Acquirement of true stress-strain curve using true fracture strain obtained by tensile test and FE analysis

Energy Technology Data Exchange (ETDEWEB)

Lee, Kyoung Yoon; Kim, Tae Hyung; Lee, Hyung Yil [Sogang University, Seoul (Korea, Republic of)

2009-07-01

In this work, we predict a true fracture strain using load-displacement curves from tensile test and Finite Element Analysis (FEA), and suggest a method for acquiring true Stress-Strain (SS) curves by predicted fracture strain. We first derived the true SS curve up to necking point from load-displacement curve. As the beginning, the posterior necking part of true SS curve is linearly extrapolated with the slope at necking point. The whole SS curve is then adopted for FE simulation of tensile test. The Bridgman factor or suitable plate correction factors are applied to pre and post FEA. In the load-true strain curve from FEA, the true fracture strain is determined as the matching point to test fracture load. The determined true strain is validated by comparing with test fracture strain. Finally, we complete the true SS curve by combining the prior necking part and linear part, the latter of which connects necking and predicted fracture points.

Acquirement of True Stress-strain Curve Using True Fracture Strain Obtained by Tensile Test and FE Analysis

Energy Technology Data Exchange (ETDEWEB)

Lee, Kyoung Yoon; Lee, Hyung Yil [Sogang University, Seoul (Korea, Republic of); Kim, Tae Hyung [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

2009-10-15

In this work, we predict a true fracture strain using load-displacement curves from tensile test and finite element analysis (FEA), and suggest a method for acquiring true stress-strain (SS) curves by predicted fracture strain. We first derived the true SS curve up to necking point from load-displacement curve. As the beginning, the posterior necking part of true SS curve is linearly extrapolated with the slope at necking point. The whole SS curve is then adopted for FE simulation of tensile test. The Bridgman factor or suitable plate correction factors are applied to pre and post FEA. In the load-true strain curve from FEA, the true fracture strain is determined as the matching point to test fracture load. The determined true strain is validated by comparing with test fracture strain. Finally, we complete the true SS curve by combining the prior necking part and linear part, the latter of which connects necking and predicted fracture points.

True bursal pigmented villonodular synovitis

International Nuclear Information System (INIS)

Abdelwahab, Ibrahim Fikry; Kenan, Samuel; Steiner, German C.; Abdul-Quader, Mohammed

2002-01-01

We describe two cases of pigmented villonodular synovitis affecting true bursae. This study was also designed to discuss the term ''pigmented villonodular bursitis'', not confined to true synovial bursae, sometimes creating misunderstanding. (orig.)

Mixed-Degree Spherical Simplex-Radial Cubature Kalman Filter

Directory of Open Access Journals (Sweden)

Shiyuan Wang

2017-01-01

Full Text Available Conventional low degree spherical simplex-radial cubature Kalman filters often generate low filtering accuracy or even diverge for handling highly nonlinear systems. The high-degree Kalman filters can improve filtering accuracy at the cost of increasing computational complexity; nevertheless their stability will be influenced by the negative weights existing in the high-dimensional systems. To efficiently improve filtering accuracy and stability, a novel mixed-degree spherical simplex-radial cubature Kalman filter (MSSRCKF is proposed in this paper. The accuracy analysis shows that the true posterior mean and covariance calculated by the proposed MSSRCKF can agree accurately with the third-order moment and the second-order moment, respectively. Simulation results show that, in comparison with the conventional spherical simplex-radial cubature Kalman filters that are based on the same degrees, the proposed MSSRCKF can perform superior results from the aspects of filtering accuracy and computational complexity.

True bursal pigmented villonodular synovitis

Energy Technology Data Exchange (ETDEWEB)

Abdelwahab, Ibrahim Fikry [Department of Radiology, New York Methodist Hospital, Affiliated with New York Hospital-Cornell Medical Center, Brooklyn, NY (United States); Kenan, Samuel [Department of Orthopedics, New York University Medical Center, NY (United States); Steiner, German C. [Department of Pathology, Hospital for Joint Diseases/Orthopedic Institute, New York, NY (United States); Abdul-Quader, Mohammed [Department of Radiology, New York Presbyterian Hospital, Columbia University, New York, NY (United States)

2002-06-01

We describe two cases of pigmented villonodular synovitis affecting true bursae. This study was also designed to discuss the term ''pigmented villonodular bursitis'', not confined to true synovial bursae, sometimes creating misunderstanding. (orig.)

Material Properties Test to Determine Ultimate Strain and True Stress-True Strain Curves for High Yield Steels

Energy Technology Data Exchange (ETDEWEB)

K.R. Arpin; T.F. Trimble

2003-04-01

This testing was undertaken to develop material true stress-true strain curves for elastic-plastic material behavior for use in performing transient analysis. Based on the conclusions of this test, the true stress-true strain curves derived herein are valid for use in elastic-plastic finite element analysis for structures fabricated from these materials. In addition, for the materials tested herein, the ultimate strain values are greater than those values cited as the limits for the elastic-plastic strain acceptance criteria for transient analysis.

'TrueCoinc' software utility for calculation of the true coincidence correction

International Nuclear Information System (INIS)

Sudar, S.

2002-01-01

The true coincidence correction plays an important role in the overall accuracy of the γ ray spectrometry especially in the case of present-day high volume detectors. The calculation of true coincidence corrections needs detailed nuclear structure information. Recently these data are available in computerized form from the Nuclear Data Centers through the Internet or on a CD-ROM of the Table of Isotopes. The aim has been to develop software for this calculation, using available databases for the levels data. The user has to supply only the parameters of the detector to be used. The new computer program runs under the Windows 95/98 operating system. In the framework of the project a new formula was prepared for calculating the summing out correction and calculation of the intensity of alias lines (sum peaks). The file converter for reading the ENDSF-2 type files was completed. Reading and converting the original ENDSF was added to the program. A computer accessible database of the X rays energies and intensities was created. The X ray emissions were taken in account in the 'summing out' calculation. Calculation of the true coincidence 'summing in' correction was done. The output was arranged to show independently two types of corrections and to calculate the final correction as multiplication of the two. A minimal intensity threshold can be set to show the final list only for the strongest lines. The calculation takes into account all the transitions, independently of the threshold. The program calculates the intensity of X rays (K, L lines). The true coincidence corrections for X rays were calculated. The intensities of the alias γ lines were calculated. (author)

Value judgments and the true self.

Science.gov (United States)

Newman, George E; Bloom, Paul; Knobe, Joshua

2014-02-01

The belief that individuals have a "true self" plays an important role in many areas of psychology as well as everyday life. The present studies demonstrate that people have a general tendency to conclude that the true self is fundamentally good--that is, that deep inside every individual, there is something motivating him or her to behave in ways that are virtuous. Study 1 finds that observers are more likely to see a person's true self reflected in behaviors they deem to be morally good than in behaviors they deem to be bad. Study 2 replicates this effect and demonstrates observers' own moral values influence what they judge to be another person's true self. Finally, Study 3 finds that this normative view of the true self is independent of the particular type of mental state (beliefs vs. feelings) that is seen as responsible for an agent's behavior.

Searching for the true diet of marine predators: incorporating Bayesian priors into stable isotope mixing models.

Directory of Open Access Journals (Sweden)

André Chiaradia

Full Text Available Reconstructing the diet of top marine predators is of great significance in several key areas of applied ecology, requiring accurate estimation of their true diet. However, from conventional stomach content analysis to recent stable isotope and DNA analyses, no one method is bias or error free. Here, we evaluated the accuracy of recent methods to estimate the actual proportion of a controlled diet fed to a top-predator seabird, the Little penguin (Eudyptula minor. We combined published DNA data of penguins scats with blood plasma δ(15N and δ(13C values to reconstruct the diet of individual penguins fed experimentally. Mismatch between controlled (true ingested diet and dietary estimates obtained through the separately use of stable isotope and DNA data suggested some degree of differences in prey assimilation (stable isotope and digestion rates (DNA analysis. In contrast, combined posterior isotope mixing model with DNA Bayesian priors provided the closest match to the true diet. We provided the first evidence suggesting that the combined use of these complementary techniques may provide better estimates of the actual diet of top marine predators- a powerful tool in applied ecology in the search for the true consumed diet.

Fully decentralized control of a soft-bodied robot inspired by true slime mold.

Science.gov (United States)

Umedachi, Takuya; Takeda, Koichi; Nakagaki, Toshiyuki; Kobayashi, Ryo; Ishiguro, Akio

2010-03-01

Animals exhibit astoundingly adaptive and supple locomotion under real world constraints. In order to endow robots with similar capabilities, we must implement many degrees of freedom, equivalent to animals, into the robots' bodies. For taming many degrees of freedom, the concept of autonomous decentralized control plays a pivotal role. However a systematic way of designing such autonomous decentralized control system is still missing. Aiming at understanding the principles that underlie animals' locomotion, we have focused on a true slime mold, a primitive living organism, and extracted a design scheme for autonomous decentralized control system. In order to validate this design scheme, this article presents a soft-bodied amoeboid robot inspired by the true slime mold. Significant features of this robot are twofold: (1) the robot has a truly soft and deformable body stemming from real-time tunable springs and protoplasm, the former is used for an outer skin of the body and the latter is to satisfy the law of conservation of mass; and (2) fully decentralized control using coupled oscillators with completely local sensory feedback mechanism is realized by exploiting the long-distance physical interaction between the body parts stemming from the law of conservation of protoplasmic mass. Simulation results show that this robot exhibits highly supple and adaptive locomotion without relying on any hierarchical structure. The results obtained are expected to shed new light on design methodology for autonomous decentralized control system.

Measurement of true density

International Nuclear Information System (INIS)

Carr-Brion, K.G.; Keen, E.F.

1982-01-01

System for determining the true density of a fluent mixture such as a liquid slurry, containing entrained gas, such as air comprises a restriction in pipe through which at least a part of the mixture is passed. Density measuring means such as gamma-ray detectors and source measure the apparent density of the mixture before and after its passage through the restriction. Solid-state pressure measuring devices are arranged to measure the pressure in the mixture before and after its passage through the restriction. Calculating means, such as a programmed microprocessor, determine the true density from these measurements using relationships given in the description. (author)

Perception of self-tilt in a true and illusory vertical plane

Science.gov (United States)

Groen, Eric L.; Jenkin, Heather L.; Howard, Ian P.; Oman, C. M. (Principal Investigator)

2002-01-01

A tilted furnished room can induce strong visual reorientation illusions in stationary subjects. Supine subjects may perceive themselves upright when the room is tilted 90 degrees so that the visual polarity axis is kept aligned with the subject. This 'upright illusion' was used to induce roll tilt in a truly horizontal, but perceptually vertical, plane. A semistatic tilt profile was applied, in which the tilt angle gradually changed from 0 degrees to 90 degrees, and vice versa. This method produced larger illusory self-tilt than usually found with static tilt of a visual scene. Ten subjects indicated self-tilt by setting a tactile rod to perceived vertical. Six of them experienced the upright illusion and indicated illusory self-tilt with an average gain of about 0.5. This value is smaller than with true self-tilt (0.8), but comparable to the gain of visually induced self-tilt in erect subjects. Apparently, the contribution of nonvisual cues to gravity was independent of the subject's orientation to gravity itself. It therefore seems that the gain of visually induced self-tilt is smaller because of lacking, rather than conflicting, nonvisual cues. A vector analysis is used to discuss the results in terms of relative sensory weightings.

False memory for context and true memory for context similarly activate the parahippocampal cortex.

Science.gov (United States)

Karanian, Jessica M; Slotnick, Scott D

2017-06-01

The role of the parahippocampal cortex is currently a topic of debate. One view posits that the parahippocampal cortex specifically processes spatial layouts and sensory details (i.e., the visual-spatial processing view). In contrast, the other view posits that the parahippocampal cortex more generally processes spatial and non-spatial contexts (i.e., the general contextual processing view). A large number of studies have found that true memories activate the parahippocampal cortex to a greater degree than false memories, which would appear to support the visual-spatial processing view as true memories are typically associated with greater visual-spatial detail than false memories. However, in previous studies, contextual details were also greater for true memories than false memories. Thus, such differential activity in the parahippocampal cortex may have reflected differences in contextual processing, which would challenge the visual-spatial processing view. In the present functional magnetic resonance imaging (fMRI) study, we employed a source memory paradigm to investigate the functional role of the parahippocampal cortex during true memory and false memory for contextual information to distinguish between the visual-spatial processing view and the general contextual processing view. During encoding, abstract shapes were presented to the left or right of fixation. During retrieval, old shapes were presented at fixation and participants indicated whether each shape was previously on the "left" or "right" followed by an "unsure", "sure", or "very sure" confidence rating. The conjunction of confident true memories for context and confident false memories for context produced activity in the parahippocampal cortex, which indicates that this region is associated with contextual processing. Furthermore, the direct contrast of true memory and false memory produced activity in the visual cortex but did not produce activity in the parahippocampal cortex. The present

Deconstructing the mammal species richness pattern in Europe - towards and understanding of the relative importance of climate, biogeographic history, habitat heterogeneity and humans

DEFF Research Database (Denmark)

Fløjgaard, Camilla; Normand, Signe; Skov, Flemming

2011-01-01

partitioning to assess the importance of macroclimate and HHH variables. The HHH variables included two historical factors, estimated by novel methodologies: (1) ice-age-driven dynamics, represented by accessibility to recolonization from hindcasting-estimated glacial refugia, and (2) biogeographic peninsular...

Data of evolutionary structure change: 1ACLA-1LPOA [Confc[Archive

Lifescience Database Archive (English)

Full Text Available entryIDChain>1ACLA DEQFP-GFSGS > - HHH...O A 1LPOA PEGTYEENLPK ...> HHH> ATOM 474 CA PRO A 65 69.013 60.208 -6.968 1...Chain>A 1LPOA GSASD--KLACL re> --HHHHH...CLA NLNSDEELIHCL > HHHHHHHH

The True Scholar.

Science.gov (United States)

Bellah, Robert N.

2000-01-01

This essay argues for ethical inquiry as the essence of true scholarship. Individual sections address: pure reason versus ethics, the current "age of money" in the university, rational choice theory, and the fatal flaw in rational choice theory that all human actions cannot be explained by it. (DB)

Your True Freedom

Directory of Open Access Journals (Sweden)

Jena Rausch

2015-02-01

Full Text Available Your True Freedom is about my journey teaching inmates the fundamental truths of self worth, self acceptance and self love--through writing, mindfulness meditation and emotional healing. It is a journey that continues to enlighten me and to heal and free the inmates with whom I work.

