of organochlorine pesticides (HCHs and DDTs) in soils was investigated in an innovative microcosm chamber.

  6. Implementation and impact of an audit and feedback antimicrobial stewardship intervention in the orthopaedics department of a tertiary-care hospital: a controlled interrupted time series study.

    Science.gov (United States)

    Tavares, Margarida; Carvalho, Ana Cláudia; Almeida, José Pedro; Andrade, Paulo; São-Simão, Ricardo; Soares, Pedro; Alves, Carlos; Pinto, Rui; Fontanet, Arnaud; Watier, Laurence

    2018-06-01

    A prospective audit and feedback antimicrobial stewardship intervention conducted in the Orthopaedics Department of a university hospital in Portugal was evaluated by comparing an interrupted time series in the intervention group with a non-intervention (control) group. Monthly antibiotic use (except cefazolin) was measured as the World Health Organization's Anatomical Therapeutic Chemical defined daily doses (ATC-DDD) from January 2012 to September 2016, excluding the 6-month phase of intervention implementation starting on 1 January 2015. Compared with the control group, the intervention group had a monthly decrease in the use of fluoroquinolones by 2.3 DDD/1000 patient-days [95% confidence interval (CI) -3.97 to -0.63]. An increase in the use of penicillins by 103.3 DDD/1000 patient-days (95% CI 47.42 to 159.10) was associated with intervention implementation, followed by a decrease during the intervention period (slope = -5.2, 95% CI -8.56 to -1.82). In the challenging scenario of treatment of osteoarticular and prosthetic joint infections, an audit and feedback intervention reduced antibiotic exposure and spectrum. Copyright © 2018 Elsevier B.V. and International Society of Chemotherapy. All rights reserved.

  7. Levels and patterns of DDTs in maternal colostrum from an island population and exposure of neonates

    International Nuclear Information System (INIS)

    Xu, Chenye; Tang, Mengling; Zhang, Honghui; Zhang, Chunlong; Liu, Weiping

    2016-01-01

    Dichlorodiphenyltrichloroethane (DDT) was heavily used in the past in many regions of the world. The occurrence of DDTs in island populations may be elevated if the island is adjacent to major DDT consumption estuaries, such as the Yangtze River Delta. In this study, colostrum samples were collected from maternal-neonate pairs (n = 106) from the Shengsi Island, located directly downstream from the Yangtze River outlet. DDT isomers and enantiomer compositions were analyzed by gas chromatography equipped with mass spectrometer (GC/MS) and GC/MS-MS. The average levels of p,p’-DDE, o,p’-DDD, p,p’-DDD, o,p’-DDT, p,p’-DDT and total DDTs were 1.32, 0.03, 0.09, 0.08, 0.48, and 1.93  μg g"−"1 lipid weight, respectively. Maternal age and pregnancy body mass index (BMI) were positively associated with levels of DDTs (p < 0.05). High (DDE+DDD)/DDT and p,p′-DDE/p,p′-DDT ratios suggested that current DDT residues originated primarily from historical use of DDT products, but new sources may also contribute partially to some high o,p′-DDT/p,p′-DDT ratios. Enantiomeric enrichment was found for the (−)-enantiomer of o,p’-DDD and the (+)-enantiomer of o,p’-DDT, suggesting stereoselective attenuation. Based on breast milk consumption, the average daily intake of DDTs by neonates was 8.33 ± 7.34 μg kg"−"1bw per day, which exceeded the WHO's tolerable daily intake guideline of 0.01 mg kg"−"1 bw per day by 25%, implying some neonates in the Yangtze River region are potentially at high risk from exposure to DDTs. - Highlights: • DDT isomers and enantiomer compositions were determined by GC/MS and GC/MS–MS. • Maternal age and pregnancy BMI were positively associated with levels of DDTs. • DDT residues was primarily from past technical usage but new sources also existed. • An enrichment was found for (−)-enantiomer of o,p’-DDD and (+)-enantiomer of o,p’-DDT. • Some neonates in this region were potentially at high risk from

  8. A study on the quality of outpatient prescription of psychopharmaceuticals in the City of Zagreb 2006-2009.

    Science.gov (United States)

    Zivković, Kresimir; Zelić-Kerep, Ana; Stimac, Danijela; Ozić, Sanja; Zivković, Nikica

    2014-06-01

    The lack of Croatian studies which could determine the justifiability of excessive psychopharmaceutical utilization was an encouragement to conduct this research. Furthermore, regarding the conduction of this study, it would be possible to determine whether the trend of drug utilization has increased, decreased or perhaps stabilized. The data on the outpatient utilization of psycholeptics and psychoanaleptics were collected from all Zagreb pharmacies, 2006-2009. Based on the collected data for all N05 and N06 groups of drugs, the defined daily doses (DDD) and DDD per thousand inhabitants per day (DDD/TID) have been calculated using the Anatomical-Therapeutic-Chemical classification (ATC) for 2006, 2007, 2008 and 2009. To indicate the quality of drug prescription the Drug Utilization 90% (DU 90%) method was used. Moreover, in order to determine a more precise quality of individual drug group prescriptions, the indicators have been calculated by determining the proportion of the total utilization of individual therapeutic and pharmacological therapeutic subgroups in DDD/TID a day. The utilization of anxiolytics (N05B) accounts for most of the psycholeptic utilization in the City of Zagreb throughout the entire study period. In the study period, the utilization of antidepressants has slightly increased, by 10.5%, taking the first and the last years of the period into account. In 2006, 5 benzodiazepines and the hypnotic zolpidem, as well as 5 selective serotonin reuptake inhibitors (SSRIs) and 1 third generation antipsychotic (olanzapin) were found in the DU 90% segment. In 2009, the DU 90% segment also comprised 5 benzodiazepines and the hypnotic zolpidem, as well as 6 SSRIs and 1 third generation antipsychotic (olanzapin). In the City of Zagreb, a general insight into the quality of psychopharmaceutical prescriptions indicates stability in comparison to earlier studies. The ratio index of the first generation antipsychotic utilization, compared to the third

  9. Effects of over-the-counter sales restriction of antibiotics on substitution with medicines for symptoms relief of cold in Mexico and Brazil: time series analysis.

    Science.gov (United States)

    Santa-Ana-Tellez, Yared; Mantel-Teeuwisse, Aukje K; Leufkens, Hubert G M; Wirtz, Veronika J

    2016-11-01

    We evaluated changes in the use of non-steroidal anti-inflammatory drugs (NSAIDs), non-opioid analgesics and cough and cold medicines and its relation with the use of antibiotics after the over-the-counter (OTC) antibiotic sales restrictions in Mexico and Brazil. IMS Health provided retail quarterly data from the private sectors in Mexico and Brazil from the first quarter of 2007 to the first quarter of 2013. Data of each active substance of antibiotics, easily accessible medicines perceived as antibiotics substitutes (cough and cold medicines, analgesics and NSAIDs-the latter two being combined in the analyses), and medicines to control for external factors that can affect the medicines usage trend (antihypertensives) were converted from kilograms to defined daily doses per 1000 inhabitants days (DDD/TID). Interrupted time series were used to estimate changes in level of medicines use at the intervention point and slope after the regulation. The Gregory-Hansen cointegration test was used to explore the relation between the use of antibiotics and perceived substitutes. After the regulation in Mexico NSAIDs-analgesics usage level increased by 1.1 DDD/TID with a slope increase of 0.2 DDD/TID per quarter and the cough and cold medicines usage level increased by 0.4 DDD/TID. In Brazil NSAIDs-analgesics usage level increased by 1.9 DDD/TID, and cough and cold medicines did not change. In the two countries, NSAIDs-analgesics usage changes were related with antibiotic usage changes; in Mexico cough and cold medicines usage changes had a relation with the antibiotics usage changes. These results showed a substitution effect on the use of other medicines, especially NSAIDs and analgesics, after reinforcement of OTC antibiotics sales restrictions. These regulations aimed to improve the antibiotics use and as a consequence reduce antimicrobial resistance; however, this type of policies should be comprehensive and take into account the potential substitution effects on the use

  10. High variability of TB, HIV, hepatitis C treatment and opioid substitution therapy among prisoners in Germany.

    Science.gov (United States)

    Müller, Jana; Schmidt, Daniel; Kollan, Christian; Lehmann, Marc; Bremer, Viviane; Zimmermann, Ruth

    2017-10-25

    In Germany, medical care of prisoners is completely separated from extramural health care. The extent and quality of medical care among prisoners in Germany are therefore largely unknown. We performed a secondary data analysis of pharmacy sales data for tuberculosis (TB), HIV, hepatitis C (HCV) and opioid substitution treatment (OST) delivered to prisons in 11 federal states (FS) in Germany between 01/2012 and 03/2013. The aims of this study were to assess (i) the treatment availability for the selected diseases and OST in German prisons, (ii) the proportion of prisoners treated per FS and overall for TB, HIV, HCV and OST during the study period. Substances unique to or typically used for the treatment of each disease were defined as marker substances with defined daily doses (DDD). For each marker substance we assessed the cumulative number of DDD, the average daily number of DDD (DDD d ) and average treatment prevalence per day in percent (adTP). Accordingly, the DDD d represents one person treated per day and the adTP means the proportion of prisoners treated per day. We compared the adTP of the diseases with previously measured prevalences. We obtained data from pharmacies supplying prisons in 11 of 16 German FS. Of the included prisons, 41% were supplied with medicines for TB, 71% for HIV and 58% for HCV and OST. Twice as many delivered marker substances for TB were indicated for the continuation phase and chemoprevention than the intensive phase. The HIV adTP ranged from 0.06% to 0.94%, HCV adTP ranged from 0.03% to 0.59% and OST adTP ranged from 0% to 7.90%. The overall adTP for the respective treatment was 0.39% for HIV, 0.12% for HCV and 2.18% for OST. According to our findings treatment rates for TB were consistent with the expected TB prevalence, at least in Berlin. HIV treatment seems to be offered to an adequate proportion of estimated infected prisoners. In contrast, the HCV treatment prevalence was low. High variation among FS in provision of all

  11. Phenotype variations affect genetic association studies of degenerative disc disease: conclusions of analysis of genetic association of 58 single nucleotide polymorphisms with highly specific phenotypes for disc degeneration in 332 subjects.

    Science.gov (United States)

    Rajasekaran, S; Kanna, Rishi Mugesh; Senthil, Natesan; Raveendran, Muthuraja; Cheung, Kenneth M C; Chan, Danny; Subramaniam, Sakthikanal; Shetty, Ajoy Prasad

    2013-10-01

    Although the influence of genetics on the process of disc degeneration is well recognized, in recently published studies, there is a wide variation in the race and selection criteria for such study populations. More importantly, the radiographic features of disc degeneration that are selected to represent the disc degeneration phenotype are variable in these studies. The study presented here evaluates the association between single nucleotide polymorphisms (SNPs) of candidate genes and three distinct radiographic features that can be defined as the degenerative disc disease (DDD) phenotype. The study objectives were to examine the allelic diversity of 58 SNPs related to 35 candidate genes related to lumbar DDD, to evaluate the association in a hitherto unevaluated ethnic Indian population that represents more than one-sixth of the world population, and to analyze how genetic associations can vary in the same study subjects with the choice of phenotype. A cross-sectional, case-control study of an ethnic Indian population was carried out. Fifty-eight SNPs in 35 potential candidate genes were evaluated in 342 subjects and the associations were analyzed against three highly specific markers for DDD, namely disc degeneration by Pfirrmann grading, end-plate damage evaluated by total end-plate damage score, and annular tears evaluated by disc herniations and hyperintense zones. Genotyping of cases and controls was performed on a genome-wide SNP array to identify potential associated disease loci. The results from the genome-wide SNP array were then used to facilitate SNP selection and genotype validation was conducted using Sequenom-based genotyping. Eleven of the 58 SNPs provided evidence of association with one of the phenotypes. For annular tears, rs1042631 SNP of AGC1 and rs467691 SNP of ADAMTS5 were highly significantly associated (p<.01) and SNPs in NGFB, IL1B, IL18RAP, and MMP10 were also significantly associated (p<.05). The rs4076018 SNP of NGFB was highly

  12. Novel method for determining DDT in vapour and particulate phases within contaminated indoor air in a malaria area of South Africa

    International Nuclear Information System (INIS)

    Naudé, Yvette; Rohwer, Egmont R.

    2012-01-01

    Highlights: ► We present a novel denuder for the determination of DDT in contaminated indoor air. ► Single step concentration of vapour phase on PDMS, particulate phase on filter. ► Solvent-free green technique, sample extraction not required. ► Ratios of airborne p,p′-DDD/p,p′-DDT and of o,p′-DDT/p,p′-DDT are unusual. ► Insecticidal efficacy of technical DDT may be compromised. - Abstract: The organochlorine insecticide DDT (1,1,1-trichloro-2,2-bis(p-chlorophenyl)ethane) is still used for malaria vector control in certain areas of South Africa. The strict Stockholm Convention on Persistent Organic Pollutants (POPs) allows spraying on the inside of traditional dwellings with DDT. In rural villages contaminated dust presents an additional pathway for exposure to DDT. We present a new method for the determination of DDT in indoor air where separate vapour and particulate samples are collected in a single step with a denuder configuration of a multi-channel open tubular silicone rubber (polydimethylsiloxane (PDMS)) trap combined with a micro quartz fibre filter. The multi-channel PDMS trap section of the denuder concentrates vapour phase insecticide whereas particle associated insecticide is transferred downstream where it is collected on a micro-fibre filter followed by a second multi-channel PDMS trap to capture the blow-off from the filter. The multi-channel PDMS trap and filter combination are designed to fit a commercial thermal desorber for direct introduction of samples into a GC–MS. The technique is solvent-free. Analyte extraction and sample clean-up is not required. Two fractions, vapour phase and particulate phase p,p′-DDT, o,p′-DDT; p,p′-DDD, o,p′-DDD; p,p′-DDE and o,p′-DDE in 4 L contaminated indoor air, were each quantitatively analysed by GC–MS using isotopically labelled ring substituted 13 C 12 –p,p′-DDT as an internal standard. Limits of detection were 0.07–0.35 ng m −3 for p,p′-DDT, o,p′-DDT, p,p′-DDD

  13. Novel method for determining DDT in vapour and particulate phases within contaminated indoor air in a malaria area of South Africa

    Energy Technology Data Exchange (ETDEWEB)

    Naude, Yvette, E-mail: yvette.naude@up.ac.za [Department of Chemistry, University of Pretoria, Private Bag X20, Hatfield 0028, Pretoria (South Africa); Rohwer, Egmont R., E-mail: egmont.rohwer@up.ac.za [Department of Chemistry, University of Pretoria, Private Bag X20, Hatfield 0028, Pretoria (South Africa)

    2012-06-12

    Highlights: Black-Right-Pointing-Pointer We present a novel denuder for the determination of DDT in contaminated indoor air. Black-Right-Pointing-Pointer Single step concentration of vapour phase on PDMS, particulate phase on filter. Black-Right-Pointing-Pointer Solvent-free green technique, sample extraction not required. Black-Right-Pointing-Pointer Ratios of airborne p,p Prime -DDD/p,p Prime -DDT and of o,p Prime -DDT/p,p Prime -DDT are unusual. Black-Right-Pointing-Pointer Insecticidal efficacy of technical DDT may be compromised. - Abstract: The organochlorine insecticide DDT (1,1,1-trichloro-2,2-bis(p-chlorophenyl)ethane) is still used for malaria vector control in certain areas of South Africa. The strict Stockholm Convention on Persistent Organic Pollutants (POPs) allows spraying on the inside of traditional dwellings with DDT. In rural villages contaminated dust presents an additional pathway for exposure to DDT. We present a new method for the determination of DDT in indoor air where separate vapour and particulate samples are collected in a single step with a denuder configuration of a multi-channel open tubular silicone rubber (polydimethylsiloxane (PDMS)) trap combined with a micro quartz fibre filter. The multi-channel PDMS trap section of the denuder concentrates vapour phase insecticide whereas particle associated insecticide is transferred downstream where it is collected on a micro-fibre filter followed by a second multi-channel PDMS trap to capture the blow-off from the filter. The multi-channel PDMS trap and filter combination are designed to fit a commercial thermal desorber for direct introduction of samples into a GC-MS. The technique is solvent-free. Analyte extraction and sample clean-up is not required. Two fractions, vapour phase and particulate phase p,p Prime -DDT, o,p Prime -DDT; p,p Prime -DDD, o,p Prime -DDD; p,p Prime -DDE and o,p Prime -DDE in 4 L contaminated indoor air, were each quantitatively analysed by GC-MS using

  14. Do coxibs reduce prescription of gastroprotective agents? Results of a record linkage study

    Directory of Open Access Journals (Sweden)

    Violante Andrea

    2006-03-01

    Full Text Available Abstract Background Coxibs are claimed to be cost-effective drugs and reduced prescription of gastroprotective agents is assumed to be one of their major benefits. Real life prescription of these drugs may be substantially different than that considered in pharmacoeconomic analyses or claimed by drug companies, yet. Our objective was to evaluate whether coxibs were associated with reduced prescription of gastro-protective agents (GPAs, specifically proton pump inhibitors, H2 blockers and misoprostol compared to non selective NSAIDs. Methods A record-linkage study was performed using 2001 outpatient prescription data from the province of Modena (about 632,000 inhabitants, in Northern Italy. Logistic regression was used to calculate the odds ratio of GPA prescription for coxib and non-selective NSAID adult users (> 14 years. Three categories of users were further investigated: "acute", "chronic and "incident or new". Main outcome measures were same-day co-prescription and 30 days prescription of GPAs in coxibs and non selective NSAIDs users. To limit selection bias, data were adjusted for age, sex, DDD of coxibs and non selective NSAIDs received during 2001, DDD of GPAs and (for non-incident users DDD of NSAIDs received during the previous 4 years Results Same day co-prescription rates were similar considering the overall population and "acute" users. Chronic coxibs users instead showed higher co-prescription rates than chronic NSAIDs users (OR = 1.2, p Conclusion Assumptions made in pharmacoeconomic analyses on coxibs (lower GPA prescription associated with coxibs use may be overly optimistic. Claims made through cost-effectiveness data should be carefully interpreted, and mechanisms for attributing drug prices revised accordingly.

  15. Stem cells in degenerative orthopaedic pathologies: effects of aging on therapeutic potential.

    Science.gov (United States)

    Atesok, Kivanc; Fu, Freddie H; Sekiya, Ichiro; Stolzing, Alexandra; Ochi, Mitsuo; Rodeo, Scott A

    2017-02-01

    The purpose of this study was to summarize the current evidence on the use of stem cells in the elderly population with degenerative orthopaedic pathologies and to highlight the pathophysiologic mechanisms behind today's therapeutic challenges in stem cell-based regeneration of destructed tissues in the elderly patients with osteoarthritis (OA), degenerative disc disease (DDD), and tendinopathies. Clinical and basic science studies that report the use of stem cells in the elderly patients with OA, DDD, and tendinopathies were identified using a PubMed search. The studies published in English have been assessed, and the best and most recent evidence was included in the current study. Evidence suggests that, although short-term results regarding the effects of stem cell therapy in degenerative orthopaedic pathologies can be promising, stem cell therapies do not appear to reverse age-related tissue degeneration. Causes of suboptimal outcomes can be attributed to the decrease in the therapeutic potential of aged stem cell populations and the regenerative capacity of these cells, which might be negatively influenced in an aged microenvironment within the degenerated tissues of elderly patients with OA, DDD, and tendinopathies. Clinical protocols guiding the use of stem cells in the elderly patient population are still under development, and high-level randomized controlled trials with long-term outcomes are lacking. Understanding the consequences of age-related changes in stem cell function and responsiveness of the in vivo microenvironment to stem cells is critical when designing cell-based therapies for elderly patients with degenerative orthopaedic pathologies.

  16. Determination of Levels of Organochlorine, Organophosphorus, and Pyrethroid Pesticide Residues in Vegetables from Markets in Dar es Salaam by GC-MS

    Directory of Open Access Journals (Sweden)

    John A. M. Mahugija

    2017-01-01

    Full Text Available This study investigated the levels of pesticides and metabolites in vegetables from major markets in Dar es Salaam city, Tanzania. Samples of fresh cabbage, spinach, and onions from the markets were analysed for pesticide residues. Extraction was performed using acetone followed by dichloromethane : cyclohexane mixture and the extracts were cleaned up using Florisil. The compounds were determined by gas chromatography-mass spectrometry (GC-MS. Pesticides and metabolites were detected in 72.2% of the samples. The detected pesticide residues and their highest mean concentrations were p,p′-DDT 4.00 × 10−3 mg/kg, p,p′-DDD 6.40 × 10−1 mg/kg, o,p′-DDD 1.00 × 10−2 mg/kg, α-endosulfan 6.00 × 10−1 mg/kg, β-endosulfan 2.10 × 10−1 mg/kg, chlorpyrifos 3.00 mg/kg, and cypermethrin 4.00 × 10−2 mg/kg. The most frequently detected compounds were p,p′-DDD and chlorpyrifos. The order of contamination was spinach > cabbage > onions. Generally, there were no significant variations in concentrations of pesticide residues among samples and sampling sites, which indicated similarities in contamination patterns. The concentrations of contaminants were above the maximum residue limits (MRLs in 33.3–50% of the samples. The findings indicated risks and concerns for public health.

  17. Do young people benefit from AA as much, and in the same ways, as adult aged 30+? A moderated multiple mediation analysis.

    Science.gov (United States)

    Hoeppner, Bettina B; Hoeppner, Susanne S; Kelly, John F

    2014-10-01

    Research has shown that participation in Alcoholics Anonymous (AA) confers significant recovery benefit to adults suffering from alcohol use disorder (AUD). Concerns persist, however, that AA may not work as well for younger adults, who tend to have shorter addiction histories, different social circumstances, and less spiritual/religious interest than adults. Secondary data analysis of Project MATCH, using a prospective, moderated multiple mediation analysis to test and compare six previously identified mechanisms of change in younger adults (n=266) vs. adults aged 30+ (n=1460). Nine clinical sites within the United States. Treatment-seeking adults (n=1726) suffering from AUD who participated in 12 weeks of outpatient treatment and completed follow-ups at 3-, 9- and 15-months. AA attendance during treatment; mediators at 9 months; and outcomes [percentage of days abstinent (PDA) and drinks per drinking day (DDD)] at 15 months. AA attendance was associated with improved drinking outcomes in both younger adults (PDA: F(1, 247)=8.55, p<0.01; DDD: F(1, 247)=15.93, p<0.01) and adults aged 30+ (PDA: F(1, 1311)=86.58, p<0.01; DDD: F(1, 1311)=11.96, p<0.01). Only two of the six hypothesized pathways (i.e., decreases in pro-drinking social networks, self-efficacy in social situations) appeared to work in younger adults. Unidentified mechanisms of behavior change that are mobilized by AA participation appear to be at work in young people. Once identified, these mechanisms may shed new light on how exactly AA confers similar benefits for young people and, more broadly, may enhance our understanding of recovery-related change for young adults that could yield novel intervention targets. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

  18. Influence of the mental health status on a new measure of objective functional impairment in lumbar degenerative disc disease.

    Science.gov (United States)

    Stienen, Martin N; Smoll, Nicolas R; Joswig, Holger; Snagowski, Jan; Corniola, Marco V; Schaller, Karl; Hildebrandt, Gerhard; Gautschi, Oliver P

    2017-06-01

    The Timed Up and Go (TUG) test has recently been proposed as a simple and standardized measure for objective functional impairment (OFI) in patients with lumbar degenerative disc disease (DDD). The study aimed to explore the relationship between a patient's mental health status and both patient-reported outcome measures (PROMs) and TUG test results. This is a prospective institutional review board-approved two-center study. The sample was composed of 375 consecutive patients scheduled for lumbar spine surgery and a healthy cohort of 110 control subjects. Patients and control subjects were assessed with the TUG test and a comprehensive panel of subjective PROMs of pain intensity (visual analog scale [VAS]), functional impairment (Roland-Morris Disability Index [RMDI]), Oswestry Disability Index [ODI]), as well as health-related quality of life (hrQoL; Euro-Qol [EQ]-5D). Standardized age- and sex-adjusted TUG test T-scores were calculated. The dependent variable was the short-form (SF)-12 mental component summary (MCS) quartiles, and the independent variables were the TUG T-scores and PROMs. Direct and adjusted analyses of covariance were performed to estimate the interaction between the SF-12 MCS quartiles and the independent variables. In patients, there was a significant decrease in the subjective PROMs, notably the VAS back pain (p=.001) and VAS leg pain (p=.035), as well as significant increase in the RMDI (pmental hrQoL on subjective measures of pain, functional impairment, and hrQoL that might lead to bias when evaluating patients with lumbar DDD who suffer from reduced mental hrQoL. The TUG test appears to be a stable instrument and especially helpful in the evaluation of patients with lumbar DDD and mental health problems. Copyright © 2016 Elsevier Inc. All rights reserved.

  19. Mutations in POGLUT1, Encoding Protein O-Glucosyltransferase 1, Cause Autosomal-Dominant Dowling-Degos Disease

    Science.gov (United States)

    Basmanav, F. Buket; Oprisoreanu, Ana-Maria; Pasternack, Sandra M.; Thiele, Holger; Fritz, Günter; Wenzel, Jörg; Größer, Leopold; Wehner, Maria; Wolf, Sabrina; Fagerberg, Christina; Bygum, Anette; Altmüller, Janine; Rütten, Arno; Parmentier, Laurent; El Shabrawi-Caelen, Laila; Hafner, Christian; Nürnberg, Peter; Kruse, Roland; Schoch, Susanne; Hanneken, Sandra; Betz, Regina C.

    2014-01-01

    Dowling-Degos disease (DDD) is an autosomal-dominant genodermatosis characterized by progressive and disfiguring reticulate hyperpigmentation. We previously identified loss-of-function mutations in KRT5 but were only able to detect pathogenic mutations in fewer than half of our subjects. To identify additional causes of DDD, we performed exome sequencing in five unrelated affected individuals without mutations in KRT5. Data analysis identified three heterozygous mutations from these individuals, all within the same gene. These mutations, namely c.11G>A (p.Trp4∗), c.652C>T (p.Arg218∗), and c.798-2A>C, are within POGLUT1, which encodes protein O-glucosyltransferase 1. Further screening of unexplained cases for POGLUT1 identified six additional mutations, as well as two of the above described mutations. Immunohistochemistry of skin biopsies of affected individuals with POGLUT1 mutations showed significantly weaker POGLUT1 staining in comparison to healthy controls with strong localization of POGLUT1 in the upper parts of the epidermis. Immunoblot analysis revealed that translation of either wild-type (WT) POGLUT1 or of the protein carrying the p.Arg279Trp substitution led to the expected size of about 50 kDa, whereas the c.652C>T (p.Arg218∗) mutation led to translation of a truncated protein of about 30 kDa. Immunofluorescence analysis identified a colocalization of the WT protein with the endoplasmic reticulum and a notable aggregating pattern for the truncated protein. Recently, mutations in POFUT1, which encodes protein O-fucosyltransferase 1, were also reported to be responsible for DDD. Interestingly, both POGLUT1 and POFUT1 are essential regulators of Notch activity. Our results furthermore emphasize the important role of the Notch pathway in pigmentation and keratinocyte morphology. PMID:24387993

  20. Dynamic Stabilisation in the Treatment of Degenerative Disc Disease with Modic Changes

    Directory of Open Access Journals (Sweden)

    Olcay Eser

    2013-01-01

    Full Text Available Objective. Posterior dynamic stabilization is an effective alternative to fusion in the treatment of chronic instability and degenerative disc disease (DDD of the lumbar spine. This study was undertaken to investigate the efficacy of dynamic stabilization in chronic degenerative disc disease with Modic types 1 and 2. Modic types 1 and 2 degeneration can be painful. Classic approach in such cases is spine fusion. We operated 88 DDD patients with Modic types 1 and 2 via posterior dynamic stabilization. Good results were obtained after 2 years of followup. Methods. A total of 88 DDD patients with Modic types 1 and 2 were selected for this study. The patients were included in the study between 2004 and 2010. All of them were examined with lumbar anteroposterior (AP and lateral X-rays. Lordosis of the lumbar spine, segmental lordosis, and ratio of the height of the intervertebral disc spaces (IVSs were measured preoperatively and at 3, 12, and 24 months after surgery. Magnetic resonance imaging (MRI analysis was carried out, and according to the data obtained, the grade of disc degeneration was classified. The quality of life and pain scores were evaluated by visual analog scale (VAS score and Oswestry Disability Index (ODI preoperatively and at 3, 12, and 24 months after surgery. Appropriate statistical method was chosen. Results. The mean 3- and 12-month postoperative IVS ratio was significantly greater than that of the preoperative group (P0.05. Furthermore, the mean preoperative and 1 and 2 postoperative angles of lumbar lordosis and segmental lordosis were not significantly different (P>0.05. The mean VAS score and ODI, 3, 12, and 24 months after surgery, decreased significantly, when compared with the preoperative scores in the groups (P=0.000. Conclusion. Dynamic stabilization in chronic degenerative disc disease with Modic types 1 and 2 was effective.

  1. The role of transient receptor potential channels in joint diseases.

    Science.gov (United States)

    Krupkova, O; Zvick, J; Wuertz-Kozak, K

    2017-10-10

    Transient receptor potential channels (TRP channels) are cation selective transmembrane receptors with diverse structures, activation mechanisms and physiological functions. TRP channels act as cellular sensors for a plethora of stimuli, including temperature, membrane voltage, oxidative stress, mechanical stimuli, pH and endogenous, as well as, exogenous ligands, thereby illustrating their versatility. As such, TRP channels regulate various functions in both excitable and non-excitable cells, mainly by mediating Ca2+ homeostasis. Dysregulation of TRP channels is implicated in many pathologies, including cardiovascular diseases, muscular dystrophies and hyperalgesia. However, the importance of TRP channel expression, physiological function and regulation in chondrocytes and intervertebral disc (IVD) cells is largely unexplored. Osteoarthritis (OA) and degenerative disc disease (DDD) are chronic age-related disorders that significantly affect the quality of life by causing pain, activity limitation and disability. Furthermore, currently available therapies cannot effectively slow-down or stop progression of these diseases. Both OA and DDD are characterised by reduced tissue cellularity, enhanced inflammatory responses and molecular, structural and mechanical alterations of the extracellular matrix, hence affecting load distribution and reducing joint flexibility. However, knowledge on how chondrocytes and IVD cells sense their microenvironment and respond to its changes is still limited. In this review, we introduced six families of mammalian TRP channels, their mechanisms of activation, as well as, activation-driven cellular consequences. We summarised the current knowledge on TRP channel expression and activity in chondrocytes and IVD cells, as well as, the significance of TRP channels as therapeutic targets for the treatment of OA and DDD.

  2. The role of transient receptor potential channels in joint diseases

    Directory of Open Access Journals (Sweden)

    O Krupkova

    2017-10-01

    Full Text Available ransient receptor potential channels (TRP channels are cation selective transmembrane receptors with diverse structures, activation mechanisms and physiological functions. TRP channels act as cellular sensors for a plethora of stimuli, including temperature, membrane voltage, oxidative stress, mechanical stimuli, pH and endogenous, as well as, exogenous ligands, thereby illustrating their versatility. As such, TRP channels regulate various functions in both excitable and non-excitable cells, mainly by mediating Ca2+ homeostasis. Dysregulation of TRP channels is implicated in many pathologies, including cardiovascular diseases, muscular dystrophies and hyperalgesia. However, the importance of TRP channel expression, physiological function and regulation in chondrocytes and intervertebral disc (IVD cells is largely unexplored. Osteoarthritis (OA and degenerative disc disease (DDD are chronic age-related disorders that significantly affect the quality of life by causing pain, activity limitation and disability. Furthermore, currently available therapies cannot effectively slow-down or stop progression of these diseases. Both OA and DDD are characterised by reduced tissue cellularity, enhanced inflammatory responses and molecular, structural and mechanical alterations of the extracellular matrix, hence affecting load distribution and reducing joint flexibility. However, knowledge on how chondrocytes and IVD cells sense their microenvironment and respond to its changes is still limited. In this review, we introduced six families of mammalian TRP channels, their mechanisms of activation, as well as, activation-driven cellular consequences. We summarised the current knowledge on TRP channel expression and activity in chondrocytes and IVD cells, as well as, the significance of TRP channels as therapeutic targets for the treatment of OA and DDD.

  3. Consumption trends for specific drugs used to treat dementia in the region of Madrid (Spain) from 2002 to 2012.

    Science.gov (United States)

    de Hoyos-Alonso, M C; Tapias-Merino, E; Meseguer Barros, C M; Sánchez-Martínez, M; Otero, A

    2015-09-01

    Analysing drug consumption in large population groups lets us observe consumption trends and compare them between different settings. to analyse the time trends for consumption and costs of specific drugs used to treat dementia in the region of Madrid (Spain) and compare trends by sex and age cohort. Descriptive study of cholinesterase inhibitors (N06DA) and memantine (N06DX01) dispensed in Madrid between 2002 and 2012 and covered by the Spain's national health system. Consumption was calculated by analysing changes in DDD (defined daily doses) to find total and yearly increases. The cost was estimated based on DDD price. To compare consumption rates by age and sex, we calculated DDD per 100 inhabitants/day. Between 2002 and 2012, consumption of drugs used to treat dementia increased sixfold. During this period, cholinesterase inhibitors accounted for 76.70% of the drugs consumed and memantine, 23.30%. The estimated cost rose by a by a factor of 5.7 over 11 years (or by a factor of 4 taking into account the use of generic drugs). In 2012, 2.42% of the patients aged 65 or over consumed cholinesterase inhibitors (women 2.82%, men 1.83%) and 0.90% consumed memantine (women 1.10%, men 0.61%). Consumption increased in age cohorts up to 86 to 90 (5.84% for cholinesterase inhibitors and 2.33% for memantine) and declined thereafter. Consumption of cholinesterase inhibitors and memantine gradually increased, but consumption in 2012 did not reach levels equivalent to dementia prevalence figures. Pharmaceutical expenditure restraint measures may temporarily slow the cost increase temporarily but if the same trend of consumption persists, costs will rise. Copyright © 2013 Sociedad Española de Neurología. Published by Elsevier España, S.L.U. All rights reserved.

  4. Impact of recent reforms in Austria on utilization and expenditure of PPIs and lipid-lowering drugs: implications for the future.

    Science.gov (United States)

    Godman, Brian; Burkhardt, Thomas; Bucsics, Anna; Wettermark, Björn; Wieninger, Peter

    2009-10-01

    To assess the impact of a plethora of reforms and initiatives introduced in Austria since 2002 on the actual utilization and expenditure of proton pump inhibitors and statins. Utilization of dispensed prescriptions in ambulatory care was captured from 2001 to 2007 using defined daily doses (DDD) as well as DDDs/1000 inhabitants/day for patients covered by the social health insurance system. The data were provided by the internal data warehouse of Hauptverband der Osterreichischen Sozialversicherungsträger. Total costs in Euros were used for the analysis from the payer's perspective. The reduction in the expenditure per DDD for both generic PPIs and statins was generally in line with expectations at over 60% of originator prices before multiple sources became available. There was also increased utilization of generics following the range of demand-side initiatives. This was 89.5% for generic omeprazole versus total omeprazole and 95.1% for generic simvastatin versus total simvastatin by the end of 2007. The utilization of atorvastatin fell substantially from 36.5% of all statins in 2002 to 10.7% by the end of 2007 following restrictions on its prescribing to patients not achieving target lipid levels with, for instance, generic simvastatin. The combined initiatives reduced expenditure per DDD for the PPIs and the statins by 41 and 60%, respectively, in 2007 versus 2001 levels. This reduction translated into lower expenditure for the statins in 2007 versus 2001 despite substantially increased utilization. The results provide examples to other European countries, especially the restrictions on atorvastatin utilization. Nevertheless, further initiatives will be needed to conserve resources as utilization rates grow in chronic disease areas. This includes potential lessons from other European countries.

  5. ESTIMACIÓN DE LA PREVALENCIA DE HIPOTIROIDISMO SEGÚN DIFERENTES MÉTODOS: DOSIS DIARIA DEFINIDA, DOSIS DIARIA PRESCRITAY REGISTRO DE PACIENTES EN TRATAMIENTO

    Directory of Open Access Journals (Sweden)

    José Escribano-Serrano

    2014-01-01

    Full Text Available Fundamentos: El hipotiroidismo (HT es una patología frecuente en la práctica clínica diaria. No existen datos recientes sobre su prevalencia en España. El objetivo de este trabajo fue conocer su prevalencia en la provincia de Cádiz. Métodos: Se estudió el consumo del grupo terapéutico H03AA realizado en receta oficial por las unidades de Atención Primaria (AP de Cádiz, durante el año 2012. La prevalencia se estimó mediante tres métodos: la Dosis Diaria Definida (DDD, la Dosis Diaria Prescrita (DDP y el Registro Pacientes en Tratamiento (RPT. Los resultados se presentaron según sexo y edad con intervalos de confianza del 95%. Resultados: La prevalencia de HT durante 2012 en población mayor de 15 años de la provincia fue del 1,36% (IC95: 1,33%-1,38% mediante DDD, del 2,60% (IC95: 2,54%-2,66% mediante DDP y del 3,10% (IC95: 2,85%-2,93% mediante RPT. La mediana de edad fue de 56 años (rango intercuartílico 43 a 68 años. La prevalencia (RPT por sexo fue de 0,75% en hombres y 5,36% en mujeres [OR 7,26 (IC95: 7,02-7,52], siendo del 9,35% la correspondiente a mujeres de 51 a 70 años. Conclusiones: El método de estimación por rptdemuestra ser una herramienta más válida que el método DDD para evaluar la prevalencia de HT. El HT muestra, en nuestra provincia una prevalencia elevada con mayor afectación del sexo femenino.

  6. Single anterior cervical discectomy and fusion (ACDF) using self- locking stand-alone polyetheretherketone (PEEK) cage: evaluation of pain and health-related quality of life.

    Science.gov (United States)

    Kapetanakis, Stylianos; Thomaidis, Tryfon; Charitoudis, George; Pavlidis, Pavlos; Theodosiadis, Panagiotis; Gkasdaris, Grigorios

    2017-09-01

    Anterior cervical discectomy and fusion (ACDF) constitutes the conventional treatment of cervical disc herniation due to degenerative disc disease (DDD). ACDF with plating presents a variety of complications postoperatively and stand-alone cages are thought to be a promising alternative. The aim of this study was firstly, to analyze prospectively collected data from a sample of patients treated with single ACDF using C-Plus self-locking stand-alone PEEK cage system, without the use of plates or screws, in order to evaluate pain levels of patients, utilizing Neck and Arm Pain scale as an expression of visual analogue scale (VAS). Secondly, we aimed to evaluate health-related quality of life, via the short-form 36 (SF-36) and Neck Disability Index (NDI). Thirty-six patients (19 male and 17 female) with mean age 49.6±7 years old who underwent successful single ACDF using self-locking stand-alone PEEK cage for symptomatic cervical DDD were selected for the study. Neck and Arm pain, as well as SF-36 and NDI were estimated preoperatively and 1, 3, 6, and 12 months postoperatively. Patients underwent preoperative and postoperative clinical, neurological and radiological evaluation. The clinical and radiological outcomes were satisfactory after a minimum 1-year follow-up. All results were statistically important (P<0.05), excluding improvement in NDI measured between 6 and 12 months. SF-36, Neck Pain, as well as Arm Pain featured gradual and constant improvement during follow-up, with best scores presenting at 12 months after surgery, while NDI reached its best at 6 months postoperatively. Generally, all scores showed improvement postoperatively during the different phases of the follow-up. Subsequently, ACDF using C-Plus cervical cage constitutes an effective method for cervical disc herniation treatment, in terms of postoperative improvement on pain levels and health-related quality of life and a safe alternative to the conventional method of treatment for cervical DDD.

  7. Evoluzione storica della farmacoutilizzazione degli anti-ipertensivi in Italia (1988-1998

    Directory of Open Access Journals (Sweden)

    Enrico Bologna

    2003-05-01

    Full Text Available The aim of this study was to perform an historical evaluation of pharmacoutilization of main antihypertensive drug classes in Italy between 1988 and 1998. There were analysed numbers of packs and costs for diuretics, beta-blockers, central and peripheral antihypertensive drugs (CPAD, calcium-channel blockers (CCB, angiotensin-converting enzyme (ACE inhibitors and angiotensin-II (AII receptor antagonists. The amount of defined-daily-doses (DDDs per preparation was calculated by dividing the annual number of packs by respective DDD value. The number of DDDs was grouped according to the second level of the anatomic-therapeutic-chemical (ATC classification. The amount of annual expenditures for each ATC level was converted to current monetary values. To calculate the annual cost per DDD, the expenditure was divided by respective number of DDDs. From 1988 to 1998, total number of DDDs of antihypertensive drugs grew from 193.657.092 to 396.140.967 with an increase of 105%, while the expenditure grew from 40.886.385 to 126.102.362, with an increase of 208%. Comparing data of 1990 and 1998, the DDDs of antihypertensive drugs increased of about 79%, the expenditure for these drugs increased of about 115%, while the global pharmaceutical expenditure increased only of 34%. Taking each drug class separately, CCB and ACE-inhibitors are the classes with the higher number of DDDs and the higher expenditure; while alpha-receptor blockers, ACE-inhibitors and AII- antagonists are the classes with the higher cost per DDD. In conclusion this study describes a substantial modification of pharmacoutilization of antihypertensive drugs in Italy along a ten-years span. The agreement between utilization trends and indications of international treatment guidelines, as well as the economic impact on drugs expenditure have been discussed.

  8. Expecting the unexpected: applying the Develop-Distort Dilemma to maximize positive market impacts in health.

    Science.gov (United States)

    Peters, David H; Paina, Ligia; Bennett, Sara

    2012-10-01

    Although health interventions start with good intentions to develop services for disadvantaged populations, they often distort the health market, making the delivery or financing of services difficult once the intervention is over: a condition called the 'Develop-Distort Dilemma' (DDD). In this paper, we describe how to examine whether a proposed intervention may develop or distort the health market. Our goal is to produce a tool that facilitates meaningful and systematic dialogue for practitioners and researchers to ensure that well-intentioned health interventions lead to productive health systems while reducing the undesirable distortions of such efforts. We apply the DDD tool to plan for development rather than distortions in health markets, using intervention research being conducted under the Future Health Systems consortium in Bangladesh, China and Uganda. Through a review of research proposals and interviews with principal investigators, we use the DDD tool to systematically understand how a project fits within the broader health market system, and to identify gaps in planning for sustainability. We found that while current stakeholders and funding sources for activities were easily identified, future ones were not. The implication is that the projects could raise community expectations that future services will be available and paid for, despite this actually being uncertain. Each project addressed the 'rules' of the health market system differently. The China research assesses changes in the formal financing rules, whereas Bangladesh and Uganda's projects involve influencing community level providers, where informal rules are more important. In each case, we recognize the importance of building trust between providers, communities and government officials. Each project could both develop and distort local health markets. Anyone intervening in the health market must recognize the main market perturbations, whether positive or negative, and manage them so

  9. Drug Utilization Review of parenteral opioid analgesics in cardiovascular surgery department of Shahid Modarres Hospital, Tehran

    Directory of Open Access Journals (Sweden)

    Vatanpour H, Soltani M,

    2016-08-01

    Full Text Available Persistent pain continues to be a common problem among patients undergoing cardiac operations and the need for controlling such pain is believed to be as a prime necessity in terms of the patient’s well being, health care costs and avoiding negative consequences provoked by the pain itself. Regarding to the newly established guidelines, opioid analgesic agents are considered as the mainstay of moderate to severe acute pain. Nonetheless, the underutilization of opioids for pain relief is still a persisting huge challenge. This survey, applying as a concurrent Drug Utilization Review using ATC/DDD system provided and recommended by the DUR group of the World Health Organization, conducted on 108 inpatients who received opioid drugs by parenteral route during 9 months from February to November 2013 at the post-ICU ward of Shahid Modarres Cardiovascular Hospital, affiliated to Shahid Beheshti University of Medical Science, in Tehran. Our findings revealed that morphine was the most commonly prescribed parenteral opioid in the hospitalized patients and pethidine usage was in the lowest level for the geriatric patients, resulting in satisfaction with the analgesic procedure among most of the cases in our study. Both of the mentioned drugs were prescribed by intramuscular route, regarding PRN way of injecting as well. Comparative results of our study with the literature revealed relatively moderate and roughly rational consumption of morphine (10.282 DDD/100bed-days and pethidine (0.013 DDD/100bed-days. Applying multivariate conditional regression modeling on the question of determining independent predictors for opioid usage, disclosed a direct correlation between the patient’s weight and daily dose of parenteral opioid consumption.

  10. Effect of Statin Intensity on the Risk of Epilepsy After Ischaemic Stroke: Real-World Evidence from Population-Based Health Claims.

    Science.gov (United States)

    Lin, Fang-Ju; Lin, Hung-Wei; Ho, Yunn-Fang

    2018-04-01

    Statins possess neuroprotective effects. However, real-world evidence supporting their utility in post-stroke epilepsy (PSE) prevention is limited. The association between statin use, including timing of prescribing (pre-stroke vs post-stroke), type (lipophilicity, intensity of therapy) and dose intensity, and risk of developing PSE were investigated by studying Taiwanese health claims (2003-2013). Patients with new-onset ischaemic stroke were identified. The main outcome was a diagnosis of epilepsy after ischaemic stroke. According to pre-stroke statin use, groups of current users, former users, and non-users were compared using ANOVA. An extended Cox regression model was utilized to estimate the hazard ratio (HR) of PSE, with post-stroke statin use and certain comedications as time-dependent variables. Serial sensitivity analyses were performed to ensure study robustness. Of the 20,858 ischaemic stroke patients, 954 (4.6%) developed PSE. Post-stroke statin use (adjusted HR (aHR) 0.55; 95% confidence interval 0.46-0.67, p < 0.001), but not pre-stroke statin use was associated with a significantly reduced risk of developing PSE. A dose-response correlation was also observed between PSE risk reduction and quartiles of the statin cumulative defined daily dose (cDDD) (aHR 0.84, 0.67, 0.53, and 0.50 for the lowest, second, third, and highest quartiles of cDDD, respectively). Risk predictors and protectors against PSE were also characterized. The post-stroke use of statins after ischaemic stroke was associated with PSE risk reduction in a cDDD-dependent manner. Further clinical studies on the potential applications of statins for PSE prophylaxis, particularly among at-risk patients, are warranted.

  11. Non-steroidal anti-inflammatory drugs, Cyclooxygenase-2 inhibitors and paracetamol use in Queensland and in the whole of Australia

    Directory of Open Access Journals (Sweden)

    Tett Susan E

    2008-09-01

    Full Text Available Abstract Background Cross national drug utilization studies can provide information about different influences on physician prescribing. This is important for medicines with issues around safety and quality of use, like non selective non-steroidal anti-inflammatory drugs (ns-NSAIDs and cyclo-oxygenase-2 (COX-2 inhibitors. To enable comparison of prescription medicine use across different jurisdictions with a range of population sizes, data first need to be compared within Australia to understand whether use in a smaller sub-population may be considered as representative of the total use within Australia. The aim of this study was to compare the utilization of non selective NSAID, COX-2 inhibitors and paracetamol between Queensland and Australia. Method Dispensing data were obtained for concession beneficiaries for Australia for ns-NSAIDs, COX-2 inhibitors and paracetamol subsidized by the PBS over the period 1997–2003. The same data were purchased for Queensland. Data were converted to Defined Daily Dose (DDD/1000 beneficiaries/day (World Health Organization anatomical therapeutic chemical classification, 2005. Results Total NSAID and paracetamol consumption were similar in Australia and Queensland. Ns-NSAID use decreased sharply with the introduction of COX-2 inhibitors (from approximately 80 to 40 DDD/1000 beneficiaries/day. Paracetamol was constant (approximately 45 DDD/1000 beneficiaries/day. COX-2 inhibitors consumption was initially higher in Queensland than in the whole of Australia. Conclusion Despite initial divergence in celecoxib use between Queensland and Australia, the use of ns-NSAIDs, COX-2 inhibitors and paracetamol overall, in concession beneficiaries, was comparable in Australia and Queensland.

  12. Surveillance of broad-spectrum antibiotic prescription in Singaporean hospitals: a 5-year longitudinal study.

    Directory of Open Access Journals (Sweden)

    Yi-Xin Liew

    Full Text Available BACKGROUND: Inappropriate prescription of antibiotics may contribute towards higher levels antimicrobial resistance. A key intervention for improving appropriate antibiotic prescription is surveillance of prescription. This paper presents the results of a longitudinal surveillance of broad-spectrum antibiotic prescription in 5 public-sector hospitals in Singapore from 2006 to 2010. METHODOLOGY/PRINCIPAL FINDINGS: Quarterly antibiotic prescription data were obtained and converted to defined daily doses (DDDs per 1,000 inpatient-days. The presence of significant trends in antibiotic prescription over time for both individual and combined hospitals was tested by regression analysis and corrected for autocorrelation between time-points. Excluding fluoroquinolones, there was a significant increase in prescription of all monitored antibiotics from an average of 233.12 defined daily doses (DDD/1,000 inpatient-days in 2006 to 254.38 DDD/1,000 inpatient-days in 2010 (Coefficient = 1.13, 95%CI: 0.16-2.09, p = 0.025. Increasing utilization of carbapenems, piperacillin/tazobactam, and Gram-positive agents were seen in the majority of the hospitals, while cephalosporins were less prescribed over time. The combined expenditure for 5 hospitals increased from USD9.9 million in 2006 to USD16.7 million in 2010. CONCLUSIONS/SIGNIFICANCE: The rate of prescription of broad-spectrum antibiotics in Singaporean hospitals is much higher compared to those of European hospitals. This may be due to high rates of antimicrobial resistance. The increase in expenditure on monitored antibiotics over the past 5 years outstripped the actual increase in DDD/1,000 inpatient-days of antibiotics prescribed. Longitudinal surveillance of antibiotic prescription on a hospital and countrywide level is important for detecting trends for formulating interventions or policies. Further research is needed to understand the causes for the various prescription trends and to act on these where

  13. Degradation of 14C - DDT in soils under moist and flooded conditions with rice straw and green manure amendments

    International Nuclear Information System (INIS)

    Dubey, S.; Dubey, P.S.; Kale, S.P.; Murthy, N.B.K.

    2001-01-01

    Degradation of 14 C - DDT in moist and flooded soils was studied with rice straw and green manure amendments for 100 days. The mineralization of DDT was not significantly influenced by any of the treatments. Rice straw and green manure in flooded soil brought about decrease in extractable 14 C - residues with concomitant increase in soil bound residues. DDT has a very short residence in flooded soils though radiocarbon was more in extractable residues. DDD is the major degradation product in flooded soils. (author)

  14. What can nanosafety learn from drug development? The feasibility of “safety by design”

    DEFF Research Database (Denmark)

    Hjorth, Rune; van Hove, Lilian; Wickson, Fern

    2017-01-01

    “Safety by design” (SbD) is an intuitively appealing concept that is on the rise within nanotoxicology and nanosafety research, as well as within nanotechnology research policy. It leans on principles established within drug discovery and development (DDD) and seeks to address safety early, as well...... as throughout product development. However, it remains unclear what the concept of SbD exactly entails for engineered nanomaterials (ENMs) or how it is envisioned to be implemented. Here, we review the concept as it is emerging in European research and compare its resemblance with the safety testing...

  15. Discuss the cause and treatment of pacemaker lead dislocation and deal with

    International Nuclear Information System (INIS)

    Chen Yueguang; Zhang Dadong; Lu Jie; Yang Hui; Liu Chunyan; Zhang Wei

    2003-01-01

    Objective: To follow up the patients with pacemaker, observe the condition of pacemaker lead, to explore the cause of lead dislocation, to find out and prevent its occurrence. Methods: Summarizing the clinical data of 6 patients with pacemaker, 7 pacemaker leads with 8 time dislocation, pacemaker 2 DDDR, 2 DDD, 2 VVI. Results: Four patients were punctured from right subclavian vein, one from left subclavian vein and one from right brachiocephalic vein; four leads were dislocation in atrium and one mildly dislocation; four leads dislocation in ventricle and two mildly dislocation; There were 3 old women with 4 leads and 5 times of dislocation

  16. Differential stabilities and sequence-dependent base pair opening dynamics of Watson-Crick base pairs with 5-hydroxymethylcytosine, 5-formylcytosine, or 5-carboxylcytosine.

    Science.gov (United States)

    Szulik, Marta W; Pallan, Pradeep S; Nocek, Boguslaw; Voehler, Markus; Banerjee, Surajit; Brooks, Sonja; Joachimiak, Andrzej; Egli, Martin; Eichman, Brandt F; Stone, Michael P

    2015-02-10

    5-Hydroxymethylcytosine (5hmC), 5-formylcytosine (5fC), and 5-carboxylcytosine (5caC) form during active demethylation of 5-methylcytosine (5mC) and are implicated in epigenetic regulation of the genome. They are differentially processed by thymine DNA glycosylase (TDG), an enzyme involved in active demethylation of 5mC. Three modified Dickerson-Drew dodecamer (DDD) sequences, amenable to crystallographic and spectroscopic analyses and containing the 5'-CG-3' sequence associated with genomic cytosine methylation, containing 5hmC, 5fC, or 5caC placed site-specifically into the 5'-T(8)X(9)G(10)-3' sequence of the DDD, were compared. The presence of 5caC at the X(9) base increased the stability of the DDD, whereas 5hmC or 5fC did not. Both 5hmC and 5fC increased imino proton exchange rates and calculated rate constants for base pair opening at the neighboring base pair A(5):T(8), whereas 5caC did not. At the oxidized base pair G(4):X(9), 5fC exhibited an increase in the imino proton exchange rate and the calculated kop. In all cases, minimal effects to imino proton exchange rates occurred at the neighboring base pair C(3):G(10). No evidence was observed for imino tautomerization, accompanied by wobble base pairing, for 5hmC, 5fC, or 5caC when positioned at base pair G(4):X(9); each favored Watson-Crick base pairing. However, both 5fC and 5caC exhibited intranucleobase hydrogen bonding between their formyl or carboxyl oxygens, respectively, and the adjacent cytosine N(4) exocyclic amines. The lesion-specific differences observed in the DDD may be implicated in recognition of 5hmC, 5fC, or 5caC in DNA by TDG. However, they do not correlate with differential excision of 5hmC, 5fC, or 5caC by TDG, which may be mediated by differences in transition states of the enzyme-bound complexes.

  17. Differential Stabilities and Sequence-Dependent Base Pair Opening Dynamics of Watson–Crick Base Pairs with 5-Hydroxymethylcytosine, 5-Formylcytosine, or 5-Carboxylcytosine

    Science.gov (United States)

    2016-01-01

    5-Hydroxymethylcytosine (5hmC), 5-formylcytosine (5fC), and 5-carboxylcytosine (5caC) form during active demethylation of 5-methylcytosine (5mC) and are implicated in epigenetic regulation of the genome. They are differentially processed by thymine DNA glycosylase (TDG), an enzyme involved in active demethylation of 5mC. Three modified Dickerson–Drew dodecamer (DDD) sequences, amenable to crystallographic and spectroscopic analyses and containing the 5′-CG-3′ sequence associated with genomic cytosine methylation, containing 5hmC, 5fC, or 5caC placed site-specifically into the 5′-T8X9G10-3′ sequence of the DDD, were compared. The presence of 5caC at the X9 base increased the stability of the DDD, whereas 5hmC or 5fC did not. Both 5hmC and 5fC increased imino proton exchange rates and calculated rate constants for base pair opening at the neighboring base pair A5:T8, whereas 5caC did not. At the oxidized base pair G4:X9, 5fC exhibited an increase in the imino proton exchange rate and the calculated kop. In all cases, minimal effects to imino proton exchange rates occurred at the neighboring base pair C3:G10. No evidence was observed for imino tautomerization, accompanied by wobble base pairing, for 5hmC, 5fC, or 5caC when positioned at base pair G4:X9; each favored Watson–Crick base pairing. However, both 5fC and 5caC exhibited intranucleobase hydrogen bonding between their formyl or carboxyl oxygens, respectively, and the adjacent cytosine N4 exocyclic amines. The lesion-specific differences observed in the DDD may be implicated in recognition of 5hmC, 5fC, or 5caC in DNA by TDG. However, they do not correlate with differential excision of 5hmC, 5fC, or 5caC by TDG, which may be mediated by differences in transition states of the enzyme-bound complexes. PMID:25632825

  18. Patterns, principles, and practices of domain-driven design

    CERN Document Server

    Millett, Scott

    2015-01-01

    Methods for managing complex software construction following the practices, principles and patterns of Domain-Driven Design with code examples in C# This book presents the philosophy of Domain-Driven Design (DDD) in a down-to-earth and practical manner for experienced developers building applications for complex domains. A focus is placed on the principles and practices of decomposing a complex problem space as well as the implementation patterns and best practices for shaping a maintainable solution space. You will learn how to build effective domain models through the use of tactical pat

  19. Organochlorine residues in sediments from selected tributaries to Manila Bay, Philippines

    International Nuclear Information System (INIS)

    Bajet, C.M.; Varca, L.M.; Navarro, M.P.

    1999-01-01

    Sediment borne pesticides are the major route of transport of pesticides in the marine environment and benthic dwellers, filter feeders and the flora/fauna closely associated with the sediments could greatly be affected. This paper focuses on the monitoring of organochlorine pesticides in sediments collected from the mouth of rivers draining to Manila Bay and relate to the contribution of inland activities to the overall pollution of the Bay. Sediments from 14-25 tributaries were collected in 1996 to 1998 and analyzed for the presence of HCB, aldrin, dieldrin, lindane, DDT, DDE, DDD, endosulfan I, endosulfan II and endosulfan sulfate using GLC-ECD

  20. Intradiscal injection of simvastatin results in radiologic, histologic, and genetic evidence of disc regeneration in a rat model of degenerative disc disease

    Science.gov (United States)

    Than, Khoi D.; Rahman, Shayan U.; Wang, Lin; Khan, Adam; Kyere, Kwaku A.; Than, Tracey T.; Miyata, Yoshinari; Park, Yoon-Shin; La Marca, Frank; Kim, Hyungjin M.; Zhang, Huina; Park, Paul; Lin, Chia-Ying

    2014-01-01

    BACKGROUND CONTEXT A large percentage of back pain can be attributed to degeneration of the intervertebral disc (IVD). Bone morphogenetic protein-2 (BMP-2) is known to play an important role in chondrogenesis of the IVD. Simvastatin is known to up-regulate expression of BMP-2. Thus, we hypothesized that intradiscal injection of simvastatin in a rat model of degenerative disc disease (DDD) would result in retardation of DDD. PURPOSE To develop a novel conservative treatment for DDD and related discogenic back pain. STUDY DESIGN/SETTING Laboratory investigation. METHODS Disc injury was induced in 272 rats via 21-gauge needle puncture. After 6 weeks, injured discs were treated with simvastatin in a saline or hydrogel carrier. Rats were sacrificed at predetermined time points. Outcome measures assessed were radiologic, histologic, and genetic. Radiologically, the MRI index (number of pixels multiplied by corresponding image densities) was determined. Histologically, disc spaces were read by 3 blinded scorers employing a previously described histological grading scale. Genetically, nuclei pulposi were harvested and polymerase chain reaction was run to determine relative levels of aggrecan, collagen type II, and BMP-2 gene expression. This project was supported by Grant No. R01 AR056649 from NIAMS/NIH. There are no other financial conflicts of interest to report. RESULTS Radiologically, discs treated with 5 mg/mL simvastatin in hydrogel or saline demonstrated MRI indices that were normal through 8 weeks post-treatment, although this was more sustained when delivered in hydrogel. Histologically, discs treated with 5 mg/mL simvastatin in hydrogel demonstrated improved grades in comparison to discs treated at higher doses. Genetically, discs treated with 5 mg/mL of simvastatin in hydrogel demonstrated higher gene expression of aggrecan and collagen type II than control. CONCLUSIONS Degenerate discs treated with 5 mg/mL simvastatin in a hydrogel carrier demonstrated

  1. The safety of meperidine prescribing in older adults: A longitudinal population-based study.

    Science.gov (United States)

    Friesen, Kevin J; Falk, Jamie; Bugden, Shawn

    2016-05-11

    Meperidine (pethidine) is an opioid analgesic that offers little advantage relative to other opioids and several disadvantages including limited potency, short duration of action, and the production of a neurotoxic metabolite (normeperidine) with a long half-life. Older adults are more sensitive to meperidine's side effects and may have diminished renal function which leads to the accumulation of normeperidine. The Institute for Safe Medication Practices has suggested avoiding meperidine in older adults, limiting its dose (≤600 mg/day) and duration of use (≤48 h). The objective of this study was to determine the level of meperidine use in older adults and assess the dosage and duration of meperidine with reference to these safety recommendations. A longitudinal study using administrative healthcare data was conducted to examine meperidine utilization and levels of high dose and extended duration prescribing among persons ≥65 years of age between April 1, 2001, and March 31, 2014 in Manitoba, Canada. The number of meperidine prescriptions, users, duration of treatment, defined daily doses (DDD) dispensed and number of prescribers were determined over the study period. In the Manitoba older adult population there was a marked decline in meperidine users and prescriptions from 2001 to 2014. There was an average use of 26.4 (95 % CI 24.0-28.8) DDDs of meperidine per user per year. While only 3.7 % of the prescriptions exceeded the 600 mg maximum daily dose, 96.7 % of prescriptions exceeded the recommended 2 days of therapy. For the remaining users of meperidine, the amount of meperidine used per person rose from 18.98 to 56.14 DDDs/user/year over the study period. The number of prescribers of meperidine declined throughout the study, but low DDD prescribers declined more quickly than high DDD prescribers. While meperidine use has declined, the remaining use appears to be decreasing in safety, with more meperidine prescribed per user. This seems to be driven by

  2. Dynamic Data-Driven UAV Network for Plume Characterization

    Science.gov (United States)

    2016-05-23

    AFRL-AFOSR-VA-TR-2016-0203 Dynamic Data-Driven UAV Network for Plume Characterization Kamran Mohseni UNIVERSITY OF FLORIDA Final Report 05/23/2016...AND SUBTITLE Dynamic Data-Driven UAV Network for Plume Characterization 5a.  CONTRACT NUMBER 5b.  GRANT NUMBER FA9550-13-1-0090 5c.  PROGRAM ELEMENT...studied a dynamic data driven (DDD) approach to operation of a heterogeneous team of unmanned aerial vehicles ( UAVs ) or micro/miniature aerial

  3. SU-F-T-144: Analytical Closed Form Approximation for Carbon Ion Bragg Curves in Water

    Energy Technology Data Exchange (ETDEWEB)

    Tuomanen, S; Moskvin, V; Farr, J [St. Jude Children’s Research Hospital, Memphis, TN (United States)

    2016-06-15

    Purpose: Semi-empirical modeling is a powerful computational method in radiation dosimetry. A set of approximations exist for proton ion depth dose distribution (DDD) in water. However, the modeling is more complicated for carbon ions due to fragmentation. This study addresses this by providing and evaluating a new methodology for DDD modeling of carbon ions in water. Methods: The FLUKA, Monte Carlo (MC) general-purpose transport code was used for simulation of carbon DDDs for energies of 100–400 MeV in water as reference data model benchmarking. Based on Thomas Bortfeld’s closed form equation approximating proton Bragg Curves as a basis, we derived the critical constants for a beam of Carbon ions by applying models of radiation transport by Lee et. al. and Geiger to our simulated Carbon curves. We hypothesized that including a new exponential (κ) residual distance parameter to Bortfeld’s fluence reduction relation would improve DDD modeling for carbon ions. We are introducing an additional term to be added to Bortfeld’s equation to describe fragmentation tail. This term accounts for the pre-peak dose from nuclear fragments (NF). In the post peak region, the NF transport will be treated as new beams utilizing the Glauber model for interaction cross sections and the Abrasion- Ablation fragmentation model. Results: The carbon beam specific constants in the developed model were determined to be : p= 1.75, β=0.008 cm-1, γ=0.6, α=0.0007 cm MeV, σmono=0.08, and the new exponential parameter κ=0.55. This produced a close match for the plateau part of the curve (max deviation 6.37%). Conclusion: The derived semi-empirical model provides an accurate approximation of the MC simulated clinical carbon DDDs. This is the first direct semi-empirical simulation for the dosimetry of therapeutic carbon ions. The accurate modeling of the NF tail in the carbon DDD will provide key insight into distal edge dose deposition formation.

  4. The use of diagnostic computerized tomography and radiation therapy in canine and feline hyperadenocorticism

    International Nuclear Information System (INIS)

    Mauldin, G.N.; Burk, R.L.

    1990-01-01

    Therapy for canine pituitary-dependent Cushing's syndrome (PDC) has primarily been medical management with o,p'-DDD. This drug therapy does not directly affect the underlying pituitary pathology, and may have undesirable side effects. Pituitary-dependent Cushing's syndrome may be caused by pituitary microadenomas or macroadenomas. Advances in diagnostic imagery have allowed the antemortem diagnosis of pituitary macrotumors. Treatment of pituitary tumors may be attempted with radiotherapy, especially if a diagnosis of macrotumor can be made before the onset of profound neurologic signs

  5. Study of total ionization dose effects in electronic devices

    International Nuclear Information System (INIS)

    Nidhin, T.S.; Bhattacharyya, Anindya; Gour, Aditya; Behera, R.P.; Jayanthi, T.

    2018-01-01

    Radiation effects in electronic devices are a major challenge in the dependable application developments of nuclear power plant instrumentation and control systems. The main radiation effects are total ionization dose (TID) effects, displacement damage dose (DDD) effects and single event effects (SEE). In this study, we are concentrating on TID effects in electronic devices. The focus of the study is mainly on SRAM based field programmable gate arrays (FPGA) along with that the devices of our interest are voltage regulators, flash memory and optocoupler. The experiments are conducted by exposing the devices to gamma radiation in power off condition and the degradation in the performances are analysed

  6. Insecticide residues in stored grains in Sonora, Mexico: quantification and toxicity testing.

    Science.gov (United States)

    Aldana-Madrid, M L; Valdez-Hurtado, S; Vargas-Valdez, N D; Salazar-Lopez, N J; Silveira-Gramont, M I; Loarca-Piña, F G; Rodríguez-Olibarria, G; Wong-Corral, F J; Borboa-Flores, J; Burgos-Hernández, A

    2008-02-01

    Food safety has acquired great attention by food importer and exporters. Food rejection or acceptance across international borders is based on the compliance with international food regulations. Due to the lack of recent data on pesticide residues in Mexican grains, this study focused on detecting and quantifying insecticide residues in stored wheat, corn, chickpeas, and beans, as well as to determine their mutagenic potential. Grains were sampled from primary storage sites in Sonora, Mexico. Malathion, chlorpyrifos, deltamethrin, cypermethrin, 4,4-DDE, 4,4-DDD and 4,4-DDT were analyzed in 135 samples. Grain samples were not mutagenic and most pesticide levels were within regulation limits.

  7. Geometry simulation and physics with the CMS forward pixel detector

    Energy Technology Data Exchange (ETDEWEB)

    Parashar, N [Purdue University Calumet, Hammond, Indiana (United States)], E-mail: Neeti@fnal.gov

    2008-06-15

    The Forward Pixel Detector of CMS is an integral part of the Tracking system, which will play a key role in addressing the full physics potential of the collected data. It has a very complex geometry that encompasses multilayer structure of its detector modules. This presentation describes the development of geometry simulation for the Forward Pixel Detector. A new geometry package has been developed, which uses the detector description database (DDD) interface for the XML (eXtensive Markup Language) to GEANT simulation. This is necessary for digitization and GEANT4 reconstruction software for tracking. The expected physics performance is also discussed.

  8. Geometry simulation and physics with the CMS forward pixel detector

    International Nuclear Information System (INIS)

    Parashar, N

    2008-01-01

    The Forward Pixel Detector of CMS is an integral part of the Tracking system, which will play a key role in addressing the full physics potential of the collected data. It has a very complex geometry that encompasses multilayer structure of its detector modules. This presentation describes the development of geometry simulation for the Forward Pixel Detector. A new geometry package has been developed, which uses the detector description database (DDD) interface for the XML (eXtensive Markup Language) to GEANT simulation. This is necessary for digitization and GEANT4 reconstruction software for tracking. The expected physics performance is also discussed

  9. Ecological and laboratory studies on the role of luminous bacteria and their luminescence in coastal pollution surveillance

    Digital Repository Service at National Institute of Oceanography (India)

    Ramaiah, N.; Chandramohan, D.

    the light to below 50% in the first 20 s. ZnCI 2, CdC12 and PPDDE decreased the luminescence to below 50% in 40 s. Hexane reduced it to 48.38% in 180 s. However, 200 or more seconds were required by decanol, penicillin, streptomycin and DDD (10 and 20...), decreased the light to less than 10% within 300 s (Fig. 4) and it dropped to 50% levels within the first 40 s, except for CdC12 which enhanced it in the first 60 s and, reduced sharply to 10% or less at the end of the experimental period (Fig. 5...

  10. Design and Synthesis of Brain Penetrant Trypanocidal N-Myristoyltransferase Inhibitors.

    Science.gov (United States)

    Bayliss, Tracy; Robinson, David A; Smith, Victoria C; Brand, Stephen; McElroy, Stuart P; Torrie, Leah S; Mpamhanga, Chido; Norval, Suzanne; Stojanovski, Laste; Brenk, Ruth; Frearson, Julie A; Read, Kevin D; Gilbert, Ian H; Wyatt, Paul G

    2017-12-14

    N-Myristoyltransferase (NMT) represents a promising drug target within the parasitic protozoa Trypanosoma brucei (T. brucei), the causative agent for human African trypanosomiasis (HAT) or sleeping sickness. We have previously validated T. brucei NMT as a promising druggable target for the treatment of HAT in both stages 1 and 2 of the disease. We report on the use of the previously reported DDD85646 (1) as a starting point for the design of a class of potent, brain penetrant inhibitors of T. brucei NMT.

  11. PHARMACOEPIDEMIOLOGICAL STUDY OF NON-STEROID ANTIINFLAMMATORY MEDICINE USE IN THE IN-PATIENT DEPARTMENT BEFORE AND AFTER THE FORMULAR SYSTEM ADOPTION

    Directory of Open Access Journals (Sweden)

    V.A. Baturin

    2008-03-01

    Full Text Available We studied the use ofnon-steroid anti-inflammatorydrugs (NSAID at the in-patient department ofcentral district hospitalwith the application ofDDD-techniques before and after the formular system adoption. After introduction of drug formular and treatment standards the use of NSAID was reduced; the physicians began to use modern drugs. Non-indicated and contraindicated NSAID were prescribed more seldom. Itwas determined that reduction of antihypertensive drugs efficiency in hypertensive patients was the main side effect of NSAID use. NSAID gastropathy occurred more seldom, and mainly in the patients receiving several NSAIDs simultaneously.

  12. Impact of neutron-induced displacement damage on the ATREE response in LM124 operational amplifier

    International Nuclear Information System (INIS)

    Roig, F.; Roche, N.J.H.; Marec, R.; Calvel, P.; Bezerra, F.; Ecoffet, R.; Azais, B.

    2014-01-01

    The synergistic effect between displacement damage dose (DDD) and analog transient radiation effects on electronics (ATREE) in an operational amplifier (LM124) (op-amp) from three different manufacturers is investigated. Pulsed X-ray experiments have highlighted ATREE sensitivity on devices significantly more important following exposure to fission neutrons than for unirradiated devices. A previously developed simulation tool is used to model ATREE responses taking into account the electrical parameters degradation due to displacement damage phenomenon. A good agreement is observed between model outputs and experimental ATREE results. (authors)

  13. Methods for estimating the occurrence of polypharmacy by means of a prescription database

    DEFF Research Database (Denmark)

    Bjerrum, L; Rosholm, J U; Hallas, J

    1997-01-01

    to equal the amount of drug purchased, as measured in defined daily doses (DDD), thereby assuming a daily intake of one DDD. PP was defined as overlapping periods of consumption for different drugs. A Venn diagram was used to illustrate and compare this estimator of PP with two other indicators of multiple......-drug use: the number of drugs purchased in 3 months and the mean number of drugs used in 1 year. A receiver operating curve (ROC) was used to evaluate the possibility of predicting episodes of PP from the number of drugs purchased in 3 months. RESULTS: The proposed estimator of PP was robust towards...... for the first time in 1994 stabilised after approximately 6 months, resulting in an incidence of major PP of 0.2% and of minor PP of 1.2% per month. For individuals exposed to PP, the median number of days of exposure was 61 and 10.5% were exposed for more than 350 days of the year. Purchase of five or more...

  14. [Appropriateness of ketorolac use in a trauma hospital].

    Science.gov (United States)

    Angeles González-Fernández, M

    2009-06-01

    To evaluate the suitability of ketorolac and non-steroidal anti-inflamatory drugs (NSAIDs) and other analgesic drugs currently used in the hospital. We have followed the steps to develop a PDCA cycle (plan, do, check, act) or quality improvement cycle. The quality problem was analysed using an Ishikawa diagram. We defined both qualitative quality indicators, those that measure prescription quality, and quantitative ones (defined daily dose, DDD/100BDs), which measure drug consumption, being the objectives to achieve. The study was conducted in all patients admitted to the hospital and who were admitted to orthopaedic and trauma surgery and plastic surgery departments with unit-dose dispensing systems. The strategy used was to give information to physicians through meetings and documentation. Finally, the results were analysed and compared with the initial objectives. The study was performed on 260 patients in the first study period and 292 in the second. Qualitative indicators: intravenous ketorolac use or =65 years old at dose < or =60 mg/day it increased 27.7% (p<0.05). Quantitative indicators: in the second study period, ketorolac use decreased (plastic surgery department: 61.8 DDD/100BDs to 14.8), whereas tramadol, ibuprofen and metamizole increased (plastic surgery department: 0 to 14.1 in tramadol, 8.7 to 48.6 in ibuprofen and 50.1 to 71 in metamizole). Appropriateness of ketorolac, NSAIDs and tramadol use has been achieved, thus improving patient safety. Strategies have been effective.

  15. Monitoring of organochlorine and organophosphorus pesticide residues in water during different seasons of Tighra reservoir Gwalior, Madhya Pradesh, India.

    Science.gov (United States)

    Mamta; Rao, R J; Wani, Khursheed Ahmad

    2015-11-01

    Analysis of pesticides during different seasons for pesticidal contamination in water samples of Tighra reservoir was carried out on gas chromatograph-electron capture detector with capillary columns following multiresidual analytical technique. Organochlorine pesticides, viz., hexachlorobenzene (HCB), alpha-benzene hexachloride (BHC), beta-BHC, γ-BHC, heptachlor, aldrin, alpha-endosulfan, beta-endosulfan, p,p-DDE, dieldrin, o,p-dichlorodiphenyldichloroethane (DDD), p,p-DDD, p,p-dichlorodiphenyltrichloroethane (DDT), and endrin, and organophosphorus pesticides, viz., choloropyrifos, methyl parathion, diazion, dicholorovos, ethion, malathion, and parathion, were detected in water samples during different seasons. However, the pesticide concentration varied during different seasons at different sites. The prominent reason of contamination is the use of pesticides (both organochlorine and organophosphorus) in the agricultural fields near Tighra reservoir. On the basis of our observations, more extensive monitoring studies need to be carried out, covering all wetlands of Madhya Pradesh to enforce the policies for the restricted application of pesticides in agricultural fields adjacent to wetlands.

  16. Anterior lumbar interbody surgery for spondylosis results from a classically-trained neurosurgeon.

    Science.gov (United States)

    Chatha, Gurkirat; Foo, Stacy W L; Lind, Christopher R P; Budgeon, Charley; Bannan, Paul E

    2014-09-01

    Anterior lumbar surgery for degenerative disc disease (DDD) is a relatively novel technique that can prevent damage to posterior osseous, muscular and ligamentous spinal elements. This study reports the outcomes and complications in 286 patients who underwent fusion - with artificial disc implants or combined fusion and artificial disc implants - by a single-operator neurosurgeon, with up to 24 months of follow-up. The visual analogue scale (VAS), Oswestry Disability Index (ODI), Short Form 36 (SF36) and prospective log of adverse events were used to assess the clinical outcome. Radiographic assessments of implant position and bony fusion were analysed. Intraoperative and postoperative complications were also recorded. Irrespective of pre-surgical symptoms (back pain alone or back and leg pain combined), workers' compensation status and type of surgical implant, clinically significant improvements in VAS, ODI and SF36 were primarily observed at 3 and/or 6 month follow-up, and improvements were maintained at 24 months after surgery. A 94% fusion rate was obtained; the overall complication was 9.8% which included 3.5% with vascular complications. The anterior lumbar approach can be used for treating DDD for both back pain and back and leg pain with low complication rates. With appropriate training, single-operator neurosurgeons can safely perform these surgeries. Crown Copyright © 2014. Published by Elsevier Ltd. All rights reserved.

  17. Identification of rabbit annulus fibrosus-derived stem cells.

    Directory of Open Access Journals (Sweden)

    Chen Liu

    Full Text Available Annulus fibrosus (AF injuries can lead to substantial deterioration of intervertebral disc (IVD which characterizes degenerative disc disease (DDD. However, treatments for AF repair/regeneration remain challenging due to the intrinsic heterogeneity of AF tissue at cellular, biochemical, and biomechanical levels. In this study, we isolated and characterized a sub-population of cells from rabbit AF tissue which formed colonies in vitro and could self-renew. These cells showed gene expression of typical surface antigen molecules characterizing mesenchymal stem cells (MSCs, including CD29, CD44, and CD166. Meanwhile, they did not express negative markers of MSCs such as CD4, CD8, and CD14. They also expressed Oct-4, nucleostemin, and SSEA-4 proteins. Upon induced differentiation they showed typical osteogenesis, chondrogenesis, and adipogenesis potential. Together, these AF-derived colony-forming cells possessed clonogenicity, self-renewal, and multi-potential differentiation capability, the three criteria characterizing MSCs. Such AF-derived stem cells may potentially be an ideal candidate for DDD treatments using cell therapies or tissue engineering approaches.