Systemic True False

African Journals Online (AJOL)

Preferred Customer

):. (a). (b). (c). (d). Answer: True systemics are (b & c); False Systemics (a & d). For more examples, see (10 and 11). Na2O2. NaCl. Na. HCl heat /excess. (O). 300°C electrolysis. (molten). NaOH. NaCl. Na. HCl. H2O electrolysis. (solution). NaCl.

Data of evolutionary structure change: 1A5CB-2QUUC [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 2QUU C 2QUUC ...in>C 2QUUC INKCPLLKPWAence> HHH...>2 2QUU C 2QUUC LKIGE--HTPSA...1A5CB-2QUUC 1A5C 2QUU B C ------LPADVAEELATTAQKLVQAGKGILAADESTQTI.../pdbChain> 1A5CB ence>LFGTK-GLGKFence> HHH -

True self-alienation positively predicts reports of mindwandering.

Science.gov (United States)

Vess, Matthew; Leal, Stephanie A; Hoeldtke, Russell T; Schlegel, Rebecca J; Hicks, Joshua A

2016-10-01

Two studies assessed the relationship between feelings of uncertainty about who one truly is (i.e., true self-alienation) and self-reported task-unrelated thoughts (i.e., mindwandering) during performance tasks. Because true self-alienation is conceptualized as the subjective disconnect between conscious awareness and actual experience, we hypothesized that greater feelings of true self-alienation would positively relate to subjective reports of mindwandering. Two convergent studies supported this hypothesis. Moreover, this relationship could not consistently be accounted for by the independent influence of other aspects of authenticity, negative mood, mindfulness, or broad personality dimensions. These findings suggest that individual differences in true self-alienation are reliably associated with subjective reports of mindwandering. The implications of these findings for the true self-alienation construct, the ways that personality relates to mindwandering, and future research directions focused on curtailing mindwandering and improving performance and achievement are discussed. Copyright © 2016 Elsevier Inc. All rights reserved.

Knowledge as Fact-Tracking True Belief

Directory of Open Access Journals (Sweden)

Fred Adams

Full Text Available ABSTRACT Drawing inspiration from Fred Dretske, L. S. Carrier, John A. Barker, and Robert Nozick, we develop a tracking analysis of knowing according to which a true belief constitutes knowledge if and only if it is based on reasons that are sensitive to the fact that makes it true, that is, reasons that wouldn’t obtain if the belief weren’t true. We show that our sensitivity analysis handles numerous Gettier-type cases and lottery problems, blocks pathways leading to skepticism, and validates the epistemic closure thesis that correct inferences from known premises yield knowledge of the conclusions. We discuss the plausible views of Ted Warfield and Branden Fitelson regarding cases of knowledge acquired via inference from false premises, and we show how our sensitivity analysis can account for such cases. We present arguments designed to discredit putative counterexamples to sensitivity analyses recently proffered by Tristan Haze, John Williams and Neil Sinhababu, which involve true statements made by untrustworthy informants and strange clocks that sometimes display the correct time while running backwards. Finally, we show that in virtue of employing the paradox-free subjunctive conditionals codified by Relevance Logic theorists instead of the paradox-laden subjunctive conditionals codified by Robert Stalnaker and David Lewis.

In search of true friendship

Directory of Open Access Journals (Sweden)

Luciana Karine de Souza

2008-01-01

Full Text Available The present text proposes a discussion on the concept of true friendship. The argument is grounded mostly on Aristotle's Nicomachean Ethics, Owen Flanagan's ethics as human ecology, and on contemporary authors' works about the Greek philosopher's concept of friendship. Given that human beings flourish through 1 exercising capacities, 2 being moral, and 3 having true friendships, difficulties to establish the level of trust required by true friendships turns the search itself (for them morally valid.O presente texto propõe uma discussão sobre o conceito de amizade verdadeira. A argumentação que fundamenta o trabalho baseia-se em grande parte na Ética a Nicômaco de Aristóteles, na ética como ecologia humana de Owen Flanagan, e em autores contemporâneos sobre o conceito de amizade do filósofo grego. Considerando-se que seres humanos encontram a felicidade mediante 1 o exercício de suas capacidades, 2 ser um ente moral, e 3 ter amizades verdadeiras, as dificuldades no estabelecimento do nível de amizade requerido nas amizades verdadeiras torna a busca (por elas, por si só, algo moralmente válido.

Comparison of true metabolisable energy and true amino acid availability between normal maize and quality protein maize (Shandan 17

Directory of Open Access Journals (Sweden)

Mei Li Zhang

2010-01-01

Full Text Available A precision-fed assay was conducted to determine true metabolisable energy and true amino acid digestibility in Chinese quality protein maize (QPM compared with normal maize (NM. Thirty adult roosters, kept in individual cages, were made to fast for 48h and then tub-fed 50g QPM or NM per bird and their excreta was colleted for the subsequent 48h. Additional fifteen roosters were made to fast in order to estimate endogenous losses of energy and amino acids (AA in excreta. Gross energy of the two types of maize were similar; the lysine content in NM and QPM were 0.27% and 0.41% (DM basis, respectively. True metabolisable energy (TME and true metabolisable energy nitrogen corrected (TMEn values of QPM and NM were not significantly different (P>0.05. Digestibility of some AA, including lysine and methionine, in QPM were higher than those in NM (P<0.05. The results of this study indicated that the nutritive value of QPM might be higher than that of NM.

Happiness, Psychology, and Degrees of Realism.

Science.gov (United States)

Lavazza, Andrea

2016-01-01

The recent emphasis on a realist ontology that cannot be overshadowed by subjectivist or relativist perspectives seems to have a number of consequences for psychology as well. My attempt here is to analyse the relationship between happiness as a state of the individual and the states of the external world and the brain events related to (or, in some hypotheses, causally responsible for) its occurrence. It can be maintained that different degrees of realism are suitable to describe the states of happiness and this fact might have relevant psychological implications, namely for the so-called positive psychology. This is especially true now that there are methods available to induce subjective states of happiness unrelated to the external conditions usually taken to be linked to such states.

Radionuclide therapy for true polycythemia

International Nuclear Information System (INIS)

Afanasieva, N.I.; Grushka, G.V.; Vasiliev, L.Ya.

2005-01-01

Full text: True polycythemia (Vaquez' disease) is the disease of the hemopoietic system of an unknown origin accompanied by increase of erythrocyte count in the peripheral blood with absolute and relative increase in the mass of circulating erythrocytes. True polycythemia is treated with bloodletting and myelosuppressing drugs. This treatment is not always effective. A special place among myelo-depressants is occupied by P-32. Its main therapeutic effect is mediated by the participation in the metabolic processes. Besides DNA damage with beta-radiation, P-32 incorporation by DNA followed by decay and transformation to a stable sulphur isotope (S-32) results in the damage of the structure of nucleic acids, which is main mechanism of cellular proliferation inhibition. Therefore, P-32 is considered a powerful myelosuppressive agent. The indication to P-32 administration is true polycythemia, which, in contrast to secondary polycythemia accompanying numerous diseases, requires special cytostatic treatment. The study involved 152 patients with true polycythemia (76 men and 76 women aged 48) treated with P-32. The treatment was administered in case when bloodletting proved to be ineffective and hematocrit level exceeded 75%. P-32 was administered orally in 100 ml of 10% glucose solution on an empty stomach at a dose of 37-111 MBq with a 4-10-day intervals (mean 6 days). The blood count was checked for 12 weeks. If the number of thrombocytes and leukocytes decreased less than by 25% and the level of hematocrit did not normalize, repeated P-32 treatments were performed. In 13 (8.6%) patients, haematocrit parameters became normal after a single P-32 administration, in 15 (9.9%) patients two treatments with P-32 were necessary to normalize the blood count. In 134 (88.1%) cases P-32 treatment was administered more then two times (maximum 10 treatments). Total P-32 activity ranged from 37 to 740 MBq. Of all the patients who were administered P- 32 treatment, hematological

True ternary fission in 310126X

International Nuclear Information System (INIS)

Banupriya, B.; Vijayaraghavan, K.R.; Balasubramaniam, M.

2015-01-01

All possible combinations are minimized by the two dimensional minimization process and minimized with respect to neutron numbers and proton numbers of the fragments. Potential energy is low and Q - value is high at true ternary fission region. It shows that true ternary mode is the dominant mode in the ternary fission of superheavy nuclei. Also, the results show that the fragments with neutron magic numbers are the dominant one in the ternary fission of superheavy nuclei whereas the fragments with proton magic numbers are the dominant one in the ternary fission of heavy nuclei

The spread of true and false news online.

Science.gov (United States)

Vosoughi, Soroush; Roy, Deb; Aral, Sinan

2018-03-09

We investigated the differential diffusion of all of the verified true and false news stories distributed on Twitter from 2006 to 2017. The data comprise ~126,000 stories tweeted by ~3 million people more than 4.5 million times. We classified news as true or false using information from six independent fact-checking organizations that exhibited 95 to 98% agreement on the classifications. Falsehood diffused significantly farther, faster, deeper, and more broadly than the truth in all categories of information, and the effects were more pronounced for false political news than for false news about terrorism, natural disasters, science, urban legends, or financial information. We found that false news was more novel than true news, which suggests that people were more likely to share novel information. Whereas false stories inspired fear, disgust, and surprise in replies, true stories inspired anticipation, sadness, joy, and trust. Contrary to conventional wisdom, robots accelerated the spread of true and false news at the same rate, implying that false news spreads more than the truth because humans, not robots, are more likely to spread it. Copyright © 2018 The Authors, some rights reserved; exclusive licensee American Association for the Advancement of Science. No claim to original U.S. Government Works.

Imaging diagnosis--positive contrast peritoneographic features of true diaphragmatic hernia.

Science.gov (United States)

Choi, Jihye; Kim, Hyunwook; Kim, Mieun; Yoon, Junghee

2009-01-01

A true diaphragmatic hernia is a congenital diaphragmatic malformation that can appear identical to a peritoneopericardial diaphragmatic hernia (PPDH). True diaphragmatic hernias are rare in dogs. Herein we describe the use of positive contrast peritoneography for diagnosis of a true diaphragmatic hernia in two dogs.

Hippocampal size is related to short-term true and false memory, and right fusiform size is related to long-term true and false memory.

Science.gov (United States)

Zhu, Bi; Chen, Chuansheng; Loftus, Elizabeth F; He, Qinghua; Lei, Xuemei; Dong, Qi; Lin, Chongde

2016-11-01

There is a keen interest in identifying specific brain regions that are related to individual differences in true and false memories. Previous functional neuroimaging studies showed that activities in the hippocampus, right fusiform gyrus, and parahippocampal gyrus were associated with true and false memories, but no study thus far has examined whether the structures of these brain regions are associated with short-term and long-term true and false memories. To address that question, the current study analyzed data from 205 healthy young adults, who had valid data from both structural brain imaging and a misinformation task. In the misinformation task, subjects saw the crime scenarios, received misinformation, and took memory tests about the crimes an hour later and again after 1.5 years. Results showed that bilateral hippocampal volume was associated with short-term true and false memories, whereas right fusiform gyrus volume and surface area were associated with long-term true and false memories. This study provides the first evidence for the structural neural bases of individual differences in short-term and long-term true and false memories.

True ternary fission of 252Cf

International Nuclear Information System (INIS)

Vijayaraghavan, K.R.; Balasubramaniam, M.; Oertzen, W. von

2014-01-01

Splitting of heavy radioactive nucleus into three fragments is known as ternary fission. If the size of the fragments are almost equal it is referred to as true ternary fission. Recently, Yu. V. Pyatkov et al observed/reported the experimental observation of true ternary fission in 252 Cf. In this work, the possibilities of different true ternary fission modes of 252 Cf through potential energy surface (PES) calculations based on three cluster model (TCM) are discussed. In TCM a condition on the mass numbers of the fission fragments is implied as A 1 ≥ A 2 ≥ A 3 in order to avoid repetition of combinations. Due to this condition, the values of Z 3 vary from 0 to 36 and Z 2 vary from 16 to 51. Of the different pairs having similar (Z 2 , Z 3 ) with different potential energy, a pair possessing minimum potential energy is chosen. Thus identified favourable combinations are plotted. For the PES calculations the arrangement of the fragments is considered in the order of A 1 +A 2 +A 3 . i.e. the heavy and the lightest fragments are kept at the ends. It is seen that the deepest minimum in the PES occurs for Z 3 =2 labelled as (Z 2 ; 2) indicating He accompanied breakup as the most favourable one. Of which, the breakup with Z 2 around 46 to 48 is the least (shown by dashed (Z 1 = 50) and dotted (Z 1 = 52) lines indicating a constant Z 1 value). The other notable minima in the PES are labelled and they correspond to the (Z 2 , Z 3 ) pairs viz., (20, 20), (28, 20), (28, 28) and (32, 32). Of these four minima, the first three are associated with the magic numbers 20 and 28. For Z 3 =20, there are two minimums at (20,20) and (28,20) among them (28,20) is the lowest minimum through which the minimum-path passes, and it is the ternary decay observed by Yu. V. Pyatkov et al. The fourth minima is the most interesting due to the fact that it corresponds to true ternary fission mode with Z 2 =32, Z 3 =32 and Z 1 =34. The minimum potential energy path also goes through this true

MR-Venography Using High Resolution True-FISP

Energy Technology Data Exchange (ETDEWEB)

Spuentrup, E. [Technische Hochschule Aachen (Germany). Klinik fuer Radiologische Diagnostik; Beth Israel Deaconess Medical Center, Boston, MA (United States). Dept. of Medicine; Harvard Medical School, Boston, MA (United States); Buecker, A.; Guenther, R.W. [Technische Hochschule Aachen (Germany). Klinik fuer Radiologische Diagnostik; Stuber, M. [Beth Israel Deaconess Medical Center, Boston, MA (United States). Dept. of Medicine; Harvard Medical School, Boston, MA (United States); Philips Med. Syst., Best (Netherlands)

2001-08-01

A new fast MR-venography approach using a high resolution True-FISP imaging sequence was investigated in 20 patients suffering from 23 deep vein thromboses. Diagnosis was proven by X-ray venography, CT or ultrasound examination. The presented technique allowed for clear thrombus visualization with a high contrast to the surrounding blood pool even in calf veins. Acquisition time was less than 10 minutes for imaging the pelvis and the legs. No contrast media was needed. The presented high resolution True-FISP MR-veography is a promising non-invasive, fast MR-venography approach for detection of deep venous thrombosis. (orig.) [German] Eine neue schnelle, oertlich hochaufgeloeste MR-Phlebographietechnik mit einer axialen True-FISP Bildgebungssequenz wurde an 20 Patienten mit 23 nach-gewiesenen tiefen Beinvenenthrombosen untersucht. Die Befunde wurden mit einer konventionellen Roentgenphlebographie, einer CT oder einer Sonographie gesichert. Die vorgestellte Technik erlaubte in allen Faellen eine Thrombusdarstellung mit hohem Kontrast zum umgebenden venoesen Blut, wobei aufgrund der hohen Ortsaufloesung auch die Unterschenkelvenen beurteilt werden konnten. Die Datenaufnahmezeit zur Untersuchung des Beckens und der Beine betrug weniger als 10 Minuten. Kontrastmittel wurde nicht benoetigt. Die vorgestellte MR-Phlebographietechnik unter Verwendung einer oertlich hochauf-geloesten True-FISP Sequenz ist eine neue, vielversprechende, nicht-invasive Technik zur Diagnostik der tiefen Bein- und Beckenvenenthrombose. (orig.)

"True" posterior communicating aneurysms: Three cases, three strategies.

Science.gov (United States)

Nery, Breno; Araujo, Ricardo; Burjaili, Bruno; Smith, Timothy R; Rodrigues, Jose Carlos; Silva, Marcelo Nery

2016-01-01

The authors provide a review of true aneurysms of the posterior communicating artery (PCoA). Three cases admitted in our hospital are presented and discussed as follows. First patient is a 51-year-old female presenting with a Fisher II, Hunt-Hess III (headache and confusion) subarachnoid hemorrhage (SAH) from a ruptured true aneurysm of the right PCoA. She underwent a successful ipsilateral pterional craniotomy for aneurysm clipping and was discharged on postoperative day 4 without neurological deficit. Second patient is a 53-year-old female with a Fisher I, Hunt-Hess III (headache, mild hemiparesis) SAH and multiple aneurisms, one from left ophthalmic carotid artery and one (true) from right PCoA. These lesions were approached and successfully treated by a single pterional craniotomy on the left side. The patient was discharged 4 days after surgery, with complete recovery of muscle strength during follow-up. Third patient is a 69-year-old male with a Fisher III, Hunt-Hess III (headache and confusion) SAH, from a true PCoA on the right. He had a left subclavian artery occlusion with flow theft from the right vertebral artery to the left vertebral artery. The patient underwent endovascular treatment with angioplasty and stent placement on the left subclavian artery that resulted in aneurysm occlusion. In conclusion, despite their seldom occurrence, true PCoA aneurysms can be successfully treated with different strategies.

Degree-degree correlations in random graphs with heavy-tailed degrees

NARCIS (Netherlands)

Hofstad, van der R.W.; Litvak, N.

2014-01-01

Mixing patterns in large self-organizing networks, such as the Internet, the World Wide Web, social, and biological networks are often characterized by degree-degree dependencies between neighboring nodes. In assortative networks, the degree-degree dependencies are positive (nodes with similar

Degree-Degree Dependencies in Random Graphs with Heavy-Tailed Degrees

NARCIS (Netherlands)

van der Hofstad, Remco; Litvak, Nelly

2014-01-01

Mixing patterns in large self-organizing networks, such as the Internet, the World Wide Web, social, and biological networks are often characterized by degree-degree dependencies between neighboring nodes. In assortative networks, the degree-degree dependencies are positive (nodes with similar

Responding to the Challenge of True Uncertainty

DEFF Research Database (Denmark)

Hallin, Carina Antonia; Andersen, Torben Juul

We construe a conceptual framework for responding effectively to true uncertainty in the business environment. We drill down to the essential micro-foundational capabilities - sensing and seizing of dynamic capabilities - and link them to classical strategic issue management theory with suggestions...... on how to operationalize these essential capabilities. By definition true uncertainty represents environmental conditions that are hard to foresee, which can catch the unprepared by surprise while presenting opportunities to the conscious organization. We demonstrate that organizations relying...

True dreams: Encounter of the worlds in Islamic philosophy

Directory of Open Access Journals (Sweden)

Halilović Tehran

2014-01-01

Full Text Available True dreams that explicitly or symbolically reveal the events of the past and the future, in the ontological sense tell more than just about the content of a dream because they bespeak the supratemporal dimension of human beings and represent man's ability to connect to different worlds, and respectively multitudinous forms and levels of being. In this paper, without going into the psychological or physiological analysis of dreams, we try to clarify the ontological significance and position of true dreams in existing worlds. In Islamic philosophy, the underlying cognitive basis for the description of the ontological level of true dreams was established by the founder of Illuminative Philosophy, Shaykh al-Ishraq (1155-1191, and it was expanded by the founder of Transcendental Philosophy, Mulla Sadra Shirazi (1572-1640. Shaykh al-Ishraq explained in detail existential position of supramaterial beings that on the one hand are above the world of matter and in a direct active contact with it, and on the other hand, are under the dominant world of intellect. He called these creatures Midworld (Barzakh and, for the first time in Islamic philosophy, stated that it is a separate world of imagination that is different from the material and intelligible one. True dreams are one of the many indications that man has a supratemporal dimension that exposes supramaterial and temporally unlimited worlds to him. Apart from true dreams, most important signs of supramaterial worlds in human life are the prophetic revelation, as well as revelations and mystical-gnostic intuition. Unlike the last two examples, true dreams are known and accessible to all people, both from their immediate experience and from the stories of the ones close to them. For this reason, in this paper we explain how true dreams represent a blend of worlds in human life.

True Fibroma of Alveolar Mucosa

Directory of Open Access Journals (Sweden)

Shankargouda Patil

2014-01-01

Full Text Available Benign fibrous overgrowths are often found in the oral cavity, almost always being reactive/irritational in nature. However, benign mesenchymal neoplasms of the fibroblasts are extremely uncommon. Here we report a case of “True Fibroma of Alveolar Mucosa” for its rarity.

True vaginal prolapse in a bitch.

Science.gov (United States)

Alan, M; Cetin, Y; Sendag, S; Eski, F

2007-08-01

Frequently, vaginal fold prolapse is the protrusion of edematous vaginal tissue into and through the opening of the vulva occurring during proestrus and estrus stages of the sexual cycle. True vaginal prolapse may occur near parturition, as the concentration of serum progesterone declines and the concentration of serum oestrogen increases. In the bitch, this type of true vaginal prolapse is a very rare condition. This short communication describes a 5-year-old female, cross-breed dog in moderate condition, weighing 33 kg, with distocia and true vaginal prolapse. Abdominal palpation and transabdominal ultrasonography revealed live and dead foetuses in the uterine horns. One dead and four live fetuses were removed from uterus by cesarean section. The ovariohysterectomy was performed after repositioning the vaginal wall with a combination of traction from within the abdomen and external manipulation through the vulva. Re-occurrence of a vaginal prolapse was not observed and the bitch recovered completely after the surgical therapy. Compared to other vaginal disorders, vaginal prolapse is an uncommon condition in the bitch. In the present case, extreme tenesmus arising from distocia may have predisposed to the vaginal prolapse. The cause of dystocia was probably the disposition of the first foetus. We concluded that the vaginal prolapse was the result of dystocia in the present case.

Visualization of swallowing using real-time TrueFISP MR fluoroscopy

Energy Technology Data Exchange (ETDEWEB)

Barkhausen, Joerg; Goyen, Mathias; Lauenstein, Thomas; Debatin, Joerg F. [Department of Diagnostic Radiology, University Hospital Essen (Germany); Winterfeld, F. von; Arweiler-Harbeck, Diana [Department of Otorhinolaryngology, University Hospital Essen (Germany)

2002-01-01

The aim of this study was to evaluate the ability of different real-time true fast imaging with steady precession (TrueFISP) sequences regarding their ability to depict the swallowing process and delineate oropharyngeal pathologies in patients with dysphagia. Real-time TrueFISP visualization of swallowing was performed in 8 volunteers and 6 patients with dysphagia using a 1.5 T scanner (Magnetom Sonata, Siemens, Erlangen Germany) equipped with high-performance gradients (amplitude 40 mT/m). Image quality of four different real-time TrueFISP sequences (TR 2.2-3.0 ms, TE 1.1-1.5 ms, matrix 63 x 128-135 x 256, field of view 250 mm{sup 2}, acquisition time per image 139-405 ms) was evaluated. Water, yoghurt, and semolina pudding were assessed as oral contrast agents. Functional exploration of the oropharyngeal apparatus was best possible using the fastest real-time TrueFISP sequence (TR 2.2 ms, TE 1.1 ms, matrix 63 x 128). Increased acquisition time resulted in blurring of anatomical structures. As the image contrast of TrueFISP sequences depends on T2/T1 properties, all tested foodstuff were well suited as oral contrast agents, but image quality was best using semolina pudding. Real-time visualization of swallowing is possible using real-time TrueFISP sequences in conjunction with oral contrast agents. For the functional exploration of swallowing high temporal resolution is more crucial than spatial resolution. (orig.)

SU-F-J-42: Comparison of Varian TrueBeam Cone-Beam CT and BrainLab ExacTrac X-Ray for Cranial Radiotherapy

Energy Technology Data Exchange (ETDEWEB)

Li, J; Shi, W; Andrews, D; Werner-Wasik, M; Lu, B; Yu, Y; Dicker, A; Liu, H [Thomas Jefferson University Hospital, Philadelphia, PA (United States)

2016-06-15

Purpose: To compare online image registrations of TrueBeam cone-beam CT (CBCT) and BrainLab ExacTrac x-ray imaging systems for cranial radiotherapy. Method: Phantom and patient studies were performed on a Varian TrueBeam STx linear accelerator (Version 2.5), which is integrated with a BrainLab ExacTrac imaging system (Version 6.1.1). The phantom study was based on a Rando head phantom, which was designed to evaluate isocenter-location dependence of the image registrations. Ten isocenters were selected at various locations in the phantom, which represented clinical treatment sites. CBCT and ExacTrac x-ray images were taken when the phantom was located at each isocenter. The patient study included thirteen patients. CBCT and ExacTrac x-ray images were taken at each patient’s treatment position. Six-dimensional image registrations were performed on CBCT and ExacTrac, and residual errors calculated from CBCT and ExacTrac were compared. Results: In the phantom study, the average residual-error differences between CBCT and ExacTrac image registrations were: 0.16±0.10 mm, 0.35±0.20 mm, and 0.21±0.15 mm, in the vertical, longitudinal, and lateral directions, respectively. The average residual-error differences in the rotation, roll, and pitch were: 0.36±0.11 degree, 0.14±0.10 degree, and 0.12±0.10 degree, respectively. In the patient study, the average residual-error differences in the vertical, longitudinal, and lateral directions were: 0.13±0.13 mm, 0.37±0.21 mm, 0.22±0.17 mm, respectively. The average residual-error differences in the rotation, roll, and pitch were: 0.30±0.10 degree, 0.18±0.11 degree, and 0.22±0.13 degree, respectively. Larger residual-error differences (up to 0.79 mm) were observed in the longitudinal direction in the phantom and patient studies where isocenters were located in or close to frontal lobes, i.e., located superficially. Conclusion: Overall, the average residual-error differences were within 0.4 mm in the translational

Firms' degree of born-globalness, international entrepreneurial orientation and export performance

DEFF Research Database (Denmark)

Servais, Per; Kuivalainen, Olli; Sundqvist, Sanna

2007-01-01

Despite the recent increase in 'born-global' studies, there has been little research on how the scale and scope of being a born-global firm affects performance: most of the earlier research takes no account either the number of or the distances between the countries on firm or export performance...... born-global pathways. The results of our empirical study on 185 Finnish exporting firms show that those that qualified as true born-globals had better export performance. Furthermore, depending on the degree of born-globalness, different dimensions of EO were of importance....

The dynamic interplay between perceived true self-knowledge and decision satisfaction.

Science.gov (United States)

Schlegel, Rebecca J; Hicks, Joshua A; Davis, William E; Hirsch, Kelly A; Smith, Christina M

2013-03-01

The present research used multiple methods to examine the hypothesis that perceived true self-knowledge and decision satisfaction are inextricably linked together by a widely held "true-self-as-guide" lay theory of decision making. Consistent with this proposition, Study 1 found that participants rated using the true self as a guide as more important for achieving personal satisfaction than a variety of other potential decision-making strategies. After establishing the prevalence of this lay theory, the remaining studies then focused on examining the proposed consequent relationship between perceived true self-knowledge and decision satisfaction. Consistent with hypotheses, 2 cross-sectional correlational studies (Studies 2 and 3) found a positive relationship between perceived true self-knowledge and decision satisfaction for different types of major decisions. Study 4 used daily diary methods to demonstrate that fluctuations in perceived true self-knowledge reliably covary with fluctuations in decision satisfaction. Finally, 2 studies directly examined the causal direction of this relationship through experimental manipulation and revealed that the relationship is truly bidirectional. More specifically, Study 5 showed that manipulating perceived knowledge of the true self (but not other self-concepts) directly affects decision satisfaction. Study 6 showed that this effect also works in reverse by manipulating feelings of decision satisfaction, which directly affected perceived knowledge of the true self (but not other self-concepts). Taken together, these studies suggest that people believe the true self should be used as a guide when making major life decisions and that this belief has observable consequences for the self and decision making. PsycINFO Database Record (c) 2013 APA, all rights reserved

True random numbers from amplified quantum vacuum.

Science.gov (United States)

Jofre, M; Curty, M; Steinlechner, F; Anzolin, G; Torres, J P; Mitchell, M W; Pruneri, V

2011-10-10

Random numbers are essential for applications ranging from secure communications to numerical simulation and quantitative finance. Algorithms can rapidly produce pseudo-random outcomes, series of numbers that mimic most properties of true random numbers while quantum random number generators (QRNGs) exploit intrinsic quantum randomness to produce true random numbers. Single-photon QRNGs are conceptually simple but produce few random bits per detection. In contrast, vacuum fluctuations are a vast resource for QRNGs: they are broad-band and thus can encode many random bits per second. Direct recording of vacuum fluctuations is possible, but requires shot-noise-limited detectors, at the cost of bandwidth. We demonstrate efficient conversion of vacuum fluctuations to true random bits using optical amplification of vacuum and interferometry. Using commercially-available optical components we demonstrate a QRNG at a bit rate of 1.11 Gbps. The proposed scheme has the potential to be extended to 10 Gbps and even up to 100 Gbps by taking advantage of high speed modulation sources and detectors for optical fiber telecommunication devices.