  18. Study on incidence of pulmonary embolism in patients with cardiac pacemakers using lung perfusion mapping and ventilation scanning

    International Nuclear Information System (INIS)

    Yamashina, Hideki; Higo, Masanori; Sueda, Takashi

    1990-01-01

    We investigated pulmonary perfusion mapping and ventilation scanning employing 99mTC-MMA and 81mKr-Gas in patients with DDD and VVI cardiac pacemaker implantation. In 51 cases among 175 patients we observed some defects which matched the results from lung perfusion scanning in the pulmonary segments and sub-segments. These were diagnosed as pulmonary embolism after the possibility of other pulmonary diseases was rejected. The incidence rate of pulmonary embolism in patients with VVI (Ventricular pacing/sensing, inhibited type) pacemakers was 47 out of 138, or 34.1%, especially for those who received a pulmonary scanning examination whithin 6 months after pacemaker implantation. In contrast, those who were examined after 6 months had lower rates as well as chronological factors. The incidence rate of pulmonary embolism in 37 patients with DDD (Double chamber pacing/sensing, double modes of response) pacemakers was 10.8%, considerably lower than that for patients with VVI pacemakers. Therefore, one main factor of pulmonary embolism in patients with pacemakers could be the non-physiological phase of the contractions of both atria and ventricles. Other factors, such as the presence of foreign bodies in the endocardium, aging, and hypertension, could also promote pulmonary embolism. (author)

  19. Lifetime use of psychiatric medications and cognition at 43years of age in schizophrenia in the Northern Finland Birth Cohort 1966.

    Science.gov (United States)

    Hulkko, A P; Murray, G K; Moilanen, J; Haapea, M; Rannikko, I; Jones, P B; Barnett, J H; Huhtaniska, S; Isohanni, M K; Koponen, H; Jääskeläinen, E; Miettunen, J

    2017-09-01

    Higher lifetime antipsychotic exposure has been associated with poorer cognition in schizophrenia. The cognitive effects of adjunctive psychiatric medications and lifetime trends of antipsychotic use remain largely unclear. We aimed to study how lifetime and current benzodiazepine and antidepressant medications, lifetime trends of antipsychotic use and antipsychotic polypharmacy are associated with cognitive performance in midlife schizophrenia. Sixty participants with DSM-IV schizophrenia from the Northern Finland Birth Cohort 1966 were examined at 43years of age with an extensive cognitive test battery. Cumulative lifetime and current use of psychiatric medications were collected from medical records and interviews. The associations between medication and principal component analysis-based cognitive composite score were analysed using linear regression. Lifetime cumulative DDD years of benzodiazepine and antidepressant medications were not significantly associated with global cognition. Being without antipsychotic medication (for minimum 11months) before the cognitive examination was associated with better cognitive performance (P=0.007) and higher lifetime cumulative DDD years of antipsychotics with poorer cognition (P=0.020), when adjusted for gender, onset age and lifetime hospital treatment days. Other lifetime trends of antipsychotic use, such as a long antipsychotic-free period earlier in the treatment history, and antipsychotic polypharmacy, were not significantly associated with cognition. Based on these naturalistic data, low exposure to adjunctive benzodiazepine and antidepressant medications does not seem to affect cognition nor explain the possible negative effects of high dose long-term antipsychotic medication on cognition in schizophrenia. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  20. Assessment of DDT and Metabolites in Soil and Sediment of Potentially Contaminated Areas of Belém, Amazon Region, Brazil.

    Science.gov (United States)

    Rodrigues, Andreia Oliveira; de Souza, Larissa Costa; da Silva Rocha, Cássia Christina; da Costa, Amilton Cesar Gomes; de Alcântara Mendes, Rosivaldo

    2017-07-01

    The aim of this study was to evaluate the distribution of DDT and metabolites in surface soils and soil profiles from two areas containing deposits of obsolete pesticides in Belém, Amazon Region, Brazil. DDT and metabolites were extracted by microwave assisted extraction and analyzed by gas chromatography with electron capture detection. Concentrations of total DDT in surface soil samples ranged from 64.22 mg kg -1 in area 1 (A1) to 447.84 mg kg -1 in area 2 (A2). Lower levels were found in soil profiles than at the surface (6.21-21.17 mg kg -1 in A1 and 36.13-113.66 mg kg -1 in A2). pp'-DDT, pp'-DDE and pp'-DDD were detected in sediments at levels of 2.01, 0.96 and 0.35 mg kg -1 , respectively. The ratio (DDE + DDD)/ΣDDT was low indicating the recent introduction of DDT to the environment in the two study areas, through the volatilization and atmospheric deposition of the obsolete pesticides.

  1. Florida seagrass habitat evaluation: A comparative survey for chemical quality

    Energy Technology Data Exchange (ETDEWEB)

    Lewis, Michael A. [U.S. Environmental Protection Agency, Office of Research and Development, National Health and Environmental Effects Research Laboratory, Gulf Ecology Division, 1 Sabine Island Drive, Gulf Breeze, FL 32561 (United States)]. E-mail: lewis.michael@epa.gov; Dantin, Darrin D. [U.S. Environmental Protection Agency, Office of Research and Development, National Health and Environmental Effects Research Laboratory, Gulf Ecology Division, 1 Sabine Island Drive, Gulf Breeze, FL 32561 (United States); Chancy, Cynthia A. [U.S. Environmental Protection Agency, Office of Research and Development, National Health and Environmental Effects Research Laboratory, Gulf Ecology Division, 1 Sabine Island Drive, Gulf Breeze, FL 32561 (United States); Abel, Kathryn C. [Department of Biological Sciences, University of West Florida, Pensacola, FL 32514 (United States); Lewis, Christopher G. [Department of Water and Soil Science, University of Florida, Gainesville, FL 32103 (United States)

    2007-03-15

    Contaminant concentrations were determined for media associated with 13 Florida seagrass beds. Concentrations of 10 trace metals were more commonly detected in surface water, sediment and two seagrass species than PAHs, pesticides and PCBs. Concentrations of copper and arsenic in surface water exceeded Florida aquatic life criteria more frequently than other trace elements. Total organic carbon, mercury, chromium, zinc, total chlordane, total PAHs, total PCBs, DDD and DDE were significantly greater in seagrass-rooted sediments than adjacent non-vegetated sediments. Total DDT, DDD, DDE, total chlordane, arsenic, copper and nickel exceeded proposed sediment quality guidelines at six of 13 grass beds. Pesticides, PAHs, and PCBs were below detection in seagrass tissues. Mercury, cadmium, nickel, lead and silver were detected in 50% or more of the tissues for Thalassia testudinum (turtle grass) and Halodule wrightii (shoal grass). Spatial, interspecific and tissue differences were usually an order of magnitude or less. - Some anthropogenic contaminants were prevalent in seagrass and their rooted sediments but the biological significance is unknown.

  2. Tracking Potentiating States of Dissociation: An Intensive Clinical Case Study of Sleep, Daydreaming, Mood, and Depersonalization/Derealization

    Science.gov (United States)

    Poerio, Giulia L.; Kellett, Stephen; Totterdell, Peter

    2016-01-01

    This study examined in real time the role of sleep and daydreaming as potentiating states for subsequent dissociation in depersonalization/derealization disorder (DDD). Research and theory suggests that dissociation may be exacerbated and maintained by a labile sleep-wake cycle in which “dream-like” mentation intrudes into waking life and fuels dissociative symptoms. We explore and extend this idea by examining the state of daydreaming in dissociation. Daydreaming is a state of consciousness between dreaming and waking cognition that involves stimulus-independent and task-unrelated mentation. We report the results of a unique intensive N = 1 study with an individual meeting diagnostic criteria for DDD. Using experience-sampling methodology, the participant rated (six times daily for 40 days) current daydreaming, mood, and dissociative symptoms. At the start of each day sleep quality and duration was also rated. Daydreaming was reported on 45% of occasions and significantly predicted greater dissociation, in particular when daydreams were repetitive and negative (but not fanciful) in content. These relationships were mediated by feelings of depression and anxiety. Sleep quality but not duration was a negative predictor of daily dissociation and also negatively predicted depression but not anxiety. Findings offer initial evidence that the occurrence and content of daydreams may act as potentiating states for heightened, in the moment, dissociation. The treatment implications of targeting sleep and daydreaming for dissociative disorders are discussed. PMID:27582722

  3. Profile of Antituberculosis Use in Community Pharmacist of Bandung City 2008–2010

    Directory of Open Access Journals (Sweden)

    Sofa D. Alfian

    2012-12-01

    Full Text Available Infectious disease is still a major disease in developing countries such as in Indonesia. As one of the health care providers which has privilege to distribute antibiotics, it is very important to control the use of antibiotics in pharmacy. The aim of this study is to conduct a profile of anti-tuberculosis use, in all pharmacies in Bandung during the period from 2008–2010. This study was performed using an observational method and retrospective approach. In this study we applied the Anatomical Therapeutic Chemical/Defined Daily Dose (ATC/DDD and Drug Utilization 90 % (DU90% method. The result showed that the use of antituberculosis tends to decrease. During the period from 2008 to 2010, the use of antituberculosis decreased by 17,783 and 169,416 DDD/1000 inhabitants in 2009 and 2010, respectively. It can be concluded that the totaluse of antituberculosis in all pharmacies in Bandung during the period from 2008 to 2010 tends to decrease.

  4. Composition, distribution and risk assessment of organochlorine pesticides in soils from the Midway Atoll, North Pacific Ocean

    Energy Technology Data Exchange (ETDEWEB)

    Ge, Jing [Key Laboratory of Aquatic Botany and Watershed Ecology, Wuhan Botanical Garden, Chinese Academy of Sciences, Wuhan 430074 (China); Woodward, Lee Ann [U.S. Fish and Wildlife Service, Pacific Reefs NWRC, Honolulu, HI 96850 (United States); Li, Qing X., E-mail: qingl@hawaii.edu [Department of Molecular Biosciences and Bioengineering, University of Hawaii at Manoa, Honolulu, HI 96822 (United States); Wang, Jun, E-mail: wangjun@wbgcas.cn [Key Laboratory of Aquatic Botany and Watershed Ecology, Wuhan Botanical Garden, Chinese Academy of Sciences, Wuhan 430074 (China); Department of Molecular Biosciences and Bioengineering, University of Hawaii at Manoa, Honolulu, HI 96822 (United States)

    2013-05-01

    Concentrations of legacy organochlorine pesticides (OCPs), including dichlorodiphenyltrichloroethane (DDT) and its metabolites (e.g., DDE and DDD), and hexachlorocyclohexanes (HCHs) were determined in 111 soil samples from the Midway Atoll. OCPs were found in all samples analyzed, with predominance of α-HCH, p,p′-DDD and p,p′-DDT. The total concentrations ranged from 0 to 127 ng g{sup −1} with a median concentration of 17 ng g{sup −1} for HCHs and 1.4 to 643 ng g{sup −1} with a median concentration of 168 ng g{sup −1} for DDTs. The possible degradation pathways and potential sources of DDTs and HCHs were investigated. The total concentrations of DDTs and HCHs were used to evaluate the cancer risk probabilities in humans via ingestion, dermal contact and inhalation of soil particles. Very low cancer risk was found in all soil samples caused by ΣDDTs and ΣHCHs. - Highlights: • Contamination levels of DDTs and HCHs were studied in the Midway Atoll, North Pacific Ocean. • Potential sources of DDTs and HCHs in soils of the Midway Atoll were investigated. • Possible degradation modes of o,p′-DDT in soils of the Midway Atoll were analyzed. • Cancer risks of DDTs and HCHs in soils of the Midway Atoll were assessed.

  5. Accumulation of pesticide residues by shrimp, fish and brine shrimp during pond culture at Ghorabari (District Thatta)

    International Nuclear Information System (INIS)

    Sultana, R.; Wajeeha, F.A.; Ameer, F.; Munshi, A.B.; Nasir, M.

    2012-01-01

    Residual level of persistent organo chlorines (OC) such as sigma-HCH (alpha-HCH, beta-HCH, gamma-HCH, delta-HCH, sigma-DDT (o,p'-DDD, op-DDE, p,p-DDE pp-DDD, pp'-DDT, o,p'-DDT), dieldrin and endrin were measured in a number of water samples from Ambro creek and their accumulation in shrimp (Penaeus merguiensis and P. penicillatus), fish (Otolithes ruber) and brine shrimp (Artemia sp.) reared in ponds for a period of four months. Samples were extracted with organic solvents, and quantified using gas chromatography-electron capture detection (GC/ECD). It has been found that results of animal tissue and water are not same however OCs, (mainly sigma DT and beta-HCH 4,4-DDT, Dieldrin + 2,4-DDT, and Methoxychlor were detected in all samples ). Heptachlor exo-epoxide were found in fish and Artemia sp. and absent in all shrimp samples. Heptachlor endo-epoxide was detected only in Artemia sp. and average residual concentration of OCs in Artemia sp. was 0.004-0.09 ppm. Methoxychlor was found in the highest quantity in all the samples whether it was fish, shrimp or Artemia. In fish average residual concentration of all (OCs) in individual sample was 0.03 - 0.180 ppm. (author)

  6. Distribution and characteristics of organic micropollutants in surface sediments from Bohai Sea

    International Nuclear Information System (INIS)

    Liu Wenxin; Chen Jianglin; Lin Xiumei; Tao Shu

    2006-01-01

    Spatial distribution and compositional characteristics of PAHs, DDTs and PCBs in surface sediments from Bohai Sea were investigated. Proportion of LMW PAHs at Jinzhou Bay was significant, due probably to the petrogenic sources from neighboring oil wells and plants, while HMW PAHs were dominant in the other sea areas, inferred pyrogenic origins mainly from coal or petroleum combustion. The average ERL quotient for the PAH species in Qinhuangdao and Liaodong Bay indicated relatively stronger potential ecological risk. The concentration ratios of DDT to metabolites (DDD + DDE) exceeded 1.0 in the coastal areas of Qinhuangdao, Liaodong Bay and Bohai Bay, demonstrated some recent inputs of DDT nearby, and DDD as the major degradation product. The concentrations of PCBs were generally low, however, the contents of DDTs were greater than the ERL guidelines in the coastal areas of Qinhuangdao, Liaodong Bay and Bohai Bay, and suggested the potential ecological risk. - The recent inputs of DDT in surface sediments at some sites of Bohai Sea indicated potential ecological risk

  7. Sample pretreatment optimization for the analysis of short chain chlorinated paraffins in soil with gas chromatography-electron capture negative ion-mass spectrometry.

    Science.gov (United States)

    Chen, Laiguo; Huang, Yumei; Han, Shuang; Feng, Yongbin; Jiang, Guo; Tang, Caiming; Ye, Zhixiang; Zhan, Wei; Liu, Ming; Zhang, Sukun

    2013-01-25

    Accurately quantifying short chain chlorinated paraffins (SCCPs) in soil samples with gas chromatograph coupled with electron capture negative ionization mass spectrometry (GC-ECNI-MS) is difficult because many other polychlorinated pollutants are present in the sample matrices. These pollutants (e.g., polychlorinated biphenyls (PCBs), organochlorine pesticides (OCPs) and toxaphene) can cause serious interferences during SCCPs analysis with GC-MS. Four main columns packed with different adsorbents, including silica gel, Florisil and alumina, were investigated in this study to determine their performance for separating interfering pollutants from SCCPs. These experimental results suggest that the optimum cleanup procedure uses a silica gel column and a multilayer silica gel-Florisil composite column. This procedure completely separated 22 PCB congeners, 23 OCPs and three toxaphene congeners from SCCPs. However, p,p'-DDD, cis-nonachlor and o,p'-DDD were not completely removed and only 53% of the total toxaphene was removed. This optimized method was successfully and effectively applied for removing interfering pollutants from real soil samples. SCCPs in 17 soil samples from different land use areas within a suburban region were analyzed with the established method. The concentrations of SCCPs in these samples were between 7 and 541 ng g(-1) (mean: 84 ng g(-1)). Similar homologue SCCPs patterns were observed between the soil samples collected from different land use areas. In addition, lower chlorinated (Cl(6/7)) C(10)- and C(11)- SCCPs were the dominant congeners. Copyright © 2012 Elsevier B.V. All rights reserved.

  8. Potential savings from an evidence-based consumer-oriented public education campaign on prescription drugs.

    Science.gov (United States)

    Donohue, Julie M; Fischer, Michael A; Huskamp, Haiden A; Weissman, Joel S

    2008-10-01

    To estimate potential savings associated with the Consumer Reports Best Buy Drugs program, a national educational program that provides consumers with price and effectiveness information on prescription drugs. National data on 2006 prescription sales and retail prices paid for angiotensin-converting enzyme inhibitors (ACEIs), β-blockers, calcium channel blockers, and 3-hydroxy-3-methylglutaryl coenzyme A (HMG-coA) reductase inhibitors (statins). We converted national data on aggregate unit sales of drugs in the four classes to defined daily doses (DDD) and estimated a range of potential savings from generic and therapeutic substitution. We estimated that $2.76 billion, or 7.83 percent of sales, could be saved if use of the drugs recommended by the educational program was increased. The recommended drugs' prices were 15-65 percent lower per DDD than their therapeutic alternatives. The majority (57.4 percent) of potential savings would be achieved through therapeutic substitution. Substantial savings can be achieved through greater use of comparatively effective and lower cost drugs recommended by a national consumer education program. However, barriers to dissemination of consumer-oriented drug information must be addressed before savings can be realized. © Health Research and Educational Trust.

  9. Impact of pharmacist intervention on antibiotic use and prophylactic antibiotic use in urology clean operations.

    Science.gov (United States)

    Zhou, Y; Ma, L-Y; Zhao, X; Tian, S-H; Sun, L-Y; Cui, Y-M

    2015-08-01

    The use of prophylactic antibiotics in clean operations was routine in China before 2011. Along with the appeal for using antibiotics rationally by WHO in 2011, China launched a national special rectification scheme on clinical use of antibiotics from April that year. The scheme, aimed at achieving rational use of antibiotics, made pharmacists part of the responsible medical team. Our objective was to describe the impacts of pharmacist intervention on the use of antibiotics, particularly in urology clean operations. Pharmacists participated in antibiotic stewardship programmes of the hospital and urological clinical work and conducted real-time interventions at the same time from 2011 to 2013. Data on the use of antibiotics between 2010 and 2013 in urology were collected. Comparison of the 2013 data with those of 2010 showed that antibiotic use density [AUD= DDDs*100/(The number of patients who were treated the same period*Average days in hospital). DDDs = Total drug consumption (g)/DDD. DDD is the Defined Daily Dose] decreased by 57·8(58·8%); average antibiotic cost decreased by 246·94 dollars; the cost of antibiotics as a percentage of total drug cost decreased by 27·7%; the rate of use of antibiotics decreased from 100% to 7·3%. The study illustrates how an antibiotic stewardship programme with pharmacist participation including real-time interventions can promote improved antibiotic-prescribing and significantly decrease costs. © 2015 John Wiley & Sons Ltd.

  10. Organochlorine Pesticides (OCPs) in raft mussels coming from Galician rías.

    Science.gov (United States)

    Carro, Nieves; García, Isabel; Ignacio, María; Mouteira, Ana

    2017-09-01

    This survey gives an overview of the range of organochlorine pesticides (OCPs) α and γ-HCH (lindane), HCB, pp´-DDE, pp´-DDD, op´-DDT, pp´-DDT, aldrin, dieldrin, endrin, isodrin and trans-nonachlor in raft mussels cultivated in several polygons of the Galician Rías (Ares-Betanzos, Muros-Noia, Arousa, Pontevedra and Vigo) during the period 1998-2014. A significant number of OCPs were detected, but the levels found were generally low, mainly in the recent samplings (2010-2014). The levels of ∑DDs (sum of DDTs and its metabolites, pp´-DDE and pp´-DDD) ranged between 0.22 ng/g dry weight (dw) in samples from the Ría of Pontevedra and 46.4 ng/g dw in mussels from the Ría of Arousa. Both aldrin and endrin were not detected or were below the analytical limits of detection. With regard to other pesticides, dieldrin is the major compound, followed by γ-HCH, isodrin, α-HCH and transnonachlor. Significant ANOVA regressions indicated variations in levels of some OCPs with the biological parameters (lipid, condition index and shell length). Univariate and multivariate analysis of OCP levels revealed no significant differences between Rías. Temporal trends showed an important decline of OCPs in the studied samples during the period 1998-2014.

  11. Abilities of Co-cultures of Brown-Rot Fungus Fomitopsis pinicola and Bacillus subtilis on Biodegradation of DDT.

    Science.gov (United States)

    Sariwati, Atmira; Purnomo, Adi Setyo; Kamei, Ichiro

    2017-09-01

    DDT (1,1,1-trichloro-2,2-bis(4-chlorophenyl)ethane) is one of the pesticides that are hazardous for the environment and human health. Effective environmental-friendly treatment using co-cultures of fungi and bacteria is needed. In this study, the bacteria Bacillus subtilis at various volumes of 1, 3, 5, 7, and 10 mL (1 mL ≈ 6.7 × 10 8  CFU) were mixed into 10 mL of the brown-rot fungus Fomitopsis pinicola culture for degrading DDT during a 7-days incubation period. DDT was degraded by approximately 42% by F. pinicola during the 7-days incubation period. The addition of 10 mL of B. subtilis into F. pinicola culture showed the highest DDT degradation of approximately 86% during the 7-days incubation period. DDD (1,1-dichloro-2,2-bis(4-chlorophenyl)ethane), DDE (1,1-dichloro-2,2-bis(4-chlorophenyl)ethylene), and DDMU (1-chloro-2,2-bis(4-chlorophenyl)ethylene) were detected as metabolic products from DDT degradation by co-cultures of F. pinicola and B. subtilis. Transformation pathway was proposed in which DDT was transformed into three pathways as follows: (1) dechlorination to DDD, (2) dehydrochlorination to DDE, and (3) formation of DDMU.

  12. Impact of a clinical microbiology-intensive care consulting program in a cardiothoracic intensive care unit.

    Science.gov (United States)

    Arena, Fabio; Scolletta, Sabino; Marchetti, Luca; Galano, Angelo; Maglioni, Enivarco; Giani, Tommaso; Corsi, Elisabetta; Lombardi, Silvia; Biagioli, Bonizella; Rossolini, Gian Maria

    2015-09-01

    A preintervention-postintervention study was carried out over a 4-year period to assess the impact of an antimicrobial stewardship intervention, based on clinical microbiologist ward rounds (clinical microbiology-intensive care partnership [CMICP]), at a cardiothoracic intensive care unit. Comparison of clinical data for 37 patients with diagnosis of bacteremia (18 from preintervention period, 19 from postintervention period) revealed that CMICP implementation resulted in (1) significant increase of appropriate empirical treatments (+34%, P = .029), compliance with guidelines (+28%, P = .019), and number of de-escalations (+42%, P = .032); and (2) decrease (average = 2.5 days) in time to optimization of antimicrobial therapy and levofloxacin (Δ 2009-2012 = -74 defined daily dose [DDD]/1,000 bed days) and teicoplanin (Δ 2009-2012 = -28 DDD/1,000 bed days) use. Copyright © 2015 Association for Professionals in Infection Control and Epidemiology, Inc. Published by Elsevier Inc. All rights reserved.

  13. High heat flux (HHF) elements for negative ion systems on ITER

    International Nuclear Information System (INIS)

    Milnes, J.; Chuilon, B.; Xue, Y.; Martin, D.; Waldon, C.

    2007-01-01

    Negative Ion Neutral Beam systems on ITER will require actively cooled scrapers and dumps to process and shape the beam before injection into the tokamak. The scale of the systems is much larger than any presently operating, bringing challenges for designers in terms of available sub cooling, total pressure drop, deflection and mandatory remote maintenance. High heat fluxes (∼15-20 MW/m 2 ), pulse lengths in excess of 3000 s and high number of cycles pose new challenges in terms of stress and fatigue life. The designs outlined in the Design Description Document for the ITER Neutral Beam System [N53 DDD 29 01-07-03 R 0.1. ITER Design Description Document, DDD 5.3, Neutral Beam H and CD system (including Appendices).], based on swirl tubes, have been reviewed as part of the design process and recommendations made. Additionally, alternative designs have been proposed based on the Hypervapotron high heat flux elements with modified geometry and drawing upon a vast background knowledge of large scale equipment procurement and integration. A full thermo-mechanical analysis of all HHF components has also been undertaken based on ITER design criteria and the limited material data available. The advantages and disadvantages of all designs are presented and recommendations for improvements discussed

  14. Residues, spatial distribution and risk assessment of DDTs and HCHs in agricultural soil and crops from the Tibetan Plateau.

    Science.gov (United States)

    Wang, Chuanfei; Wang, Xiaoping; Gong, Ping; Yao, Tandong

    2016-04-01

    Due to its high elevation and cold temperature, the Tibetan Plateau (TP) is regarded as the "Third Pole". Different from other polar regions, which are truly remote, the TP has a small population and a few agricultural activities. In this study, agricultural soil and crop samples (including highland barley and rape) were collected in the main farmland of the TP to obtain the contamination levels of dichlorodiphenyltrichloroethane (DDT) and hexachlorocyclohexane (HCH) in the Tibetan agricultural system as well as the relevant human exposure risks. The average concentrations of DDTs and HCHs in the agricultural soil, highland barley and rape were 1.36, 0.661, 1.03 ng/g dw and 0.349, 0.0364, 0.0225 ng/g dw, respectively. In the agricultural soil, DDTs and HCHs metabolism (DDE, DDD and β-HCH) were abundant, which indicated a "historical" source, whereas crops contained a similar composition ((DDE + DDD)/DDT, α/β-HCH and α/γ-HCH) to that of wild plants, suggesting that the DDTs and HCHs in crops are likely from long range atmospheric transport. The human health risks via non-dietary and dietary to DDTs and HCHs in the farmland were assessed. All of the hazard index (HI) values of DDTs and HCHs for non-carcinogenic risks were Tibetan residents. Copyright © 2016 Elsevier Ltd. All rights reserved.

  15. Biodegradation of 1,1,1-trichloro-2,2-bis(4-chlorophenyl) ethane (DDT) by using Serratia marcescens NCIM 2919.

    Science.gov (United States)

    Grewal, Jasneet; Bhattacharya, Amrik; Kumar, Sumit; Singh, Dileep K; Khare, Sunil K

    2016-12-01

    A solvent tolerant bacterium Serratia marcescens NCIM 2919 has been evaluated for degradation of DDT (1,1,1-trichloro-2,2-bis (4-chlorophenyl) ethane). The bacterium was able to degrade up to 42% of initial 50 mg L -1 of DDT within 10 days of incubation. The highlight of the work was the elucidation of DDT degradation pathway in S. marcescens. A total of four intermediates metabolites viz. 2,2-bis (chlorophenyl)-1,1-dichloroethane (DDD), 2,2-bis (chlorophenyl)-1,1-dichloroethylene (DDE), 2,2-bis (chlorophenyl)-1-chloroethylene (DDMU), and 4-chlorobenzoic acid (4-CBA) were identified by GC-Mass and FTIR. 4-CBA was found to be the stable product of DDT degradation. Metabolites preceding 4-CBA were not toxic to strain as reveled through luxuriant growth in presence of varying concentrations of exogenous DDD and DDE. However, 4-CBA was observed to inhibit the growth of bacterium. The DDT degrading efficiency of S. marcescens NCIM 2919 hence could be used in combination with 4-CBA utilizing strains either as binary culture or consortia for mineralization of DDT. Application of S. marcescens NCIM 2919 to DDT contaminated soil, showed 74.7% reduction of initial 12.0 mg kg -1 of DDT after 18-days of treatment.

  16. Assessing the effectiveness of voluntary solid waste reduction policies: Methodology and a Flemish case study

    International Nuclear Information System (INIS)

    Jaeger, Simon de; Eyckmans, Johan

    2008-01-01

    The purpose of this paper is to illustrate the use of statistical techniques to evaluate the effectiveness of voluntary policy instruments for waste management. The voluntary character of these instruments implies that latent characteristics, unobserved by the analyst, might influence the subscription decision and might lead to biased estimates of the effectiveness of the policy instrument if standard techniques are used. We propose an extension of the difference-in-differences (DiD) estimator to evaluate the effectiveness of voluntary policy instruments, which is termed the dynamic difference-in-differences (or DDD) estimator. We illustrate the technique by estimating the effectiveness of voluntary cooperation agreements between the Flemish environmental administration and individual municipalities aimed at curbing residential solid waste. Using a dataset covering all 308 Flemish municipalities for the period 2000-2005, our results indicate that municipalities subscribing to the agreement accomplished less reduction of their waste levels compared to what could be expected on the basis of their own performance prior to subscription and the performance of the non-subscribers. This result might be explained by the rising marginal cost of extra residential solid waste reduction policies. In addition, there are indications that subscribing municipalities refrain from additional reduction efforts once the target waste level of the program is achieved. The more complicated DDD methodology is shown to generate additional insight over the ordinary DiD analysis

  17. Necrotising enterocolitis in preterm infants: epidemiology and antibiotic consumption in the Polish neonatology network neonatal intensive care units in 2009.

    Directory of Open Access Journals (Sweden)

    Jadwiga Wójkowska-Mach

    Full Text Available The aim of this study was to describe the epidemiology of necrotising enterocolitis (NEC, antibiotic consumption and the usefulness of microbiological tests in very low birth weight (VLBW Polish newborns.Prospective surveillance was performed in the year 2009 by local infection control teams. The study covered 910 infants hospitalized in six Polish neonatal intensive care units. Two kinds of indicators were used for the description of antibiotic usage: the duration of treatment (days of treatment, DOTs and the defined daily dose (DDD.NEC incidence was 8.7% and fatality rate was 19%. Chorioamnionitis, late gestational age and low birth weight were identified as risk factors for NEC. Catheterization, mechanical ventilation and other selected procedures were used considerably longer in newborns with NEC than in the remaining neonates. Total usage of antibiotics reached 2.9 DDDs or 1.437 days; the average use of drugs per case of NEC amounted to 0.47 DDD or 23.2 DOTs. The level of antibiotic usage was analysed with correlation to microbiological tests performed and it was non-significantly greater in the group of children with NEC in whom the tests were performed.A high risk of developing NEC is closely associated with VLBW and with inflammation of the amnion during labour. We observed no relationship between the consumption of antibiotics in neonates with NEC and positive results of microbiological testing indicating sepsis accompanying NEC or gut colonization with pathogens.

  18. Magnitude of [14C] DDT residues in stored dried fish and pre-cooking processing effect on their removal

    International Nuclear Information System (INIS)

    Rahman, M.; Khatoon, J.; Matin, M.A.; Main, A.J.

    1998-01-01

    Residues of 14 C-DDT in stored dried fish was determined under ambient conditions for a 6 month period. Immediately after treatment, about 40% of the applied DDT was eliminated from surface of the dried fish with water washing. However, such removal was reduced to about 26% on storage for 6 months. Boiling of dried fish in water resulted in further removal of about 16% residues. In boiled dried fish, about 14% residues might remain and this could be removed by Soxhlet extraction. Surface extraction with hexane yielded about 80% of the residues immediately after treatment and the extractable residues decreased to about half the initial value of 6 months' storage. Dried fish residues, on surface extraction with water or hexane, when subjected to exhaustive Soxhlet extraction with methanol was found to result in further recovery of about 39-49% and 17-32%, respectively. Bound DDT residues were found to be about 5% in water washed dried fish samples and about 1.5% in case of hexane-extracted samples. Degradation of parent DDT to DDE and DDD was found. Maximum values of 16.58% DDE and 21.6% DDD were found in dried fish stored for 6 months. (author)

  19. Measurements of the Neutron Longitudinal Spin Asymmetry A1n and Flavor Decomposition in the Valence Quark Region

    Energy Technology Data Exchange (ETDEWEB)

    Flay, David J. [Temple University, Philadelphia, PA (United States)

    2014-08-01

    The current data for the nucleon-virtual photon longitudinal spin asymmetry A1 on the proton and neutron have shown that the ratio of the polarized-to-unpolarized down-quarkparton distribution functions,Dd=d, tends towards -1/2 at large x, in disagreement with the perturbative QCD prediction that Dd/d approaches 1 but more in line with constituent quark models. As a part of experiment E06-014 in Hall A of Jefferson Lab, double-spin asymmetries were measured in the scattering of a longitudinally polarized electron beam of energies 4.74 and 5.89 GeV from a longitudinally and transversely polarized 3He target in the deep inelastic scattering and resonance region, allowing for the extraction of the neutron asymmetry An1 and the ratios Dd/d and Du/u. We will discuss our analysis of the data and present results for A1 and g1/F1 on both 3He and the neutron, and the resulting quark ratios for the up and down quarks in the kinematic range of 0.2

  20. Incinerator Pollution and Child Development in the Taiwan Birth Cohort Study

    Directory of Open Access Journals (Sweden)

    Bih-Ching Shu

    2013-05-01

    Full Text Available This study aimed to investigate the direct and indirect effects of environmental pollutants on child development and parental concerns. It focused on the pathway relationships among the following factors: living within three kilometers of an incinerator, breastfeeding, place of residence, parental concerns about development, and parent-perceived child development. The Taiwan Birth Cohort Study (TBCS dataset includes randomized community data on 21,248 children at six, 18, and 36 months of age. The Parental Concern Checklist and the Taiwan Birth Cohort Study-Developmental Instrument were used to measure parental concern and parent-perceived child development. Living within three kilometers of an incinerator increased the risk of children showing delayed development in the gross motor domain at six and 36 months. Although breastfeeding is a protective factor against uneven/delayed developmental disability (U/DDD, children living near an incinerator who were breastfed had an increased risk of U/DDD compared with those who did not live near incinerators. The presence of a local incinerator affected parent-perceived child development directly and indirectly through the mediating factor of breastfeeding. Further follow-up of these children to investigate the long-term effects of specific toxins on their development and later diagnostic categorization is necessary.

  1. Residues of organochlorine pesticides, mercury, and PCB's in mourning doves from eastern United States--1970-71

    Science.gov (United States)

    Kreitzer, J.F.

    1974-01-01

    Mourning dove (Zenaidura macroura) breast muscle samples from birds collected in 1970-71 from Rhode Island, Pennsylvania, Maryland, Missouri, Kentucky, Virginia, Arkansas, Tennessee, North Carolina, South Carolina, Mississippi, Alabama, Georgia, Louisiana, and Florida were found to contain residues of DDT, DDE, DDD, polychlorinated biphenyls, dieldrin, mirex, mercury, and heptachlor epoxide in amounts not considered hazardous to consumers, human or nonhuman. There were 145 birds involved, 7 to 10 from each State. Residues of DDT plus DDE plus DDD averaged 5.83 ppm lipid weight (0.068 ppm wet weight); those of PCB's, 9.75 ppm lipid weight (0.121 ppm wet weight); compounds were found in all birds. Heptachlor epoxide and dieldrin were found in little more than trace amounts: heptachlor in all birds, dieldrin in 73. Mirex was found only in birds from South Carolina, Georgia, and Florida, averaging 4.32 ppm lipid weight (0.046 ppm wet weight) in eight birds. Less than 0.05 ppm (wet weight) mercury was found in all birds except 10, in which it ranged from 0.07 to 0.67 ppm. The 10 were from Rhode Island, Pennsylvania, Maryland, Virginia, Tennessee, and Alabama.

  2. Alignment of cryo-EM movies of individual particles by optimization of image translations.

    Science.gov (United States)

    Rubinstein, John L; Brubaker, Marcus A

    2015-11-01

    Direct detector device (DDD) cameras have revolutionized single particle electron cryomicroscopy (cryo-EM). In addition to an improved camera detective quantum efficiency, acquisition of DDD movies allows for correction of movement of the specimen, due to both instabilities in the microscope specimen stage and electron beam-induced movement. Unlike specimen stage drift, beam-induced movement is not always homogeneous within an image. Local correlation in the trajectories of nearby particles suggests that beam-induced motion is due to deformation of the ice layer. Algorithms have already been described that can correct movement for large regions of frames and for >1 MDa protein particles. Another algorithm allows individual images to be aligned without frame averaging or linear trajectories. The algorithm maximizes the overall correlation of the shifted frames with the sum of the shifted frames. The optimum in this single objective function is found efficiently by making use of analytically calculated derivatives of the function. To smooth estimates of particle trajectories, rapid changes in particle positions between frames are penalized in the objective function and weighted averaging of nearby trajectories ensures local correlation in trajectories. This individual particle motion correction, in combination with weighting of Fourier components to account for increasing radiation damage in later frames, can be used to improve 3-D maps from single particle cryo-EM. Copyright © 2015 Elsevier Inc. All rights reserved.

  3. Reimbursement of hormonal contraceptives and the frequency of induced abortion among teenagers in Sweden.

    Science.gov (United States)

    Sydsjö, Adam; Sydsjö, Gunilla; Bladh, Marie; Josefsson, Ann

    2014-05-29

    Reduction in costs of hormonal contraceptives is often proposed to reduce rates of induced abortion among young women. This study investigates the relationship between rates of induced abortion and reimbursement of dispensed hormonal contraceptives among young women in Sweden. Comparisons are made with the Nordic countries Finland, Norway and Denmark. Official statistics on induced abortion and numbers of prescribed and dispensed hormonal contraceptives presented as "Defined Daily Dose/thousand women" (DDD/T) aged 15-19 years were compiled and related to levels of reimbursement in all Swedish counties by using public official data. The Swedish numbers of induced abortion were compared to those of Finland, Norway and Denmark. The main outcome measure was rates of induced abortion and DDD/T. No correlation was observed between rates of abortion and reimbursement among Swedish counties. Nor was any correlation found between sales of hormonal contraceptives and the rates of abortion. In a Nordic perspective, Finland and Denmark, which have no reimbursement at all, and Norway all have lower rates of induced abortion than Sweden. Reimbursement does not seem to be enough in order to reduce rates of induced abortion. Evidently, other factors such as attitudes, education, religion, tradition or cultural differences in each of Swedish counties as well as in the Nordic countries may be of importance. A more innovative approach is needed in order to facilitate safe sex and to protect young women from unwanted pregnancies.

  4. Opioid analgesic use in Australia and The Netherlands: a cross-country comparison.

    Science.gov (United States)

    Wagemaakers, Francisca N; Hollingworth, Samantha A; Kreijkamp-Kaspers, Sanne; Tee, Ernest H L; Leendertse, Anne J; van Driel, Mieke L

    2017-08-01

    Background Increasing use of opioid analgesics (OA) has been reported worldwide. Objective To compare the use of OA in two countries in order to better understand these trends. Setting Outpatient settings in Australia and The Netherlands. Method We analysed publicly available government data on outpatient OA dispensing over 15 years (2000-2014). We compared dispensing trends for specific OA and explored medical (national clinical guidelines), contextual and policy-related factors to explain differences in use between the two countries. Main outcome measure OA prescribing in Australia and The Netherlands, absolute volume of use, preferred types of opioids and changes over time. Results The average annual increase in OA prescribing was 10% in Australia and 8% in The Netherlands between 2000 and 2014. In 2014, the total use of OA was 10.0 daily defined doses (DDD)/1000 population/day in Australia and 9.4 DDD/1000 population/day in The Netherlands. In Australia, the most commonly prescribed opioids were oxycodone and tramadol, compared to fentanyl and tramadol in The Netherlands. We found differences in prescribing guidelines, culture of prescribing and regulatory frameworks that could explain some of the observed differences. Conclusion OA prescribing has increased remarkably in both countries between 2000 and 2014 but the types of prescribed OA vary. Differences in national evidence-based guidelines influenced the types of OA used. Prescribing culture as well as regulatory policies and costs, may also contribute to the different patterns of OA use.

  5. Evaluation of pharmacotherapy of obstructive airway diseases in the Montenegrin outpatient care: comparison with two Scandinavian countries

    Directory of Open Access Journals (Sweden)

    Duborija-Kovacevic Natasha

    2012-06-01

    Full Text Available Abstract Background This study is aimed at evaluating the pharmacotherapy of obstructive airway diseases (OAD in the Montenegrin outpatient care (MOC in 2010. Methods Data on the reimbursed drugs which were prescribed during the reference period were obtained from the National Database that was established within the Health Insurance Fund of Montenegro in 2004. We have applied the standard pharmacoepidemiologic methodology with the defined daily dose (DDD along with the Anatomical Therapeutic Chemical (ATC classification of drugs. Clinical entities of OAD were classified according to the International Classification of Diseases (ICD-Revision X. Results Prescribing and the subsequent use of drugs for OAD (ATC code R03 in 2010 was 18.18 DDD/1000inhabitants/day, much lower than in some developed countries. Fenoterol/ipratropium and salmeterol/fluticasone fixed combinations had the highest utilisation level, accounting for more than 50% of all OAD drugs. About 90% of OAD drugs were prescribed for COPD and asthma. Conclusions Obtained results indicate that there are still large differences in OAD drug utilisation in MOC when compared with developed countries, but also some improvement in pharmacological approach to the pharmacotherapy of OAD in comparison to the earlier period.

  6. Identification and quantification of pesticide residues in water samples of Dhamrai Upazila, Bangladesh

    Science.gov (United States)

    Hasanuzzaman, M.; Rahman, M. A.; Salam, M. A.

    2017-10-01

    Being agricultural country, different types of pesticides are widely used in Bangladesh to prevent the crop losses due to pest attack which are ultimately drain to the water bodies. The present study was conducted to identify and quantify the organochlorine (DDT, DDE and DDD), organophosphorus (malathion, diazinon and chloropyrifos) and carbamate (carbaryl) residues in water samples of different sources from Dhamrai upazila of Bangladesh using high performance liquid chromatography (HPLC) equipped with ultra violate (UV) detector. Thirty water samples from fish pond, cultivated land and tube-well were collected in winter season to analyze the pesticide residues. Among the organophosphorus pesticides, malathion was present in seven water samples ranging from 42.58 to 922.8 μg/L, whereas diazinon was detected in water sample-8 (WS-8) and the concentration was 31.5 μg/L. None of the tested water samples was found to be contaminated with chlorpyrifos, carbaryl or DDT and its metabolites (DDE and DDD). Except for a tube-well water sample, concentrations of the detected residues are above the acceptable limit for human body as assigned by different organizations. To avoid the possible health hazards, the indiscriminate application of pesticides should be restricted and various substitute products like bio-pesticide should be introduced in a broad scale as soon as possible.

  7. Radiation Characterization of Commercial GaN Devices

    Science.gov (United States)

    Harris, Richard D.; Scheick, Leif Z.; Hoffman, James P.; Thrivikraman, Tushar; Jenabi, Masud; Gim, Yonggyu; Miyahira, Tetsuo

    2011-01-01

    Radiative feedback from primordial protostars and final mass of the first star Commercially available devices fabricated from GaN are beginning to appear from a number of different suppliers. Based on previous materials and prototype device studies, it is expected that these commercial devices will be quite tolerant to the types of radiation encountered in space. This expectation needs to be verified and the study described herein was undertaken for that purpose. All of the parts discussed in this report are readily available commercially. The parts chosen for study are all targeted for RF applications. Three different studies were performed: 1) a preliminary DDD/TID test of a variety of part types was performed by irradiating with 50 MeV protons, 2) a detailed DDD/TID study of one particular part type was performed by irradiating with 50 MeV protons, and 3) a SEB/SEGR test was performed on a variety of part types by irradiating with heavy ions. No significant degradation was observed in the tests performed in this study.

  8. Atmospheric contamination by pesticides: Determination in the liquid, gaseous and particulate phases.

    Science.gov (United States)

    Millet, M; Wortham, H; Sanusi, A; Mirabel, P

    1997-01-01

    Between 1991 and 1993, 18 fogwater samples, 31 rainwater samples and 17 atmosphere (gas and particles) samples were analysed for 13 pesticides (pp'DDT,pp'DDD,pp'DDE, aldrin, dieldrin, lindane, hexachlorobenzene, fenpropathrin, mecoprop, methyl-parathion, atrazine, isoproturon and aldicarb). The samples were collected in a rural area where some of the compounds are in use (experimental INRA farm, "Institut National de la Recherche Agronomique" in Colmar, Eastern France, 80,000 inhabitants). This paper briefly presents the analytical methodology used and, in detail, the contamination level of the different atmospheric phases. The contamination levels are roughly constant throughout the year in all the atmospheric phases and the most abundant pesticides are those commonly used on the experimental INRA farm and other surrounding farms. Nevertheless, some pesticides not used since the 1970s such as 1,1-Bis(4-chlorophenyl)-2,2,2-trichloroethane (pp'DDT) and 2,2-Bis(4-chlorophenyl)-1,1-dichloroethane (pp 'DDD) are also detected in the atmosphere of Colmar. A small increase in the pesticide concentrations in the atmosphere (gas and particles) was observed during treatments.

  9. Tracking potentiating states of dissociation: An intensive clinical case study of sleep, daydreaming, mood, and depersonalization/derealization

    Directory of Open Access Journals (Sweden)

    Giulia Lara Poerio

    2016-08-01

    Full Text Available This study examined in real time the role of sleep and daydreaming as potentiating states for subsequent dissociation in depersonalization/derealization disorder (DDD. Research and theory suggests that dissociation may be exacerbated and maintained by a labile sleep-wake cycle in which ‘dream-like’ mentation intrudes into waking life and fuels dissociative symptoms. We explore and extend this idea by examining the state of daydreaming in dissociation. Daydreaming is a state of consciousness between dreaming and waking cognition that involves stimulus-independent and task-unrelated mentation. We report the results of a unique intensive N=1 study with an individual meeting diagnostic criteria for DDD. Using experience-sampling methodology, the participant rated (six times daily for 40 days current daydreaming, mood, and dissociative symptoms. At the start of each day sleep quality and duration was also rated. Daydreaming was reported on 45% of occasions and significantly predicted greater dissociation, in particular when daydreams were repetitive and negative (but not fanciful in content. These relationships were mediated by feelings of depression and anxiety. Sleep quality but not duration was a negative predictor of daily dissociation and also negatively predicted depression but not anxiety. Findings offer initial evidence that the occurrence and content of daydreams may act as potentiating states for heightened, in the moment, dissociation. The treatment implications of targeting sleep and daydreaming for dissociative disorders are discussed.

  10. Results of treatment of Icenko-Cushing disease with proton beam irradiation of the pituitary gland

    International Nuclear Information System (INIS)

    Marova, E.I.; Starkova, N.T.; Kirpatovskaya, L.E.; Kolesnikova, G.S.; Bukhman, A.I.; Rozhinskaya, L.Ya.; Bel'chenko, L.V.

    1987-01-01

    Proton beam therapy was given to 98 patients with Icenko-Cushing disease aged 15 to 40. Mild cases were treated by proton beam irradiation only while severe cases were managed using proton beam therapy combined with unilateral adrenalectomy or ortho-para-DDD. Catamnesis duration varied from 3 to 5 years. In most cases the exposure dose was 80-90 Gy (50-110 Gy). The procedure was well tolerated by all the patients. A dynamic multipolar converting method with 15-20 entrance poles in the left temporal area was employed (with the beam energy of 200 MeV). Stabilization of the course of disease and some clinical improvement were observed in most of the patients 3-4 months after proton beam therapy. In 6-36 months after irradiation 90% of the patients showed normal biochemical indices and the absence of any clinical signs of the disease. Thus the results of proton beam therapy of 98 patients with Icenko-Cushing disease after a follow-up of 3-5 years showed a high efficacy of this type of treatment. The method can be used alone or in combination with unilateral adrenalectomy as well as with oral administration of ortho-para-DDD

  11. Levels and temporal trends (1983-2003) of persistent organic pollutants (POPs) and mercury (Hg) in seabird eggs from Northern Norway

    International Nuclear Information System (INIS)

    Helgason, Lisa B.; Barrett, Rob; Lie, Elisabeth; Polder, Anuschka; Skaare, Janneche U.; Gabrielsen, Geir W.

    2008-01-01

    The main objective of this study was to investigate possible temporal trends of persistent organic pollutants (POPs) and mercury in eggs of herring gulls (Larus argentatus), black-legged kittiwakes (Rissa tridactyla), common guillemots (Uria aalge) and Atlantic puffins (Fratercula arctica) in Northern Norway. Eggs were collected in 1983, 1993 and 2003. Egg concentrations of POPs (PCB congeners IUPAC numbers: CB-28, 74, 66, 101, 99, 110, 149, 118, 153, 105, 141, 138, 187, 128, 156, 157, 180, 170, 194, 206, HCB, α-HCH, β-HCH, γ-HCH, oxychlordane, trans-chlordane, cis-chlordane, trans-nonachlor, cis-nonachlor, p,p'-DDE, o,p'-DDD, p,p'-DDD, o,p'-DDT and p,p'-DDT) and mercury were quantified. Generally, POP levels decreased between 1983 and 2003 in all species. No significant temporal trend in mercury levels was found between 1983 and 2003. - POP levels decreased between 1983 and 2003 in seabird eggs from Northern Norway

  12. Organochlorinated pesticides in sediments from the Lake Albufera of Valencia (Spain).

    Science.gov (United States)

    Peris, E; Requena, S; de la Guardia, M; Pastor, A; Carrasco, J M

    2005-09-01

    Bottom sediment samples from 121 sites of the Lake Albufera of Valencia were analyzed. Dieldrin, endrin, heptachlor and op'-DDT were not detected (<0.01 ng g(-1)) in 88-93% of the sites. Aldrin and HCB concentration ranges were between <0.01 and 0.1 ng g(-1) in 86% and 94% of the sites, respectively. Heptachlor-epoxide and lindane 95% confidence intervals were 0.2-0.5 and 0.06-0.12, respectively. The greatest average concentration corresponds to pp'-DDE, pp'-DDD and pp'-DDT. The sum of six isomers and derivatives of the DDT average concentration reaches 2.1 ng g(-1), as opposed to 2.7 ng g(-1) for the sum of 13 pesticides considered. In the site with a major contamination, 27.0 ng g(-1) of pp'-DDD and 12.8 ng g(-1) of pp'-DDT were accumulated. The DDE:DDT proportion average was 0.37, indicating an aged DDT contamination. Concentrations of pesticides in sediments were compared to three sediment quality guidelines, and indicated that a low biological effects level can be expected in either sediments or aquatic organisms.

  13. Evaluation of antimicrobial consumption in Campania Region, Italy

    Directory of Open Access Journals (Sweden)

    Simona Cammarota

    2008-01-01

    Full Text Available Introduction: the antibiotic usage in Italy is above the European average. From several years the Campania was the first Italian region in terms of antimicrobial consumption. Aim: to evaluate antibiotic utilisation in primary health care in Campania, a region of approximately 5.7 million inhabitants in the south of Italy. Method: we collected, from an electronic database, all prescription drugs reimbursed in 2005. The cohort was defined as the population of subjects receiving at least one prescription of any antimicrobial agent for systemic use, classified according to their therapeutic role using Anatomic Therapeutic Chemical (ATC classification. Drugs cost and consumption were quantified using National Health Service (NHS prospective and Defined Daily Dose system (DDD respectively. All costs were expressed in Euro 2005. Results: antiinfectives agents (ATC J was the second class of drugs in terms of cost, representing 16.1% of the regional drug expenditure. Their consumption were 33 DDD/1000 inhabitants/day. Stratifying by age antibiotic use was highest in children and elderly subjects. Penicillins, macrolides and cephalosporins were the most prescribed antibiotic classes in all age groups. Discussion: despite guidelines introduced to limit the prescription of parenteral antibiotics to the patients who are most likely to benefit from it, they were mostly prescribed. This represented a serious problem for the development of drug-resistant bacteria.

  14. Risk-adjusted antibiotic consumption in 34 public acute hospitals in Ireland, 2006 to 2014

    Science.gov (United States)

    Oza, Ajay; Donohue, Fionnuala; Johnson, Howard; Cunney, Robert

    2016-01-01

    As antibiotic consumption rates between hospitals can vary depending on the characteristics of the patients treated, risk-adjustment that compensates for the patient-based variation is required to assess the impact of any stewardship measures. The aim of this study was to investigate the usefulness of patient-based administrative data variables for adjusting aggregate hospital antibiotic consumption rates. Data on total inpatient antibiotics and six broad subclasses were sourced from 34 acute hospitals from 2006 to 2014. Aggregate annual patient administration data were divided into explanatory variables, including major diagnostic categories, for each hospital. Multivariable regression models were used to identify factors affecting antibiotic consumption. Coefficient of variation of the root mean squared errors (CV-RMSE) for the total antibiotic usage model was very good (11%), however, the value for two of the models was poor (> 30%). The overall inpatient antibiotic consumption increased from 82.5 defined daily doses (DDD)/100 bed-days used in 2006 to 89.2 DDD/100 bed-days used in 2014; the increase was not significant after risk-adjustment. During the same period, consumption of carbapenems increased significantly, while usage of fluoroquinolones decreased. In conclusion, patient-based administrative data variables are useful for adjusting hospital antibiotic consumption rates, although additional variables should also be employed. PMID:27541730

  15. THE USE OF HORMONES DURING THE PERIMENOPAUSAL PERIOD IN SLOVENIA

    Directory of Open Access Journals (Sweden)

    Damir Franić

    2003-12-01

    Full Text Available Background. We want to collect data on the use of hormone therapy (HT in perimenopausal women in Slovenia. These data were to serve as the basis for evaluation of the most frequently prescribed HT, and of the distribution of prescriptions by Slovene health regions. Consequently, the percent of women aged 40–65 years, current hormone replacement therapy (HRT users was to be assessed.Methods. The analysis was made on the basis of the data collected by the automatic processing of prescriptions (AOR. Reliability of the data has been excellent since the introduction of the health insurance card. The data on drug use are expressed as defined daily doses (DDD per 1000 inhabitants aged 40–65 years. The information on the number of women in a certain age group and their number in a certain medical region was obtained from the Statistical Institute of Slovenia and from the database of the Institute of Health Insurance of Slovenia. DDD is a technical unit, by means of which drug use can be compared. DDD is a mean daily dose of the drug prescribed for the main indication in adults, the unit being 1 gram of the active substance. The AOR data have become reliable after 2001, therefore our analysis comparised the years 2001 and 2002. Comparison of the data was done using the list of drugs prepared according to the Anatomical Therapeutic Chemical classification (ATC for coding drugs.Results.  HRT (at least one pack was found to be used by 12.5% of women in 2001 and 12.4% in 2002. The estimated percent of women receiving HRT for at least 6 months was 6.5% in 2001 and 6.4% in 2002. Considering DDD, most frequently prescribed drugs were estrogens and monophasic estrogens + progesterone, these in the age groups 45–55 years; beyond this age HT was used decreasingly. Conjugated equine estrogen and antiandrogens combined with estrogens were prescribed the least. By medical regions, most systemic hormones were prescribed in the Ljubljana and Novo mesto

  16. Tendencia en la utilización de antiagregantes en la comunidad valenciana (2000-2005

    Directory of Open Access Journals (Sweden)

    Beatriz Román Llamosí

    2007-01-01

    Full Text Available Fundamento: Los antiagregantes plaquetarios son fármacos básicos para la prevención de enfermedades isquémicas arteriales. El objetivo de este trabajo es conocer la evolución de su utilización en Atención Primaria en la Comunidad Valenciana durante el periodo 2000-2005. Métodos: Estudio descriptivo del consumo de los antiagregantes plaquetarios (código ATC: B01AC dispensados con cargo al Sistema Nacional de Salud en la Comunidad Valenciana en el ámbito de Atención Primaria. Datos expresados en dosis diarias definidas (DDD por 1.000 habitantes y día. Resultados: En 2005 tres fármacos representaron el 98% de la prescripción global (ácido acetilsalicílico (AAS 66%, clopidogrel 23% y triflusal 9%. El consumo de antiagregantes orales se incrementó en un 23% entre 2000 y 2005 (desde 29,6 DDD/1.000 hab y día hasta 36,5. El clopidogrel mostró un incremento del 218%, mientras que el ácido acetilsalicílico fue el principio de mayor consumo con una cuota de utilización bastante estable durante todo el periodo (próxima al 70%. El gasto generado por este grupo de fármacos se duplicó, el clopidogrel fue el fármaco con mayor coste/DDD (2,14t, en 2005 su utilización constituyó un 23% del total de antiagregantes pero su gasto representó el 76% del total. Conclusiones: En este periodo se incrementó el consumo de antiagregantes en la Comunidad Valenciana. El AAS mantuvo estable su utilización, mientras que el clopidogrel aumentó su cuota de mercado pese a las recomendaciones de las guías terapéuticas y las restricciones para su uso. El consumo del clopidogrel contribuyó de forma notable al gasto farmacéutico de este grupo.

  17. A Bridging Water Anchors the Tethered 5-(3-Aminopropyl)-2′-deoxyuridine Amine in the DNA Major Groove Proximate to the N+2 C·G Base Pair: Implications for Formation of Interstrand 5′-GNC-3′ Cross-Links by Nitrogen Mustards‡

    Science.gov (United States)

    Wang, Feng; Li, Feng; Ganguly, Manjori; Marky, Luis A.; Gold, Barry; Egli, Martin; Stone, Michael P.

    2009-01-01

    Site-specific insertion of 5-(3-aminopropyl)-2′-deoxyuridine (Z3dU) and 7-deaza-dG into the Dickerson-Drew dodecamers 5′-d(C1G2C3G4A5A6T7T8C9Z10C11G12)-3′ · 5′-d(C13G14C15G16A17A18T19T20-C21Z22C23G24)-3′ (named DDDZ10) and 5′-d(C1G2C3G4A5A6T7X8C9Z10C11G12)-3′ · 5′-d(C13G14C15G16A17A18-T19X20C21Z22C23G24)-3′ (named DDD2+Z10)(X = Z3dU; Z = 7-deaza-dG) suggests a mechanism underlying the formation of interstrand N+2 DNA cross-links by nitrogen mustards, e.g., melphalan and mechlorethamine. Analysis of the DDD2+Z10 duplex reveals that the tethered cations at base pairs A5 · X20 and X8 · A17 extend within the major groove in the 3′-direction, toward conserved Mg2+ binding sites located adjacent to N+2 base pairs C3 · Z22 and Z10 · C15. Bridging waters located between the tethered amines and either Z10 or Z22 O6 stabilize the tethered cations and allow interactions with the N + 2 base pairs without DNA bending. Incorporation of 7-deaza-dG into the DDD2+Z10 duplex weakens but does not eliminate electrostatic interactions between tethered amines and Z10 O6 and Z22 O6. The results suggest a mechanism by which tethered N7-dG aziridinium ions, the active species involved in formation of interstrand 5′-GNC-3′ cross-links by nitrogen mustards, modify the electrostatics of the major groove and position the aziridinium ions proximate to the major groove edge of the N+2 C · G base pair, facilitating interstrand cross-linking. PMID:18549246

  18. Biodegradación estimulada de los suelos contaminados con pesticidas organoclorados

    Directory of Open Access Journals (Sweden)

    María Kopytko

    2017-06-01

    Full Text Available DDT al igual que otros pesticidas organoclorados han sido utilizados extensivamente en Colombia entre los años 1970 y 1980 en cultivos de algodón. DDT es resistente a la degradación y fuertemente relacionado con numerosos problemas de salud y actualmente está  prohibido su uso. El propósito de esta investigación fue evaluar la biodegradación de DDT y de los productos DDD y DDE, presentes en el suelo contaminado durante 16 años en le municipio Agustín Codazzi, Cesar, Colombia. Se llevaron a cabo bioestimulación, bioaumentación y un tratamiento de control bajo condiciones anaerobias y aerobias secuenciales. El proceso de biodegradación anaerobia duró 8 semanas y consecutivamente se realizó el proceso aerobio por 20 semanas. En el proceso de bioestimulación se adicionó fósforo para optimizar la proporción C:N:P en el suelo tratado. De las bacterias nativas se aislaron las cepas bacterianas con la capacidad biodegradadora del DDT y fueron identificadas mediante las características morfológicas y ampliación por PCR de la región de 1465 pb del gen ribosomal 16S y secuenciación. De estas se seleccionaron cuatro cepas bacterianas para el proceso de bioaumentación: Burkholderia cepacia, Pseudomonas fluorescens, Aeromona caviae, y Bacillus sp,  las cuales fueron bioaumentadas en el laboratorio e inoculadas en el suelo tratado en concentración de 108 UFC/ml. La concentración de DDT, DDD y DDE se determinó por medio de cromatografía de gases. Los mejores resultados se obtuvieron durante la fase anaerobia logrando una remoción de DDT, DDD y DDE en un 56,2%, 17,1% y 44,5% respectivamente.

  19. Níveis de organoclorados em queijos produzidos no Estado do Rio Grande do Sul

    Directory of Open Access Journals (Sweden)

    Santos Joice Sifuentes dos

    2006-01-01

    Full Text Available Os compostos organoclorados são pesticidas que foram usados na agricultura, no controle de vetores biológicos e de ectoparasitas do gado. Atualmente seu uso está proibido no Brasil, exceto para o controle de vetores biológicos em casos de epidemia. No entanto, resíduos desses compostos ainda são encontrados no meio ambiente e nos alimentos. Por esse motivo, avaliou-se a presença de organoclorados em queijos produzidos no Estado do Rio Grande do Sul (Brasil, bem como os níveis desses compostos em queijos dos tipos "colonial" e industrializado. A gordura das amostras foi extraída pela adição de sulfato de sódio seguida por uma lavagem com éter de petróleo. Os pesticidas foram purificados a partir da gordura em uma coluna contendo florisil e eluída com hexano. O extrato obtido foi utilizado para as análises cromatográficas (cromatografia gasosa com captura de elétrons. Os compostos alfa-HCH, HCB, lindano, aldrin, o,p-DDD e p,p-DDD foram identificados em 100% das amostras; o,p-DDE em 88,9% e o,p-DDT em 94,4%. p,p-DDD foi o pesticida detectado na maior concentração (11,5ng g-1 de gordura, seguido pelo aldrin (8,7ng g-1 de gordura. Os níveis de alfa-HCH, aldrin e DDT total foram maiores que o limite máximo de resíduos em 2, 8 e 1 amostra de queijo, respectivamente. Não foram encontradas diferenças significativas nos níveis de organoclorados entre as amostras de queijo "colonial" e industrializado, ou entre amostras de queijos produzidos em três regiões do Estado.

  20. Occurrence of fungicides and other pesticides in surface water, groundwater, and sediment from three targeted-use areas in the United States, 2009

    Science.gov (United States)

    Orlando, James L.; Smalling, Kelly L.; Reilly, Timothy J.; Boehlke, Adam; Meyer, Michael T.; Kuivila, Kathryn

    2013-01-01

    Surface-water, groundwater, and suspended- and bedsediment samples were collected in three targeted-use areas in the United States where potatoes were grown during 2009 and analyzed for an extensive suite of fungicides and other pesticides by gas chromatograph/mass spectrometry and liquid chromatography with tandem mass spectrometry. Fungicides were detected in all environmental matrices sampled during the study. The most frequently detected fungicides were azoxystrobin, boscalid, chlorothalonil, and pyraclostrobin. Other pesticides that were detected frequently included amino phosphonic acid (AMPA), atrazine, metolaclor, and the organochlorine insecticide p,p’-DDT and its degradates p,p’-DDD and p,p’-DDE. A greater number of pesticides were detected in surface water relative to the other environmental matrices sampled, and at least one pesticide was detected in 62 of the 63 surfacewater samples. The greatest numbers of pesticides and the maximum observed concentrations for most pesticides were measured in surface-water samples from Idaho. In eight surface- water samples (six from Idaho and two from Wisconsin), concentrations of bifenthrin, metolachlor, or malathion exceeded U.S. Environmental Protection Agency freshwater aquatic-life benchmarks for chronic toxicity to invertebrates. Thirteen pesticides, including seven fungicides, were detected in groundwater samples. Shallow groundwater samples collected beneath recently harvested potato fields contained more pesticides and had higher concentrations of pesticides than samples collected from other groundwater sources sampled during the study. Generally, pesticide concentrations were lower in groundwater samples than in surfacewater or sediment samples, with the exception of the fungicide boscalid, which was found to have its highest concentration in a shallow groundwater sample collected in Wisconsin. Thirteen pesticides, including four fungicides, were detected in suspended-sediment samples. The most

  1. Organochlorines in benthic invertebrates and sediments from the Dutch Wadden Sea; identification of individual PCB components

    Science.gov (United States)

    Duinker, J. C.; Hillebrand, M. T. J.; Boon, J. P.

    Concentrations of organochlorines were determined in Macoma balthica, Arenicola marina, Crangon crangon and sediments from the Dutch Wadden Sea. Maximum concentrations of (total) PCB, γ-HCH and dieldrin were found in the western part; a pronounced maximum of HCB was found in the western part. Concentrations of PCB, p,p'-DDD and p,p'-DDE in sediment were correlated with the percentage of particles metabolism, were lower in Crangon. The patterns of pentachloro- and higher chlorinated biphenyls were equal in Macoma, Arenicola and sediments. Since these components are not found in solution, they must be taken up from sediment and food. The results are in agreement with partitioning between body lipids and water as the dominant mechanism determining concentrations of persistent lipophilic contaminants in the animals. Partitioning with the ambient water may also determine the concentrations in the sediment.

  2. Helicobacter pylori resistance to antibiotics in Europe and its relationship to antibiotic consumption

    DEFF Research Database (Denmark)

    Megraud, Francis; Coenen, Samuel; Versporten, Ann

    2013-01-01

    OBJECTIVE: Resistance to antibiotics is the major cause of treatment failure of Helicobacter pylori infection. A study was conducted to assess prospectively the antibacterial resistance rates of H pylori in Europe and to study the link between outpatient antibiotic use and resistance levels...... in different countries. DESIGN: Primary antibiotic resistance rates of H pylori were determined from April 2008 to June 2009 in 18 European countries. Data on yearly and cumulative use over several years of systemic antibacterial agents in ambulatory care for the period 2001-8 were expressed in Defined Daily...... Doses (DDD) per 1000 inhabitants per day. The fit of models and the degree of ecological association between antibiotic use and resistance data were assessed using generalised linear mixed models. RESULTS: Of 2204 patients included, H pylori resistance rates for adults were 17.5% for clarithromycin, 14...

  3. Parents' socioeconomic factors related to high antibiotic prescribing in primary health care among children aged 0-6 years in the Capital Region of Denmark

    DEFF Research Database (Denmark)

    Jensen, Jette Nygaard; Bjerrum, Lars; Boel, Jonas

    2016-01-01

    OBJECTIVE: To investigate the distribution of antibiotic prescriptions in primary health care among children aged 0-6 years and its association with socioeconomic factors. DESIGN: A cross-sectional study describing antibiotic prescriptions and socioeconomic factors, using different population......-based registers from Statistics Denmark. SETTING: Antibiotic prescriptions in 2012 from primary health care in the Capital Region of Denmark. SUBJECTS: The population of children aged 0-6 years (n = 139,398) in the Capital Region of Denmark. MAIN OUTCOME MEASURES: High use of antibiotics identified by number...... of antibiotic prescriptions (≥ 3 prescriptions per year) and defined daily doses (DDD). A multinomial logistic regression analysis estimating the association between high antibiotic use and parents' education, employment status, income, child's sex, and ethnic background. RESULTS: Ten percent of children...

  4. Trends in statin consumption and cardiovascular mortality in Croatia 2004-2012.

    Science.gov (United States)

    Vojvodić, Zeljko; Stimac, Danijela

    2014-12-01

    Prescribing of statins showed an increasing trend in all developed countries, during the last two decades. The aim of this study was to research the trends in statin consumption in the period from 2004 to 2012 as well as trends of cardiovascular mortality during the 1990 to 2012 period, and to compare them between Croatia and several neighbouring countries. Data on statin expenditures and consumption expresed in defined daily doses per 1000 inhabitants per day (DDD/TID), were taken from annual reports of Croatian Agency for Medicinal Products and Medical Devices (HALMED). Data on crude mortality rates and standardized cardiovascular mortality rates, were taken from the Croatian Health Statistics Yearbooks. The utilization of statins increased by 196.7% during the observed period, with the highest consumption of atorvastatin and simvastatin. Financial expenditure of statins expanded at much faster rate in comparison with overall drug costs. Cardiovascular mortality rates decreased slightly, while maintaining higher level in comparison with some neighbouring countries.

  5. [The implementation of strategy of medicinal support in multi-type hospital].

    Science.gov (United States)

    Ludupova, E Yu

    2016-01-01

    The article presents brief review of implementation of strategy of medicinal support of population of the Russian Federation and experience of application of at the level of regional hospital. The necessity and importance of implementation into practice of hospitals of methodology of pharmaco-economical management of medicinal care using modern technologies of XYZ-, ABC and VEN-analysis is demonstrated. The stages of development and implementation of process of medicinal support of multifield hospital applying principles of system of quality management (processing and systemic approaches, risk management) on the basis of standards ISO 9001 are described. The significance of monitoring of results ofprocess of medicinal support of the basis of implementation of priority target programs (prevention of venous thrombo-embolic complications, system od control of anti-bacterial therapy) are demonstrated in relation to multi-field hospital using technique of ATC/DDD-analysis for evaluating indices of effectiveness and efficiency.

  6. Selected elements and organic chemicals in streambed sediment in the Salem area, Oregon, 1999

    Science.gov (United States)

    Tanner, Dwight Q.

    2002-09-13

    Analysis of streambed sediments in the Salem, Oregon, area showed anomalously large concentrations of some elements and organic chemicals, indicating contamination from anthropogenic and/or geologic sources. The streambed sediment sample from Clark Creek, an urban basin, had large concentrations of polycyclic aromatic hyrdocarbons (PAHs), organochlorines, cadmium, lead, and zinc. The sample from the East Fork of Pringle Creek, which is a mostly urban basin, had the highest concentrations of DDD, DDE, and DDT compounds. Aldrin was detected in streambed sediment at only one site, the East Fork of Pringle Creek. Ten of the 14 sites sampled had exceedances of the sediment quality guidelines of the Canadian Council of Ministers of the Environment (CCME), and 8 sites had exceedances of guidelines from the Puget Sound Dredged Disposal Analysis (PSDDA) Program.

  7. Defining the complement biomarker profile of c3 glomerulopathy

    DEFF Research Database (Denmark)

    Zhang, Yuzhou; Nester, Carla M; Martin, Bertha

    2014-01-01

    BACKGROUND AND OBJECTIVES: C3 glomerulopathy (C3G) applies to a group of renal diseases defined by a specific renal biopsy finding: a dominant pattern of C3 fragment deposition on immunofluorescence. The primary pathogenic mechanism involves abnormal control of the alternative complement pathway......, although a full description of the disease spectrum remains to be determined. This study sought to validate and define the association of complement dysregulation with C3G and to determine whether specific complement pathway abnormalities could inform disease definition. DESIGN, SETTING, PARTICIPANTS......, & MEASUREMENTS: This study included 34 patients with C3G (17 with C3 glomerulonephritis [C3GN] and 17 with dense deposit disease [DDD]) diagnosed between 2008 and 2013 selected from the C3G Registry. Control samples (n=100) were recruited from regional blood drives. Nineteen complement biomarkers were assayed...

  8. Die Bandscheibenprothese bei schmerzhafter Diskusdegeneration

    Directory of Open Access Journals (Sweden)

    Ogon M

    2004-01-01

    Full Text Available Bandscheibenprothesen sind indiziert bei Patienten mit einer schmerzhaften Bandscheibendegeneration, einer sogenannten DDD (degenerative disc disease, bei gut erhaltenen Facettengelenken. Kontraindikationen stellen eine Instabilität, eine Spondylarthrose, eine spinale Stenose und eine Osteoporose dar. Bei 19 Patienten mit einem Follow-up von mindestens 12 Monaten fand sich eine durchschnittliche Verbesserung des Oswestry Disability Index von präoperativ 50,8 auf 19,8. Der SF-36 Score zur Erfassung der Lebensqualität besserte sich von 31,5 auf 48,8 (Physical Component Summary Score bzw. von 37,8 auf 44,5 (Mental Component Summary Score im 1-Jahres-Follow-up. Nachhaltige Komplikationen traten nicht auf. Bandscheibenprothesen können heute bei Patienten mit therapieresistenten Kreuzschmerzen als gute Alternative zu einer Wirbelfusion angesehen werden.

  9. Three decades (1983-2010) of contaminant trends in East Greenland polar bears (Ursus maritimus). Part 2

    DEFF Research Database (Denmark)

    Dietz, Rune; Rigét, Frank F; Sonne, Christian

    2013-01-01

    Legacy organochlorine contaminants were determined in adipose tissues from 294 polar bears (Ursus maritimus) sampled in East Greenland in 23 of the 28years between 1983 and 2010. Of 19 major legacy contaminants and congeners (ΣPCB, 4 PCB congeners (CB153, 180, 170/190), ΣDDT, p,p'-DDE, p,p' -DDD...... and p,p'-DDT, α- and β-hexachlorocyclohexane (HCH), HCB, octachlorostyrene, dieldrin, oxychlordane, cis- and trans-chlordane, cis- and trans-nonachlor, heptachlor epoxide and BB-153), 18 showed statistically significant average yearly declines of -4.4% (range: -2.0 to -10.8%/year) among subadult polar...... bears (i.e. females...

  10. Population Exposure to Phthalate-Containing Drugs

    DEFF Research Database (Denmark)

    Broe, Anne; Ennis, Zandra Nymand; Pottegård, Anton

    2017-01-01

    Phthalates are known endocrine disruptors. Not commonly recognised, phthalates are used as excipients in a number of drug formulations. We aimed to describe the sale of phthalate-containing drugs in Denmark from 2004 to 2015. National data on annual sale of medications (tablets only) were accessed...... from medstat.dk. Data from the Danish Medicines Agency on phthalate content per tablet were merged with data on total sale for each active substance and drug formulation. We used the 'defined daily dose' (DDD) as the unit of sale and calculated the total amount of phthalate (mg) dispensed per 1......,000 inhabitants. Specific tablet content was compared with the maximum daily exposure limits defined by regulatory agencies for diethylphthalate (DEP) and dibutylphthalate (DBP) of 4.0 and 0.01 mg/kg/day, respectively. Use of phthalate-containing drugs in Denmark was common. We found 154 drug products containing...

  11. Primary antibiotic resistance of Helicobacter pylori strains among adults and children in a tertiary referral centre in Lithuania

    DEFF Research Database (Denmark)

    Dargiene, Gintare; Kupcinskas, Juozas; Jonaitis, Laimas

    2018-01-01

    The study evaluated primary antibiotic resistance of Helicobacter pylori within the period 2013-2015 and trends of antibiotic consumption over the last decade in Lithuania; 242 adults and 55 children were included in the study. E-tests were performed for amoxicillin, metronidazole, clarithromycin......, ciprofloxacin, rifampicin and tetracycline. The presence of H. pylori and clarithromycin resistance was additionally tested by PCR. Helicobacter pylori culture was positive in 67 of 242 (28%) adult and in 12 of 55 (21.8%) children samples. Resistance rates among adults by E-tests were as follows: metronidazole......, while it has doubled from 1.10 to 2.22 DDD/1000/children/day in children within 2003-2015. There are no significant changes in the susceptibility of H. pylori to the most widely used antibiotics in adults over the last years in Lithuania; however, clarithromycin resistance among children exceeds 15...

  12. Implementação da técnica de extração de dispersão da matriz em fase sólida ("MSPD" para determinação de resíduos de agrotóxicos em laranjas Implementation of MSPD technique to determination of pesticides residues in oranges

    Directory of Open Access Journals (Sweden)

    Maria Helena W. M. Cardoso

    2004-06-01

    Full Text Available Um método de extração de multiresíduos baseado na técnica de dispersão da matriz em fase sólida ("MSPD", foi otimizado e validado para a extração e análise cromatográfica de 27 agrotóxicos (isômeros a, b, g, d do hexaclorociclohexano (HCH, dieldrin, endrin, heptacloro e seu epóxido (HE, a e b-endosulfan, o,p'-DDD, p,p'-DDD, o,p'-DDE, p,p'-DDE, o,p'-DDT, p,p'-DDT, dicofol, metoxicloro, mirex, hexaclorobenzeno (HCB, clorotalonil, parationa metílica, fenitrotiona, malationa, folpete, diazinona, cis e trans-permetrina em laranjas. A amostra macerada é inicialmente homogeneizada com C18, o homogeneizado é transferido para uma coluna de vidro contendo sílica gel onde se adiciona 10mL de acetato de etila como solvente de eluição. O eluente é concentrado, diluído em isooctano e 1mL deste é injetado no cromatógrafo a gás. Para a separação e quantificação dos 27 agrotóxicos, foi utilizado um CG/DCE. A confirmação dos mesmos foi feita por espectrometria de massas. Para a quantificação dos 27 agrotóxicos utilizou-se a padronização externa. As recuperações dos mesmos variaram de 70 a 120%, considerando-se os níveis de adição agrotóxicos/amostra de 0,02 e 2,0mg/kg. Os limites de quantificação variaram de 0,01 a 0,5mg/kg.A multiresidue method of extraction based on matrix solid-phase dispersion (MSPD technique was optimized and validated for chromatographic analyses of twenty seven pesticides residues [hexachlorocyclohexane (HCH isomers (a, b, g, d, dieldrin, endrin, heptachlor and its epoxide (HE, a and b-endosulfan, o,p'-DDD, p,p'-DDD, o,p'-DDE, p,p'-DDE, o,p'-DDT p,p'-DDT, dicofol, methoxychlor, mirex, hexachlorobenzene (HCB, chlorotalonil, parathion methyl, fenitrothion, malathion, folpet, diazinon, permethrin (cis and trans in oranges. The sample was blended with C18 and then the homogenized sample was introduced onto a glass column containing silica. Ten mL of ethyl acetate was added to the column as elution

  13. Tre års anxiolytikaforbrug i almen praksis. En retrospektiv opgørelse fra en to-mands-landpraksis

    DEFF Research Database (Denmark)

    Christensen, P B; Bjerrum, L; Glent-Madsen, L

    1992-01-01

    %) than did the short term users (12%). Long term users consulted the doctor twice as frequently and were admitted to psychiatric departments six times as frequently during the period. One fourth of the long term users received disability pensions and one fourth had now or had previous alcohol problems......In a rural general practice with two doctors and 3.671 patients and employing a practice data system (APEX), a retrospective review was undertaken of the anxiolytic drugs (ATC gr NO5B) prescribed. A total of 376 persons received 3,556 prescriptions for a total of 121,111 DDD (Defined Daily Doses......). Forty of these patients (approximately 10%) received half of the medicine involved and half of the patients received 5% of the medicine. 68% of the prescriptions were renewals without contact between doctor and patient. A total of 85 new users was observed and the number of new users/annum decreased...