True navigation and magnetic maps in spiny lobsters.

Science.gov (United States)

Boles, Larry C; Lohmann, Kenneth J

2003-01-02

Animals are capable of true navigation if, after displacement to a location where they have never been, they can determine their position relative to a goal without relying on familiar surroundings, cues that emanate from the destination, or information collected during the outward journey. So far, only a few animals, all vertebrates, have been shown to possess true navigation. Those few invertebrates that have been carefully studied return to target areas using path integration, landmark recognition, compass orientation and other mechanisms that cannot compensate for displacements into unfamiliar territory. Here we report, however, that the spiny lobster Panulirus argus oriented reliably towards a capture site when displaced 12-37 km to unfamiliar locations, even when deprived of all known orientation cues en route. Little is known about how lobsters and other animals determine position during true navigation. To test the hypothesis that lobsters derive positional information from the Earth's magnetic field, lobsters were exposed to fields replicating those that exist at specific locations in their environment. Lobsters tested in a field north of the capture site oriented themselves southwards, whereas those tested in a field south of the capture site oriented themselves northwards. These results imply that true navigation in spiny lobsters, and perhaps in other animals, is based on a magnetic map sense.

Representations built from a true geographic database

DEFF Research Database (Denmark)

Bodum, Lars

2005-01-01

the whole world in 3d and with a spatial reference given by geographic coordinates. Built on top of this is a customised viewer, based on the Xith(Java) scenegraph. The viewer reads the objects directly from the database and solves the question about Level-Of-Detail on buildings, orientation in relation...... a representation based on geographic and geospatial principles. The system GRIFINOR, developed at 3DGI, Aalborg University, DK, is capable of creating this object-orientation and furthermore does this on top of a true Geographic database. A true Geographic database can be characterized as a database that can cover...

True and False Memories, Parietal Cortex, and Confidence Judgments

Science.gov (United States)

Urgolites, Zhisen J.; Smith, Christine N.; Squire, Larry R.

2015-01-01

Recent studies have asked whether activity in the medial temporal lobe (MTL) and the neocortex can distinguish true memory from false memory. A frequent complication has been that the confidence associated with correct memory judgments (true memory) is typically higher than the confidence associated with incorrect memory judgments (false memory).…

Effects of Vehicle Weight and True Versus Indicated Airspeed on BVI Noise During Steady Descending Flight

Science.gov (United States)

Stephenson, James H.; Greenwood, Eric

2015-01-01

Blade-vortex interaction noise measurements are analyzed for an AS350B helicopter operated at 7000 ft elevation above sea level. Blade-vortex interaction (BVI) noise from four, 6 degree descent conditions are investigated with descents flown at 80 knot true and indicated airspeed, as well as 4400 and 3915 pound take-off weights. BVI noise is extracted from the acquired acoustic signals by way of a previously developed time-frequency analysis technique. The BVI extraction technique is shown to provide a better localization of BVI noise, compared to the standard Fourier transform integration method. Using this technique, it was discovered that large changes in BVI noise amplitude occurred due to changes in vehicle gross weight. Changes in BVI noise amplitude were too large to be due solely to changes in the vortex strength caused by varying vehicle weight. Instead, it is suggested that vehicle weight modifies the tip-path-plane angle of attack, as well as induced inflow, resulting in large variations of BVI noise. It was also shown that defining flight conditions by true airspeed, rather than indicated airspeed, provides more consistent BVI noise signals.

Effect of caecectomy on true metabolizable energy and lysine ...

African Journals Online (AJOL)

True metabolizable energy, conected for nitrogen retention. cfMEx) and true rysine avilabiliry, was determined for maize and sunflower oilcake o,?, t*o ,u*ii"s of each, *O in-r*ples of fishmeal, soyabean oilcake -"ur -a sorghum meal using intact and caecectomized roosters. The roosters were allowed ad tibitum intake over a ...

True Umbilical Cord Knot Leading to Fetal Demise | Ikechebelu ...

African Journals Online (AJOL)

The incidence of true knot of the umbilical cord is not only very low but it is often undiagnosed antenatally when present despite the availability of prenatal ultrasonography. When the true knot remains tight, it may impede the circulation of the fetus and may result to fetal death in utero especially in labor. We report a very ...

Electrically tunable photonic true-time-delay line.

Science.gov (United States)

Barmenkov, Yuri O; Cruz, José Luis; Díez, Antonio; Andrés, Miguel V

2010-08-16

We present a new application of the acousto-optic superlattice modulation of a fiber Bragg grating based on the dynamic phase and group delay properties of this fiber-optic component. We demonstrate a tunable photonic true-time-delay line based on the group delay change of the light reflected from the grating sidebands. The delay is electrically tuned by adjusting the voltage applied to a piezoelectric transducer that generates the acoustic wave propagating along the grating. In our experiments, a true-time delay of 400 ps is continuously adjusted (300 ps within the 3 dB amplitude range of the first sideband), using a 12 cm long uniform grating.

Determination of true coincidence correction factors using Monte-Carlo simulation techniques

Directory of Open Access Journals (Sweden)

Chionis Dionysios A.

2014-01-01

Full Text Available Aim of this work is the numerical calculation of the true coincidence correction factors by means of Monte-Carlo simulation techniques. For this purpose, the Monte Carlo computer code PENELOPE was used and the main program PENMAIN was properly modified in order to include the effect of the true coincidence phenomenon. The modified main program that takes into consideration the true coincidence phenomenon was used for the full energy peak efficiency determination of an XtRa Ge detector with relative efficiency 104% and the results obtained for the 1173 keV and 1332 keV photons of 60Co were found consistent with respective experimental ones. The true coincidence correction factors were calculated as the ratio of the full energy peak efficiencies was determined from the original main program PENMAIN and the modified main program PENMAIN. The developed technique was applied for 57Co, 88Y, and 134Cs and for two source-to-detector geometries. The results obtained were compared with true coincidence correction factors calculated from the "TrueCoinc" program and the relative bias was found to be less than 2%, 4%, and 8% for 57Co, 88Y, and 134Cs, respectively.

The Use of Dexamethasone in Support of High-Altitude Ground Operations and Physical Performance: Review of the Literature

Science.gov (United States)

2014-12-01

rates vary dramatically, the physiological effect of hypobaric high-altitude hypoxia (HHH) is ubiquitous.1,2 Symptoms of less severe cases of HHH...staff member on a quarterly basis at the UHM Fellowship Program and Multiplace Hyperbaric Chamber Wilford Hall San Anto- nio MHS, Texas. Initially...oc- cupational, and undersea hyperbaric medicine. Lt Col (Ret) Wright, PhD, CAsP, is a full-time faculty member at the USAF School of Aerospace

The True Self: A Psychological Concept Distinct From the Self.

Science.gov (United States)

Strohminger, Nina; Knobe, Joshua; Newman, George

2017-07-01

A long tradition of psychological research has explored the distinction between characteristics that are part of the self and those that lie outside of it. Recently, a surge of research has begun examining a further distinction. Even among characteristics that are internal to the self, people pick out a subset as belonging to the true self. These factors are judged as making people who they really are, deep down. In this paper, we introduce the concept of the true self and identify features that distinguish people's understanding of the true self from their understanding of the self more generally. In particular, we consider recent findings that the true self is perceived as positive and moral and that this tendency is actor-observer invariant and cross-culturally stable. We then explore possible explanations for these findings and discuss their implications for a variety of issues in psychology.

Whole-genome sequencing of Campylobacter jejuni isolated from Danish routine human stool samples reveals surprising degree of clustering

DEFF Research Database (Denmark)

Joensen, K G; Kuhn, K G; Müller, L

2018-01-01

OBJECTIVES: Outbreaks of Campylobacter are traditionally considered to be rare, however rather than being the true nature of the disease, this may reflect our present inability to detect them. The aim of this study was to determine the genetic and epidemiological degree of clustering among Campyl...... of the most important cause of bacterial gastroenteritis in the industrialized world....

The true cost of electric power. Summary for policymakers

Energy Technology Data Exchange (ETDEWEB)

Burtraw, Dallas; Knupnick, Alan [Resources for the Future, Washington, DC (United States). Center for Energy Economics and Policy

2012-06-15

This report examines the various methods that have been used to measure 'true' costs of electricity generation technologies and looks at how such estimates can be used in company decision-making and public policy to ensure that investments are directed at the electricity generation methods with the lowest true costs to investors and society. In some geographic areas, adequate data and methods exist to make a solid estimate of the total social costs of energy production. In those places where the data or methods (or both) are less robust, it is possible to use a benefits transfer approach that still gives stakeholders important guidance about the scale of the true costs of their investments and to get started in formulating policies to incorporate those costs into the market price.

True and Fair View: Incentive or Inhibitor for Creative Accounting?

Directory of Open Access Journals (Sweden)

Ciocan Claudia-Cătălina

2017-01-01

Full Text Available The objective of accounting is to present information about the financial position, changes forthe financial position and performance of an economic entity and the financial statements mustpresent a true and fair view of the economic reality for the enterprise concerned. Creativeaccounting is a present issue, a phenomenon that increases users mistrust in financial statements,being considered a manipulation of figures in order to obtain a favorable image, far from beingtrue. In order to address this issue, we analyzed several definitions and forms of this concept, andfollowed how they relate to the objective of the true and fair view. The paper points out that theinteraction between creative accounting and true and fair view can be regarded in a double way:on one side, taking into account the influence of creative accounting on the objective of the trueand fair view, and, on the other side, considering the influence of the perception of the true and fairview on the choice of these techniques.

A Case of True Hermaphroditism Presenting as a Testicular Tumour

Directory of Open Access Journals (Sweden)

Michelle Ceci

2015-01-01

Full Text Available True hermaphroditism represents only 5% cases of all of disorders of sexual differentiation (DSD and usually present in early childhood with ambiguous genitalia. Occasionally, cases might present later on in adolescence with problems of sexual maturation. Our case report presents a true hermaphrodite with normal male phenotype that presented as a left testicular mass, two years after being diagnosed with Sertoli cell only syndrome in the contralateral testis. Histological examination of the left testis showed ovarian, fallopian tube, myometrial, endometrial, and epididymal tissue. This combination of findings is found in approximately one-third of true hermaphrodites, but it is very rare to present clinically as an inguinoscrotal mass.

Cosmic chirality both true and false.

Science.gov (United States)

Barron, Laurence D

2012-12-01

The discrete symmetries of parity P, time reversal T, and charge conjugation C may be used to characterize the properties of chiral systems. It is well known that parity violation infiltrates into ordinary matter via an interaction between the nucleons and electrons, mediated by the Z(0) particle, that lifts the degeneracy of the mirror-image enantiomers of a chiral molecule. Being odd under P but even under T, this P-violating interaction exhibits true chirality and so may induce absolute enantioselection under all circumstances. It has been suggested that CP violation may also infiltrate into ordinary matter via a P-odd, T-odd interaction mediated by the (as yet undetected) axion. This CP-violating interaction exhibits false chirality and so may induce absolute enantioselection in processes far from equilibrium. Both true and false cosmic chirality should be considered together as possible sources of homochirality in the molecules of life. Copyright © 2012 Wiley Periodicals, Inc.

Endovascular treatment of ruptured true posterior communicating artery aneurysms.

Science.gov (United States)

Yang, Yonglin; Su, Wandong; Meng, Qinghai

2015-01-01

Although true posterior communicating artery (PCoA) aneurysms are rare, they are of vital importance. We reviewed 9 patients with this fatal disease, who were treated with endovascular embolization, and discussed the meaning of endovascular embolization for the treatment of true PCoA aneurysms. From September 2006 to May 2012, 9 patients with digital substraction angiography (DSA) confirmed true PCoA aneurysms were treated with endovascular embolization. Patients were followed-up with a minimal duration of 17 months and assessed by Glasgow Outcome Scale (GOS) score. All the patients presented with spontaneous subarachnoid hemorrhage from the ruptured aneurysms. The ratio of males to females was 1:2, and the average age of onset was 59.9 (ranging from 52 to 72) years. The preoperative Hunt-Hess grade scores were I to III. All patients had recovered satisfactorily. No permanent neurological deficits were left. Currently, endovascular embolization can be recommended as the top choice for the treatment of most true PCoA aneurysms, due to its advanced technique, especially the application of the stent-assisted coiling technique, combined with its advantage of mininal invasiveness and quick recovery. However, the choice of treatment methods should be based on the clinical and anatomical characteristics of the aneurysm and the skillfulness of the surgeon.

TH-EF-BRB-10: Dosimetric Validation of a Trajectory Based Cranial SRS Treatment Technique On a Varian TrueBeam Linac

Energy Technology Data Exchange (ETDEWEB)

Wilson, B [University of British Columbia, Vancouver, BC (Canada); Vancouver Cancer Centre, Vancouver, BC (Canada); Gete, E [Vancouver Cancer Centre, Vancouver, BC (Canada)

2016-06-15

Purpose: This work investigates the dosimetric accuracy of a trajectory based delivery technique in which an optimized radiation beam is delivered along a Couch-Gantry trajectory that is formed by simultaneous rotation of the linac gantry and the treatment couch. Methods: Nine trajectory based cranial SRS treatment plans were created using in-house optimization software. The plans were calculated for delivery on the TrueBeam STx linac with 6MV photon beam. Dose optimization was performed along a user-defined trajectory using MLC modulation, dose rate modulation and jaw tracking. The pre-defined trajectory chosen for this study is formed by a couch rotation through its full range of 180 degrees while the gantry makes four partial arc sweeps which are 170 degrees each. For final dose calculation, the trajectory based plans were exported to the Varian Eclipse Treatment Planning System. The plans were calculated on a homogeneous cube phantom measuring 18.2×18.2×18.2 cm3 with the analytical anisotropic algorithm (AAA) using a 1mm3 calculation voxel. The plans were delivered on the TrueBeam linac via the developer’s mode. Point dose measurements were performed on 9 patients with the IBA CC01 mini-chamber with a sensitive volume of 0.01 cc. Gafchromic film measurements along the sagittal and coronal planes were performed on three of the 9 treatment plans. Point dose values were compared with ion chamber measurements. Gamma analysis comparing film measurement and AAA calculations was performed using FilmQA Pro. Results: The AAA calculations and measurements were in good agreement. The point dose difference between AAA and ion chamber measurements were within 2.2%. Gamma analysis test pass rates (2%, 2mm passing criteria) for the Gafchromic film measurements were >95%. Conclusion: We have successfully tested TrueBeam’s ability to deliver accurate trajectory based treatments involving simultaneous gantry and couch rotation with MLC and dose rate modulation along the

True Faith in Faith and Knowledge

NARCIS (Netherlands)

Jonkers, P.H.A.I.