  14. A cross-taxa survey of organochlorine pesticide contamination in a Costa Rican wildland

    Energy Technology Data Exchange (ETDEWEB)

    Klemens, J.A.; Wieland, M.L.; Flanagin, V.J.; Frick, J.A.; Harper, R.G

    2003-04-01

    Amphibians, turtles, mice and birds from a protected Costa Rican wildland were contaminated with organochlorine pesticides and metabolites. - Amphibians, turtles, birds (mostly passerines) and mice collected from a conservation area in northwestern Costa Rica were analyzed for organochlorine (OC) pesticide contamination. Six of 39 amphibians (three of eight species), three of six turtles (two species), one of eight mice (one species) and 19 of 55 birds (five of seven species) contained OCs at levels up to 580 ng/g. The most frequently detected compound in 23 of 108 organisms was p,p'DDE. Dieldrin, delta-BHC, heptachlor, p,p'DDD, and endosulfan II were each found in at least four organisms, while eight other OCs were found in at least one organism. The presence of OCs in taxa from the conservation area indicates the likelihood of long-distance transport of such compounds through the atmosphere.

  15. Allergisk rhinoconjunctivitis behandlet med intramuskulaert injiceret glukokortikoid

    DEFF Research Database (Denmark)

    Dahl, Morten; Laursen, L C

    1998-01-01

    Effects and side effects of injectable depot steroid in the treatment of allergic rhinoconjunctivitis (hay fever) are described. A few controlled studies have shown injectable steroids to be superior to the effect of placebo and locally applied steroid. Over a period of 10 years from 1984-95 only...... 26 registered side effects were reported to the central Danish register for side effects of drugs (Laegemiddelstyrelsens Bivirkningsregister). Only eight concerned subcutaneous atrophy and in two cases the cutaneous changes persisted. Based on registration of number of treatments in the county...... of Funen 1996, it is estimated that the use of injectable depot steroids for treatment of hay fever accounts for about 535,000 DDD (defined daily doses corresponding to about 33,000 treatments per year). We conclude that the use of injectable corticosteroids in the treatment of hay fever is common...

  16. Phenobarbital treatments lower DDT body burden in rhesus monkeys

    Energy Technology Data Exchange (ETDEWEB)

    Ferguson, P.W.; Clark, C.R.; Gee, S.J.; Krieger, R.I.

    1981-01-01

    Decreased DDT, DDD, DDE in blood and DDA in urine followed phenobarbital treatments (10 mg/kg/day, 11 days, intramuscular (im)) in three male rhesus monkeys (Macaca mulatta). Animals were fed DDT diets containing up to 500 ppm DDT during a 3-year period. Induction of liver monooxygenases was confirmed by reduced in vivo antipyrine plasma half-life and increased in vitro oxidation rates of dihydroisodrin, p-nitroanisole and benz(alpha)pyrene by homogenates of liver obtained from closed needle biopsy. Chlorohydrocarbon blood levels significantly decreased during the induction period (days 1-11). Concentrations on day 28 were at or below pre-DDT exposure levels. Urine DDA gradually decreased in all monkeys from days 16 to 28.

  17. Residues, Sources and Potential Biological Risk of Organochlorine Pesticides in Surface Sediments of Qiandao Lake, China.

    Science.gov (United States)

    Yang, Huayun; Zhou, Shanshan; Li, Weidong; Liu, Qi; Tu, Yunjie

    2015-10-01

    Sediment samples were analyzed to comprehensively characterize the concentrations, distribution, possible sources and potential biological risk of organochlorine pesticides in Qiandao Lake, China. Concentrations of sumHCH and sumDDT in sediments ranged from 0.03 to 5.75 ng/g dry weight and not detected to 14.39 ng/g dry weight. The predominant β-HCH and the α-HCH/γ-HCH ratios indicated that the residues of HCHs were derived not only from historical technical HCH use but also from additional usage of lindane. Ratios of o,p'-DDT/p,p'-DDT and DDD/DDE suggested that both dicofol-type DDT and technical DDT applications may be present in most study areas. Additionally, based on two sediment quality guidelines, γ-HCH, o,p'-DDT and p,p'-DDT could be the main organochlorine pesticides species of ecotoxicological concern in Qiandao Lake.

  18. Size-Tuned Plastic Flow Localization in Irradiated Materials at the Submicron Scale

    Science.gov (United States)

    Cui, Yinan; Po, Giacomo; Ghoniem, Nasr

    2018-05-01

    Three-dimensional discrete dislocation dynamics (3D-DDD) simulations reveal that, with reduction of sample size in the submicron regime, the mechanism of plastic flow localization in irradiated materials transitions from irradiation-controlled to an intrinsic dislocation source controlled. Furthermore, the spatial correlation of plastic deformation decreases due to weaker dislocation interactions and less frequent cross slip as the system size decreases, thus manifesting itself in thinner dislocation channels. A simple model of discrete dislocation source activation coupled with cross slip channel widening is developed to reproduce and physically explain this transition. In order to quantify the phenomenon of plastic flow localization, we introduce a "deformation localization index," with implications to the design of radiation-resistant materials.

  19. Utilization of psychotropic drugs prescribed to persons with and without HIV infection

    DEFF Research Database (Denmark)

    Rasmussen, L. D.; Obel, D; Kronborg, G

    2014-01-01

    on redeemed prescription of psychotropic drugs during 1995-2009. We primarily focused our analyses on HIV-infected individuals with no history of injecting drug use (IDU) or hepatitis C virus (HCV) infection. Drug utilization was expressed as defined daily doses per 1000 person-days (DDD/1000PD...... with exposure to HAART or efavirenz was found. CONCLUSIONS: HIV-infected individuals had a higher utilization of psychotropic drugs than the background population, which was not confined to individuals with a history of IDU or HCV infection. This emphasizes the need to focus on diagnosis of, and appropriate......OBJECTIVES: The objective was to estimate the utilization of psychotropic drugs in HIV-infected individuals compared with that in the background population. METHODS: Using data obtained from the Danish HIV Cohort Study and the Danish National Prescription Registry, we analysed aggregated data...

  20. Simulation framework and XML detector description for the CMS experiment

    CERN Document Server

    Arce, P; Boccali, T; Case, M; de Roeck, A; Lara, V; Liendl, M; Nikitenko, A N; Schröder, M; Strässner, A; Wellisch, H P; Wenzel, H

    2003-01-01

    Currently CMS event simulation is based on GEANT3 while the detector description is built from different sources for simulation and reconstruction. A new simulation framework based on GEANT4 is under development. A full description of the detector is available, and the tuning of the GEANT4 performance and the checking of the ability of the physics processes to describe the detector response is ongoing. Its integration on the CMS mass production system and GRID is also currently under development. The Detector Description Database project aims at providing a common source of information for Simulation, Reconstruction, Analysis, and Visualisation, while allowing for different representations as well as specific information for each application. A functional prototype, based on XML, is already released. Also examples of the integration of DDD in the GEANT4 simulation and in the reconstruction applications are provided.

  1. Le conseguenze sulla spesa farmaceutica pubblica di un nuovo inibitore di pompa protonica: esomeprazolo

    Directory of Open Access Journals (Sweden)

    C. Lucioni

    2002-03-01

    Full Text Available Aim of the present study is to check the economic advantage of esomeprazole, a new proton pump inhibitor that suppresses gastric acid secretion. The efficacy and tolerability of esomeprazole have been already demonstrated, now the pharmacoeconomic studies must investigate the possible savings for the SSN in case of esomeprazole immission on the Italian market. In this paper the authors present two pharmacoeconomic evaluations, the first based on cost/efficacy analysis, the second based on cost minimization analysis. For both analyses, the term of comparison is omeprazole, “gold standard” in the treatment of acid reflux-related pathologies. The effect in terms of volumes (DDD and costs of the introduction of esomeprazole in the italian market has also been simulated.

  2. Reversible complete atrioventricular block in patient with wegener's granulomatosis - a report on fortunate outcome with long term follow-up.

    Science.gov (United States)

    Steckiewicz, Roman; Rosiak, Marek; Stolarz, Przemysław; Świętoń, Elżbieta B; Grabowski, Marcin; Kosior, Dariusz A

    Reversible complete atrioventricular block in patient with Wegener's granulomatosis - a report on a positive outcome with long term follow-up. Atrioventricular (AV) block is a rare complication of Wegener's granulomatosis (WG), thus there are no standards of management in such cases. We present a case of a patient with a dual-chamber pacemaker (DDD) implanted due to complete AV block in the course of Wegener's granulomatosis (WG). An immunosuppressive therapy resulted in the resolution of non-cardiac and AV conduction disorders. The diagnostic functions of the pacemaker enabled us to evaluate AV conduction over a five-year follow-up period. The resolution of AV conduction disorders, which accompanied WG remission, suggests that careful monitoring with temporary cardiac pacing may be considered in some patients before permanent pacemaker implantation.

  3. Dicty_cDB: Contig-U03730-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available us... 38 0.002 3 ( DC237378 ) Hodotermopsis sjoestedti cDNA clone: MY0684BHsMg_... 38 0.002 2 ( FD625418 ) s... 40 0.007 2 ( EJ329051 ) 1092963417437 Global-Ocean-Sampling_GS-28-01-01-1... 42 0.007 2 ( DA728805 ) Homo sapie... AGENCOURT_13629201 NIH_MGC_148 Homo sapiens cDNA ... 40 0.007 2 ( EK209959 ) 1095460095251 Global-Ocean-Sampli...8746 ) ox66e02.s1 Soares_NhHMPu_S1 Homo sapiens cDNA clo... 40 0.007 2 ( EJ828039 ) 1093017568475 Global-Ocean-Sampli...136358 ) 1092343604888 Global-Ocean-Sampling_GS-27-01-01-1... 54 0.008 1 ( BU801459 ) SJF2DDD09 SJF Schistosoma japonicum cDNA sim

  4. [Monitoring of environmental pollution in Armenia and certain issues on reproductive health and cytogenetic status of organism].

    Science.gov (United States)

    Tadevosian, N S; Muradian, S A; Tadevosian, A E; Khachatrian, B G; Dzhandzhapanian, A N; Parsadanian, G G; Pogosian, S B; Gevorkian, N B; Guloian, A A

    2012-01-01

    Investigations aimed at the study on the state of environment from the point of pollution by organochlorine pesticides and their metabolites (HCH, DDT, DDE and DDD), as well as on possible unfavorable impact due to carriage of mentioned persistent organic pollutants (POPs) towards reproductive health and cytogenetic status of organism were done. In parallel, monitoring of possible mutagenic components of the environment was also conducted. As to obtained data, residues of organochlorine pesticides are continually determined with high frequency both in environmental media, agricultural foodstuffs and biomedia of rural population of observed region (Aragatsotn marz, Armenia). No changes in mutagenic background were registered. The represented results of the study make fragment of complex social-hygienic, monitoring investigations on environmental quality that would further serve as a platform for working out the recommendations on reduction of environmental pollution and improvement of health protection issues in Armenia.

  5. Organochlorine Pesticides Residues in Human Breast Milk from the Middle Governorates in Jordan in 2013/2014.

    Science.gov (United States)

    Al Antary, Tawfiq M; Alawi, Mahmoud A; Estityah, Hussein; Haddad, Nizar

    2017-07-01

    One hundred samples of mother breast milk were gathered from six middle governorates and districts in Jordan in 2013/2014 to monitor Organochlorine pesticides pollutants. The results showed clearly that banned organochlorine pesticides are still detected in the monitored samples in low concentration despite banning of these persistent pollutants in Jordan since 36 years ago. However, the results indicated that 1% of the contaminated samples contained β-HCH, 5% γ-HCH, 3% p,p'-DDD, 2% heptachlor, 45% p,p'-DDE and 3% p,p'-DDT. In addition, these monitored samples had no residues of aldrin, dieldrin, α-endosulfan, β-endosulfan, HCB, o,p'-DD, o,p'-DDT and o,p'-DDE. In conclusion, there was a decline in the residues of Organochlorine pesticides, particularly DDT group members.

  6. Anatomy and systematics of Anodontites Elongatus (Swainson from Amazon and Parana Basins, Brazil (Mollusca, Bivalvia, Unionoida, Mycetopodidae

    Directory of Open Access Journals (Sweden)

    Luiz Ricardo L Simone

    1997-12-01

    Full Text Available The anatomy of Anodontiies elongatus (Swainson, 1823, a rare species restricted to the Amazon and Parana Basins, is described by first time, showing a group of conchological and anatomical characters exclusive of this species that may be analyzed to identify it. Diagnosis of A. elongatus: shell long antero-posteriorly, umbones prominent, periostracum opaque and smooth, two posterior radial striae; middle fold of mantle edge veiy tall; gill long antero-posteriorly and short dorso-ventrally, extending about a half of it total length beyond visceral mass; palps proportionally small, several furrows in its outer surface; stomach without esophageal transversal ridjp, dorsal hood and gastric shield poorly developed, major typhlosole entering in ddd , posterior pouch of sa³ very-long; style sac reduced, without crystalline style; distal region of intestine and rectum with a well developed typhlosole, "T" in section, other intestinal regions without folds; gonad gonochoristic.

  7. Mechanical design of the ITER ion cyclotron heating launcher based on in-vessel tuning system

    Energy Technology Data Exchange (ETDEWEB)

    Vulliez, K. [Association Euratom-CEA, CEA/DSM/DRFC, CEA Cadarache, F-13108 St Paul Lez Durance (France)], E-mail: karl.vulliez@cea.fr; Bosia, G. [Dipartimento di Fisica Generale, Universita di Torino (Italy); Agarici, G.; Beaumont, B.; Argouarch, A.; Mollard, P. [Association Euratom-CEA, CEA/DSM/DRFC, CEA Cadarache, F-13108 St Paul Lez Durance (France); Testoni, P. [Electrical and Electronics Engineering Department, University of Cagliari (Italy); Maggiora, R.; Milanesio, D. [Dipartimento di Elettronica Politecnico di Torino (Italy)

    2007-10-15

    Since the release of the ITER ICRH system reference design report [ITER Final Design Report: DDD 5.1 -Ion Cyclotron and Current Drive System, July 2001], further design studies have been conducted. If the base of the reference design [Final Report on EFDA contract 04/1129, ITER ICRF antenna and Matching system design (Internalmatching), April 2005] is kept unchanged, several significant modifications have been proposed for a better efficiency and reliability. The increase of the poloidal order of the array and strong modifications of the matching system concept are the main changes. Technical aspects insufficiently covered in previous studies are also now worked out in detail, like the integration on a mid-plane port satisfying the constraints of the ITER environment.

  8. Cerebral toxoplasmosis and lymphoma in patients with Acquired Immunodeficiency Syndrome

    International Nuclear Information System (INIS)

    Laviopierre, A.M.; Lawler, G.A.

    1989-01-01

    Toxoplasmosis now constitutes a relatively frequent central nervous system (CNS) complication of AIDS, primary CNS lymphoma being far less common. CT scanning using the double-dose delayed (D-D-D) scan technique has proved an effective way of helping in the diagnosis of these complications. 16 patients with CNS complications of the acquired immunodeficiency syndrome (AIDS) are described. All patients were male homosexuals. The most common demonstrable lesion in the parenchyma was toxoplasmosis, which produced an area of focal oedema, usually containing a central zone of nodular or ring-shaped enhancement. Cerebral atrophy was also a common finding. One patient had diffuse peri-ventricular lymphomatous infiltration, and a further two patients had both cerebral toxoplasmosis and lymphoma. A delayed double dose contrast examination appears to be the most accurate method of outlining the total extent of CNS disease in these patients. 11 refs., 7 figs., 2 tabs

  9. Geochemical distribution of trace metals and organochlorine contaminants of a lake ontario shoreline marsh

    Energy Technology Data Exchange (ETDEWEB)

    Glooschenko, W A; Capocianco, J; Coburn, J; Glooschenko, V

    1981-02-01

    Rattray Marsh, an 8 ha marsh on the Lake Ontario shoreline at Mississauga, Ontario, is an important local habitat for waterfowl and shorebirds during spring and fall migration. A study was conducted to determine the distribution of nutrients (carbon, nitrogen, and phosphorus) and potential trace metal and organochlorine pollutants in the marsh as evidenced by the sedimentary concentrations of these compounds. Generally, copper, zinc, lead, and mercury were higher in concentration in local soils than in Lake Ontario sediments. Metals and organic carbon levels did not correlate, and the metals appeared to be associated with silts and clays. Organochlorine contaminants include p,p1-DDE, p,p1-DDD, p,p1-DDT, alpha-chlordane, PCB, mirex, and HCB.

  10. Three decades (1983-2010) of contaminant trends in East Greenland polar bears (Ursus maritimus). Part 1: legacy organochlorine contaminants.

    Science.gov (United States)

    Dietz, Rune; Rigét, Frank F; Sonne, Christian; Born, Erik W; Bechshøft, Thea; McKinney, Melissa A; Letcher, Robert J

    2013-09-01

    Legacy organochlorine contaminants were determined in adipose tissues from 294 polar bears (Ursus maritimus) sampled in East Greenland in 23 of the 28years between 1983 and 2010. Of 19 major legacy contaminants and congeners (ΣPCB, 4 PCB congeners (CB153, 180, 170/190), ΣDDT, p,p'-DDE, p,p' -DDD and p,p'-DDT, α- and β-hexachlorocyclohexane (HCH), HCB, octachlorostyrene, dieldrin, oxychlordane, cis- and trans-chlordane, cis- and trans-nonachlor, heptachlor epoxide and BB-153), 18 showed statistically significant average yearly declines of -4.4% (range: -2.0 to -10.8%/year) among subadult polar bears (i.e. femalespolar bear tissues. Copyright © 2012 Elsevier Ltd. All rights reserved.

  11. Use of acid-suppressive therapy before anti-reflux surgery in 2922 patients

    DEFF Research Database (Denmark)

    Lødrup, A; Pottegård, A; Hallas, J

    2015-01-01

    BACKGROUND: Guidelines recommend that patients with gastro-oesophageal reflux disease are adequately treated with acid-suppressive therapy before undergoing anti-reflux surgery. Little is known of the use of acid-suppressive drugs before anti-reflux surgery. AIM: To determine the use of proton pump...... inhibitors and H2 -receptor antagonists in the year before anti-reflux surgery. METHODS: A nationwide retrospective study of all patients aged ≥18 undergoing first-time anti-reflux surgery in Denmark during 2000-2012 using data from three different sources: the Danish National Register of Patients......, the Danish National Prescription Register, and the Danish Person Register. RESULTS: The study population thus included 2922 patients (median age: 48 years, 55.7% male). The annual proportion of patients redeeming ≥180 DDD of acid-suppressive therapy increased from 17.0% 5 years before anti-reflux surgery...

  12. High Antibiotic Consumption

    DEFF Research Database (Denmark)

    Malo, Sara; José Rabanaque, María; Feja, Cristina

    2014-01-01

    Heavy antibiotic users are those individuals with the highest exposure to antibiotics. They play an important role as contributors to the increasing risk of antimicrobial resistance. We applied different methods to identify and characterize the group of heavy antibiotic users in Spain as well...... as their exposure to antibiotics. Data on outpatient prescribing of antimicrobials (ATC J01) in 2010 were obtained from a prescription database covering Aragón (northeastern Spain). The antimicrobial consumption at the individual level was analysed both according to the volume of DDD and the number of packages...... purchased per year. Heavy antibiotic users were identified according to Lorenz curves and characterized by age, gender, and their antimicrobial prescription profile. Lorenz curves demonstrated substantial differences in the individual use of antimicrobials. Heavy antibiotic users (5% of individuals...

  13. A cross-taxa survey of organochlorine pesticide contamination in a Costa Rican wildland

    International Nuclear Information System (INIS)

    Klemens, J.A.; Wieland, M.L.; Flanagin, V.J.; Frick, J.A.; Harper, R.G.

    2003-01-01

    Amphibians, turtles, mice and birds from a protected Costa Rican wildland were contaminated with organochlorine pesticides and metabolites. - Amphibians, turtles, birds (mostly passerines) and mice collected from a conservation area in northwestern Costa Rica were analyzed for organochlorine (OC) pesticide contamination. Six of 39 amphibians (three of eight species), three of six turtles (two species), one of eight mice (one species) and 19 of 55 birds (five of seven species) contained OCs at levels up to 580 ng/g. The most frequently detected compound in 23 of 108 organisms was p,p'DDE. Dieldrin, delta-BHC, heptachlor, p,p'DDD, and endosulfan II were each found in at least four organisms, while eight other OCs were found in at least one organism. The presence of OCs in taxa from the conservation area indicates the likelihood of long-distance transport of such compounds through the atmosphere

  14. Long-Term Creep Behavior of the Intervertebral Disk: Comparison between Bioreactor Data and Numerical Results

    Energy Technology Data Exchange (ETDEWEB)

    Castro, A. P. G., E-mail: apgcastro@dem.uminho.pt [Center for Mechanical and Materials Technologies, Department of Mechanical Engineering, University of Minho, Guimarães (Portugal); INSIGNEO Institute for in silico Medicine, Department of Mechanical Engineering, University of Sheffield, Sheffield (United Kingdom); Paul, C. P. L. [Department of Orthopaedic Surgery, VU Medical Center, Amsterdam (Netherlands); Research Institute MOVE, Faculty of Human Movement Sciences, VU Medical Center, Amsterdam (Netherlands); Detiger, S. E. L.; Smit, T. H.; Royen, B. J. van [Department of Orthopaedic Surgery, VU Medical Center, Amsterdam (Netherlands); Research Institute MOVE, Faculty of Human Movement Sciences, VU Medical Center, Amsterdam (Netherlands); Skeletal Tissue Engineering Group Amsterdam, VU Medical Center, Amsterdam (Netherlands); Pimenta Claro, J. C. [Center for Mechanical and Materials Technologies, Department of Mechanical Engineering, University of Minho, Guimarães (Portugal); Mullender, M. G. [Department of Orthopaedic Surgery, VU Medical Center, Amsterdam (Netherlands); Research Institute MOVE, Faculty of Human Movement Sciences, VU Medical Center, Amsterdam (Netherlands); Department of Plastic, Reconstructive and Hand Surgery, VU Medical Center, Amsterdam (Netherlands); Alves, J. L. [Center for Mechanical and Materials Technologies, Department of Mechanical Engineering, University of Minho, Guimarães (Portugal)

    2014-11-20

    The loaded disk culture system is an intervertebral disk (IVD)-oriented bioreactor developed by the VU Medical Center (VUmc, Amsterdam, The Netherlands), which has the capacity of maintaining up to 12 IVDs in culture, for approximately 3 weeks after extraction. Using this system, eight goat IVDs were provided with the essential nutrients and submitted to compression tests without losing their biomechanical and physiological properties, for 22 days. Based on previous reports (Paul et al., 2012, 2013; Detiger et al., 2013), four of these IVDs were kept in physiological condition (control) and the other four were previously injected with chondroitinase ABC (CABC), in order to promote degenerative disk disease (DDD). The loading profile intercalated 16 h of activity loading with 8 h of loading recovery to express the standard circadian variations. The displacement behavior of these eight IVDs along the first 2 days of the experiment was numerically reproduced, using an IVD osmo-poro-hyper-viscoelastic and fiber-reinforced finite element (FE) model. The simulations were run on a custom FE solver (Castro et al., 2014). The analysis of the experimental results allowed concluding that the effect of the CABC injection was only significant in two of the four IVDs. The four control IVDs showed no signs of degeneration, as expected. In what concerns to the numerical simulations, the IVD FE model was able to reproduce the generic behavior of the two groups of goat IVDs (control and injected). However, some discrepancies were still noticed on the comparison between the injected IVDs and the numerical simulations, namely on the recovery periods. This may be justified by the complexity of the pathways for DDD, associated with the multiplicity of physiological responses to each direct or indirect stimulus. Nevertheless, one could conclude that ligaments, muscles, and IVD covering membranes could be added to the FE model, in order to improve its accuracy and properly describe the

  15. Spatial and seasonal variations of pesticide contamination in agricultural soils and crops sample from an intensive horticulture area of Hohhot, North-West China.

    Science.gov (United States)

    Zhang, Fujin; He, Jiang; Yao, Yiping; Hou, Dekun; Jiang, Cai; Zhang, Xinxin; Di, Caixia; Otgonbayar, Khureldavaa

    2013-08-01

    The spatial variability and temporal trend in concentrations of the organochlorine pesticides (OCPs), hexachlorocyclohexane (HCH) and dichlorodiphenyltrichloroethane (DDT), in soils and agricultural corps were investigated on an intensive horticulture area in Hohhot, North-West China, from 2008 to 2011. The most frequently found and abundant pesticides were the metabolites of DDT (p,p'-DDE, p,p'-DDT, o,p'-DDT and p,p'-DDD). Total DDT concentrations ranged from ND (not detectable) to 507.41 ng/g and were higher than the concentration of total HCHs measured for the range of 4.84-281.44 ng/g. There were significantly positive correlations between the ∑DDT and ∑HCH concentrations (r (2)>0.74) in soils, but no significant correlation was found between the concentrations of OCPs in soils and clay content while a relatively strong correlation was found between total OCP concentrations and total organic carbon (TOC). β-HCH was the main isomer of HCHs, and was detected in all samples; the maximum proportion of β-HCH compared to ∑HCHs (mean value 54%) was found, suggesting its persistence. The α/γ-HCH ratio was between 0.89 and 5.39, which signified the combined influence of technical HCHs and lindane. Low p,p'-DDE/p,p'-DDT in N1, N3 and N9 were found, reflecting the fresh input of DDTs, while the relatively high o,p'-DDT/p,p'-DDT ratios indicated the agricultural application of dicofol. Ratios of DDT/(DDE+DDD) in soils do not indicate recent inputs of DDT into Hohhot farmland soil environment. Seasonal variations of OCPs featured higher concentrations in autumn and lower concentrations in spring. This was likely associated with their temperature-driven re-volatilization and application of dicofol in late spring.

  16. Pacemaker implantation complication rates in elderly and young patients

    Directory of Open Access Journals (Sweden)

    Özcan KS

    2013-08-01

    Full Text Available Kazim Serhan Özcan, Damirbek Osmonov, Servet Altay, Cevdet Dönmez, Ersin Yildirim, Ceyhan Türkkan, Baris Güngör, Ahmet Ekmekçi, Ahmet Taha Alper, Kadir Gürkan, İzzet ErdinlerDepartment of Cardiology, Siyami Ersek Cardiovascular and Thoracic Surgery Center, Istanbul, TurkeyAims: To evaluate the complication rate differences between elderly and younger patients who receive a permanent pacemaker implantation.Methods: We reviewed all cases admitted to our institution between January 2008 and June 2009 with symptomatic bradyarrhythmia for whom a permanent pacemaker was implanted. Beginning in June 2009, we prospectively collected data from all patients with the same diagnosis and procedure. The frequency of complications due to the pacemaker implantation procedure was evaluated and compared between young (<70 years old and elderly (≥70 years old patients.Results: Among 574 patients with a permanent pacemaker, 259 patients (45.1% were below and 315 patients (54.9% were above or at 70 years of age. There were 240 (92.7% and 19 (7.3% dual-chamber pacemaker (DDD and single-chamber pacemaker (VVI implanted patients in the younger group, and 291 (76.8% and 73 (23.2% DDD and VVI pacemaker implanted patients in the elderly group, respectively. The complication rate was 39 (15.1% out of 259 young patients and 24 (7.6% out of 315 elderly patients. Postprocedural complications were statistically lower in the elderly patients than in younger patients (P = 0.005.Conclusion: A pacemaker implantation performed by an experienced operator is a safe procedure for patients of advanced age. The patients who are above 70 years old may have less complication rates than the younger patients.Keywords: complications of pacemaker implantation, elderly patients, permanent pacemaker

  17. Use of isotope tracer techniques for studying pesticide residues in meat with particular reference to the effects of processing. Part of a coordinated programme on the fate and significance of foreign chemical substances in food

    International Nuclear Information System (INIS)

    Mirna, A.

    1976-03-01

    The possibility of reducing DDT, BHC and monolinuron (MLN) residues in meat products by microbial activity and other methods was investigated. Muscle and fat tissue of rabbits fed with 14 C-labelled pesticides were used. In culture media micrococci and moulds metabolized DDT mainly to DDD within two weeks. Reductive dechlorination from DDT to DDD was frequently observed under anaerobic conditions; in aerobic media as e.g. in sausage mixtures this reaction was ineffective. γ-BHC was biodegraded by 30% and MLN by 10 to 20%, mainly to unidentified products. Two strains of labtobacilli tested were ineffective in degrading DDT and degraded γ-BHC only by about 10%. The enzymic degradation of DDT and γ-BHC in muscle mitochondria (released after freezing) was insignificant, while MLN was metabolized by about 15%. In well-homogenized, enzyme-rich liver sausage mixtures with sodium chloride, DDT and γ-BHC were metabolized generally to a greater extent, (40% and 30% respectively after 2 days) than in mixtures with NPS or NPS and NaASC (10% and 20% respectively). In sterilized liver sausage the corresponding figures were 31% and 22 to 11% for DDT and 84% and 39 to 12% for γ-BHC. In culture media the formation of nitrite from nitrate was retarded by as little as 1.0 ppm DDT which may cause disturbances in the production of fermented meats. The most effective treatment to eliminate DDT from meat was curing with 10% sodium chloride and 0.015% KNO (residues decreased by 39%) followed by hot smoking (25%) and cooking (6%). In case of γ-BHC cooking reduced the residues by 65% while curing by 20% and hot smoking by 12%. Decrease of γ-BHC residues in sausages appeared to be due mainly to volatilization through the casings. For MLN about 50% of the radioactivity was removed by curing, smoking or cooking

  18. River sediment (S-37)--a new analytical quality control material ensuring comparability of chlorinated hydrocarbon analysis during an international environmental study in China.

    Science.gov (United States)

    Gawlik, B M; Martens, D; Henkelmann, B; Schramm, K W; Kettrup, A; Muntau, H

    2000-06-01

    A sediment reference material (S-37) was prepared as analytical quality control material to be used within an international project on polychlorinated hydrocarbon analysis in two Chinese rivers. The raw material was sampled during a cruise on Yangtse River and transported afterwards to the JRC Ispra for further processing. The material was treated according to the general principles applicable for candidate reference material production. After a thorough homogeneity study of the bulk the material was bottled. A total of 1,080 bottles each containing 50 g of dry sediment powder was obtained. Final homogeneity and stability testing proved the material to be fit for the purpose. Isotope dilution GC/MS was used to establish target values for pentachlorobenzene (1.17 +/- 0.08 ng/g), hexachlorobenzene (3.60 +/- 0.17 ng/g), octachlorostyrene (0.19 +/- 0.01 ng/g), pentachloroanisole (0.52 +/- 0.02 ng/g), alpha-HCH (0.70 +/- 0.05 ng/g), beta-HCH (1.38 +/- 0.18 ng/g), gamma-HCH (0.83 +/- 038 ng/g), 2,4'-DDT (0.36 +/- 0.04 ng/g), 2,4'-DDE (0.29 +/- 0.02 ng/g), 2,4'-DDD (0.49 +/- 0.02), 4,4'-DDT (3.42 +/- 0.47 ng/g), 4,4'-DDD (1.29 +/- 0.17 ng/g), PCB 28 (0.11 +/- 0.01 ng/g), PCB 52 (0.09 +/- 0.003 ng/g), PCB 101 (0.07 +/- 0.003 ng/g), PCB 138 (0.06 +/- 0.003 ng/g) and PCB 153 (0.06 +/- 0.003 ng/g). Furthermore, indicative values for major and minor constituents as well as for polychlorinated dibenzodioxines and -furanes were measured.

  19. [REDUCTION OF ANTIBIOTIC CONSUMPTION IN RAMBAM HEALTH CARE CAMPUS - THE ROLE OF AN ANTIBIOTIC STEWARDSHIP PROGRAM].

    Science.gov (United States)

    Bitterman, Roni; Raz-Pasteur, Ayelet; Azzam, Zaher S; Karban, Amir; Levy, Yishai; Hayek, Tony; Braun, Eyal; Oren, Ilana; Bar-Lavi, Yaron; Kassis, Imad; Hussein, Khetam; Paul, Mical

    2017-09-01

    Antibiotic stewardship programs (ASP) are designed to optimize antibiotic use in hospitals. Antibiotic consumption is one of the measures assessing the effects of ASPs. To evaluate the effect of an ASP on antibiotic consumption in our hospital and compare it to hospitals in Israel and worldwide. Between October 2012 and March 2013 an ASP was implemented in Rambam Hospital. The program included educational activities, publication of local guidelines for empirical antibiotic treatment, structured infectious diseases consultations, pre-authorization antibiotic restrictions and stop orders. We compared antibacterial antibiotic consumption in defined daily doses (DDD)/100 hospital days (HD) between the periods before (1/2010-3/2013) and after (4/2013-9/2014) implementing the ASP. The study was conducted in the medical departments, hematology, the intensive care unit (ICU) and all pediatric wards. Total antibiotic consumption before implementing the ASP was 96±11.2 DDD/100 HD in medical departments, 186.4±42.8 in the ICU and 185.5±59 in hematology; all values were higher than the worldwide-reported averages for these departments. Following the ASP, total antibiotic consumption decreased by 12% (p=0.008) in the medical departments and by 26% (p=0.002) in hematology, mostly due to reductions in non-restricted antibiotics. No significant changes were observed overall in the ICU and in pediatric wards. There was a significant reduction in consumption of vancomycin and carbapenems in all settings, the latter was reduced to nearly half. Amikacin use quadrupled in the medical departments. Implementation of an ASP lead to a reduction in non-restricted and restricted antibiotic consumption, especially carbapenems.

  20. Bioremediation of Cd-DDT co-contaminated soil using the Cd-hyperaccumulator Sedum alfredii and DDT-degrading microbes

    Energy Technology Data Exchange (ETDEWEB)

    Zhu, Zhi-qiang [MOE Key Laboratory of Environment Remediation and Ecosystem Health, College of Environmental and Resources Science, Zhejiang University, Zijingang Campus, Hangzhou 310058 (China); College of Agriculture, Hainan University, Renmin Road 58, Haikou 570228 (China); Yang, Xiao-e, E-mail: xyang@zju.edu.cn [MOE Key Laboratory of Environment Remediation and Ecosystem Health, College of Environmental and Resources Science, Zhejiang University, Zijingang Campus, Hangzhou 310058 (China); Wang, Kai; Huang, Hua-gang; Zhang, Xincheng [MOE Key Laboratory of Environment Remediation and Ecosystem Health, College of Environmental and Resources Science, Zhejiang University, Zijingang Campus, Hangzhou 310058 (China); Fang, Hua [Department of Plant Protection, College of Agriculture and Biotechnology, Zhejiang University, Zijingang Campus, Hangzhou 310058 (China); Li, Ting-qiang [MOE Key Laboratory of Environment Remediation and Ecosystem Health, College of Environmental and Resources Science, Zhejiang University, Zijingang Campus, Hangzhou 310058 (China); Alva, A.K. [U.S. Department of Agriculture-Agricultural Research Service, Prosser, WA (United States); He, Zhen-li [University of Florida, Institute of Food and Agricultural Sciences, Indian River Research and Education Center, Fort Pierce, FL 34945 (United States)

    2012-10-15

    Highlights: Black-Right-Pointing-Pointer Planting of S. alfredii is an effective technique for phytoextraction of Cd and DDs. Black-Right-Pointing-Pointer Soil inoculation with Pseudomonas sp. DDT-1 increases root biomass of S. alfredii. Black-Right-Pointing-Pointer Soil inoculation with Pseudomonas sp. DDT-1 improves the removal efficiency of DDs. Black-Right-Pointing-Pointer The plant-microbe strategy is promising for remediation of Cd-DDT co-contaminated soil. - Abstract: The development of an integrated strategy for the remediation of soil co-contaminated by heavy metals and persistent organic pollutants is a major research priority for the decontamination of soil slated for use in agricultural production. The objective of this study was to develop a bioremediation strategy for fields co-contaminated with cadmium (Cd), dichlorodiphenyltrichloroethane (DDT), and its metabolites 1, 1-dichloro-2, 2-bis (4-chlorophenyl) ethylene (DDE) and 1, 1-dichloro-2, 2-bis (4-chlorophenyl) ethane (DDD) (DDT, DDE, and DDD are collectively called DDs) using an identified Cd-hyperaccumulator plant Sedum alfredii (SA) and DDT-degrading microbes (DDT-1). Initially, inoculation with DDT-1 was shown to increase SA root biomass in a pot experiment. When SA was applied together with DDT-1, the levels of Cd and DDs in the co-contaminated soil decreased by 32.1-40.3% and 33.9-37.6%, respectively, in a pot experiment over 18 months compared to 3.25% and 3.76% decreases in soil Cd and DDs, respectively, in unplanted, untreated controls. A subsequent field study (18-month duration) in which the levels of Cd and DDs decreased by 31.1% and 53.6%, respectively, confirmed the beneficial results of this approach. This study demonstrates that the integrated bioremediation strategy is effective for the remediation of Cd-DDs co-contaminated soils.

  1. Pattern Recognition of the Presence and Distribution of Organo chlorine Pesticides in Sediment of Cameron Highlands, Malaysia

    International Nuclear Information System (INIS)

    Md Pauzi Abdullah; Naghmeh Saadati; Wan Mohd Afiq Wan Mohd Khalik

    2015-01-01

    This study aimed to assess the environmental situation of 18 organo chlorine pesticides (OCPs), of which some are members of Persistent Organic Pollutants (POPs) in the sediment of an intensive agriculture area as well as popular tourism destination of Cameron Highlands, Malaysia. A total of 56 surface sediment samples were collected at eight selected sampling points along the two main rivers in the area namely Telom and Bertam Rivers during the dry and wet seasons in 2011. The OCPs levels detected were between 0.41 - 82.16 (mean of 21.33 ± 18.54) ng/ g of dry weight. A total of 15 OCPs namely 4,4' DDT, 4,4' DDD, 4,4' DDE, γ-HCH, β- HCH, aldrin, dieldrin, endrin, endosulfan I, endosulfan II endosulfan sulfate, heptachlor and heptachlor epoxide were detected in all sediment samples. Multivariate analysis of the 15 detected OCPs with respect to the type of land-use shows that endosulfan I was found around the tea plantation areas; γ-HCH was found near vegetable plantation areas; 4,4 ' DDE and aldrin were found near Blue Valley station; and endrin, heptachlor, 4,4 ' DDD, 4,4 ' DDT, and heptachlor epoxide were found in the nearby villages. Four clusters (C1; 1, C2; 1, C3; 2 and C4; 4 stations) were generated using a cluster analysis method. Four latent factors (74.36 % of total variance) were identified by principle component and factor analysis method. Three classifications namely tea plantations, vegetable plantations, and villages provide 83.90 % of the composition pattern of 15 OCPs, whereas 3 OCPs are significant components in discriminating organo chlorine pesticides contamination detected in sediment samples. Pollutants seemed to enter the river through the run-off from agricultural areas and villages. HCH isomer (β-HCH) was mostly found in the downstream stations of the rivers. (author)

  2. Gated blood pool imaging in the diagnosis and management of arrhythmia

    International Nuclear Information System (INIS)

    Yamamoto, Shuhei; Kawai, Naoki; Okada, Mitsuhiro; Matsushima, Hideo; Kato, Rinya; Sotobata, Iwao; Tanahashi, Yoshibumi.