2003-01-01

This article deals with the diverging conceptions of faith that Hegel discusses in his essay Faith and Knowledge (1802). In order to modify the usual, negative image of Hegel’s attitude towards faith, which stresses its reflective character, I analyze his idea of a ‘true faith’. My conclusion is

Frege on Truths, Truth and the True

Directory of Open Access Journals (Sweden)

Wolfgang Künne

2008-08-01

Full Text Available The founder of modern logic and grandfather of analytic philosophy was 70 years old when he published his paper 'Der Gedanke' (The Thought in 1918. This essay contains some of Gottlob Frege's deepest and most provocative reflections on the concept of truth, and it will play a prominent role in my lectures. The plan for my lectures is as follows. What is it that is (primarily true or false? 'Thoughts', is Frege's answer. In §1, I shall explain and defend this answer. In §2, I shall briefly consider his enthymematic argument for the conclusion that the word 'true' resists any attempt at defining it. In §3, I shall discuss his thesis that the thought that things are thus and so is identical with the thought that it is true that things are thus and so. The reasons we are offered for this thesis will be found wanting. In §4, I shall comment extensively on Frege's claim that, in a non-formal language like the one I am currently trying to speak, we can say whatever we want to say without ever using the word 'true' or any of its synonyms. I will reject the propositional-redundancy claim, endorse the assertive-redundancy claim and deny the connection Frege ascribes to them. In his classic 1892 paper 'Über Sinn und Bedeutung' (On Sense and Signification Frege argues that truth-values are objects. In §5, I shall scrutinize his argument. In §6, I will show that in Frege's ideography (Begriffsschrift truth, far from being redundant, is omnipresent. The final §7 is again on truth-bearers, this time as a topic in the theory of intentionality and in metaphysics. In the course of discussing Frege's views on the objecthood, the objectivity of thoughts and the timelessness of truth(s, I will plead for a somewhat mitigated Platonism.

On-line Learning of Unlearnable True Teacher through Mobile Ensemble Teachers

Science.gov (United States)

Hirama, Takeshi; Hukushima, Koji

2008-09-01

The on-line learning of a hierarchical learning model is studied by a method based on statistical mechanics. In our model, a student of a simple perceptron learns from not a true teacher directly, but ensemble teachers who learn from a true teacher with a perceptron learning rule. Since the true teacher and ensemble teachers are expressed as nonmonotonic and simple perceptrons, respectively, the ensemble teachers go around the unlearnable true teacher with the distance between them fixed in an asymptotic steady state. The generalization performance of the student is shown to exceed that of the ensemble teachers in a transient state, as was shown in similar ensemble-teachers models. Furthermore, it is found that moving the ensemble teachers even in the steady state, in contrast to the fixed ensemble teachers, is efficient for the performance of the student.

Neural Global Pattern Similarity Underlies True and False Memories.

Science.gov (United States)

Ye, Zhifang; Zhu, Bi; Zhuang, Liping; Lu, Zhonglin; Chen, Chuansheng; Xue, Gui

2016-06-22

The neural processes giving rise to human memory strength signals remain poorly understood. Inspired by formal computational models that posit a central role of global matching in memory strength, we tested a novel hypothesis that the strengths of both true and false memories arise from the global similarity of an item's neural activation pattern during retrieval to that of all the studied items during encoding (i.e., the encoding-retrieval neural global pattern similarity [ER-nGPS]). We revealed multiple ER-nGPS signals that carried distinct information and contributed differentially to true and false memories: Whereas the ER-nGPS in the parietal regions reflected semantic similarity and was scaled with the recognition strengths of both true and false memories, ER-nGPS in the visual cortex contributed solely to true memory. Moreover, ER-nGPS differences between the parietal and visual cortices were correlated with frontal monitoring processes. By combining computational and neuroimaging approaches, our results advance a mechanistic understanding of memory strength in recognition. What neural processes give rise to memory strength signals, and lead to our conscious feelings of familiarity? Using fMRI, we found that the memory strength of a given item depends not only on how it was encoded during learning, but also on the similarity of its neural representation with other studied items. The global neural matching signal, mainly in the parietal lobule, could account for the memory strengths of both studied and unstudied items. Interestingly, a different global matching signal, originated from the visual cortex, could distinguish true from false memories. The findings reveal multiple neural mechanisms underlying the memory strengths of events registered in the brain. Copyright © 2016 the authors 0270-6474/16/366792-11$15.00/0.

Apparent and true resistant hypertension: definition, prevalence and outcomes.

Science.gov (United States)

Judd, E; Calhoun, D A

2014-08-01

Resistant hypertension, defined as blood pressure (BP) remaining above goal despite the use of > or =3 antihypertensive medications at maximally tolerated doses (one ideally being a diuretic) or BP that requires > or =4 agents to achieve control, has received more attention with increased efforts to improve BP control rates and the emergence of device-based therapies for hypertension. This classically defined resistant group consists of patients with true resistant hypertension, controlled resistant hypertension and pseudo-resistant hypertension. In studies where pseudo-resistant hypertension cannot be excluded (for example, 24-h ambulatory BP not obtained), the term apparent resistant hypertension has been used to identify 'apparent' lack of control on > or =3 medications. Large, well-designed studies have recently reported the prevalence of resistant hypertension. Pooling prevalence data from these studies and others within North America and Europe with a combined sample size of >600,000 hypertensive participants, the prevalence of resistant hypertension is 14.8% of treated hypertensive patients and 12.5% of all hypertensives. However, the prevalence of true resistant hypertension, defined as uncontrolled both by office and 24-h ambulatory BP monitoring with confirmed medication adherence, may be more meaningful in terms of identifying risk and estimating benefit from newer therapies like renal denervation. Rates of cardiovascular events and mortality follow mean 24-h ambulatory BPs in patients with resistant hypertension, and true resistant hypertension represents the highest risk. The prevalence of true resistant hypertension has not been directly measured in large trials; however, combined data from smaller studies suggest that true resistant hypertension is present in half of the patients with resistant hypertension who are uncontrolled in the office. Our pooled analysis shows prevalence rates of 10.1% and 7.9% for uncontrolled resistant hypertension among

Degree-degree correlations in directed networks with heavy-tailed degrees

NARCIS (Netherlands)

van der Hoorn, W.L.F.; Litvak, Nelli

2013-01-01

In network theory, Pearson's correlation coefficients are most commonly used to measure the degree assortativity of a network. We investigate the behavior of these coefficients in the setting of directed networks with heavy-tailed degree sequences. We prove that for graphs where the in- and

Differentiating true and false schematic memories in older adults.

Science.gov (United States)

Webb, Christina E; Dennis, Nancy A

2018-02-06

While schemas aid memory for schematically related information, the gist induced by the schema can also lead to high rates of false memories, especially in older adults. The neural mechanisms that support and differentiate true and false memories in aging are not well understood. The current study sought to clarify this, using a novel scene paradigm to investigate the role of schemas on true and false memories in older adults. Healthy older adults encoded schematic scenes (e.g., bathroom). At retrieval, participants were tested on their memory for both schematic and non-schematic targets and lures while fMRI data was collected. Results indicate that true memories were supported by the typical retrieval network, and activity in this network was greater for true than false memories. Schema specific retrieval was supported by mPFC, extending this common finding to aging. While no region differentiated false memories compared to correct rejections, results showed that individual differences in false memory rates were associated with variability in neural activity. The findings underscore the importance of elucidating the neural basis of cognition within older adults, as well as the specific contribution of individual differences to the neural basis of memory errors in aging. © The Author(s) 2018. Published by Oxford University Press on behalf of The Gerontological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

Degree-degree dependencies in directed networks with heavy-tailed degrees

NARCIS (Netherlands)

van der Hoorn, W.L.F.; Litvak, Nelly

2015-01-01

In network theory, Pearson’s correlation coefficients are most commonly used to measure the degree assortativity of a network. We investigate the behavior of these coefficients in the setting of directed networks with heavy-tailed degree sequences. We prove that for graphs where the in- and

Estimating true instead of apparent survival using spatial Cormack-Jolly-Seber models

Science.gov (United States)

Schaub, Michael; Royle, J. Andrew

2014-01-01

Survival is often estimated from capture–recapture data using Cormack–Jolly–Seber (CJS) models, where mortality and emigration cannot be distinguished, and the estimated apparent survival probability is the product of the probabilities of true survival and of study area fidelity. Consequently, apparent survival is lower than true survival unless study area fidelity equals one. Underestimation of true survival from capture–recapture data is a main limitation of the method.

Near-infrared spectroscopy assessment of divided visual attention task-invoked cerebral hemodynamics during prolonged true driving

Science.gov (United States)

Li, Ting; Zhao, Yue; Sun, Yunlong; Gao, Yuan; Su, Yu; Hetian, Yiyi; Chen, Min

2015-03-01

Driver fatigue is one of the leading causes of traffic accidents. It is imperative to develop a technique to monitor fatigue of drivers in real situation. Near-infrared spectroscopy (fNIRS) is now capable of measuring brain functional activity noninvasively in terms of hemodynamic responses sensitively, which shed a light to us that it may be possible to detect fatigue-specified brain functional activity signal. We developed a sensitive, portable and absolute-measure fNIRS, and utilized it to monitor cerebral hemodynamics on car drivers during prolonged true driving. An odd-ball protocol was employed to trigger the drivers' visual divided attention, which is a critical function in safe driving. We found that oxyhemoglobin concentration and blood volume in prefrontal lobe dramatically increased with driving duration (stand for fatigue degree; 2-10 hours), while deoxyhemoglobin concentration increased to the top at 4 hours then decreased slowly. The behavior performance showed clear decrement only after 6 hours. Our study showed the strong potential of fNIRS combined with divided visual attention protocol in driving fatigue degree monitoring. Our findings indicated the fNIRS-measured hemodynamic parameters were more sensitive than behavior performance evaluation.

Psychometric Functioning of the MMPI-2-RF VRIN-r and TRIN-r Scales with Varying Degrees of Randomness, Acquiescence, and Counter-Acquiescence

Science.gov (United States)

Handel, Richard W.; Ben-Porath, Yossef S.; Tellegen, Auke; Archer, Robert P.

2010-01-01

In the present study, the authors evaluated the effects of increasing degrees of simulated non-content-based (random or fixed) responding on scores on the newly developed Variable Response Inconsistency-Revised (VRIN-r) and True Response Inconsistency-Revised (TRIN-r) scales of the Minnesota Multiphasic Personality Inventory-2 Restructured Form…

Filing false vice reports: Distinguishing true from false allegations of rape

NARCIS (Netherlands)

de Zutter, A.; Horselenberg, R.; van Koppen, P.J.

2017-01-01

False allegations constitute a problem since they may cause harm. To study the difference between true and false allegations we used a quasi-experimental approach. In the control condition likely true allegations were retrieved from criminal files. The victims, all female, were between the ages of

Reactivity of coal chars prepared in a fluidised bed reactor at different burn-off degrees

Energy Technology Data Exchange (ETDEWEB)

Moreno, A.H.; Arenillas, A.; Rubiera, F.; Fuente, E.; Pis, J.J. [Inst. Nacional del Carbon, Oviedo (Spain)

1997-12-31

The main goal of this work has been to study the effect of the textural properties of coal chars, obtained from partially burned coal, on their reactivity to oxygen. A low volatile bituminous coal was used to prepare chars, with different levels of burn-off, in a bench-scale fluidised bed reactor. Textural characterisation of the samples was accomplished by measuring true (helium) and apparent (mercury) densities, and mercury porosimetry. An increase in the burn-off degree gave rise to a densification of the chars. Porosity development greatly changed during progressive burning of the samples. DTG burning profiles and isothermal gasification were utilised to estimate the reactivities of the precursor coal and its partially burned chars. Reactivity reached a maximum value at an intermediate burn-off and strongly decreased at higher burn-off degrees. (orig.)

Dishonest responding or true virtue?

DEFF Research Database (Denmark)

Zettler, Ingo; Hilbig, Benjamin E.; Moshagen, Morten

2015-01-01

but troubling proposition that high scores in impression management scales actually reflect honesty rather than dishonest responding. In line with findings indicating that respondents answer to personality questionnaires rather accurately in typical low demand situations, we herein suggest that high impression...... management scores indeed reflect true virtues rather than dishonesty under such conditions. We found support for this idea by replicating previous correlations between impression management scores and virtue-related basic personality traits (including honesty-humility), and additionally provided conclusive...

Emotional content enhances true but not false memory for categorized stimuli.

Science.gov (United States)

Choi, Hae-Yoon; Kensinger, Elizabeth A; Rajaram, Suparna

2013-04-01

Past research has shown that emotion enhances true memory, but that emotion can either increase or decrease false memory. Two theoretical possibilities-the distinctiveness of emotional stimuli and the conceptual relatedness of emotional content-have been implicated as being responsible for influencing both true and false memory for emotional content. In the present study, we sought to identify the mechanisms that underlie these mixed findings by equating the thematic relatedness of the study materials across each type of valence used (negative, positive, or neutral). In three experiments, categorically bound stimuli (e.g., funeral, pets, and office items) were used for this purpose. When the encoding task required the processing of thematic relatedness, a significant true-memory enhancement for emotional content emerged in recognition memory, but no emotional boost to false memory (exp. 1). This pattern persisted for true memory with a longer retention interval between study and test (24 h), and false recognition was reduced for emotional items (exp. 2). Finally, better recognition memory for emotional items once again emerged when the encoding task (arousal ratings) required the processing of the emotional aspect of the study items, with no emotional boost to false recognition (EXP. 3). Together, these findings suggest that when emotional and neutral stimuli are equivalently high in thematic relatedness, emotion continues to improve true memory, but it does not override other types of grouping to increase false memory.