    1985-01-01

    The usefulness of multigated cardiac blood pool imaging in evaluating left ventricular function and ventricular activation was studied in patients with cardiac arrhythmias. Subjects consisted of 12 patients with the Wolff-Parkinson-White (WPW) syndrome; 20 with ventricular premature contractions (VPC); 21 with various modes of artificial pacemakers; and two normal controls. 1. Phase analysis was useful in localizing the bypass tract in patients with the WPW syndrome. In four patients with the WPW syndrome and five with VVI pacing, the phase difference between the posterolateral wall of the left ventricle (LV) and the right ventricular apex correlated significantly with the activation time difference between these two regions as assessed by endocardial electrograms (r = 0.94, p < 0.001). 2. Images of VPC were obtained using the bad beat rejection program in an ADAC computer system. The origin of VPCs evaluated by phase image coincided with results of standard 12-lead electrograms. 3. The LV ejection fraction (LVEF) decreased significantly (p < 0.001) after the injection of lidocaine (-3.7 %) or disopyramide (-6.2 %). The percent reduction in LVEF was significantly greater with disopyramide than with lidocaine (-15.1 vs -11.2 %). There was a significant correlation between the percent reduction in LVEF and the disopyramide plasma concentrations (r = -0.62, p < 0.001). 4. The influence of the pacing mode and exercise on LV function was studied in 21 patients with artificial pacemakers. In the VDD and DDD modes, end-diastolic volume (EDV) and cardiac output (CO) decreased after converting to VVI mode. CO increased markedly to approximately 250 % of the control value in the VDD and DDD, and moderately in the VVI and AAI modes during ergometer exercise. (J.P.N.)

  3. Evaluation of organochlorine pesticides in serum from students in Coimbra, Portugal: 1997-2001

    International Nuclear Information System (INIS)

    Lino, Celeste Matos; Silveira, M. Irene Noronha da

    2006-01-01

    In 1997, 1999, 2000, and 2001, in an attempt to evaluate the contamination level of a Portuguese population, organochlorine pesticide residues were evaluated in human serum from students of the University of Coimbra. Concentrations of selected organochlorine pollutants (α-, β-, and γ-HCH, aldrin, dieldrin, HE, HCB, p,p'-DDT, o,p'-DDT, p,p'-DDE, p,p'-DDD) and endosulfan sulfate was measured with gas chromatography-electron capture detector. Our objective is to point out the general levels of pesticide contamination and the differences between the four populations; and together with this, if a connection could be established with gender or the residence area of the subjects. Endosulfan sulfate, p,p'-DDE, o,p'-DDT, and p,p'-DDD were the most frequently identified residues. Endosulfan sulfate present the highest concentrations for all subjects, 42.6 μg/l, with concentrations ranging from undetected to 1295.5 μg/l. Between DDT, isomers, and analogues, o,p'-DDT, and p,p'-DDT presented the highest levels, 24.8 and 21.9 μg/l, respectively. Mean total DDT levels were higher than mean total HCH levels. For Σ-DDT, the highest levels were found among female gender and urban samples. An opposite situation was found in Σ-HCH: males presented higher levels than females. The mean concentration of organochlorine pesticide residues, present in the student populations, showed that it is among the highest levels of contamination, when compared with others from Europe, Asia, and America

  4. Undisturbed dust as a metric of long-term indoor insecticide exposure: Residential DDT contamination from indoor residual spraying and its association with serum levels in the VHEMBE cohort.

    Science.gov (United States)

    Gaspar, Fraser W; Chevrier, Jonathan; Bornman, Riana; Crause, Madelein; Obida, Muvhulawa; Barr, Dana Boyd; Bradman, Asa; Bouwman, Henk; Eskenazi, Brenda

    2015-12-01

    Although approximately 123 million people may be exposed to high levels of insecticides through the use of indoor residual spraying (IRS) for malaria control, few studies exist on indoor insecticide contamination due to IRS and its relationship with human exposure. In the present study, we developed a sampling method to collect undisturbed dust from 50 homes in Limpopo, South Africa, a region where dichlorodiphenyltrichloroethane (DDT) has been used in IRS programs to prevent malaria for ~70years. We quantified DDT and its degradation products, dichlorodiphenyldichloroethylene (DDE), and dichlorodiphenyldichloroethane (DDD) in dust samples to determine dust loading levels and compared these levels to paired serum concentrations of p,p'-DDT and p,p'-DDE in women residents. p,p'-DDT and p,p'-DDE had the highest detection frequencies in both dust (58% and 34% detection, respectively) and serum samples (98% and 100% detection, respectively). Significantly higher detection frequencies for o,p'-DDT, p,p'-DDE, and p,p'-DDD were observed in dust samples collected in buildings that had been previously sprayed for malaria control. We also observed a significant, positive association between dust loading and serum concentrations of p,p'-DDT and p,p'-DDE (Spearman's rho=0.68 and 0.54, respectively). Despite the low detection frequency in dust, our results indicate that undisturbed dust may be a good metric to quantify long-term home exposure to DDT-related compounds and that contamination of the home environment may be an important determinant/source of DDT and DDE exposure. Copyright © 2015 Elsevier Ltd. All rights reserved.

  5. Resistance to erythropoiesis stimulating agents in patients treated with online hemodiafiltration and ultrapure low-flux hemodialysis: results from a randomized controlled trial (CONTRAST.

    Directory of Open Access Journals (Sweden)

    Neelke C van der Weerd

    Full Text Available Resistance to erythropoiesis stimulating agents (ESA is common in patients undergoing chronic hemodialysis (HD treatment. ESA responsiveness might be improved by enhanced clearance of uremic toxins of middle molecular weight, as can be obtained by hemodiafiltration (HDF. In this analysis of the randomized controlled CONvective TRAnsport STudy (CONTRAST; NCT00205556, the effect of online HDF on ESA resistance and iron parameters was studied. This was a pre-specified secondary endpoint of the main trial. A 12 months' analysis of 714 patients randomized to either treatment with online post-dilution HDF or continuation of low-flux HD was performed. Both groups were treated with ultrapure dialysis fluids. ESA resistance, measured every three months, was expressed as the ESA index (weight adjusted weekly ESA dose in daily defined doses [DDD]/hematocrit. The mean ESA index during 12 months was not different between patients treated with HDF or HD (mean difference HDF versus HD over time 0.029 DDD/kg/Hct/week [-0.024 to 0.081]; P = 0.29. Mean transferrin saturation ratio and ferritin levels during the study tended to be lower in patients treated with HDF (-2.52% [-4.72 to -0.31]; P = 0.02 and -49 ng/mL [-103 to 4]; P = 0.06 respectively, although there was a trend for those patients to receive slightly more iron supplementation (7.1 mg/week [-0.4 to 14.5]; P = 0.06. In conclusion, compared to low-flux HD with ultrapure dialysis fluid, treatment with online HDF did not result in a decrease in ESA resistance.ClinicalTrials.gov NCT00205556.

  6. National disparities in the relationship between antimicrobial resistance and antimicrobial consumption in Europe: an observational study in 29 countries.

    Science.gov (United States)

    McDonnell, Lucy; Armstrong, David; Ashworth, Mark; Dregan, Alexandru; Malik, Umer; White, Patrick

    2017-11-01

    Antimicrobial resistance in invasive infections is driven mainly by human antimicrobial consumption. Limited cross-national comparative evidence exists about variation in antimicrobial consumption and effect on resistance. We examined the relationship between national community antimicrobial consumption rates (2013) and national hospital antimicrobial resistance rates (2014) across 29 countries in the European Economic Area (EEA). Consumption rates were obtained from the European Surveillance of Antimicrobial Consumption Network (ESAC-Net). Resistance data were obtained from the European Antimicrobial Resistance Surveillance Network (EARS-Net), based on 196480 invasive isolates in 2014. Data availability and consistency were good. Some countries did not report figures for each strain of resistant bacteria. National antimicrobial consumption rates (2013) varied from ≤ 13 DDD (Estonia, the Netherlands and Sweden) to ≥ 30 DDD (France, Greece and Romania) per 1000 inhabitants per day. National antimicrobial resistance rates (hospital isolates, 15 species) also varied from  37.2% (Bulgaria, Greece, Romania and Slovakia). National antimicrobial consumption rates (2013) showed strong to moderate correlation with national hospital antimicrobial resistance rates (2014) in 19 strains of bacteria (r = 0.84 to r = 0.39). Some countries defied the trend with high consumption and low resistance (France, Belgium and Luxembourg) or low consumption and high resistance (Bulgaria, Hungary and Latvia). We found associations between national community antimicrobial consumption and national hospital antimicrobial resistance across a wide range of bacteria. These associations were not uniform. Different mechanisms may drive resistance in hospital-based invasive infections. Future research on international variations in antimicrobial resistance should consider environmental factors, agricultural use, vaccination policies and prescribing quality. © The Author 2017

  7. A 5-year follow-up study of users of benzodiazepine: starting with diazepam versus oxazepam.

    Science.gov (United States)

    Tvete, Ingunn Fride; Bjørner, Trine; Skomedal, Tor

    2016-04-01

    Drug dependency may develop during long-term benzodiazepine use, indicated, for example, by dose escalation. The first benzodiazepine chosen may affect the risk of dose escalation. To detect possible differences in benzodiazepine use between new users of diazepam and oxazepam over time. This 5-year prescription database study included 19 747 new benzodiazepine users, inhabitants of Norway, aged 30-60 years, with first redemption for diazepam or oxazepam. Individuals starting on diazepam versus oxazepam were analysed by logistic regression with sex, age, other drug redemptions, prescriber's specialty, household income, education level, type of work, and vocational rehabilitation support as background variables. Time to reach a daily average intake of ≥1 defined daily doses (DDD) over a 3-month period was analysed using a Cox proportional hazard regression model. New users of oxazepam had a higher risk for dose escalation compared with new users of diazepam. This was true even when accounting for differences in sociodemographic status and previous drug use (hazard ratio [HR] 1.33, 95% confidence interval = 1.17 to 1.51). Most doctors prescribed, according to recommendations, oxazepam to individuals they may have regarded as prone to and at risk of dependency. However, these individuals were at higher risk for dose escalation even when accounting for differences in sociodemographic status and previous drug use. Differences between the two user groups could be explained by different preferences for starting drug, DDD for oxazepam being possibly too low, and some unaccounted differences in illness. © British Journal of General Practice 2016.

  8. Prevalence of conduction delay of the right atrium in patients with SSS: implications for pacing site selection.

    Science.gov (United States)

    Verlato, Roberto; Zanon, Francesco; Bertaglia, Emanuele; Turrini, Pietro; Baccillieri, Maria Stella; Baracca, Enrico; Bongiorni, Maria Grazia; Zampiero, Aldo; Zonzin, Pietro; Pascotto, Pietro; Venturini, Diego; Corbucci, Giorgio

    2007-09-01

    To evaluate the prevalence of severe right atrial conduction delay in patients with sinus node dysfunction (SND) and atrial fibrillation (AF) and the effects of pacing in the right atrial appendage (RAA) and in the inter-atrial septum (IAS). Forty-two patients (15 male, 72 +/- 7 years) underwent electrophysiologic study to measure the difference between the conduction time from RAA to coronary sinus ostium during stimulation at 600 ms and after extrastimulus (DeltaCTos). Patients were classified as group A if DeltaCTos > 60 ms and group B if IAS pacing and algorithms ON/OFF. Fifteen patients (36%, group A) had DeltaCTos = 76 +/- 11 ms and 27 patients (64%, group B) had DeltaCTos = 36 +/- 20 ms. Twenty-two patients were paced at the RAA and 20 at the IAS. During the study, no AF recurrences were reported in 11 of 42 (26%) patients, independently of RAA or IAS pacing. Patients from group A and RAA pacing had 0.79 +/- 0.81 episodes of AF/day during DDD, which increased to 1.52 +/- 1.41 episodes of AF/day during DDDR + Alg (P = 0.046). Those with IAS pacing had 0.5 +/- 0.24 episodes of AF/day during DDD, which decreased to 0.06 +/- 0.08 episodes of AF/day during DDDR + Alg (P = 0.06). In group B, no differences were reported between pacing sites and pacing modes. Severe right atrial conduction delay is present in one-third of patients with SND and AF: continuous pacing at the IAS is superior to RAA for AF recurrences. In patients without severe conduction delay, no differences between pacing site or mode were observed.

  9. Incidence of organochlorine pesticides and the health condition of nestling ospreys (Pandion haliaetus) at Laguna San Ignacio, a pristine area of Baja California Sur, Mexico.

    Science.gov (United States)

    Rivera-Rodríguez, Laura B; Rodríguez-Estrella, Ricardo

    2011-01-01

    We identified and quantified organochlorine (OC) pesticide residues in the plasma of 28 osprey (Pandion haliaetus) nestlings from a dense population in Laguna San Ignacio, a pristine area of Baja California Sur, Mexico, during the 2001 breeding season. Sixteen OC pesticides were identified and quantified. α-, β-, δ- and γ-hexachlorocyclohexane, heptaclor, heptachlor epoxide, endosulfan I and II, endosulfan-sulfate, p,p'-DDE, p,p'-DDD, aldrin, dieldrin, endrin, endrin aldehyde, and endrin ketone were the OCs found in the plasma of nestlings, ranging from 0.002 to 6.856 pg/μl (parts per billion). No differences were found in the concentration of pesticides between genders (P > 0.05). In our work, the concentrations detected in the plasma were lower than those reported to be a threat for the species and that affect the survival and reproduction of birds. The presence of OC pesticides in the remote Laguna San Ignacio osprey population is an indication of the ubiquitous nature of these contaminants. OCs are apparently able to travel long distances from their source to the study area. A significant relationship between hemoglobin and mean corpuscular hemoglobin concentrations and OC concentrations were found suggesting that a potential effect on the health of chicks may exist in this osprey population caused by the OC, e.g. anemia. The total proteins were positively correlated with α-BHC, endosulfan I, and p,p'-DDD. It has been suggested that OC also affects competitive interactions and population status over the long term in vertebrate species, and our results could be used as reference information for comparison with other more exposed osprey populations.

  10. Use of 5-alpha-reductase inhibitors did not increase the risk of cardiovascular diseases in patients with benign prostate hyperplasia: a five-year follow-up study.

    Directory of Open Access Journals (Sweden)

    Teng-Fu Hsieh

    Full Text Available This nationwide population-based study investigated the risk of cardiovascular diseases after 5-alpha-reductase inhibitor therapy for benign prostate hyperplasia (BPH using the National Health Insurance Research Database (NHIRD in Taiwan.In total, 1,486 adult patients newly diagnosed with BPH and who used 5-alpha-reductase inhibitors were recruited as the study cohort, along with 9,995 subjects who did not use 5-alpha-reductase inhibitors as a comparison cohort from 2003 to 2008. Each patient was monitored for 5 years, and those who subsequently had cardiovascular diseases were identified. A Cox proportional hazards model was used to compare the risk of cardiovascular diseases between the study and comparison cohorts after adjusting for possible confounding risk factors.The patients who received 5-alpha-reductase inhibitor therapy had a lower cumulative rate of cardiovascular diseases than those who did not receive 5-alpha-reductase inhibitor therapy during the 5-year follow-up period (8.4% vs. 11.2%, P=0.003. In subgroup analysis, the 5-year cardiovascular event hazard ratio (HR was lower among the patients older than 65 years with 91 to 365 cumulative defined daily dose (cDDD 5-alpha-reductase inhibitor use (HR=0.63, 95% confidence interval (CI 0.42 to 0.92; P=0.018, however there was no difference among the patients with 28 to 90 and more than 365 cDDD 5-alpha-reductase inhibitor use (HR=1.14, 95% CI 0.77 to 1.68; P=0.518 and HR=0.83, 95% CI 0.57 to 1.20; P=0.310, respectively.5-alpha-reductase inhibitor therapy did not increase the risk of cardiovascular events in the BPH patients in 5 years of follow-up. Further mechanistic research is needed.

  11. Comparative study of paediatric prescription drug utilization between the spanish and immigrant population

    Science.gov (United States)

    2009-01-01

    Background The immigrant population has increased greatly in Spain in recent years to the point where immigrants made up 12% of the infant population in 2008. There is little information available on the profile of this group with regard to prescription drug utilization in universal public health care systems such as that operating in Spain. This work studies the overall and specific differences in prescription drug utilization between the immigrant and Spanish population. Methods Use was made of the Aragonese Health Service databases for 2006. The studied population comprises 159,908 children aged 0-14 years, 13.6% of whom are foreign nationals. Different utilization variables were calculated for each group. Prescription-drug consumption is measured in Defined Daily Doses (DDD) and DDD/1000 persons/day/(DID). Results A total of 833,223 prescriptions were studied. Utilization is lower for immigrant children than in Spanish children for both DID (66.27 v. 113.67) and average annual expense (€21.55 v. €41.14). Immigrant children consume fewer prescription drugs than Spanish children in all of the therapy groups, with the most prescribed (in DID) being: respiratory system, anti-infectives for systemic use, nervous system, sensory organs. Significant differences were observed in relation to the type of drugs and the geographical background of immigrants. Conclusion Prescription drug utilization is much greater in Spanish children than in immigrant children, particularly with reference to bronchodilators (montelukast and terbutaline) and attention-disorder hyperactivity drugs such as methylphenidate. There are important differences regarding drug type and depending on immigrants' geographical backgrounds that suggest there are social, cultural and access factors underlying these disparities. PMID:19995453

  12. Treatment outcomes of a Stage 1 cognitive-behavioral trial to reduce alcohol use among HIV-infected outpatients in western Kenya

    Science.gov (United States)

    Papas, Rebecca K.; Sidle, John E.; Gakinya, Benson N.; Baliddawa, Joyce B.; Martino, Steve; Mwaniki, Michael M.; Songole, Rogers; Omolo, Otieno E.; Kamanda, Allan M.; Ayuku, David O.; Ojwang, Claris; Owino-Ong’or, Willis D.; Harrington, Magdalena; Bryant, Kendall J.; Carroll, Kathleen M.; Justice, Amy C.; Hogan, Joseph W.; Maisto, Stephen A.

    2011-01-01

    Aims Dual epidemics of HIV and alcohol use disorders, and a dearth of professional resources for behavioral treatment in sub-Saharan Africa, suggest the need for development of culturally relevant and feasible interventions. The purpose of this study was to test the preliminary efficacy of a culturally adapted 6-session gender-stratified group cognitive-behavioral therapy (CBT) intervention delivered by paraprofessionals to reduce alcohol use among HIV-infected outpatients in Eldoret, Kenya. Design Randomized clinical trial comparing CBT against a usual care assessment only control Setting A large HIV outpatient clinic in Eldoret, Kenya, part of the Academic Model for Providing Access to Healthcare collaboration Participants 75 HIV-infected outpatients who were antiretroviral (ARV)-initiated or ARV-eligible and who reported hazardous or binge drinking Measurements Percent drinking days (PDD) and mean drinks per drinking days (DDD) measured continuously using the Timeline Followback Findings There were 299 ineligible and 102 eligible outpatients with 12 refusals. Effect sizes of the change in alcohol use since baseline between the two conditions at the 30-day follow-up were large (d=.95, p=.0002, mean difference=24.93 (95% CI: 12.43, 37.43) PDD; d=.76, p=.002, mean difference=2.88 (95% CI: 1.05, 4.70) DDD). Randomized participants attended 93% of the 6 CBT sessions offered. Reported alcohol abstinence at the 90-day follow-up was 69.4% (CBT) and 37.5% (usual care). Paraprofessional counselors achieved independent ratings of adherence and competence equivalent to college-educated therapists in the U.S. Treatment effect sizes were comparable to alcohol intervention studies conducted in the U.S. Conclusions Cognitive-behavioral therapy can be successfully adapted to group paraprofessional delivery in Kenya and may be effective in reducing alcohol use among HIV-infected Kenyan outpatients. PMID:21631622

  13. Just in Time DSA-The Hanford Nuclear Safety Basis Strategy

    Energy Technology Data Exchange (ETDEWEB)

    Olinger, S. J.; Buhl, A. R.

    2002-02-26

    The U.S. Department of Energy, Richland Operations Office (RL) is responsible for 30 hazard category 2 and 3 nuclear facilities that are operated by its prime contractors, Fluor Hanford Incorporated (FHI), Bechtel Hanford, Incorporated (BHI) and Pacific Northwest National Laboratory (PNNL). The publication of Title 10, Code of Federal Regulations, Part 830, Subpart B, Safety Basis Requirements (the Rule) in January 2001 imposed the requirement that the Documented Safety Analyses (DSA) for these facilities be reviewed against the requirements of the Rule. Those DSA that do not meet the requirements must either be upgraded to satisfy the Rule, or an exemption must be obtained. RL and its prime contractors have developed a Nuclear Safety Strategy that provides a comprehensive approach for supporting RL's efforts to meet its long term objectives for hazard category 2 and 3 facilities while also meeting the requirements of the Rule. This approach will result in a reduction of the total number of safety basis documents that must be developed and maintained to support the remaining mission and closure of the Hanford Site and ensure that the documentation that must be developed will support: compliance with the Rule; a ''Just-In-Time'' approach to development of Rule-compliant safety bases supported by temporary exemptions; and consolidation of safety basis documents that support multiple facilities with a common mission (e.g. decontamination, decommissioning and demolition [DD&D], waste management, surveillance and maintenance). This strategy provides a clear path to transition the safety bases for the various Hanford facilities from support of operation and stabilization missions through DD&D to accelerate closure. This ''Just-In-Time'' Strategy can also be tailored for other DOE Sites, creating the potential for large cost savings and schedule reductions throughout the DOE complex.

  14. Just in Time DSA the Hanford Nuclear Safety Basis Strategy

    Energy Technology Data Exchange (ETDEWEB)

    JACKSON, M.W.

    2002-06-01

    The U.S. Department of Energy, Richland Operations Office (RL) is responsible for 30 hazard category 2 and 3 nuclear facilities that are operated by its prime contractors, Fluor Hanford, Incorporated (FHI), Bechtel Hanford, Incorporated (BHI) and Pacific Northwest National Laboratory (PNNL). The publication of Title 10, Code of Federal Regulations, Part 830, Subpart B, Safely Basis Requirements (the Rule) in January 2001 requires that the Documented Safety Analyses (DSA) for these facilities be reviewed against the requirements of the Rule. Those DSAs that do not meet the requirements must either be upgraded to satisfy the Rule, or an exemption must be obtained. RL and its prime contractors have developed a Nuclear Safety Strategy that provides a comprehensive approach for supporting RL's efforts to meet its long-term objectives for hazard category 2 and 3 facilities while also meeting the requirements of the Rule. This approach will result in a reduction of the total number of safety basis documents that must be developed and maintained to support the remaining mission and closure of the Hanford Site and ensure that the documentation that must be developed will support: Compliance with the Rule; A ''Just-In-Time'' approach to development of Rule-compliant safety bases supported by temporary exemptions; and Consolidation of safety basis documents that support multiple facilities with a common mission (e.g. decontamination, decommissioning and demolition [DD&D], waste management, surveillance and maintenance). This strategy provides a clear path to transition the safety bases for the various Hanford facilities from support of operation and stabilization missions through DD&D to accelerate closure. This ''Just-In-Time'' Strategy can also be tailored for other DOE Sites, creating the potential for large cost savings and schedule reductions throughout the DOE complex.

  15. European Surveillance of Antimicrobial Consumption (ESAC): outpatient penicillin use in Europe (1997-2009).

    Science.gov (United States)

    Versporten, Ann; Coenen, Samuel; Adriaenssens, Niels; Muller, Arno; Minalu, Girma; Faes, Christel; Vankerckhoven, Vanessa; Aerts, Marc; Hens, Niel; Molenberghs, Geert; Goossens, Herman

    2011-12-01

    Data on 13 years (1997-2009) of outpatient penicillin use were collected from 33 European countries within the European Surveillance of Antimicrobial Consumption (ESAC) project and analysed in detail. For the period 1997-2009, data on outpatient use of systemic penicillins aggregated at the level of the active substance were collected using the Anatomical Therapeutic Chemical (ATC)/defined daily dose (DDD) method (WHO, version 2011) and expressed in DDD per 1000 inhabitants per day (DID). For detailed analysis of trends over time, seasonal variation and composition of outpatient penicillin use in 33 European countries, we distinguished between narrow-spectrum penicillins (NSP), broad-spectrum penicillins (BSP), penicillinase-resistant penicillins (PRP) and combinations with β-lactamase inhibitors (COP). Total outpatient penicillin (ATC group J01C) use in 2009 varied by a factor of 3.8 between the countries with the highest (16.08 DID in France) and lowest (4.23 DID in the Russian Federation) use. COP represented 45.8%, BSP 40.7%, NSP 10.8% and PRP 2.6% of total European outpatient penicillin use. Total outpatient penicillin use significantly increased over time by 1.53 (SD 0.71) DID between 1997 and 2009. COP (mainly co-amoxiclav) increased by 2.17 (SD 0.40) DID, which was the result of its absolute increase as well as the observed shift from NSP and BSP towards COP. This increase exceeded 10% in 20 countries, where it coincided with a similar decrease in either BSP (15 countries) or NSP (5 countries). Penicillins represented the most widely used antibiotic subgroup in all 33 participating countries, albeit with considerable variation in their use patterns. For Europe, a continuous increase in overall penicillin use and of COP use was observed during the period 1997-2009.

  16. Long-Term Creep Behavior of the Intervertebral Disc: Comparison between Bioreactor Data and Numerical Results

    Directory of Open Access Journals (Sweden)

    APG eCastro

    2014-11-01

    Full Text Available The Loaded Disc Culture System (LDCS is an Intervertebral Disc (IVD-oriented bioreactor developed by the VU Medical Center (VUmc, Amsterdam, The Netherlands, which has the capacity of maintaining up to 12 IVDs in culture, for approximately 3 weeks after extraction. Using this system, 8 goat IVDs were provided with the essential nutrients and submitted to compression tests without losing their biomechanical and physiological properties, for 22 days. Based on previous reports (Detiger et al., 2013; Paul et al., 2013, 2012, 4 of these IVDs were kept in physiological condition (control and the other 4 were previously injected with chondroitinase ABC (CABC, in order to promote Degenerative Disc Disease (DDD. The loading profile intercalated 16h of activity loading with 8h of loading recovery to express the standard circadian variations.The displacement behavior of these 8 IVDs along the first 2 days of the experiment was numerically reproduced, using an IVD osmo-poro-hyper-viscoelastic and fiber-reinforced Finite Element (FE model. The simulations were run on a custom FE solver (Castro et al., 2014.The analysis of the experimental results allowed concluding that the effect of the CABC injection was only significant in 2 of the 4 IVDs. The 4 control IVDs showed no signs of degeneration, as expected. In what concerns to the numerical simulations, the IVD FE model was able to reproduce the generic behavior of the two groups of goat IVDs (control and injected. However, some discrepancies were still noticed on the comparison between the injected IVDs and the numerical simulations, namely on the recovery periods. This may be justified by the complexity of the pathways for DDD, associated with the multiplicity of physiological responses to each direct or indirect stimulus. Nevertheless, one could conclude that ligaments, muscles and IVD covering membranes could be added to the FE model, in order to improve its accuracy and properly describe the recovery

  17. Does Alcoholics Anonymous work differently for men and women? A moderated multiple-mediation analysis in a large clinical sample.

    Science.gov (United States)

    Kelly, John F; Hoeppner, Bettina B

    2013-06-01

    Alcoholics Anonymous (AA) began as a male organization, but about one third is now female. Studies have found that women participate at least as much as men and benefit equally from AA, but it is unclear whether women benefit from AA in the same or different ways as men. This study tested whether gender moderated the mechanisms through which AA aids recovery. A cohort study of alcohol dependent adults (N=1726; 24% female; Project MATCH) was assessed on AA attendance during treatment; with mediators at 9 months; outcomes (Percent Days Abstinent [PDA] and Drinks per Drinking Day [DDD]) at 15 months. Multiple mediator models tested whether purported mechanisms (i.e., self-efficacy, depression, social networks, spirituality/religiosity) explained AA's effects differently for men and women controlling for baseline values, mediators, treatment, and other confounders. For PDA, the proportion of AA's effect accounted for by the mediators was similar for men (53%) and women (49%). Both men and women were found to benefit from changes in social factors but these mechanisms were more important among men. For DDD, the mediators accounted for 70% of the effect of AA for men and 41% for women. Again, men benefitted mostly from social changes. Independent of AA's effects, negative affect self-efficacy was shown to have a strong relationship to outcome for women but not men. The recovery benefits derived from AA differ in nature and magnitude between men and women and may reflect differing needs based on recovery challenges related to gender-based social roles and drinking contexts. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

  18. Current implications of past DDT indoor spraying in Oman.

    Science.gov (United States)

    Booij, Petra; Holoubek, Ivan; Klánová, Jana; Kohoutek, Jiří; Dvorská, Alice; Magulová, Katarína; Al-Zadjali, Said; Čupr, Pavel

    2016-04-15

    In Oman, DDT was sprayed indoors during an intensive malaria eradication program between 1976 and 1992. DDT can remain for years after spraying and is associated with potential health risk. This raises the concern for human exposure in areas where DDT was used for indoor spraying. Twelve houses in three regions with a different history of DDT indoor spraying were chosen for a sampling campaign in 2005 to determine p,p'-dichlorodiphenyltrichloroethane (p,p'-DDT), p,p'-dichlorodiphenyldichloroethylene (p,p'-DDE) and p,p'-dichlorodiphenyldichloroethane (p,p'-DDD) levels in indoor air, dust, and outdoor soil. Although DDT was only sprayed indoor, p,p'-DDT, p,p'-DDE and p,p'-DDD were also found in outdoor soil. The results indicate that release and exposure continue for years after cessation of spraying. The predicted cancer risk based on concentrations determined in 2005, indicate that there was still a significant cancer risk up to 13 to 16years after indoor DDT spraying. A novel approach, based on region-specific half-lives, was used to predict concentrations in 2015 and showed that more than 21years after spraying, cancer risk for exposure to indoor air, dust, and outdoor soil are acceptable in Oman for adults and young children. The model can be used for other locations and countries to predict prospective exposure of contaminants based on indoor experimental measurements and knowledge about the spraying time-schedule to extrapolate region-specific half-lives and predict effects on the human population years after spraying. Copyright © 2015 Elsevier B.V. All rights reserved.

  19. Automatic day-2 intervention by a multidisciplinary Antimicrobial Stewardship-Team leads to multiple positive effects

    Directory of Open Access Journals (Sweden)

    Jan-Willem H Dik

    2015-06-01

    Full Text Available Background: Antimicrobial resistance rates are increasing. This is, among others, caused by incorrect or inappropriate use of antimicrobials. To target this, a multidisciplinary Antimicrobial Stewardship-Team (A-Team was implemented at the University Medical Center Groningen on a urology ward. Goal of this study is to evaluate the clinical effects of the case-audits done by this team, looking at length of stay (LOS and antimicrobial use.Methods: Automatic e-mail alerts were sent after 48 hours of consecutive antimicrobial use triggering the case-audits, consisting of an A-Team member visiting the ward, discussing the patient’s therapy with the bed-side physician and together deciding on further treatment based on available diagnostics and guidelines. Clinical effects of the audits were evaluated through an Interrupted Time Series analysis and a retrospective historic cohort. Results: A significant systemic reduction of antimicrobial consumption for all patients on the ward, both with and without case-audits was observed. Furthermore, LOS for patients with case-audits who were admitted primarily due to infections decreased to 6.20 days (95% CI: 5.59-6.81 compared to the historic cohort (7.57 days; 95% CI: 6.92-8.21 (p=0.012. Antimicrobial consumption decreased for these patients from 8.17 DDD/patient (95% CI: 7.10-9.24 to 5.93 DDD/patient (95% CI: 5.02-6.83 (p=0.008. For patients with severe underlying diseases (e.g. cancer these outcome measures remained unchanged.Conclusions: The evaluation showed a considerable positive impact. Antibiotic use of the whole ward was reduced, transcending the intervened patients. Furthermore, LOS and mean antimicrobial consumption for a subgroup was reduced, thereby improving patient care and potentially lowering resistance rates.

  20. Site profiles of low-volatile chlorinated hydrocarbons - cause-oriented monitoring in aquatic media. Vol.2. Low-volatile chlorinated hydrocarbons in surface water, sediments, suspended matter and fish of the Elbe river and its tributaries; Standortprofile schwerfluechtiger chlorierter Kohlenwasserstoffe (SCKW) - ursachenorientiertes Monitoring in aquatischen Medien. Bd. 2. SCKW in Oberflaechenwasser, Sediment, Schwebstoffen und Fischen aus der Elbe und Nebenfluessen

    Energy Technology Data Exchange (ETDEWEB)

    Heinisch, E.; Kettrup, A.; Gebefuegi, I.; Martens, D.; Bergheim, W.; Wenzel, S.

    2001-07-01

    Evaluating the primary data from ARGE ELBE, LAU Halle/Saale and the Environmental Specimen Banking (Umweltprobenbank) as well from publications from the Czech Republic (CHMU) the concentrations of the following low volatile chlorinated hydrocarbons were established for surface water, sediment, breams and eels from the rivers Elbe, Schwarze Elster, Mulde and Saale partly from 1989 till 1999: DDT and its metabolites DDE and DDD, partly as 2,4'- and 4,4' isomers; HCH ({alpha}-, {beta}-, {gamma}- and {delta} isomers); chlorinated benzenes with 1-6 Cl atoms and octachlorostyrene. The data evaluated were drawn up into tables - comprehensive in a separate supplement, in short versions within the text - and consolidated into graphs. Aim of the paper was a cause-oriented monitoring. The by far most important emission sources, found from the distance and time profiles as well as from special assessments of the substance patterns, were chemical plants. (orig.) [German] Durch Auswertung von Primaerdaten der ARGE ELBE, des LAU Halle/Saale und der Umweltprobenbank sowie von Publikationen aus Tschechien (CHMU) wurden fuer Oberflaechenwasser, Sediment, Brassen/Bleien und Aale aus der Elbe, Schwarzen Elster, Mulde und Saale fuer die Jahre von z.T. 1989 bis 1999 die Konzentrationen der folgenden schwerfluechtigen Kohlenwasserstoffe (SCKW) ermittelt: DDT und seine Metabolite DDE und DDD, z.T. als 2,4'- und 4,4'-Isomere; HCH ({alpha}-, {beta}-, {gamma}- und {delta}-Isomere); chlorierte Benzole mit 1-6 Cl-Atomen und Octachlorstyrol. Die ausgewerteten Daten wurden zu Tabellen - ausfuehrlich in einem gesonderten Tabellenanhang und verkuerzt im Textteil - zusammengestellt sowie zu Grafiken verdichtet. Ziel der Arbeit war ein ursachenorientiertes Monitoring. Als mit Abstand wesentlichste Emissionsquellen konnten anhand von Streckenprofilen und Zeitrastern sowie durch spezielle Auswertungen der Stoffmusterverteilungen Chemibetriebe ermittelt werden. (orig.)

  1. NSAIDs utilization for musculoskeletal indications in elderly patients with cerebro/cardiovascular disease.

    Science.gov (United States)

    Roberto, Giuseppe; Bartolini, Claudia; Rea, Federico; Onder, Graziano; Vitale, Cristiana; Trifirò, Gianluca; Kirchmayer, Ursula; Chinellato, Alessandro; Lucenteforte, Ersilia; Corrao, Giovanni; Mugelli, Alessandro; Lapi, Francesco; Gini, Rosa

    2018-05-01

    To describe NSAID utilization for musculoskeletal conditions in a large cohort of Italian elderly with cerebro/cardiovascular disease, a population in which NSAIDs should be generally avoided due to the prothrombotic potential. Administrative data from five Italian geographic areas were analyzed. Patients aged ≥ 65 with a cerebro/cardiovascular event recorded between 2008 and 2011 (cohort entry) were selected. Prescription NSAIDs reimbursed for musculoskeletal conditions and dispensed during 1 year follow-up were retrieved to describe (i) prevalence of use, (ii) average amount of defined daily doses of NSAIDs claimed by users per day of follow-up, and (iii) distribution of the received daily dose (RDD) among patients with ≥ 2 dispensings. Among new users, i.e., patients without NSAID dispensings during 2 years before cohort entry, the first dispensed NSAID molecule was observed. Overall, 511,989 patients were selected. Across the five geographic areas, prevalence of use ranged from 48 to 21% and average consumption ranged between 30 and 67 DDD/1000 users/day. Around 10% of patients in the overall cohort had a RDD > 1. Nimesulide (9.6%) and diclofenac (7.5%) had the highest prevalence of use. The most consumed NSAIDs were nimesulide and coxibs with 10.6 and 7.5 DDD/1000 users/day, respectively. Among new users recruited in 2011, 30% had diclofenac or a coxibs as the first prescription. NSAID use was common in the study cohort, particularly in central-southern areas. In contrast with current recommendations, coxibs and diclofenac were among the most prescribed active principles, even in new users. Interventions to promote appropriateness of use are warranted.

  2. Comparative study of paediatric prescription drug utilization between the spanish and immigrant population

    Directory of Open Access Journals (Sweden)

    Macipe-Costa Rosa

    2009-12-01

    Full Text Available Abstract Background The immigrant population has increased greatly in Spain in recent years to the point where immigrants made up 12% of the infant population in 2008. There is little information available on the profile of this group with regard to prescription drug utilization in universal public health care systems such as that operating in Spain. This work studies the overall and specific differences in prescription drug utilization between the immigrant and Spanish population. Methods Use was made of the Aragonese Health Service databases for 2006. The studied population comprises 159,908 children aged 0-14 years, 13.6% of whom are foreign nationals. Different utilization variables were calculated for each group. Prescription-drug consumption is measured in Defined Daily Doses (DDD and DDD/1000 persons/day/(DID. Results A total of 833,223 prescriptions were studied. Utilization is lower for immigrant children than in Spanish children for both DID (66.27 v. 113.67 and average annual expense (€21.55 v. €41.14. Immigrant children consume fewer prescription drugs than Spanish children in all of the therapy groups, with the most prescribed (in DID being: respiratory system, anti-infectives for systemic use, nervous system, sensory organs. Significant differences were observed in relation to the type of drugs and the geographical background of immigrants. Conclusion Prescription drug utilization is much greater in Spanish children than in immigrant children, particularly with reference to bronchodilators (montelukast and terbutaline and attention-disorder hyperactivity drugs such as methylphenidate. There are important differences regarding drug type and depending on immigrants' geographical backgrounds that suggest there are social, cultural and access factors underlying these disparities.