PLATONISTS AND GNOSTICS ON NEGATIVE THEOLOGY AND TRUE INNER SELF

Directory of Open Access Journals (Sweden)

VICTOR ALEXANDRU PRICOPI

2014-11-01

Full Text Available Late Antiquity is characterized by a strong search for human’s true nature. This is proper to almost all philosophical and religious movements in the first three Christian centuries. Christians, Gnostics, and philosophers of those days aim to find the true nature of man. In this study we will deal mainly with anthropology and gnoseology of Valentinian Gnostics and Platonists. In their case, knowledge of human nature is inextricably linked to knowledge of God's true nature. These thinkers say that the first Principle/the Father/the source of this universe is inherently unknowable, indescribable and unspeakable. However, God can be known, either through secret revelation (Gnostics or through a purely rational approach (Platonists. For these thinkers, the true knowledge of the Divine Principle and knowledge of the human being or the world we live in is carried out in a double sense. By knowing God is possible the knowledge of human nature, while knowing human nature unfolds the nature of the first Principle. This is due to the fact that although the creator is alien to this world, he is now here through man true nature. In other words, in man there is a spark of the divine that has fallen or was dropped in the sublunary world. These ideas are found in Plato’s Phaedrus, Meno or Phaedo and also in some Valentinian gnostic texts as Gospel of Truth, Tripartite Tractate, Gospel of Philip and Treatise on Resurrection. Therefore, in this paper we will analyze the Platonists conceptions about human nature in comparison to Gnostic conception of man, as it appears in Plato’s works and Coptic texts discovered in Egypt, at Nag Hammadi.

Chemical composition, true metabolisable energy content and ...

African Journals Online (AJOL)

The physical characteristics (thousand seed and hectolitre mass), chemical composition (dry matter, ash, crude protein (CP), ether extract, acid detergent fibre, neutral detergent fibre and mineral content), energy values (nitrogen corrected true metabolisable energy content (TMEn for roosters)) as well as the lysine and ...

Is It True That Smoking Causes Wrinkles?

Science.gov (United States)

Healthy Lifestyle Quit smoking Is it true that smoking causes wrinkles? Answers from J. Taylor Hays, M.D. Yes. So if you need another reason to motivate ... elastin, which are fibers that give your skin its strength and elasticity. As a result, skin begins ...

Higgs boson pair production at the photon linear collider in the two Higgs doublet model

International Nuclear Information System (INIS)

Asakawa, Eri; Harada, Daisuke; Okada, Yasuhiro; Kanemura, Shinya; Tsumura, Koji

2009-02-01

We calculate the cross section of the lightest Higgs boson pair production at the Photon Linear Collider in the two Higgs doublet model. We focus on the scenario in which the lightest Higgs boson has the standard model like couplings to gauge bosons. We take into account the one-loop correction to the hhh coupling as well as additional one-loop diagrams due to charged bosons to the γγ → hh helicity amplitudes. We discuss the impact of these corrections on the hhh coupling measurement at the Photon Linear Collider. (author)

Chemical composition, true nutrient digestibility, and true metabolizable energy of novel pet food protein sources using the precision-fed cecectomized rooster assay.

Science.gov (United States)

Deng, P; Utterback, P L; Parsons, C M; Hancock, L; Swanson, K S

2016-08-01

A wide variety of animal protein-based ingredients is commonly used in the pet food products. The raw ingredients and processing procedures used may greatly affect protein quality. Testing the quality of alternative protein sources is necessary and contributes to the sustainability of pet foods. The objective of this study was to test the chemical composition of 8 protein sources intended for use in dog and cat foods (calamari meal, pork peptone, alligator meal, lamb meal, venison meal, chicken meal, and 2 duck meals), and evaluate their true nutrient digestibility and nitrogen-corrected true ME (TMEn) using the precision-fed cecectomized rooster assay. Calamari meal and pork peptone had lower ash (4.4 and 3.6% of DM, respectively) but greater CP (88.1 and 80.5% of DM, respectively) and either greater or similar GE (5.6 and 5.3 kcal/g of DM, respectively) compared with alligator, lamb, venison, chicken, and duck meals (11.8 to 24.5% ash, 58.7 to 65.9% CP, and 4.6 to 5.3 kcal GE/g). Acid-hydrolyzed fat (AHF) was lower in calamari meal (8.7% of DM) compared with the other proteins tested (15.5-22.1% of DM). True nutrient digestibility was variable among the protein sources (52 to 79% of DM, 60 to 83% of OM, 78 to 92% of AHF, and 70 to 89% of GE) with pork peptone having the highest DM, AHF, and GE digestibility and calamari meal having the highest OM digestibility. True indispensable AA digestibility was highest for calamari meal, with all AA having a digestibility greater than 90%. Except for histidine, all indispensable AA had a digestibility over 85% for pork peptone. In contrast, true indispensable AA digestibility was lowest for lamb meal, with histidine having digestibility less than 70% and the other entire indispensable AA having digestibility between 72 and 88%. The TMEn of calamari meal (4.82 kcal/g DM and 86.9% of GE) was greater ( digestibility among protein sources intended for use in dog and cat foods and justifies further in vivo testing of novel

Studies on the true coincidence correction in measuring filter samples by gamma spectrometry

CERN Document Server

Lian Qi; Chang Yong Fu; Xia Bing

2002-01-01

The true coincidence correction in measuring filter samples has been studied by high efficiency HPGe gamma detectors. The true coincidence correction for a specific three excited levels de-excitation case has been analyzed, and the typical analytical expressions of true coincidence correction factors have been given. According to the measured relative efficiency on the detector surface with 8 'single' energy gamma emitters and efficiency of filter samples, the peak and total efficiency surfaces are fitted. The true coincidence correction factors of sup 6 sup 0 Co and sup 1 sup 5 sup 2 Eu calculated by the efficiency surfaces agree well with experimental results

Journalism as Justified True Belief

OpenAIRE

Lisboa, Sílvia; Benetti, Marcia

2015-01-01

If it is important to think of journalism as a form of knowledge, then how does it become knowledge? How does this process work? In order to answer this question, this article proposes a new understanding of journalism as a subject; presenting it as a justified true belief. We think of journalism being based on pillars of truth and justification, conditions necessary in order for Epistemology to grant it the status of knowledge. We address the concept of truth and show how journalistic report...

A True Human Tail in a Neonate; Case report and literature review

Directory of Open Access Journals (Sweden)

Mahesh K. Pillai

2017-03-01

Full Text Available A true human tail is a benign vestigial caudal cutaneous structure composed of adipose, connective tissue, muscle, vessels, nerves and mechanoreceptors. A true human tail can be distinguished from a pseudotail as the latter is commonly associated with underlying spinal dysraphism, which requires specialised management. True human tails are very rare, with fewer than 40 cases reported to date. We report a healthy one-day-old male newborn who was referred to the Bharath Hospital, Kottayam, Kerala, India, in 2014 with a cutaneous appendage arising from the lumbosacral region. Magnetic resonance imaging of the spine ruled out spinal dysraphism. The appendage was removed by simple surgical excision. Clinicians should emphasise use of ‘true tail’ and ‘pseudotail’ as specific disparate terms as the clinical, radiological and histological findings of these conditions differ significantly, along with management strategies and outcomes.

Usefulness of true FISP cine MR imaging in patients with poor cardiac function

Energy Technology Data Exchange (ETDEWEB)

Sakuma, Toshiharu; Yamada, Naoaki; Motooka, Makoto; Enomoto, Naoyuki; Maeshima, Isamu; Matsuda, Kazuhide; Urayama, Shinichi; Ikeo, Miki [National Cardiovascular Center, Suita, Osaka (Japan)

2002-01-01

This study was done to assess the value of True FISP cine in patients with poor cardiac function. True FISP cine and FLASH cine imaging were performed on a 1.5 T machine. Both short axis and horizontal long axis imaging sections were used. The imaging sections used a Matrix (120 x 128), FOV (24 x 32 cm), and had a slice thickness of 8 mm. The imaging time for True FISP cine was 8 heart beats and 17 heart beats for FLASH cine. The contrast-to-noise ratio between the blood and myocardium (CNR) was measured at enddiastole and endsystole. The subjects in the study were 10 healty volunteers (average age 26.5{+-}3.2 years) and 12 patients with hypofunction (average age 53.9{+-}13.2 years). In the volunteers, the CNR of the short axis imaging was similar in both True FISP (24.6{+-}3.7) and FLASH (23.4{+-}5.9). In the patients with poor cardiac function however, the CNR of True FISP was larger than FLASH in both the short and long axis. In the short axis (22.7{+-}6.1 vs. 17.9{+-}5.3, P<0.01) and in the long axis (17.4{+-}4.3 vs. 9.3{+-}4.0, P<0.01). We conclude that True FISP cine has a higher contrast in a shorter imaging time than FLASH cine. True FISP cine is especially useful in patients with poor cardiac function. (author)

The "True and fair view" concept in Lithuanian accounting regulation

OpenAIRE

Rudžionienė, Kristina; Christauskas, Česlovas

2010-01-01

The "true and fair view" concept is very popular in the professional accountants’ language. After theoretical analysis of the "true and fair view" concept it was made research how understanding of this concept was created in Lithuanian accounting regulation. The stated purpose of financial statements is taken from the United Kingdom, and is different in the particular formulation. Additionally, it is not explained anywhere what it is and how to reach it. There are not specifically defined qua...

Magnetic field control of 90 Degree-Sign , 180 Degree-Sign , and 360 Degree-Sign domain wall resistance

Energy Technology Data Exchange (ETDEWEB)

Majidi, Roya, E-mail: royamajidi@gmail.com [Department of Physics, Shahid Rajaee Teacher Training University, Lavizan, 16788-15811 Tehran (Iran, Islamic Republic of)

2012-10-01

In the present work, we have compared the resistance of the 90 Degree-Sign , 180 Degree-Sign , and 360 Degree-Sign domain walls in the presence of external magnetic field. The calculations are based on the Boltzmann transport equation within the relaxation time approximation. One-dimensional Neel-type domain walls between two domains whose magnetization differs by angle of 90 Degree-Sign , 180 Degree-Sign , and 360 Degree-Sign are considered. The results indicate that the resistance of the 360 Degree-Sign DW is more considerable than that of the 90 Degree-Sign and 180 Degree-Sign DWs. It is also found that the domain wall resistance can be controlled by applying transverse magnetic field. Increasing the strength of the external magnetic field enhances the domain wall resistance. In providing spintronic devices based on magnetic nanomaterials, considering and controlling the effect of domain wall on resistivity are essential.

Diagnostic pitfalls associated with a large true posterior communicating artery aneurysm: a case report.

Science.gov (United States)

Nagatani, Kimihiro; Otani, Naoki; Seno, Soichiro; Takeuchi, Satoru; Wada, Kojiro; Mori, Kentaro

2013-10-01

True posterior communicating artery (PCoA) aneurysm is an aneurysm that originates from the PCoA, and large or giant true PCoA aneurysms are rare. We report a case of a large true PCoA aneurysm successfully clipped after anterior clinoidectomy and discuss the diagnostic pitfalls associated with this rare clinical entity.

Usefulness of true FISP cine MR imaging in patients with poor cardiac function

International Nuclear Information System (INIS)

Sakuma, Toshiharu; Yamada, Naoaki; Motooka, Makoto; Enomoto, Naoyuki; Maeshima, Isamu; Matsuda, Kazuhide; Urayama, Shinichi; Ikeo, Miki

2002-01-01

This study was done to assess the value of True FISP cine in patients with poor cardiac function. True FISP cine and FLASH cine imaging were performed on a 1.5 T machine. Both short axis and horizontal long axis imaging sections were used. The imaging sections used a Matrix (120 x 128), FOV (24 x 32 cm), and had a slice thickness of 8 mm. The imaging time for True FISP cine was 8 heart beats and 17 heart beats for FLASH cine. The contrast-to-noise ratio between the blood and myocardium (CNR) was measured at enddiastole and endsystole. The subjects in the study were 10 healty volunteers (average age 26.5±3.2 years) and 12 patients with hypofunction (average age 53.9±13.2 years). In the volunteers, the CNR of the short axis imaging was similar in both True FISP (24.6±3.7) and FLASH (23.4±5.9). In the patients with poor cardiac function however, the CNR of True FISP was larger than FLASH in both the short and long axis. In the short axis (22.7±6.1 vs. 17.9±5.3, P<0.01) and in the long axis (17.4±4.3 vs. 9.3±4.0, P<0.01). We conclude that True FISP cine has a higher contrast in a shorter imaging time than FLASH cine. True FISP cine is especially useful in patients with poor cardiac function. (author)

THE CONFLICT BETWEEN THE TRUE AND FAIR VIEW AND THE PRUDENCE IN ROMANIAN ACCOUNTING

Directory of Open Access Journals (Sweden)

Violeta Isai

2015-05-01

Full Text Available In the accounts of Romania, the principle of true and fair view and the prudence principle are in a relationship of mutual conditioning. True and fair view has its origins in Anglo-Saxon accounting, the British, and English translation of the expression is "true and fair view". In the context of Romania's national, a first reference to the concept of true and fair view a we identify in the root Accounting Law No 82/1991 which lays down that objective accounting- ensuring accurate image, clear, and complete heritage of the financial situation and the results. Prudence is to be found in sincerity (in the direction of the present in the financial statements facts which might influence the recipient information and should serve the concept of true and fair view.

Posttraumatic True Aneurysm of the Axillary Artery Following Blunt Trauma

Directory of Open Access Journals (Sweden)

Tugrul Goncu

2010-01-01

Full Text Available The majority of the axillary artery aneurysm cases arise as pseudoaneurysms secondary to blunt or iatrogenic trauma. Isolated traumatic true axillary artery aneurysm is a relatively unusual disorder and generally occurs with repetitive blunt trauma. A 22-year-old female patient with distal axillary artery true aneurysm due to simple blunt axillothoracic trauma is presented. The aneurysm was excised with subpectoral-axillary approach and saphenous vein graft interposition was applied. Long-term follow-up with the patient was uneventful.

The Dream Comes True in the Golden Hall

Institute of Scientific and Technical Information of China (English)

JianZhong; ChenJianguo

2004-01-01

Nanjing Traditional Music Ensemble has long dreamed of performing in Vienna's Golden Hall.Now the dream has come true.the whole troupe felt so exciting that they did not even sleep well during the flight.