  3. Assessing the effects of urbanization on the environment with soil legacy and current-use insecticides: a case study in the Pearl River Delta, China.

    Science.gov (United States)

    Wei, Yan-Li; Bao, Lian-Jun; Wu, Chen-Chou; He, Zai-Cheng; Zeng, Eddy Y

    2015-05-01

    To evaluate the impacts of anthropogenic events on the rapid urbanized environment, the levels of legacy organochlorine pesticides (OCPs) and current-use insecticides (CUPs), i.e., dichlorodiphenyltrichloroethane and its metabolites (DDTs), hexachlorocyclohexanes (HCHs), pyrethroids and organophosphates in soil of the Pearl River Delta (PRD) and surrounding areas were examined. Spatial concentration distributions of legacy OCPs and CUPs shared similar patterns, with higher concentrations occurred in the central PRD with more urbanization level than that in the PRD's surrounding areas. Furthermore, relatively higher concentrations of OCPs and CUPs were found in the residency land than in other land-use types, which may be attributed to land-use change under rapid urbanization. Moderate correlations between gross domestic production or population density and insecticide levels in fifteen administrative districts indicated that insecticide spatial distributions may be driven by economic prosperity. The soil-air diffusive exchanges of DDTs and HCHs demonstrated that soil was a sink of atmospheric o,p'-DDE, o,p'-DDD, p,p'-DDD and o,p'-DDT, and was a secondary source of HCHs and p,p'-DDT to atmosphere. The soil inventories of DDTs and HCHs (100 ± 134 and 83 ± 70 tons) were expected to decrease to half of their current values after 18 and 13 years, respectively, whereas the amounts of pyrethroids and organophosphates (39 and 6.2 tons) in soil were estimated to decrease after 4 and 2 years and then increase to 87 and 1.0 tons after 100 years. In this scenario, local residents in the PRD and surrounding areas will expose to the high health risk for pyrethroids by 2109. Strict ban on the use of technical DDTs and HCHs and proper training of famers to use insecticides may be the most effective ways to alleviate the health effect of soil contamination. Copyright © 2015 Elsevier B.V. All rights reserved.

  4. Bioremediation of Cd-DDT co-contaminated soil using the Cd-hyperaccumulator Sedum alfredii and DDT-degrading microbes

    International Nuclear Information System (INIS)

    Zhu, Zhi-qiang; Yang, Xiao-e; Wang, Kai; Huang, Hua-gang; Zhang, Xincheng; Fang, Hua; Li, Ting-qiang; Alva, A.K.; He, Zhen-li

    2012-01-01

    Highlights: ► Planting of S. alfredii is an effective technique for phytoextraction of Cd and DDs. ► Soil inoculation with Pseudomonas sp. DDT-1 increases root biomass of S. alfredii. ► Soil inoculation with Pseudomonas sp. DDT-1 improves the removal efficiency of DDs. ► The plant-microbe strategy is promising for remediation of Cd-DDT co-contaminated soil. - Abstract: The development of an integrated strategy for the remediation of soil co-contaminated by heavy metals and persistent organic pollutants is a major research priority for the decontamination of soil slated for use in agricultural production. The objective of this study was to develop a bioremediation strategy for fields co-contaminated with cadmium (Cd), dichlorodiphenyltrichloroethane (DDT), and its metabolites 1, 1-dichloro-2, 2-bis (4-chlorophenyl) ethylene (DDE) and 1, 1-dichloro-2, 2-bis (4-chlorophenyl) ethane (DDD) (DDT, DDE, and DDD are collectively called DDs) using an identified Cd-hyperaccumulator plant Sedum alfredii (SA) and DDT-degrading microbes (DDT-1). Initially, inoculation with DDT-1 was shown to increase SA root biomass in a pot experiment. When SA was applied together with DDT-1, the levels of Cd and DDs in the co-contaminated soil decreased by 32.1–40.3% and 33.9–37.6%, respectively, in a pot experiment over 18 months compared to 3.25% and 3.76% decreases in soil Cd and DDs, respectively, in unplanted, untreated controls. A subsequent field study (18-month duration) in which the levels of Cd and DDs decreased by 31.1% and 53.6%, respectively, confirmed the beneficial results of this approach. This study demonstrates that the integrated bioremediation strategy is effective for the remediation of Cd-DDs co-contaminated soils.

  5. The 'Lumbar Fusion Outcome Score' (LUFOS): a new practical and surgically oriented grading system for preoperative prediction of surgical outcomes after lumbar spinal fusion in patients with degenerative disc disease and refractory chronic axial low back pain.

    Science.gov (United States)

    Mattei, Tobias A; Rehman, Azeem A; Teles, Alisson R; Aldag, Jean C; Dinh, Dzung H; McCall, Todd D

    2017-01-01

    In order to evaluate the predictive effect of non-invasive preoperative imaging methods on surgical outcomes of lumbar fusion for patients with degenerative disc disease (DDD) and refractory chronic axial low back pain (LBP), the authors conducted a retrospective review of 45 patients with DDD and refractory LBP submitted to anterior lumbar interbody fusion (ALIF) at a single center from 2007 to 2010. Surgical outcomes - as measured by Visual Analog Scale (VAS/back pain) and Oswestry Disability Index (ODI) - were evaluated pre-operatively and at 6 weeks, 3 months, 6 months, and 1 year post-operatively. Linear mixed-effects models were generated in order to identify possible preoperative imaging characteristics (including bone scan/99mTc scintigraphy increased endplate uptake, Modic endplate changes, and disc degeneration graded according to Pfirrmann classification) which may be predictive of long-term surgical outcomes . After controlling for confounders, a combined score, the Lumbar Fusion Outcome Score (LUFOS), was developed. The LUFOS grading system was able to stratify patients in two general groups (Non-surgical: LUFOS 0 and 1; Surgical: LUFOS 2 and 3) that presented significantly different surgical outcomes in terms of estimated marginal means of VAS/back pain (p = 0.001) and ODI (p = 0.006) beginning at 3 months and continuing up to 1 year of follow-up. In conclusion,  LUFOS has been devised as a new practical and surgically oriented grading system based on simple key parameters from non-invasive preoperative imaging exams (magnetic resonance imaging/MRI and bone scan/99mTc scintigraphy) which has been shown to be highly predictive of surgical outcomes of patients undergoing lumbar fusion for treatment for refractory chronic axial LBP.

  6. Effect of statin on hepatocellular carcinoma in patients with type 2 diabetes: A nationwide nested case-control study.

    Science.gov (United States)

    Kim, Gyuri; Jang, Suk-Yong; Han, Eugene; Lee, Yong-Ho; Park, Se-Young; Nam, Chung Mo; Kang, Eun Seok

    2017-02-15

    Relationship on new statin use and the risk of hepatocellular carcinoma (HCC) in patients with incident type 2 diabetes mellitus (T2DM), who might be at the risk of developing HCC, is uncertained. A nationwide population-based nested case-control study was conducted within the National Health Insurance Service National Sample Cohort 2002-2013 in Korea. Newly prescribed statin after newly diagnosed T2DM was defined as statin use. Controls were matched to case patients on age, sex, follow-up time, and the date of diabetes diagnosis at a five-to-one ratio. Odds ratios (ORs) for associations of statin use with HCC were calculated using conditional logistic regression. After at least a 5-year HCC-free period, there were 229 incident HCC cases and 1,145 matched controls from 47,738 patients with incident diabetes. Of these 229 incident HCC cases, 27 (11.8%) were statin users, whereas 378 (33.0%) were statin users among 1,145 controls. Statin use was associated with a reduced risk of HCC development (adjusted OR [AOR]= 0.36, 95% confidence interval [CI] 0.22-0.60) after adjustment for chronic viral hepatitis, liver cirrhosis, alcoholic liver disease, previous cancer, aspirin use, insulin use, sulfonylurea use, metformin use, thiazolidinedione use, history of chronic obstructive pulmonary disease, Charlson comorbidity score, household income level, and residential area. Risk reduction was accentuated with an increase of cumulative defined daily doses (cDDD) compared with non-users (AORs 0.53, 0.36, 0.32, and 0.26 in ≤60, 60-180, 181-365, and >365cDDD, respectively; P for trend statin use before HCC diagnosis may have a beneficial inhibitory effect on HCC development in a dose-dependent manner, especially in individuals with liver disease. © 2016 UICC.

  7. Antiretroviral drug expenditure, pricing and judicial demand: an analysis of federal procurement data in Brazil from 2004–2011

    Science.gov (United States)

    2014-01-01

    Background Previous studies have described expenditures for antiretroviral (ARV) medicines in Brazil through 2005. While prior studies examined overall expenditures, they have not have analyzed drug procurement data in order to describe the role of court litigation on access and pricing. Methods ARV drug procurement from private sector sources for the years 2004–2011 was obtained through the general procurement database of the Brazilian Federal Government (SIASG). Procurement was measured in Defined Daily Doses (DDD) per 1000 persons-under-treatment per day. Expenditures and price per DDD were calculated and expressed in U.S. Dollars. Justifications for ARV purchases were examined in order to determine the relationship between health litigation and incorporation into Brazil’s national treatment guidelines. Results Drug procurement of ARVs from private sources underwent marked expansion in 2005, peaked in 2009, and stabilized to 2008 levels by 2011. Expenditures followed procurement curves. Medications which were procured for the first time after 2007 cost more than medicines which were introduced before 2007. Judicial actions initially resulted in purchases of newer medications for a select number of patients in Brazil but ultimately expanded availability to a larger population through incorporation into the national treatment guidelines. Conclusions Drug procurement and expenditures for ARVs in Brazil varied between 2004–2011. The procurement of some drugs from the private sector ceased after public manufacturers started producing them locally. Judicial demand has resulted in the incorporation of newer drugs into the national treatment guidelines. In order for the AIDS treatment program to remain sustainable, efforts should be pursued to reduce prices through generic drugs, price negotiation and other public health flexibilities such as compulsory licensing. PMID:24735589

  8. Experimental evaluation of the influence of the team members' personalities on the team performance

    International Nuclear Information System (INIS)

    Nagasaka, Akihiko

    1998-01-01

    This report deals with the result of the experiment that testees' teams had coped with abnormal events on power plant simulator. 8 teams were AAA1, AAA2, ACD1, ACD2, CCC1, CCC2, DDD1 and DDD2 consist of 3 members. Members of teams were intentionally united by his personality with the results examined by Yatabe-Guilford personality test (A: Average type, C: Calm type, D: Director type). Each team coped with 8 abnormal events (leak from the pipe after the condensate booster pump-A and feedwater control system failure, vacuum pump-A failure, etc.). Teams' behaviors were evaluated and calculated the evaluated values about 3 team's functions: (1) direction and orientation (11 items), (2) recovery (13 items) and (3) maintenance of cooperation (13 items). The order of the evaluated values were almost AAAs≤ACDs≤CCCs< DDDs with each function. And the results on multiple comparison of the evaluated values are as follows: (a) There are remarkable significances between DDDs and other combinations of personalities (32 cases per 36 cases). (b) Some cases are significant among 2 teams of same combination of personalities (4 cases per 12 cases). Also the results on analysis of utterances of team member are as follows: (c) There is good correspondence of the number of utterances to the evaluated values. (d) With AAAs, the number of 'Instruction' is very small. (e) With CCCs, utterances related to maintenance of cooperation are relatively few. On these results, the author is convinced that combination of personalities in not matured team certainly relates team performance and utterances among the members. (author)

  9. Unmasking of complements using proteinase-K in formalin fixed paraffin embedded renal biopsies

    Directory of Open Access Journals (Sweden)

    R Nada

    2016-01-01

    Full Text Available Renal biopsy interpretation requires histopathology, direct immunofluorescence (DIF and electron microscopy. Formalin-fixed, paraffin-embedded tissue (FFPE sent for light microscopy can be used for DIF after antigen retrieval. However, complement staining has not been satisfactory. We standardized DIF using proteinase-K for antigen retrieval in FFPE renal biopsies. A pilot study was conducted on known cases of membranous glomerulonephritis (MGN, membranoproliferative type-1 (MPGN-1, immunoglobulin A nephropathy (IgAN, and anti-glomerular basement disease (anti-GBM. Immunofluorescence panel included fluorescein isothiocyanate (FITC conjugated IgG, IgA, IgM, complements (C3 and C1q, light chains (kappa, lambda and fibrinogen antibodies. After standardization of the technique, 75 renal biopsies and 43 autopsies cases were stained. Out of 43 autopsy cases, immune-complex mediated glomerulonephritis (GN was confirmed in 18 cases (Lupus nephritis-11, IgAN-6, MGN-1, complement-mediated dense deposit disease (DDD-1 and monoclonal diseases in 4 cases (amyloidosis-3, cast nephropathy-1. Immune-mediated injury was excluded in 17 cases (focal segmental glomerulosclerosis -3, crescentic GN-6 [pauci-immune-3, anti-GBM-3], thrombotic microangiopathy-5, atherosclerosis-3. Renal biopsies (n-75 where inadequate or no frozen sample was available; this technique classified 52 mesangiocapillary pattern as MPGN type-1-46, DDD-2 and (C3GN-4. Others were diagnosed as IgAN-3, lupus nephritis-2, MGN-4, diffuse proliferative glomerulonephritis (DPGN-1, Non-IC crescentic GN-1, monoclonal diseases-3. In nine cases, DIF on FFPE tissue could not help in making diagnosis. Proteinase-K enzymatic digestion of FFPE renal biopsies can unmask complements (both C3 and C1q in immune-complexes mediated and complement-mediated diseases. This method showed good results on autopsy tissues archived for as long as 15 years.

  10. Evaluation of biostimulation and Tween 80 addition for the bioremediation of long-term DDT-contaminated soil.

    Science.gov (United States)

    Betancur-Corredor, Bibiana; Pino, Nancy J; Cardona, Santiago; Peñuela, Gustavo A

    2015-02-01

    The bioremediation of a long-term contaminated soil through biostimulation and surfactant addition was evaluated. The concentrations of 1,1,1-trichloro-2,2-bis(4-chlorophenyl) ethane (DDT) and its metabolites 1,1-dichloro-2,2-bis(4-chlorophenyl) ethane (DDD) and 1,1-dichloro-2,2-bis(4-chlorophenyl) ethylene (DDE) were monitored during an 8-week remediation process. Physicochemical characterization of the treated soil was performed before and after the bioremediation process. The isolation and identification of predominant microorganisms during the remediation process were also carried out. The efficiency of detoxification was evaluated after each bioremediation protocol. Humidity and pH and the heterotrophic microorganism count were monitored weekly. The DDT concentration was reduced by 79% after 8 weeks via biostimulation with surfactant addition (B+S) and 94.3% via biostimulation alone (B). Likewise, the concentrations of the metabolites DDE and DDD were reduced to levels below the quantification limits. The microorganisms isolated during bioremediation were identified as Bacillus thuringiensis, Flavobacterium sp., Cuprivadius sp., Variovorax soli, Phenylobacterium sp. and Lysobacter sp., among others. Analysis with scanning electron microscopy (SEM) allowed visualization of the colonization patterns of soil particles. The toxicity of the soil before and after bioremediation was evaluated using Vibrio fischeri as a bioluminescent sensor. A decrease in the toxic potential of the soil was verified by the increase of the concentration/effect relationship EC50 to 26.9% and 27.2% for B+S and B, respectively, compared to 0.4% obtained for the soil before treatment and 2.5% by natural attenuation after 8 weeks of treatment. Copyright © 2014. Published by Elsevier B.V.

  11. Utilización de coxibs: una estrategia de intervención en la atención primaria Prescription of cyclooxygenase-2 inhibitors: an intervention strategy in primary care

    Directory of Open Access Journals (Sweden)

    Isabel Rosich

    2005-06-01

    Full Text Available Objetivo: Evaluar una intervención dirigida a mejorar la prescripción de antiinflamatorios no esteroideos (AINE, fundamentalmente del grupo de los inhibidores de la ciclooxigenenasa-2 (coxibs. Sujetos y métodos: Estudio de intervención antes-después individual para médicos altamente prescriptores y grupal para el resto. Los datos sobre prescripción se obtuvieron del aplicativo de farmacia del Institut Català de la Salut. El período preintervención se comparó con el postintervención inmediato (que coincidió con la publicación de una alerta farmacológica sobre los efectos secundarios de los coxibs y tardío. Se controlaron el gasto de coxibs, la dosis diaria definida (DDD por 1.000 habitantes/día (DHD, el porcentaje DHD coxibs/total AINE, el porcentaje de AINE recomendados/total AINE, y el coste medio diario de la DDD de AINE. Resultados: La reducción media mensual del gasto en coxibs fue de 19.480 €/mes en el período postintervención inmediato y de 18.555 e/mes en el tardío. La disminución de la DHD de coxibs fue del 35,4% (p Objective: To evaluate an intervention designed to rationalize prescription of nonsteroidal anti-inflammatory drugs (NSAIDs, especially cyclooxygenase-2 inhibitors (COXIBs. Subjects and methods: We performed a before-after intervention study. Face-to-face educational outreach visits were conducted in general practitioners who were heavy prescribers and group intervention for the remaining. Data on prescribing habits were obtained from the pharmacy database of the Catalan Health Institute. The pre-intervention period (period 1 was compared with the immediate postintervention period (period 2, which coincided with the publication of a safety alert on the adverse effects of COXIBs and the late postintervention period (period 3. The data monitored were: a expenditure due to COXIBs; b consumption in daily defined doses (DDD per 1,000 habitants/day (DHD; c the percentage of COXIBs/total NSAIDs and the

  12. Assessment of selected contaminants in streambed- and suspended-sediment samples collected in Bexar County, Texas, 2007-09

    Science.gov (United States)

    Wilson, Jennifer T.

    2011-01-01

    large ranges and standard deviations associated with the concentrations measured in all three areas, the trace element concentrations are similar. On the basis of Mann-Whitney U test results, the presence of a military installation in a watershed was associated with statistically significant higher chromium, mercury, and zinc concentrations in streambed sediments compared to concentrations of the same elements in a watershed without a military installation. Halogenated organic compounds analyzed in sediment samples included pesticides (chlordane, dieldrin, DDT, DDD, and DDE), polychlorinated biphenyls (PCBs), and brominated flame retardants. Three or more halogenated organic compounds were detected in each sediment sample, and 66 percent of all concentrations were less than the respective interim reporting levels. Halogenated organic compound concentrations were mostly low compared to consensus-based sediment quality guidelines-;TECs were exceeded in 11 percent of the analyses and PECs were exceeded in 1 percent of the analyses. Chlordane compounds were the most frequently detected halogenated organic compounds with one or more detections of chlordane compounds in every watershed; concentrations were greater than the TEC in 6 percent of the samples. Dieldrin was detected in 50 percent of all samples, however all concentrations were much less than the TEC. The DDT compounds (p,p'-DDT, p,p'-DDD, and p,p'-DDE) were detected less frequently than some other halogenated organic compounds, however most detections exceeded the TECs. p,p'-DDT was detected in 13 percent of the samples (TEC exceeded in 67 percent); p,p'-DDD was detected in 19 percent of the samples (TEC exceeded in 78 percent); and p,p'-DDE was detected in 35 percent of the samples (TEC exceeded in 53 percent). p,p'-DDE concentrations in streambed-sediment samples correlate positively with population density and residential, commercial, and transportation land use. One or more PCB congeners were detected in

  13. Residuos de plaguicidas organoclorados en Rhizophora mangle y Avicennia germinans en la Ciénaga Grande de Santa Marta, Caribe Colombiano

    Directory of Open Access Journals (Sweden)

    Espinosa Luisa F.

    1998-06-01

    Full Text Available Residues of the organochlorine compounds lindane, heptachlor, aldrin, pp'DDE, pp'DDD y pp'DDT were determined in leaves of two species of mangrove (Rhízophora mangle and Avícennía germínans from the Ciénaga Grande de Santa Marta. Samples were made quarterly (between March and December 1993, at tour stations at the Ciénaga and at one station in Bahía de Chengue (Parque Nacional Natural Tayrona. Measurements were made usinq gas-liquid chromatography. In both ecosystems the two species are accumulating all the six cornpounds analyzed, as well as other indeterminate organochlorines. The greatest concentrations were found for lindane with maximum values of 15,9 ng/g (dry weight. For lindane, heptachlor and aldrin the concentrations were significantly different only between climatic periods. The highest concentrations were obtained for the dry season. The concentration factor by species was calculated and it was determined that the mangroves are accumulating organochlorine compounds in greatest proportion from sedimento.Se determinaron los contenidos de residuos de los plaguicidas organoclorados lindano, heptacloro, aldrin, pp'DDE, pp'DDD Y pp'DDT en hojas de dos especies de mangle (Rhízophora mangle y Avícennía germínans de la Ciénaga Grande de Santa Marta. Se recolectaron muestras trimestralmente (entre marzo y diciembre de 1993 en cuatro estaciones en la Ciénaga y en una estación de la Bahía de Chengue, Parque Nacional Natural Tayrona. Las determinaciones se hicieron por cromatografía gas-líquido. Se encontró que en los dos ecosistemas las dos especies de mangle están acumulando los seis compuestos analizados, además de otros compuestos organoclorados indeterminados. Las mayores concentraciones fueron las de lindano, con valores máximos de 15.9 ng/g (peso seco. Solo se encontraron diferencias significativas entre las épocas climáticas para las concentraciones de lindano, heptacloro y aldrin. Las mayores concentraciones se

  14. Effects of a chemical plant on surface water, illustrated by the example of the chemical plant at Berlin-Adlershof/Gruenau. Vol.3 in the series: Site profiles of persistent chlorinated hydrocarbons - cause-oriented monitoring in aquatic media; Auswirkungen eines Chemiestandortes auf umliegende Gewaesser dargestellt am Beispiel der chemischen Fabrik in Berlin-Adlershof/Gruenau. Bd. 3 der Reihe: Standortprofile persistenter chlorierter Kohlenwasserstoffe - ursachenorientiertes Monitoring in aquatischen Medien

    Energy Technology Data Exchange (ETDEWEB)

    Heinisch, E.; Kettrup, A.; Bergheim, W.; Wenzel, S.

    2002-06-01

    Primary data which were obtained on the basis of official surveys by the Senatsverwaltung fuer Stadtentwicklung/Fischereiamt des Landes Berlin for sDDT ({sigma} DDT, DDE, DDD, DDMU), sHCH ({sigma}{alpha}-, {beta}-, {gamma}-, {delta}-, {epsilon}-HCH), sPCB ({sigma} Cong. 28, 52, 101, 138, 153, 180) and HCB in surface water, surface sediment, suspended matter, breams (Abramis brama) and eels (Anguilla anguilla) a cause-oriented monitoring was elaborated concerning the load of waters of Berlin for the period 1983-2000. The structuring of the data consolidated statistically was made according to longitudinal profiles (Teltowkanal from the entrance to the Griebnitzsee, Spree-Oder-System from Seddinsee via Ober-, Stadt- and Unterspree to the mouth into the Havel in Spandau, the Havel from Niederneuendorfer See till Suedliche Unterhavel, the lakes in Grunewald till the city area in Charlottenburg, the lakes in the north of Berlin) as well as time series. The chemical enterprise in Adlershof/Gruenau which produced DDT containing preparations till 1985 and lindane containing preparations till 1989 was identified as the outstanding source of sDDT and sHCH loads. (orig.) [German] Auf der Basis amtlicher Erhebungen durch die Senatsverwaltung fuer Stadtentwicklung/Fischereiamt des Landes Berlin gewonnene Primaerdaten von sDDT ({sigma} DDT, DDE, DDD, DDMU), sHCH ({sigma}{alpha}-, {beta}-, {gamma}-, {delta}-, {epsilon}-HCH), sPCB ({sigma} Kong. 28, 52, 101, 138, 153, 180) und HCB in Oberflaechenwasser, Oberflaechensediment, Schwebstoffen, Brassen/Bleien (Abramis brama) und Aalen (Anguilla anguilla) wurde ein ursachenorientiertes Monitoring ueber die Belastung Berliner Gewaesser erarbeitet, das den Zeitraum von 1983-2000 umfasst. Die Strukturierung der statistisch aufgearbeiteten Werte erfolgte einmal nach Laengsprofilen (Teltowkanal von der Einfahrt bis zum Griebnitzsee, Spree-Oder-System vom Seddinsee ueber die Ober-, Stadt- und Unterspree bis zur Muendung in die Havel in

  15. Social inequalities in use of potentially addictive drugs in Norway – use among disability pensioners

    Directory of Open Access Journals (Sweden)

    Ingeborg Hartz

    2010-01-01

    Full Text Available Objectives: The Norwegian Government urges that actions are needed to stimulate the working capacity in disability pensioners (DPs with such a potential. Information on factors that may impair rehabilitation efforts, including use of potentially addictive drugs, may be useful in this context. Thus, the aim was to study the association between DP on initiation as well as long-term use of benzodiazepines (BZDs, and to describe aspects of problematic use of BZDs in terms of: long-term use pattern, including escalation of dose over time, and use of other potentially addictive drugs.Methods: We followed a cohort of 8,942 men and 10,578 women aged 40, 45, 60 years (non-users of BZDs at baseline, who participated in health surveys in 2000-01 in three Norwegian counties, with respect to use of BZDs, and other potentially addictive drugs, by linkage to the Norwegian Prescription Database (NorPD for 2004-2007. Information on DP status was retrieved from Statistics Norway.Results: Incident BZD use was highest among female DPs; 18-20% compared to 5-8% of the non-DPs. Multivariable analyses revealed an independent effect of DP on incident (OR 1.6 (95% CI 1.4-2.0 and long-term use (OR 2.47 (95% CI 1.90-3.20 of BZDs. Among incident users, 51-60% of the DPs retrieved BZDs throughout the period 2004-07, as compared to 32-33% of the non-DPs. The annual median defined daily doses (DDDs of BZDs among long-term users increased throughout the period 2004-07, most pronounced in the youngest DPs; from 50 (interquartile range (IQR 14,140 DDD to 205 (IQR 25,352 DDD.Conclusions: The chance of being prescribed BZDs as well as becoming a long-term user was higher among DPs. High continuation rates, with a steadily increasing annual amount of use among the long term users may reflect an unfavourable use pattern of potentially addictive drugs among DPs, most worrisome among the youngest.

  16. Patterns of prescription antihypertensive drug utilization and adherence to treatment guidelines in the city of Novi Sad.

    Science.gov (United States)

    Tomas, Ana; Tomić, Zdenko; Milijasević, Boris; Ban, Milica; Horvat, Olga; Vukmirović, Sasa; Sabo, Ana

    2016-06-01

    Hypertension is one of the leading causes of cardiovascular morbidity and mortality and more than a half of all health insurance expenditures for reimbursed medicines are allocated to antihypertensive drugs in Serbia. The aim of this study was to identify the antihypertensive drug utilization patterns among hypertensive outpatients in the city of Novi Sad, Serbia, determine the adherence to clinical guidelines and address the economic aspects of current prescribing practices. This retrospective observational study was conducted in Novi Sad over a period of six months. The data on the number of packages, size their, and retail price of antihypertensives issued on prescription in outpatients with the diagnosis of essential arterial hypertension was collected from all state-owned pharmacies in Novi Sad. Drug consumption was analyzed using the Anatomical Therapeutic Chemical (ATC)/ defined daily dose (DDD) methodology. Total consumption of antihypertensives issued on prescription over a 6-month period in the city of Novi sad, Serbia was 283.48 DDD per 1,000 inhabitans per day (DID). Angiotensin converting enzyme inhibitors (ACEi) were most commonly prescribed drugs, and were used 3 times more often than calcium channel blockers and 5 times more than beta-blockers. The consumption of diuretics and angiotensin receptor antagonists was low within all the groups of outpatients. Both national and international guidelines state superiority and effectiveness of diuretics in treatment of hypertension in the elderly, but their consumption was unreasonable low despite the fact that over 70% of all antihypertensive drugs in the city of Novi Sad were dispensed in people aged > 60. The use of more expensive ACEi was observed despite the guidelines deeming all the drugs of this class equally effective in treatment of hypertension. Large differences in utilization of different groups of antihypertensive agents were noted in this study. Underutilization of valuable, efficacious, and

  17. Effects of Carbapenem consumption on the prevalence of Acinetobacter infection in intensive care unit patients.

    Science.gov (United States)

    Ogutlu, Aziz; Guclu, Ertugrul; Karabay, Oguz; Utku, Aylin Calica; Tuna, Nazan; Yahyaoglu, Mehmet

    2014-01-09

    The consumption of carbapenems has increased worldwide, together with the increase in resistant gram negative bacilli. Subsequently, the prevalence of carbapenem-resistant Acinetobacter infections has increased rapidly and become a significant problem particularly in intensive care unit patients. The aim of the present study was to evaluate the changes in the prevalence of Acinetobacter infection by restricting the consumption of carbapenems in intensive care unit patients. This study was conducted between May 1, 2011 and February 28, 2013. The amount of carbapenem consumption and the number of patients with multi-drug resistant Acinetobacter baumannii (MDRAB) isolates during the study period were retrospectively obtained from the records of the patients, who were hospitalized in the intensive care unit. The study period was divided into two periods named as: Carbapenem non-restricted period (CNRP) and carbapenem-restricted period (CRP). During CNRP, no restrictions were made on the use of carbapenems. During CRP, the use of carbapenems was not allowed if there was an alternative to carbapenems. Primary Endpoint: MDRAB infection after ICU admission. The definition of nosocomial infections related to Acinetobacter spp. was based on the criteria of the Center for Disease Control (CDC). The correlation between the amount of carbapenem consumption and the number of infections with MDRAB strains between the two periods were evaluated. During the study period, a total of 1822 patients' (1053 patients in CNRP and 769 patients in CRP) records were evaluated retrospectively. A total of 10.82 defined daily dose (DDD/100 ICU days) of anti-pseudomonal carbapenem were used in CNRP, and this figure decreased to 6.95 DDD/100 ICU days in CRP. In the 8-month CNRP, 42 (3.98%) MDRAB-related nosocomial infections were detected, and 14 (1.82%) infections were detected in CRP (p = 0.012). The prevalence of MDRAB strains isolated in the CNRP was 2.24-fold higher than the prevalence in

  18. Photocatalytic degradation of p,p'-DDT under UV and visible light using interstitial N-doped TiO₂.

    Science.gov (United States)

    Ananpattarachai, Jirapat; Kajitvichyanukul, Puangrat

    2015-01-01

    1,1,1-trichloro-2,2-bis(p-chlorophenyl)ethane (or p,p'-DDT) is one of the most persistent pesticides. It is resistant to breakdown in nature and cause the water contamination problem. In this work, a major objective was to demonstrate the application of N-doped TiO2 in degradation and mineralization of the p,p'-DDT under UV and visible light in aqueous solution. The N-doped TiO2 nanopowders were prepared by a simple modified sol-gel procedure using diethanolamine (DEA) as a nitrogen source. The catalyst characteristics were investigated using XRD, SEM, TEM, and XPS. The adsorption and photocatalytic oxidation of p,p'-DDT using the synthesized N-doped TiO2 under UV and visible light were conducted in a batch photocatalytic experiment. The kinetics and p,p'-DDT degradation performance of the N-doped TiO2 were evaluated. Results show that the N-doped TiO2 can degrade p,p'-DDT effectively under both UV and visible lights. The rate constant of the p,p'-DDT degradation under UV light was only 0.0121 min(-1), whereas the rate constant of the p,p'-DDT degradation under visible light was 0.1282 min(-1). Under visible light, the 100% degradation of p,p'-DDT were obtained from N-doped TiO2 catalyst. The reaction rate of p,p'-DDT degradation using N-doped TiO2 under visible light was sixfold higher than that under UV light. According to Langmuir-Hinshelwood model, the adsorption equilibrium constant (K) for the N-doped TiO2 under visible light was 0.03078 L mg(-1), and the apparent reaction rate constant (k) was 1.3941 mg L(-1)-min. Major intermediates detected during the p,p'-DDT degradation were p,p'-DDE, o,p'-DDE, p,p'-DDD and p,p'-DDD. Results from this work can be applied further for the breakdown of p,p'-DDT molecule in the real contaminated water using this technology.

  19. Estradiol and endocrine disrupting compounds adversely affect development of sea urchin embryos at environmentally relevant concentrations

    International Nuclear Information System (INIS)

    Roepke, Troy A.; Snyder, Mark J.; Cherr, Gary N.

    2005-01-01

    Environmental endocrine disrupting compounds (EDCs) are a wide variety of chemicals that typically exert effects, either directly or indirectly, through receptor-mediated processes, thus mimicking endogenous hormones and/or inhibiting normal hormone activities and metabolism. Little is known about the effects of EDCs on echinoderm physiology, reproduction and development. We exposed developing sea urchin embryos (Strongylocentrotus purpuratus and Lytechinus anamesus) to two known EDCs (4-octylphenol (OCT), bisphenol A (BisA)) and to natural and synthetic reproductive hormones (17β-estradiol (E 2 ), estrone (E 1 ), estriol (E 3 ), progesterone (P 4 ) and 17α-ethynylestradiol (EE 2 )). In addition, we studied two non-estrogenic EDCs, tributyltin (TBT) and o,p-DDD. Successful development to the pluteus larval stage (96 h post-fertilization) was used to define EDC concentration-response relationships. The order of compound potency based on EC 50 values for a reduction in normal development was as follows: TBT L.anamesus > OCT > TBT S. p urpuratus >> E 2 > EE 2 > DDD >> BisA > P 4 > E 1 >> E 3 . The effect of TBT was pronounced even at concentrations substantially lower than those commonly reported in heavily contaminated areas, but the response was significantly different in the two model species. Sea urchin embryos were generally more sensitive to estrogenic EDCs and TBT than most other invertebrate larvae. Stage-specific exposure experiments were conducted to determine the most sensitive developmental periods using blastula, gastrula and post-gastrula (pluteus) stages. The stage most sensitive to E 2 , OCT and TBT was the blastula stage with less overall sensitivity in the gastrula stage, regardless of concentration. Selective estrogen receptor modulators (SERMs) were added to the experiments individually and in combination with estrogenic EDCs to interfere with potential receptor-mediated actions. Tamoxifen, a partial ER agonist, alone inhibited development at

  20. Novel Chryseobacterium sp. PYR2 degrades various organochlorine pesticides (OCPs) and achieves enhancing removal and complete degradation of DDT in highly contaminated soil.

    Science.gov (United States)

    Qu, Jie; Xu, Yang; Ai, Guo-Min; Liu, Ying; Liu, Zhi-Pei

    2015-09-15

    Long term residues of organochlorine pesticides (OCPs) in soils are of great concerning because they seriously threaten food security and human health. This article focuses on isolation of OCP-degrading strains and their performance in bioremediation of contaminated soil under ex situ conditions. A bacterium, Chryseobacterium sp. PYR2, capable of degrading various OCPs and utilizing them as a sole carbon and energy source for growth, was isolated from OCP-contaminated soil. In culture experiments, PYR2 degraded 80-98% of hexachlorocyclohexane (HCH) or 1,1,1-trichloro-2,2-bis (4-chlorophenyl) ethane (DDT) isomers (50 mg L(-1)) in 30 days. A pilot-scale ex situ bioremediation study of highly OCP-contaminated soil augmented with PYR2 was performed. During the 45-day experimental period, DDT concentration was reduced by 80.3% in PYR2-augmented soils (35.37 mg kg(-1) to 6.97 mg kg(-1)) but by only 57.6% in control soils. Seven DDT degradation intermediates (metabolites) were detected and identified in PYR2-augmented soils: five by GC/MS: 1,1-dichloro-2,2-bis (4-chlorophenyl) ethane (DDD), 1,1-dichloro-2,2-bis (4-chlorophenyl) ethylene (DDE), 1-chloro-2,2-bis (4-chlorophenyl) ethylene (DDMU), 1-chloro-2,2-bis (4-chlorophenyl) ethane (DDMS), and dichlorobenzophenone (DBP); and two by LC/MS: 4-chlorobenzoic acid (PCBA) and 4-chlorophenylacetic acid (PCPA). Levels of metabolites were fairly stable in control soils but varied greatly with time in PYR2-augmented soils. Levels of DDD, DDMU, and DDE in PYR2-augmented soils increased from day 0 to day 30 and then decreased by day 45. A DDT biodegradation pathway is proposed based on our identification of DDT metabolites in PYR2-augmented systems. PYR2 will be useful in future studies of OCP biodegradation and in bioremediation of OCP-contaminated soils. Copyright © 2015 Elsevier Ltd. All rights reserved.

  1. Multidrug-resistant Enterobacteriaceae including metallo-β-lactamase producers are predominant pathogens of healthcare-associated infections in an Indian teaching hospital

    Directory of Open Access Journals (Sweden)

    J B Sarma

    2011-01-01

    Full Text Available Purpose: A study was carried out in an Indian teaching hospital in 2009 to detect the rate of surgical site infections (SSI and peripheral vascular access site infections. Materials and Methods: The study was a point-prevalence study involving over 300 patients. The presence of infection was determined according to the CDC criteria. Swabs were taken from the infected sites and identification and sensitivity were carried out using VITEK® 2 automated system. Characterisation of β-lactamase was carried out at ARRML, Colindale, London. Results: The rate of SSI was 15% for the clean and clean-contaminated categories while that for the dirty contaminated category was 85% (NNIS risk index 0. Cultures yielded definite or probable pathogens from 64% (9/14 of the patients with SSI. In 1/3 rd of the cultures, Staphylococcus aureus was grown and the rest had Enterobacteriaceae, either extended-spectrum β-lactamase (ESBL producers or Amp-C hyperproducers and, alarmingly, three isolates were positive for newly recognised New Delhi metallo-β-lactamase-1 (NDM-1. In medicine, 87% (n = 99 of the patients had a peripheral IV access device, 55% developed associated phlebitis/infection and, in seven, probable pathogens were isolated (Candida species and Escherichia coli producing ESBL and NDM-1, respectively, Staphylococcus aureus and Enterococcus faecium. All ESBL and metallo-β-lactamase producers were resistant to multiple classes of antimicrobials, the latter being sensitive only to colistin and tigecycline. The study also found that all post-operative patients were on antibiotics, 92% on IV [213 defined daily doses (DDD/100 post-op patients] limited mainly to the third-generation cephalosporins (26% and aminoglycosides (24% and imidazole derivatives (30%. In medicine, 83% (n = 82 were on IV antibiotics (123 DDD/100 bed-days, limited mainly to the third-generation cephalosporins (74%. Conclusion: Indiscriminate use of antibiotics is a major problem

  2. Influência da polinização com variedades de laranja-doce sobre o número de sementes de tangelo Nova Pollination influence of sweet orange varieties on 'Nova tangelo' seeds production

    Directory of Open Access Journals (Sweden)

    Aline Enila Ferraro

    2006-08-01

    Full Text Available O objetivo deste trabalho foi estudar a influência da polinização sobre o número de sementes de tangelo Nova. O experimento foi conduzido no Pólo de Desenvolvimento Tecnológico dos Agronegócios do Sudoeste Paulista/DDD, em Capão Bonito (SP, na safra 2004-2005. Flores de plantas de tangelo Nova, com nove anos, foram tratadas durante o florescimento em 2004, como segue: 1. Polinização com laranja Valência; 2. Polinização com laranja Natal; 3. Polinização com laranja Pêra; 4. Isolamento de flores emasculadas; 5. Isolamento de flores completas, e 6. Testemunha (flor livre. Em maio de 2005, os frutos foram colhidos. Embora não tenha existido diferença estatística entre os resultados, em valores absolutos, a maior porcentagem de frutos colhidos foi observada no tratamento com laranja Pêra (42%. Nos tratamentos 4 e 5 não houve frutos colhidos, o que sugere que este tangelo não desenvolveu frutos partenocárpicos nas condições deste estudo. Nos tratamentos com polinização cruzada, observaram-se entre 20 e 23 sementes nos frutos, o que mostra a influência da polinização nas características dos frutos. Não se observaram diferenças significativas nas qualidades do fruto.The objective of this work was to study the pollination influence on Nova tangelo seed production. The experiment was carried out in the Pólo de Desenvolvimento Tecnológico dos Agronegócios do Sudoeste Paulista/DDD, Capão Bonito, SP, Brazil, during 2004/2005 crop. Nine years old flowers of Nova tangelo plants were treated as follows: 1. Valencia sweet orange pollination; 2. Natal sweet orange pollination; 3. Pera sweet orange pollination; 4. emasculated flower isolation; 5. complete flower isolation and 6. Check (free flower. In May 2005, the fruits were harvested. The highest harvested fruits percentage was obtained in Pera sweet orange treatment (42%. No fruits were obtained in treatments 4 and 5, suggesting that this tangelo did not develop

  3. Comparison of total disc replacement with lumbar fusion: a meta-analysis of randomized controlled trials

    International Nuclear Information System (INIS)

    Nie, H.