Mood-congruent true and false memory: effects of depression.

Science.gov (United States)

Howe, Mark L; Malone, Catherine

2011-02-01

The Deese/Roediger-McDermott paradigm was used to investigate the effect of depression on true and false recognition. In this experiment true and false recognition was examined across positive, neutral, negative, and depression-relevant lists for individuals with and without a diagnosis of major depressive disorder. Results showed that participants with major depressive disorder falsely recognised significantly more depression-relevant words than non-depressed controls. These findings also parallel recent research using recall instead of recognition and show that there are clear mood congruence effects for depression on false memory performance. © 2011 Psychology Press, an imprint of the Taylor & Francis Group, an Informa business

Radiation fibrosis : differentiation from true hilar mass on plain chest film

International Nuclear Information System (INIS)

Baik, Jun Hyun; Ahn, Kook Jin; Park, Seog Hee; Shinn, Kyung Sub

1996-01-01

Radiation-induced fibrotic mass might masquerade as a true hilar tumor mass on a plain chest radiograph. We attempted to differentiate radiation fibrosis from a true hilar tumor using only a plain radiograph. Plain chest radiographs were obtained from seven patients who had developed radiation fibrosis simulating hilar mass after radiation therapy for lung cancer, and from 19 patients with lung cancer, a comparison group, who had not received radiation therapy. They were reviewed for the obliteration of the overlapped mediastinal and hilar anatomical silhouettes by the mass : pulmonary artery, heart or aorta border, and paraspinal line. All seven patients with radiation-induced fibrotic mass(bilateral lesion in two patients) showed obliteration of all three overlapped anatomical silhouettes of the mediastinum and hilum on chest radiographs. In the comparison group of 19 patients with a true hilar mass, there was, however, no case which demonstrated obliteration of all landmarks, Obliteration of all anatomical landmarks at the hilum and mediastinum may be a helpful clue in the differential diagnosis of radiation-induced fibrotic mass from true hilar mass on a plain radiograph, particularly when clinical information on previous radiation therapy is unavailable

Semantic processes leading to true and false memory formation in schizophrenia.

Science.gov (United States)

Paz-Alonso, Pedro M; Ghetti, Simona; Ramsay, Ian; Solomon, Marjorie; Yoon, Jong; Carter, Cameron S; Ragland, J Daniel

2013-07-01

Encoding semantic relationships between items on word lists (semantic processing) enhances true memories, but also increases memory distortions. Episodic memory impairments in schizophrenia (SZ) are strongly driven by failures to process semantic relations, but the exact nature of these relational semantic processing deficits is not well understood. Here, we used a false memory paradigm to investigate the impact of implicit and explicit semantic processing manipulations on episodic memory in SZ. Thirty SZ and 30 demographically matched healthy controls (HC) studied Deese/Roediger-McDermott (DRM) lists of semantically associated words. Half of the lists had strong implicit semantic associations and the remainder had low strength associations. Similarly, half of the lists were presented under "standard" instructions and the other half under explicit "relational processing" instructions. After study, participants performed recall and old/new recognition tests composed of targets, critical lures, and unrelated lures. HC exhibited higher true memories and better discriminability between true and false memory compared to SZ. High, versus low, associative strength increased false memory rates in both groups. However, explicit "relational processing" instructions positively improved true memory rates only in HC. Finally, true and false memory rates were associated with severity of disorganized and negative symptoms in SZ. These results suggest that reduced processing of semantic relationships during encoding in SZ may stem from an inability to implement explicit relational processing strategies rather than a fundamental deficit in the implicit activation and retrieval of word meanings from patients' semantic lexicon. Copyright © 2013 Elsevier B.V. All rights reserved.

The system Cu-Rh-S at 900 degrees, 700 degrees, 540 degrees and 500 degrees C

DEFF Research Database (Denmark)

Karup-Møller, Sven; Makovicky, E.

2007-01-01

Phase relations in the dry condensed system Cu-Rh-S were determined at 900, 700, 540 and 500 degrees C. At 900 degrees C, the system contains digenite, four rhodium sulfides (Rh17S15, Rh3S4, Rh2S3 and RhS similar to 3), three ternary sulfides (CuRh2S4, CuxRhS3+x and a fibrous sulfide in the range...

Chemical composition, true metabolisable energy content and ...

African Journals Online (AJOL)

aneldavh

116. Chemical composition, true metabolisable energy content and amino acid availability of grain legumes for poultry. T.S. Brand. 1, 2,3#. , D.A. Brandt. 1, 2,4 and C.W. ... alternatives (Wiseman, 1987; Brand et al., 1995). ..... The Ca, P and trace element concentrations for lupins, faba beans and peas recorded in the present.

Chernobyl, the true, the false and the uncertain

International Nuclear Information System (INIS)

1996-04-01

This work makes the part between the true and the false information in France about the Chernobyl accident that have been read in different newspapers during the last years. This document is divide in three parts: what is true, what is false, what is uncertain. In each part are noticed extracts from newspapers face to the synthesis of thoughts about them. It is the fourth edition, the first one was in April 1990, the second one was in 1992 after a report from IAEA on the radiological consequences, the third edition was born in 1994 with the emergence of thyroid cancers especially among children, this fourth edition of 1996 takes into account the sanitary report given by the World Health Organisation experts in 1995. It confirms the progression of thyroid cancers and the absence of any other cancer as well leukemia. (N.C.)

MODEL PENSKORAN PARTIAL CREDIT PADA BUTIR MULTIPLE TRUE-FALSE BIDANG FISIKA

OpenAIRE

Wasis Wasis

2013-01-01

Tujuan penelitian ini menghasilkan model penskoran politomus untuk respons butir multiple true-false, sehingga dapat mengestimasi secara lebih akurat kemampuan di bidang fisika. Pengembangan penskoran menggunakan Four-D model dan diuji akurasinya melalui penelitian empiris dan simulasi. Penelitian empiris menggunakan 15 butir multiple true-false yang diambil dari soal UMPTN tahun 1996-2006 dan dikenakan pada 410 mahasiswa baru FMIPA Universitas Negeri Surabaya angkatan tahun 2007. Respons pes...

Estimating True Short-Term Consistency in Vocational Interests: A Longitudinal SEM Approach

Science.gov (United States)

Gaudron, Jean-Philippe; Vautier, Stephane

2007-01-01

This study aimed at estimating the correlation between true scores (true consistency) of vocational interest over a short time span in a sample of 1089 adults. Participants were administered 54 items assessing vocational, family, and leisure interests twice over a 1-month period. Responses were analyzed with a multitrait (MT) model, which supposes…

When Graduate Degrees Prostitute the Educational Process: Degrees Gone Wild

Science.gov (United States)

Lumadue, Richard T.

2006-01-01

Graduate degrees prostitute the educational process when they are sold to consumers by unaccredited degree/diploma mills as being equivalent to legitimate, bona-fide degrees awarded by accredited graduate schools. This article carefully analyzes the serious problems of bogus degrees and their association with the religious higher education…

A True Open-Loop Synchronization Technique

DEFF Research Database (Denmark)

Golestan, Saeed; Vidal, Ana; Yepes, Alejandro G.

2016-01-01

Synchronization techniques can be broadly classified into two major categories: Closed-loop and open-loop methods. The open-loop synchronization (OLS) techniques, contrary to the closed-loop ones, are unconditionally stable and benefit from a fast dynamic response. Their performance, however, tends...... is to develop a true OLS (and therefore, unconditionally stable) technique without any need for the calculation of sine and cosine functions. The effectiveness of the proposed synchronization technique is confirmed through the simulation and experimental results....

True Orthophoto Generation from Aerial Frame Images and LiDAR Data: An Update

Directory of Open Access Journals (Sweden)

Hamid Gharibi

2018-04-01

Full Text Available Image spectral and Light Detection and Ranging (LiDAR positional information can be related through the orthophoto generation process. Orthophotos have a uniform scale and represent all objects in their correct planimetric locations. However, orthophotos generated using conventional methods suffer from an artifact known as the double-mapping effect that occurs in areas occluded by tall objects. The double-mapping problem can be resolved through the commonly known true orthophoto generation procedure, in which an occlusion detection process is incorporated. This paper presents a review of occlusion detection methods, from which three techniques are compared and analyzed using experimental results. The paper also describes a framework for true orthophoto production based on an angle-based occlusion detection method. To improve the performance of the angle-based technique, two modifications to this method are introduced. These modifications, which aim at resolving false visibilities reported within the angle-based occlusion detection process, are referred to as occlusion extension and radial section overlap. A weighted averaging approach is also proposed to mitigate the seamline effect and spectral dissimilarity that may appear in true orthophoto mosaics. Moreover, true orthophotos generated from high-resolution aerial images and high-density LiDAR data using the updated version of angle-based methodology are illustrated for two urban study areas. To investigate the potential of image matching techniques in producing true orthophotos and point clouds, a comparison between the LiDAR-based and image-matching-based true orthophotos and digital surface models (DSMs for an urban study area is also presented in this paper. Among the investigated occlusion detection methods, the angle-based technique demonstrated a better performance in terms of output and running time. The LiDAR-based true orthophotos and DSMs showed higher qualities compared to their

Dose dependence of true stress parameters in irradiated bcc, fcc, and hcp metals

Science.gov (United States)

Byun, T. S.

2007-04-01

The dose dependence of true stress parameters has been investigated for nuclear structural materials: A533B pressure vessel steels, modified 9Cr-1Mo and 9Cr-2WVTa ferritic martensitic steels, 316 and 316LN stainless steels, and Zircaloy-4. After irradiation to significant doses, these alloys show radiation-induced strengthening and often experience prompt necking at yield followed by large necking deformation. In the present work, the critical true stresses for deformation and fracture events, such as yield stress (YS), plastic instability stress (PIS), and true fracture stress (FS), were obtained from uniaxial tensile tests or calculated using a linear strain-hardening model for necking deformation. At low dose levels where no significant embrittlement was detected, the true fracture stress was nearly independent of dose. The plastic instability stress was also independent of dose before the critical dose-to-prompt-necking at yield was reached. A few bcc alloys such as ferritic martensitic steels experienced significant embrittlement at doses above ∼1 dpa; and the true fracture stress decreased with dose. The materials fractured before yield at or above 10 dpa.

Measuring true localization accuracy in super resolution microscopy with DNA-origami nanostructures

International Nuclear Information System (INIS)

Reuss, Matthias; Blom, Hans; Brismar, Hjalmar; Fördős, Ferenc; Högberg, Björn; Öktem, Ozan

2017-01-01

A common method to assess the performance of (super resolution) microscopes is to use the localization precision of emitters as an estimate for the achieved resolution. Naturally, this is widely used in super resolution methods based on single molecule stochastic switching. This concept suffers from the fact that it is hard to calibrate measures against a real sample (a phantom), because true absolute positions of emitters are almost always unknown. For this reason, resolution estimates are potentially biased in an image since one is blind to true position accuracy, i.e. deviation in position measurement from true positions. We have solved this issue by imaging nanorods fabricated with DNA-origami. The nanorods used are designed to have emitters attached at each end in a well-defined and highly conserved distance. These structures are widely used to gauge localization precision. Here, we additionally determined the true achievable localization accuracy and compared this figure of merit to localization precision values for two common super resolution microscope methods STED and STORM. (paper)

An Explanation of True Dreams: Aristotle and Jung

Directory of Open Access Journals (Sweden)

Ali Sanai

2016-12-01

Full Text Available The naturalistic explanation of realized dream (or dreams that come true means that this phenomen will be explained regardless of supernatural agents. Aristotle in Parva naturalia and Jung in his works explained dream visionary. In this article by scrutiny on these thinkers’ theory, we will indicate the naturalistic approach to dream that is far- fetched for followers of metaphysics. In spite of this fact that Aristotle and Jung both belongs to different historical contexts, they have common aspects in terms of naturalistic method; in the universal or broad sense of word, but in terms of content both explain the true dream by the term “coincidence” or accidental conformity between objective events and psychological affairs. It also seems that the notion of Neutral monism in Jung is adaptive to Hylomorphism in Aristotle psychology, and this, provides a path for naturalistic approach to dream as one forms of consciousness.

Commercialized VCSEL components fabricated at TrueLight Corporation

Science.gov (United States)

Pan, Jin-Shan; Lin, Yung-Sen; Li, Chao-Fang A.; Chang, C. H.; Wu, Jack; Lee, Bor-Lin; Chuang, Y. H.; Tu, S. L.; Wu, Calvin; Huang, Kai-Feng

2001-05-01

TrueLight Corporation was found in 1997 and it is the pioneer of VCSEL components supplier in Taiwan. We specialize in the production and distribution of VCSEL (Vertical Cavity Surface Emitting Laser) and other high-speed PIN-detector devices and components. Our core technology is developed to meet blooming demand of fiber optic transmission. Our intention is to diverse the device application into data communication, telecommunication and industrial markets. One mission is to provide the high performance, highly reliable and low-cost VCSEL components for data communication and sensing applications. For the past three years, TrueLight Corporation has entered successfully into the Gigabit Ethernet and the Fiber Channel data communication area. In this paper, we will focus on the fabrication of VCSEL components. We will present you the evolution of implanted and oxide-confined VCSEL process, device characterization, also performance in Gigabit data communication and the most important reliability issue

A True-False Test on Methods of Typewriting Instruction.

Science.gov (United States)

West, Leonard J.