    2015-01-01

    A meta-analysis was performed to evaluate whether a beneficial clinical effect of the Total Disc Replacement (TDR) over lumbar fusion for the treatment of patients with Degenerative Disc Disease (DDD). An electronic search of PubMed, Cochrane Central Register of Controlled Trials, and EMBASE from their inception to 2012 was completed, and we assessed risk bias and retrieved relevant data, and meta-analysis was performed, if appropriate. Oswestry Disability Index (ODI), Visual Analog Score (VAS), patient satisfaction or VAS patient satisfaction, narcotic use, overall success rate, reoperation rate, work status, surgery again, complications and radiographic outcomes were evaluated. Six RCTs were included in this meta-analysis. At 2 years, TDR was demonstrated to be more beneficial for patients compared to lumbar fusion in the following outcomes, including ODI scores (MD: -4.87, 95% CI: -7.77 to -1.97, p=0.001), patient satisfaction (OR:1.91, 95% CI: 1.27 to 2.86, p=0.002) and VAS patient satisfaction (MD:9.10, 95% CI: 3.20 to 14.99, p=0.002), the percentage of using narcotics (OR=0.54, 95%CI: 0.31 to 0.96, p=0.03), overall success rate (OR:1.68, 95% CI: 1.26 to 2.25, p=0.005), the rate of patients to chose the same surgical treatment again (OR:2.38, 95% CI: 1.72 to 3.28, p < 0.001), and complications (OR=0.50, 95% CI: 0.29 to 0.84, p=0.008). Other outcomes, including re-operation rate (OR:0.62, 95% CI: 0.36 to 1.06, p=0.08) and work status (OR=1.05, 95% CI: 0.75 to 1.47, p=0.80), were demonstrated to be no differences between the two groups. In a long-term of follow-up (2 years), TDR shows a significant superiority for the treatment of lumbar DDD compared with fusion. (author)

  4. A case report of motor neuron disease in a patient showing significant level of DDTs, HCHs and organophosphate metabolites in hair as well as levels of hexane and toluene in blood

    International Nuclear Information System (INIS)

    Kanavouras, Konstantinos; Tzatzarakis, Manolis N.; Mastorodemos, Vasileios; Plaitakis, Andreas; Tsatsakis, Aristidis M.

    2011-01-01

    Motor neuron disease is a devastating neurodegenerative condition, with the majority of sporadic, non-familial cases being of unknown etiology. Several epidemiological studies have suggested that occupational exposure to chemicals may be associated with disease pathogenesis. We report the case of a patient developing progressive motor neuron disease, who was chronically exposed to pesticides and organic solvents. The patient presented with leg spasticity and developed gradually clinical signs suggestive of amyotrophic lateral sclerosis, which was supported by the neurophysiologic and radiological findings. Our report is an evidence based case of combined exposure to organochlorine (DDTs), organophosphate pesticides (OPs) and organic solvents as confirmed by laboratory analysis in samples of blood and hair confirming systematic exposure. The concentration of non-specific dialkylphosphates metabolites (DAPs) of OPs in hair (dimethyphopshate (DMP) 1289.4 pg/mg and diethylphosphate (DEP) 709.4 pg/mg) and of DDTs (opDDE 484.0 pg/mg, ppDDE 526.6 pg/mg, opDDD 448.4 pg/mg, ppDDD + opDDT 259.9 pg/mg and ppDDT 573.7 pg/mg) were considerably significant. Toluene and n-hexane were also detected in blood on admission at hospital and quantified (1.23 and 0.87 μg/l, respectively), while 3 months after hospitalization blood testing was found negative for toluene and n-hexane and hair analysis was provided decrease levels of HCHs, DDTs and DAPs. -- Highlights: ► Exposure to pesticides and organic solvents might be a risk factor for sporadic MND. ► We report a patient who developed progressive upper and lower motor neuron disease. ► The patient had a history of occupational exposure to pesticides and solvents. ► High DDTs’ levels and increased levels of DMP and DEP were measured in his hair. ► The patients’ exposure to chemicals might have played a role in MND development.

  5. Dislocation-cavity interaction in Fe: a comparison between molecular dynamics and dislocation dynamics

    International Nuclear Information System (INIS)

    Hafez Haghighat, S.M.; Schaeublin, R.; Fivel, M.C.

    2007-01-01

    Full text of publication follows: multi-scale modeling, including molecular dynamics (MD) and discrete dislocation dynamics (DDD) methods, appears as a significant tool for the description of plasticity and mechanical properties of materials. This research is on the investigation of the subsequence effects of irradiation on the plasticity of pure Fe and focuses on the interaction of a single dislocation and a spherical cavity, as void or He bubble. Extensive MD simulations of the interaction under imposed strain rate [1, 2] have shown that various temperatures and cavity sizes result in different release stresses depending on dislocation bow out. It appears that a temperature increase and cavity size decrease reduce the cavity strength. MD simulation shows that the elastic field around the cavity is largely anisotropic. This anisotropy may influence the way the dislocation unpins from the cavity. Following the MD simulations, the interaction of a single dislocation and a spherical cavity is now simulated using a DDD discrete dislocation dynamics model. The simulation accounts for the non-Schmidt effect induced by the bcc structure of Fe through local rules derived from MD simulations [3]. The cavity is introduced in the simulation by computing the image forces using a finite element technique. The effective stress applied on the dislocation is then obtained as the superimposition of the applied stress field, the image stress field and the internal stresses. Note that such a model only uses elasticity theory and no core effect of dislocations is taken into account. One of the objectives of this work is to check whether elasticity is responsible of the behaviour observed by MD. Several cases are tested. First an edge dislocation in a (110) plane is pushed against the cavity under a pure shear loading. The local reaction of the dislocations and the cavity are compared to the MD simulations. Then, the case of a screw dislocation is studied. Finally, other loading

  6. Treatment outcomes of a stage 1 cognitive-behavioral trial to reduce alcohol use among human immunodeficiency virus-infected out-patients in western Kenya.

    Science.gov (United States)

    Papas, Rebecca K; Sidle, John E; Gakinya, Benson N; Baliddawa, Joyce B; Martino, Steve; Mwaniki, Michael M; Songole, Rogers; Omolo, Otieno E; Kamanda, Allan M; Ayuku, David O; Ojwang, Claris; Owino-Ong'or, Willis D; Harrington, Magdalena; Bryant, Kendall J; Carroll, Kathleen M; Justice, Amy C; Hogan, Joseph W; Maisto, Stephen A

    2011-12-01

    Dual epidemics of human immunodeficiency virus (HIV) and alcohol use disorders, and a dearth of professional resources for behavioral treatment in sub-Saharan Africa, suggest the need for development of culturally relevant and feasible interventions. The purpose of this study was to test the preliminary efficacy of a culturally adapted six-session gender-stratified group cognitive-behavioral therapy (CBT) intervention delivered by paraprofessionals to reduce alcohol use among HIV-infected out-patients in Eldoret, Kenya. Randomized clinical trial comparing CBT against a usual care assessment-only control. A large HIV out-patient clinic in Eldoret, Kenya, part of the Academic Model for Providing Access to Healthcare collaboration. Seventy-five HIV-infected out-patients who were antiretroviral (ARV)-initiated or ARV-eligible and who reported hazardous or binge drinking. Percentage of drinking days (PDD) and mean drinks per drinking days (DDD) measured continuously using the Time line Follow back method. There were 299 ineligible and 102 eligible out-patients with 12 refusals. Effect sizes of the change in alcohol use since baseline between the two conditions at the 30-day follow-up were large [d=0.95, P=0.0002, mean difference=24.93, 95% confidence interval (CI): 12.43, 37.43 PDD; d=0.76, P=0.002, mean difference=2.88, 95% CI: 1.05, 4.70 DDD]. Randomized participants attended 93% of the six CBT sessions offered. Reported alcohol abstinence at the 90-day follow-up was 69% (CBT) and 38% (usual care). Paraprofessional counselors achieved independent ratings of adherence and competence equivalent to college-educated therapists in the United States. Treatment effect sizes were comparable to alcohol intervention studies conducted in the United States. Cognitive-behavioral therapy can be adapted successfully to group paraprofessional delivery in Kenya and may be effective in reducing alcohol use among HIV-infected Kenyan out-patients. © 2011 The Authors, Addiction © 2011

  7. Determination of n-octanol/water partition coefficient for DDT-related compounds by RP-HPLC with a novel dual-point retention time correction.

    Science.gov (United States)

    Han, Shu-ying; Qiao, Jun-qin; Zhang, Yun-yang; Yang, Li-li; Lian, Hong-zhen; Ge, Xin; Chen, Hong-yuan

    2011-03-01

    n-Octanol/water partition coefficients (P) for DDTs and dicofol were determined by reversed-phase high performance liquid chromatography (RP-HPLC) on a C(18) column using methanol-water mixture as mobile phase. A dual-point retention time correction (DP-RTC) was proposed to rectify chromatographic retention time (t(R)) shift resulted from stationary phase aging. Based on this correction, the relationship between logP and logk(w), the logarithm of the retention factor extrapolated to pure water, was investigated for a set of 12 benzene homologues and DDT-related compounds with reliable experimental P as model compounds. A linear regression logP=(1.10±0.04) logk(w) - (0.60±0.17) was established with correlation coefficient R(2) of 0.988, cross-validated correlation coefficient R(cv)(2) of 0.983 and standard deviation (SD) of 0.156. This model was further validated using four verification compounds, naphthalene, biphenyl, 2,2-bis(4-chlorophenyl)-1,1-dichloroethane (p,p'-DDD) and 2,2-bis(4-chlorophenyl)-1,1-dichloroethene (p,p'-DDE) with similar structure to DDT. The RP-HPLC-determined P values showed good consistency with shake-flask (SFM) or slow-stirring (SSM) results, especially for highly hydrophobic compounds with logP in the range of 4-7. Then, the P values for five DDT-related compounds, 2-(2-chlorophenyl)-2-(4-chlorophenyl)-1,1,1-trichloroethane (o,p'-DDT), 2-(2-chlorophenyl)-2-(4-chlorophenyl)-1,1-dichloroethane (o,p'-DDD), 2-(2-chlorophenyl)-2-(4-chlorophenyl)-1,1-dichloroethene (o,p'-DDE), and 2,2,2-trichloro-1,1-bis(4-chlorophenyl)ethanol (dicofol) and its main degradation product 4,4'-dichlorobenzophenone (p,p'-DBP) were evaluated by the improved RP-HPLC method for the first time. The excellent precision with SD less than 0.03 proved that the novel DP-RTC protocol can significantly increases the determination accuracy and reliability of P by RP-HPLC. Copyright © 2011 Elsevier Ltd. All rights reserved.

  8. Indicaciones del meprobamato en personas de 60 años de edad y más en Ciudad de La Habana, 2000-2001

    Directory of Open Access Journals (Sweden)

    Ana Julia García Milian

    2003-12-01

    Full Text Available Teniendo en cuenta las evidencias de un consumo elevado del meprobamato (10,4 % de los pacientes de la tercera edad lo consumen y es el 4,2 % del total de los medicamentos consumidos por ellos, además de un aumento en el consumo nacional del medicamento expresado en DDD (1996-3,4 a 1999-4,2/1 000 habitantes. Se decidió realizar un estudio de utilización de medicamentos indicación-prescripción que permitiera identificar los diagnósticos más frecuentes que motivaron la prescripción del medicamento y las especialidades que lo prescriben en Ciudad de La Habana en el período de septiembre de 2000 a enero de 2001. Se encuestó el 86,6 % de la muestra y se identificó la indicación del meprobamato en 11 afecciones; la hipertensión arterial constituyó la más frecuente y la Medicina General Integral la especialidad que más lo prescribe. Se recomienda la realización de una intervención sobre hipertensión arterial en Atención Primaria de Salud y educar a la población en el tratamiento de dicha enfermedad, así como los usos y riesgos del meprobamato.Taking into account the evidences of an elevated consumption of meprobamate (10.4 % of the patients at the third age take it, and it accounts for 4.2 % of the total of drugs consumed by them, and an increase in the national consumption of the drug expressed in DDD (from 1996-3.4 to 1999-4.2/1 000 inhabitants, it was decided to carry out a study on the use of indication-prescription drugs that allowed to identify the most frequent diagnoses leading to the prescription of drugs and the specialties of the physicians prescribing it in Havana City, from September, 2000, to January, 2001. 86.6 % of the sample were surveyed and the indication of meprobamate was found in 11 affections. Arterial hypertension was the most common affection and General Comprehensive Medicine was the specialty prescribing it the most. It was recommended to make an intervention on arterial hypertension in Primary Health

  9. Estimación de la prevalencia de hipotiroidismo en España a partir del consumo de hormonas tiroideas (1996-1999

    Directory of Open Access Journals (Sweden)

    Morant Ginestar Consuelo

    2001-01-01

    Full Text Available Fundamento: Ante la escasez de datos acerca de la prevalencia de hipotiroidismo en España, se decide estimarla a través del consumo de su tratamiento específico, las hormonas tiroideas, utilizando la metodología de los estudios de utilización de medicamentos. Métodos: Cálculo de la Dosis Habitante Día (DHD de hormonas tiroideas (grupo terapéutico H03 de la Anatomical Therapeutic Chemical a través de la Dosis Diaria Definida (DDD, durante 1996 y 1999, en las distintas provincias de las Comunidades Autónomas de todo el territorio nacional. Se han calculado los intervalos de confianza al 95 % para las prevalencias estimadas en las comunidades autónomas y en el territorio nacional, así como los incrementos porcentuales de 1999 respecto a 1996. Los datos de las prescripciones han sido facilitados por el Ministerio de Sanidad y Consumo. Resultados: Se estima una prevalencia nacional de hipotiroidismo para 1996, de 3,19 casos por 1.000 habitantes y para 1999, de 4,33 casos por 1000 habitantes; el incremento porcentual es de 26,38 %. Los resultados de la DHD muestran diferencias en la prevalencia entre provincias: Guadalajara presenta las cifras más altas en los dos años estudiados(5,02 y 7,01 casos por 1.000 habitantes/día en 1996 y 1999 respectivamente y Melilla, las más bajas (1,07 y 1,60 casos por 1.000 habitantes/día. En todas las provincias y comunidades autónomas se ha producido un incremento de la DHD en el año 1999 respecto al 1996. El incremento menor fue para Asturias (9,62 % y el más alto para La Rioja (35,26 %. Conclusiones: Los 3,19 y 4,33 DDD por 1.000 habitantes/día en 1996 y 1999 respectivamente, pueden ser interpretados como la prevalencia de hipotiroidismo diagnosticado y tratado. Estas cifras se hallan en el intervalo determinado por otros estudios, aunque las comparaciones entre estudios de diferente metodología deben hacerse con extremada precaución. El incremento observado en el consumo podría explicarse m

  10. Estimación de la prevalencia de hipotiroidismo en españa a partir del consumo de hormonas tiroideas (1996-1999

    Directory of Open Access Journals (Sweden)

    Consuelo Morant Ginestar

    2001-01-01

    Full Text Available Fundamento: Ante la escasez de datos acerca de la prevalencia de hipotiroidismo en España, se decide estimarla a través del consumo de su tratamiento específico, las hormonas tiroideas, utilizando la metodología de los estudios de utilización de medicamentos. Métodos: Cálculo de la Dosis Habitante Día (DHD de hormonas tiroideas (grupo terapéutico H03 de la Anatomical Therapeutic Chemical a través de la Dosis Diaria Definida (DDD, durante 1996 y 1999, en las distintas provincias de las Comunidades Autónomas de todo el territorio nacional. Se han calculado los intervalos de confianza al 95 % para las prevalencias estimadas en las comunidades autónomas y en el territorio nacional, así como los incrementos porcentuales de 1999 respecto a 1996. Los datos de las prescripciones han sido facilitados por el Ministerio de Sanidad y Consumo. Resultados: Se estima una prevalencia nacional de hipotiroidismo para 1996, de 3,19 casos por 1.000 habitantes y para 1999, de 4,33 casos por 1000 habitantes; el incremento porcentual es de 26,38 %. Los resultados de la DHD muestran diferencias en la prevalencia entre provincias: Guadalajara presenta las cifras más altas en los dos años estudiados(5,02 y 7,01 casos por 1.000 habitantes/ día en 1996 y 1999 respectivamente y Melilla, las más bajas (1,07 y 1,60 casos por 1.000 habitantes/día. En todas las provincias y comunidades autónomas se ha producido un incremento de la DHD en el año 1999 respecto al 1996. El incremento menor fue para Asturias (9,62 % y el más alto para La Rioja (35,26 %. Conclusiones: Los 3,19 y 4,33 DDD por 1.000 habitantes/ día en 1996 y 1999 respectivamente, pueden ser interpretados como la prevalencia de hipotiroidismo diagnosticado y tratado. Estas cifras se hallan en el intervalo determinado por otros estudios, aunque las comparaciones entre estudios de diferente metodología deben hacerse con extremada precaución. El incremento observado en el consumo podría explicarse

  11. Increased base rate of atrial pacing for prevention of atrial fibrillation after implantation of a dual-chamber pacemaker: insights from the Atrial Overdrive Pacing Study.

    Science.gov (United States)

    Kantharia, Bharat K; Freedman, Roger A; Hoekenga, David; Tomassoni, Gery; Worley, Seth; Sorrentino, Robert; Steinhaus, David; Wolkowicz, Joel M; Syed, Zaffer A

    2007-11-01

    Different pacing sites and various algorithms have been utilized to prevent atrial fibrillation (AF) in pacemaker recipients. However, the optimal pacing rate settings have not yet been established. In this randomized, prospective, multicentre, single-blinded, cross over study, rate-adaptive pacing at a high base rate (BR) in patients, age 60 years or above, or a history of paroxysmal AF, who underwent dual-chamber (DDD) pacemaker implantation for standard pacing indications, was evaluated for prevention of AF. In the study cohort of 145 patients implanted with DDD pacemakers with a programmable rest rate (RR) feature, the BR/RR settings were sequentially but randomly adjusted as follows: 60 bpm/Off for the baseline quarter (initial 3 months) and then to either 'A-B-C' or 'C-B-A' settings (A = 70/65 bpm, B = 70/Off, C = 80/65 bpm) for the subsequent quarters each of 3 months duration. Data on automatic mode switch episodes, device diagnostics, and a questionnaire evaluating pacemaker awareness and palpitations were collected. Ninety-nine patients, mean age 77 +/- 10 years, who completed the study protocol and followed for 12 months did not show significant differences in the number of mode switch episodes between any settings used. The percentage of atrial pacing was lower during baseline pacing compared to settings A, B, and C (P < 0.0001). Setting C produced a higher percentage of atrial pacing than A and B (P < 0.01). Although a higher percentage of atrial pacing correlated with a lower incidence of mode switch episodes, there was no statistically significant difference in the number of mode switch episodes between settings A, B, and C. There were no significant differences in the questionnaire scores relating to pacemaker awareness or palpitation. Overdrive single-site pacing in the right atrium achieved by programming analysed settings in the present study did not reduce AF as assessed by mode switch episodes. Additionally, no change in the symptoms of

  12. Insights about the process and impact of implementing nursing guidelines on delivery of care in hospitals and community settings

    Directory of Open Access Journals (Sweden)

    Ploeg Jenny

    2008-02-01

    Full Text Available Abstract Background Little is known about the impact of implementing nursing-oriented best practice guidelines on the delivery of patient care in either hospital or community settings. Methods A naturalistic study with a prospective, before and after design documented the implementation of six newly developed nursing best practice guidelines (asthma, breastfeeding, delirium-dementia-depression (DDD, foot complications in diabetes, smoking cessation and venous leg ulcers. Eleven health care organisations were selected for a one-year project. At each site, clinical resource nurses (CRNs worked with managers and a multidisciplinary steering committee to conduct an environmental scan and develop an action plan of activities (i.e. education sessions, policy review. Process and patient outcomes were assessed by chart audit (n = 681 pre-implementation, 592 post-implementation. Outcomes were also assessed for four of six topics by in-hospital/home interviews (n = 261 pre-implementation, 232 post-implementation and follow-up telephone interviews (n = 152 pre, 121 post. Interviews were conducted with 83/95 (87% CRN's, nurses and administrators to describe recommendations selected, strategies used and participants' perceived facilitators and barriers to guideline implementation. Results While statistically significant improvements in 5% to 83% of indicators were observed in each organization, more than 80% of indicators for breastfeeding, DDD and smoking cessation did not change. Statistically significant improvements were found in > 50% of indicators for asthma (52%, diabetes foot care (83% and venous leg ulcers (60%. Organizations with > 50% improvements reported two unique implementation strategies which included hands-on skill practice sessions for nurses and the development of new patient education materials. Key facilitators for all organizations included education sessions as well as support from champions and managers while key barriers were lack

  13. A case report of motor neuron disease in a patient showing significant level of DDTs, HCHs and organophosphate metabolites in hair as well as levels of hexane and toluene in blood

    Energy Technology Data Exchange (ETDEWEB)

    Kanavouras, Konstantinos [Department of Neurology, Medical School, University of Crete, Heraklion, Crete (Greece); Tzatzarakis, Manolis N. [Center of Toxicology Science and Research, University of Crete, Heraklion, Crete (Greece); Mastorodemos, Vasileios; Plaitakis, Andreas [Department of Neurology, Medical School, University of Crete, Heraklion, Crete (Greece); Tsatsakis, Aristidis M., E-mail: aris@med.uoc.gr [Center of Toxicology Science and Research, University of Crete, Heraklion, Crete (Greece)

    2011-11-15

    Motor neuron disease is a devastating neurodegenerative condition, with the majority of sporadic, non-familial cases being of unknown etiology. Several epidemiological studies have suggested that occupational exposure to chemicals may be associated with disease pathogenesis. We report the case of a patient developing progressive motor neuron disease, who was chronically exposed to pesticides and organic solvents. The patient presented with leg spasticity and developed gradually clinical signs suggestive of amyotrophic lateral sclerosis, which was supported by the neurophysiologic and radiological findings. Our report is an evidence based case of combined exposure to organochlorine (DDTs), organophosphate pesticides (OPs) and organic solvents as confirmed by laboratory analysis in samples of blood and hair confirming systematic exposure. The concentration of non-specific dialkylphosphates metabolites (DAPs) of OPs in hair (dimethyphopshate (DMP) 1289.4 pg/mg and diethylphosphate (DEP) 709.4 pg/mg) and of DDTs (opDDE 484.0 pg/mg, ppDDE 526.6 pg/mg, opDDD 448.4 pg/mg, ppDDD + opDDT 259.9 pg/mg and ppDDT 573.7 pg/mg) were considerably significant. Toluene and n-hexane were also detected in blood on admission at hospital and quantified (1.23 and 0.87 {mu}g/l, respectively), while 3 months after hospitalization blood testing was found negative for toluene and n-hexane and hair analysis was provided decrease levels of HCHs, DDTs and DAPs. -- Highlights: Black-Right-Pointing-Pointer Exposure to pesticides and organic solvents might be a risk factor for sporadic MND. Black-Right-Pointing-Pointer We report a patient who developed progressive upper and lower motor neuron disease. Black-Right-Pointing-Pointer The patient had a history of occupational exposure to pesticides and solvents. Black-Right-Pointing-Pointer High DDTs' levels and increased levels of DMP and DEP were measured in his hair. Black-Right-Pointing-Pointer The patients' exposure to chemicals might

  14. EuroEco (European Health Economic Trial on Home Monitoring in ICD Patients): a provider perspective in five European countries on costs and net financial impact of follow-up with or without remote monitoring.

    Science.gov (United States)

    Heidbuchel, Hein; Hindricks, Gerd; Broadhurst, Paul; Van Erven, Lieselot; Fernandez-Lozano, Ignacio; Rivero-Ayerza, Maximo; Malinowski, Klaus; Marek, Andrea; Romero Garrido, Rafael F; Löscher, Steffen; Beeton, Ian; Garcia, Enrique; Cross, Stephen; Vijgen, Johan; Koivisto, Ulla-Maija; Peinado, Rafael; Smala, Antje; Annemans, Lieven

    2015-01-14

    Remote follow-up (FU) of implantable cardiac defibrillators (ICDs) allows for fewer in-office visits in combination with earlier detection of relevant findings. Its implementation requires investment and reorganization of care. Providers (physicians or hospitals) are unsure about the financial impact. The primary end-point of this randomized prospective multicentre health economic trial was the total FU-related cost for providers, comparing Home Monitoring facilitated FU (HM ON) to regular in-office FU (HM OFF) during the first 2 years after ICD implantation. Also the net financial impact on providers (taking national reimbursement into account) and costs from a healthcare payer perspective were evaluated. A total of 312 patients with VVI- or DDD-ICD implants from 17 centres in six EU countries were randomised to HM ON or OFF, of which 303 were eligible for data analysis. For all contacts (in-office, calendar- or alert-triggered web-based review, discussions, calls) time-expenditure was tracked. Country-specific cost parameters were used to convert resource use into monetary values. Remote FU equipment itself was not included in the cost calculations. Given only two patients from Finland (one in each group) a monetary valuation analysis was not performed for Finland. Average age was 62.4 ± 13.1 years, 81% were male, 39% received a DDD system, and 51% had a prophylactic ICD. Resource use with HM ON was clearly different: less FU visits (3.79 ± 1.67 vs. 5.53 ± 2.32; P financial impact on providers [profit of €408 (327-489) vs. €400 (345-455); range for difference (€-104 to 88), NS], but there was heterogeneity among countries, with less profit for providers in the absence of specific remote FU reimbursement (Belgium, Spain, and the Netherlands) and maintained or increased profit in cases where such reimbursement exists (Germany and UK). Quality of life (SF-36) was not different. For all the patients as a whole, FU-related costs for providers are not

  15. Exploration of different methods for measuring DDT exposure among malaria vector-control workers in Limpopo Province, South Africa

    International Nuclear Information System (INIS)

    Dalvie, M.A.; Myers, J.E.; Thompson, M.L.; Robins, T.G.; Omar, Shaheed; Riebow, John

    2004-01-01

    DDT compounds are used in many developing countries, including South Africa, for the control of malaria vectors. This study investigated biological exposures among workers in relation to job history. A cross-sectional study of 59 workers at the Malaria Control Centre (MCC) in Tzaneen, South Africa, was performed. Tests included a job history questionnaire and the measurement of serum o'p' and p'p' isomers of DDE, DDT, and DDD, corrected for serum total lipids. Forty-seven (80%) workers donated a blood sample for the determination of serum DDT. The mean number of years worked at the MCC (malaria years) was 15.8±7.8 years and the mean serum DDT was 94.3±57.1 μg/g of lipid. There were no significant associations between short-to-medium-term serum DDT exposure measures (o'p'-DDE and o'p' and p'p' isomers of DDD and DDT) and malaria years. The long-term exposure measure, p'p'-DDE, was significantly associated with malaria years (β-circumflex=3.0±1.2 μg/g lipid/year; P=0.001; n=47; adjusted for age), but only 27% variance of p'p'-DDE was explained. Blood total DDT uncorrected for lipid content was strongly related to corrected levels (β-circumflex=0.74±0.48, P=0.00, R 2 =0.77), but uncorrected p'p'-DDE had a weaker association (β-circumflex=0.0024±0.0013, P=0.074; R 2 =0.53) with malaria years than did corrected levels (β-circumflex=0.042±0.017; P=0.016; R 2 =0.56). The results show that serum DDT levels for malaria vector-control workers in South Africa with a long-term spraying history are high. Job history information on DDT exposures must be very detailed in order to provide valid estimates of exposure

  16. Vigilancia del consumo de antimicrobianos en hospitales de México: situación actual y guía práctica para su implementación Surveillance of antimicrobial drug use in Mexican hospitals: current situation and practical guidelines for its implementation

    Directory of Open Access Journals (Sweden)

    Odalis Rodríguez-Ganen

    2012-11-01

    Full Text Available En México se han constatado un elevado consumo de antibióticos, su uso irracional en la atención primaria y altas tasas de resistencia en bacterias causantes de infecciones nosocomiales. Se hace necesario revisar la metodología recomendada para informar el consumo de antimicrobianos, de manera que la cuantificación se realice mediante estudios de utilización de medicamentos. Estos estudios, que permiten conocer los medicamentos utilizados en el hospital, requieren de una fuente de datos de consumo de antimicrobianos accesible y con el menor riesgo de sesgos, un sistema de identificación único para los fármacos y la adopción de unidades de medida extrapolables. Se propone usar la metodología elaborada por el Centro Colaborador de la Organización Mundial de la Salud para la Metodología Estadística de Medicamentos, basada en la clasificación anatómica, terapéutica y química (ATC y la dosis diaria definida (DDD. A pesar de sus limitaciones, el empleo de esta metodología para el monitoreo local del consumo de antimicrobianos permite detectar diferencias en los patrones de uso respecto a otras instituciones y, sobre todo, las tendencias dentro de una misma institución. Esto ayudaría a alertar oportunamente sobre posibles problemas en la utilización de antimicrobianos y la necesidad de implementar intervenciones específicas.Antibiotic use in Mexico is characterized by high levels of consumption, irrational use in primary care services, and high rates of bacterial resistance that cause hospital infections. Changes are needed in the recommended method for reporting antimicrobial drug use, so that quantification can be carried out through drug utilization studies. Such studies, which make it possible to know which drugs are used in hospitals, require an accessible source of data on antimicrobial drug use with the least risk of biases, a single drug identification system, and the adoption of units of measure that can be extrapolated

  17. Functional outcome transforaminal lumbar inter body fusion: an experience at a tertiary care centre

    International Nuclear Information System (INIS)

    Talha, M.; Qureshi, M.A.

    2016-01-01

    Objective: To assess functional outcome of transforaminal lumbar inter body fusion (TLIF) with specific reference to improvement in pain by visual analogue score (VAS) and Oswestry disability index (ODI). Study Design: Quasi-experimental study. Place and Duration of Study: The study was conducted at the Department of Spine Surgery of a tertiary care hospital in Rawalpindi from May 2004 to May 2013. Material and Methods: Thirty nine patients who underwent TLIF and completed one year of follow up in our department during the study period were included in the study. Cases were evaluated clinically and radiologically preoperatively and assessed for pain with VAS and general well being with ODI. After TLIF they were reassessed at 1, 3, 6 months and 1 year for improvement in VAS and ODI. Patient satisfaction and work status after surgery was also recorded at 1 year of follow up. Results: Out of 39 cases 19(48.7 percent) were operated for degenerated disc disease (DDD), 11(28.2 percent) for spinal stenosis and 7(17.9 percent) for spondylolisthesis and 2(5.2 percent) for trauma. A total of 28(71.79 percent) were males and 11(28.21 percent) were females. Common levels operated were 12 (30.8 percent) at L4-5, 11 (28.2 percent) at L5-S1, and 12(30.8 percent) at L4,5-S1, 2(5.1 percent) at L2-4 and 1(2.6 percent) each at L3-4 and L3-5. At 1 year of follow up median VAS score improved significantly from 7 to 2 and median ODI improved significantly from 76 to 34. Regarding patient satisfaction 26 (66.7 percent) patients were satisfied, 9 (23.1 percent) were partially satisfied and 4 (10.2 percent) were not satisfied with the surgical outcome. Conclusion: TLIF is a safe and effective procedure for reducing chronic low back pain as a result of DDD, instability and spondylolisthesis. (author)

  18. The effect of antibiotic use on prevalence of nosocomial vancomycin-resistant enterococci- an ecologic study

    Directory of Open Access Journals (Sweden)

    Cornelius Remschmidt

    2017-09-01

    Full Text Available Abstract Background Vancomycin-resistant enterococci (VRE are among the most common antimicrobial-resistant pathogens causing nosocomial infections. Although antibiotic use has been identified as a risk factor for VRE, it remains unclear which antimicrobial agents particularly facilitate VRE selection. Here, we assessed whether use of specific antimicrobial agents is independently associated with healthcare-associated (HA VRE rates in a university hospital setting in Berlin, Germany. Methods We conducted the study between January 2014 and December 2015 at the Charité-university hospital of Berlin, Germany. From the hospital pharmacy, we extracted data for all antibacterials for systemic use (anatomical therapeutic chemical (ATC-classification J01 and calculated ward specific antibiotic consumption in defined daily doses (DDDs per 100 patient-days (PD. We used the microbiology laboratory database to identify all patients with isolation of invasive or non-invasive VRE and calculated HA-VRE incidence as nosocomial VRE-cases per 100 patients and HA-VRE incidence density as nosocomial VRE-cases per 1000 PD. We defined VRE isolates as hospital-acquired if they were identified three days or later after hospital admission and otherwise as community-acquired (CA-VRE. We performed univariable and multivariable regression analyses to estimate the association of the frequency of HA-VRE per month with antibiotic use and other parameters such as length of stay, type of ward or presence of at least one CA-VRE on ward. In a second analysis, we considered only patients with VRE infections. Results We included data from 204,054 patients with 948,380 PD from 61 wards. Overall, 1430 VRE-cases were identified of which 409 (28.6% were considered hospital-acquired (HA. We found that carbapenem use in the current month and prior-month use of glycopeptides increased the risk for HA-VRE by 1% per 1 DDD/100 PD and 3% per 1 DDD/100 PD, respectively. However, when only VRE

  19. How much are biosimilars used in southern Italy?: a retrospective analysis of epoetin utilization in the local health unit of Messina in the years 2010-2011.

    Science.gov (United States)

    Loiacono, Chiara; Sgroi, Carmela; Coppolino, Salvatore; Cannata, Angelo; Ferrara, Rosarita; Arcoraci, Vincenzo; Cananzi, Pasquale; Savica, Vincenzo; Schuemie, Martijn; Caputi, Achille P; Trifirò, Gianluca

    2012-04-01

    Epoetins are one of the three biologics for which biosimilars are available in Italy. So far, there is a lack of Italian national/regional longitudinal data about epoetin use. The aim of this study was to evaluate the prescribing pattern of epoetins (reference products and biosimilars) in a Local Health Unit (LHU) of Southern Italy in recent years. A retrospective drug utilization study was conducted during the period 1 January 2010 - 31 May 2011. The data source was the dispensing database of the Messina LHU, which contains anonymized data about dispensed drugs (including epoetins) that are prescribed by specialists to the residents in the catchment area. Indication of use and prescribed dosage of epoetins were derived by the therapeutic plans filled in by specialists and linked to drug dispensing records. Prevalence of epoetin use in the province of Messina (653 810 inhabitants) in 2010 was calculated. Furthermore, frequency analyses by sex, age, indication of use of epoetin users, as well as measurement of volume of use (defined daily dose [DDD]/1000/day) and expenditure of epoetins in 2010 were also performed. Analysis of the switching pattern between different reference products and biosimilar epoetins was performed. Overall, 4288 patients were treated with epoetins during the study period (mean age  ± SD: 74.2 ± 13.7; females: 52%). Darbepoetin alpha and reference product epoetin alpha accounted overall for 79.8% of epoetin users, while biosimilars of epoetin alpha accounted for 0.9%. Among 1247 epoetin users for whom the therapeutic plan was revised, 1065 (85.4%) were treated because of anemia due to chronic kidney disease and 158 (12.6%) because of chemotherapy-induced anemia. In 2010, prevalence of epoetin use was 5.5 (95% CI 5.3, 5.7) per 1000 inhabitants in the province of Messina. The volume of use and related expenditure for epoetins was 3.58 DDD/1000 inhabitants/day and Euro 5 572 457 (about Euro 8.50 per capita/day) in 2010. Switching

  20. Multiple challenges of antibiotic use in a large hospital in Ethiopia - a ward-specific study showing high rates of hospital-acquired infections and ineffective prophylaxis.

    Science.gov (United States)

    Gutema, Girma; Håkonsen, Helle; Engidawork, Ephrem; Toverud, Else-Lydia

    2018-05-03

    This project aims to study the use of antibiotics in three clinical wards in the largest tertiary teaching hospital in Ethiopia for a period of 1 year. The specific aims were to assess the prevalence of patients on antibiotics, quantify the antibiotic consumption and identify the main indications of use. The material was all the medical charts (n = 2231) retrieved from three clinical wards (internal medicine, gynecology/obstetrics and surgery) in Tikur Anbessa Specialized Hospital (TASH) in Addis Ababa between September 2013 and September 2014. Data collection was performed manually by four pharmacists. Each medical chart represented one patient. About 60% of the patients were admitted to internal medicine, 20% to each of the other two wards. The number of bed days (BD) was on average 16.5. Antibiotics for systemic use were prescribed to 73.7% of the patients (on average: 2.1 antibiotics/patient) of whom 86.6% got a third or fourth generation cephalosporin (mainly ceftriaxone). The average consumption of antibiotics was 81.6 DDD/100BD, varying from 91.8 in internal medicine and 71.6 in surgery to 47.6 in gynecology/obstetrics. The five most frequently occurring infections were pneumonia (26.6%), surgical site infections (21.5%), neutropenic fever (6.9%), sepsis (6.4%) and urinary tract infections (4.7%). About one fourth of the prescriptions were for prophylactic purposes. Hospital acquired infections occurred in 23.5% of the patients (353 cases of surgical site infection). The prescribing was based on empirical treatment and sensitivity testing was reported in only 3.8% of the cases. In the present study from three wards in the largest tertiary teaching hospital in Ethiopia, three out of four patients were prescribed antibiotics, primarily empirically. The mean antibiotic consumption was 81.6 DDD/100BD. Surgical site infections constituted a large burden of the infections treated in the hospital, despite extensive prescribing of prophylaxis. The findings show