1984-01-01

Presents a true-false test on typewriting instruction to illustrate the effects of educational lag, publishing practices, and deficiencies in preservice and inservice teacher education upon teaching methods. (SK)

Brucella Antibodies in Alaskan True Seals and Eared Seals—Two Different Stories

Directory of Open Access Journals (Sweden)

Ingebjørg H. Nymo

2018-01-01

Full Text Available Brucella pinnipedialis was first isolated from true seals in 1994 and from eared seals in 2008. Although few pathological findings have been associated with infection in true seals, reproductive pathology including abortions, and the isolation of the zoonotic strain type 27 have been documented in eared seals. In this study, a Brucella enzyme-linked immunosorbent assay (ELISA and the Rose Bengal test (RBT were initially compared for 206 serum samples and a discrepancy between the tests was found. Following removal of lipids from the serum samples, ELISA results were unaltered while the agreement between the tests was improved, indicating that serum lipids affected the initial RBT outcome. For the remaining screening, we used ELISA to investigate the presence of Brucella antibodies in sera of 231 eared and 1,412 true seals from Alaskan waters sampled between 1975 and 2011. In eared seals, Brucella antibodies were found in two Steller sea lions (Eumetopias jubatus (2% and none of the 107 Northern fur seals (Callorhinus ursinus. The low seroprevalence in eared seals indicate a low level of exposure or lack of susceptibility to infection. Alternatively, mortality due to the Brucella infection may remove seropositive animals from the population. Brucella antibodies were detected in all true seal species investigated; harbor seals (Phoca vitulina (25%, spotted seals (Phoca largha (19%, ribbon seals (Histriophoca fasciata (16%, and ringed seals (Pusa hispida hispida (14%. There was a low seroprevalence among pups, a higher seroprevalence among juveniles, and a subsequent decreasing probability of seropositivity with age in harbor seals. Similar patterns were present for the other true seal species; however, solid conclusions could not be made due to sample size. This pattern is in accordance with previous reports on B. pinnipedialis infections in true seals and may suggest environmental exposure to B. pinnipedialis at the juvenile stage, with a

MODEL PENSKORAN PARTIAL CREDIT PADA BUTIR MULTIPLE TRUE-FALSE BIDANG FISIKA

Directory of Open Access Journals (Sweden)

Wasis Wasis

2013-01-01

Full Text Available Tujuan penelitian ini menghasilkan model penskoran politomus untuk respons butir multiple true-false, sehingga dapat mengestimasi secara lebih akurat kemampuan di bidang fisika. Pengembangan penskoran menggunakan Four-D model dan diuji akurasinya melalui penelitian empiris dan simulasi. Penelitian empiris menggunakan 15 butir multiple true-false yang diambil dari soal UMPTN tahun 1996-2006 dan dikenakan pada 410 mahasiswa baru FMIPA Universitas Negeri Surabaya angkatan tahun 2007. Respons peserta tes diskor dengan tiga model partial credit (PCM I; II; dan III dan secara dikotomus. Hasil penskoran dianalisis dengan program Quest untuk mendapat-kan estimasi tingkat kesukaran butir (δ dan estimasi ke-mampuan peserta (θ untuk menentukan nilai fungsi informasi tes dan kesalahan baku estimasi. Penelitian simulasi mengguna-kan data bangkitan berdasarkan parameter empiris (δ dan θ memakai program statistik SAS dan akurasi estimasinya di-analisis dengan metode root mean squared error (RMSE. Hasil penelitian ini menunjukkan: (i Penskoran PCM dengan pem-bobotan mampu mengestimasi kemampuan lebih akurat di-bandingkan tanpa pembobotan maupun secara dikotomus; (ii Semakin banyak jumlah kategori dalam penskoran partial credit, semakin akurat. Kata kunci: model penskoran partial credit, butir multiple true-false ____________________________________________________________ THE PARTIAL CREDIT SCORING MODEL FOR THE MULTIPLE TRUE-FALSE BUTIRS IN PHYSICS Abstract This study is an attempt to overcome the weaknesses. This study aims to produce a polytomous scoring model for responses to multiple true-false butirs in order to get a more accurate estimation of abilities in physics. It adopts the Four-D model and its accuracy is assessed through empirical and simulation studies. The empirical study employed 15 multiple true-false butirs taken from the New Students Entrance Test of State University the year of 1996–2006. It administered to 410 new students enrolled

TRUE Block Scale Continuation Project. Final Report

Energy Technology Data Exchange (ETDEWEB)

Andersson, Peter; Byegaard, Johan [Geosigma AB (Sweden); Billaux, Daniel [Itasca Consultants SA (France); Cvetkovic, Vladimir [Royal Inst. of Technology, Stockholm (Sweden); Dershowitz, William; Doe, Thomas [Golder Associates Inc. (United States); Hermanson, Jan [Golder Associates AB (Sweden); Poteri, Antti [VTT (Finland); Tullborg, Eva-Lena [Terralogica AB (Sweden); Winberg, Anders [Conterra AB (SE)] (ed.)

2007-03-15

The TRUE Block Scale project was carried out during 1996-2002. This project focused on site characterisation and building of hydrostructural and microstructural models, sorbing tracer experiments in single structures and networks of structures over distances ranging between 1 and 100 m and also involved a unified application of various model approaches for modelling the in situ experiments. In 2002, ANDRA, Posiva, JNC and SKB decided to pursue some remaining issues in the so-called TRUE Block Scale Continuation project (TRUE BS2). The specific objectives of BS2 can be summarised as: 'Improve understanding of transport pathways at the block scale, including assessment of effects of geology and geometry, macrostructure and microstructure'. In order to cater to addressing the stated objective a series of hypotheses were formulated which explored the importance of geological information for predicting transport and retention and the possible differences between transport and retention between transport paths dominated by faults and those dominated by non-fault fractures (background fractures). In the process, prospects for carrying out experiments in fracture networks over longer distances (c 20-100 m) were explored. It was identified that experiments with sorbing tracers over these distances were prohibitive because of the time frames involved and the projected low mass recoveries. Instead the experimental locus was shifted to a geological structure previously not investigated by tracer tests in the TRUE Block Scale experiments. The lower immobile zone retention material properties assigned to background fractures compared to those assigned to the fault-type Structure 19 have been verified by means of back-calculations. The evaluated Type 1 flow path (Structure 19, Flow path I) retention material properties, as expressed by {kappa} parameter, are one order of magnitude higher than for the background fracture flow path. This finding is consistent with the

True fir spacing trials: 10-year results.

Science.gov (United States)

Robert O. Curtis

2008-01-01

Eighteen precommercial thinning trials were established in true fir-hemlock stands in the Olympic Mountains and the west side of the Cascade Range during the period 1987 through 1994. This paper updates a previous report, with results for the first 10 years after establishment. Results are given for (1) all trees, (2) the largest 80 per acre of any species, and (3)...

Second-degree discrete Painleve equations conceal first-degree ones

International Nuclear Information System (INIS)

Ramani, A; Grammaticos, B; Joshi, N

2010-01-01

We examine various second-degree difference equations which have been proposed over the years and according to their authors' claims should be integrable. This study is motivated by the fact that we consider that second-degree discrete systems cannot be integrable due to the proliferation of the images (and pre-images) of the initial point. We show that in the present cases no contradiction exists. In all cases examined, we show that there exists an underlying integrable first-degree mapping which allows us to obtain an appropriate solution of the second-degree one.

From gender identity disorder to gender identity creativity: true gender self child therapy.

Science.gov (United States)

Ehrensaft, Diane

2012-01-01

True gender self child therapy is based on the premise of gender as a web that weaves together nature, nurture, and culture and allows for a myriad of healthy gender outcomes. This article presents concepts of true gender self, false gender self, and gender creativity as they operationalize in clinical work with children who need therapeutic supports to establish an authentic gender self while developing strategies for negotiating an environment resistant to that self. Categories of gender nonconforming children are outlined and excerpts of a treatment of a young transgender child are presented to illustrate true gender self child therapy.

Benign cementoblastoma (true cementoma in a cat

Directory of Open Access Journals (Sweden)

Lenin A Villamizar-Martinez

2016-01-01

Full Text Available Case summary A 10-year-old castrated male domestic shorthair cat was presented for assessment of a gingival mass surrounding the left maxillary third and fourth premolar teeth. The mass was surgically removed by means of a marginal rim excision, and the tissue was submitted for histological assessment. It was identified as a benign cementoblastoma (true cementoma. There was proliferation of mineralized eosinophilic material with multiple irregularly placed lacunae and reversal lines, reminiscent of cementum. The cat recovered uneventfully from the anesthesia, and there was no evidence of tumor recurrence 6 months after surgery. Relevance and novel information Cementoblastomas (true cementomas in domestic animals are rare, with just a few reports in ruminants, monogastric herbivores and rodents. Cementoblastoma is considered a benign tumor that arises from the tooth root. The slow, expansive and constant growth that characterizes these masses may be accompanied by signs of oral discomfort and dysphagia. This case report is intended to increase knowledge regarding this tumor in cats and also highlights the importance of complete excision of the neoplasm. To our knowledge, there are no previous reports in the literature of cementoblastoma in the cat.

Molecular characterization of true morels (Morchella) in Turkey

Science.gov (United States)

A collection of 247 true morels (Morchella spp.) was made from 10 different provinces of Turkey during the 2007-2008 growing season. This collection was analyzed for species diversity using phylogenetic analyses of partial Ribonucleic acid (RNA) polymerase I (RPB1) and nuclear ribosomal large subuni...

On a true value of risk

DEFF Research Database (Denmark)

Kozin, Igor

2018-01-01

The paper suggests looking on probabilistic risk quantities and concepts through the prism of accepting one of the views: whether a true value of risk exists or not. It is argued that discussions until now have been primarily focused on closely related topics that are different from the topic...... intervals, the use of Byes rule, models of complete ignorance, hierarchical models of uncertainty, assignment of probabilities over possibility space and interpretation of derived probabilistic measures. Behavioural implications of favouring the either view are also briefly described....

Three-dimensional true FISP for high-resolution imaging of the whole brain

International Nuclear Information System (INIS)

Schmitz, B.; Hagen, T.; Reith, W.

2003-01-01

While high-resolution T1-weighted sequences, such as three-dimensional magnetization-prepared rapid gradient-echo imaging, are widely available, there is a lack of an equivalent fast high-resolution sequence providing T2 contrast. Using fast high-performance gradient systems we show the feasibility of three-dimensional true fast imaging with steady-state precession (FISP) to fill this gap. We applied a three-dimensional true-FISP protocol with voxel sizes down to 0.5 x 0.5 x 0.5 mm and acquisition times of approximately 8 min on a 1.5-T Sonata (Siemens, Erlangen, Germany) magnetic resonance scanner. The sequence was included into routine brain imaging protocols for patients with cerebrospinal-fluid-related intracranial pathology. Images from 20 patients and 20 healthy volunteers were evaluated by two neuroradiologists with respect to diagnostic image quality and artifacts. All true-FISP scans showed excellent imaging quality free of artifacts in patients and volunteers. They were valuable for the assessment of anatomical and pathologic aspects of the included patients. High-resolution true-FISP imaging is a valuable adjunct for the exploration and neuronavigation of intracranial pathologies especially if cerebrospinal fluid is involved. (orig.)

Critical opalescence and the true dielectric state in a Coulomb system

Science.gov (United States)

Bobrov, V. B.; Trigger, S. A.

2015-04-01

To study the critical opalescence effect in a two-component Coulomb system consisting of single-type electrons and nuclei, we consider the limit relations for static structure factors and analyze the singularities of the dielectric permittivity. We show that the critical opalescence effect can be observed not only at the critical point corresponding to the gas-liquid phase transition but also near the true dielectric state with zero static conductivity. With the available experimental data taken into account, we assume that the true dielectric state is the limit state of the liquid-liquid phase transition accompanied by sharp variations in the electrical conduction of the substances. We find that if the thermodynamic parameters correspond to the true dielectric state, then the critical opalescence effect can arise in the case where the squared fluctuation in the total number of electrons and nuclei in a two-component Coulomb system becomes infinite, as this occurs at the critical point corresponding to the gas-liquid phase transition.

Discrimination of relationships with the same degree of kinship using chromosomal sharing patterns estimated from high-density SNPs.

Science.gov (United States)

Morimoto, Chie; Manabe, Sho; Fujimoto, Shuntaro; Hamano, Yuya; Tamaki, Keiji

2018-03-01

Distinguishing relationships with the same degree of kinship (e.g., uncle-nephew and grandfather-grandson) is generally difficult in forensic genetics by using the commonly employed short tandem repeat loci. In this study, we developed a new method for discerning such relationships between two individuals by examining the number of chromosomal shared segments estimated from high-density single nucleotide polymorphisms (SNPs). We computationally generated second-degree kinships (i.e., uncle-nephew and grandfather-grandson) and third-degree kinships (i.e., first cousins and great-grandfather-great-grandson) for 174,254 autosomal SNPs considering the effect of linkage disequilibrium and recombination for each SNP. We investigated shared chromosomal segments between two individuals that were estimated based on identity by state regions. We then counted the number of segments in each pair. Based on our results, the number of shared chromosomal segments in collateral relationships was larger than that in lineal relationships with both the second-degree and third-degree kinships. This was probably caused by differences involving chromosomal transitions and recombination between relationships. As we probabilistically evaluated the relationships between simulated pairs based on the number of shared segments using logistic regression, we could determine accurate relationships in >90% of second-degree relatives and >70% of third-degree relatives, using a probability criterion for the relationship ≥0.9. Furthermore, we could judge the true relationships of actual sample pairs from volunteers, as well as simulated data. Therefore, this method can be useful for discerning relationships between two individuals with the same degree of kinship. Copyright © 2017 Elsevier B.V. All rights reserved.

PUFKEY: A High-Security and High-Throughput Hardware True Random Number Generator for Sensor Networks

Directory of Open Access Journals (Sweden)

Dongfang Li

2015-10-01

Full Text Available Random number generators (RNG play an important role in many sensor network systems and applications, such as those requiring secure and robust communications. In this paper, we develop a high-security and high-throughput hardware true random number generator, called PUFKEY, which consists of two kinds of physical unclonable function (PUF elements. Combined with a conditioning algorithm, true random seeds are extracted from the noise on the start-up pattern of SRAM memories. These true random seeds contain full entropy. Then, the true random seeds are used as the input for a non-deterministic hardware RNG to generate a stream of true random bits with a throughput as high as 803 Mbps. The experimental results show that the bitstream generated by the proposed PUFKEY can pass all standard national institute of standards and technology (NIST randomness tests and is resilient to a wide range of security attacks.

PUFKEY: a high-security and high-throughput hardware true random number generator for sensor networks.

Science.gov (United States)

Li, Dongfang; Lu, Zhaojun; Zou, Xuecheng; Liu, Zhenglin

2015-10-16

Random number generators (RNG) play an important role in many sensor network systems and applications, such as those requiring secure and robust communications. In this paper, we develop a high-security and high-throughput hardware true random number generator, called PUFKEY, which consists of two kinds of physical unclonable function (PUF) elements. Combined with a conditioning algorithm, true random seeds are extracted from the noise on the start-up pattern of SRAM memories. These true random seeds contain full entropy. Then, the true random seeds are used as the input for a non-deterministic hardware RNG to generate a stream of true random bits with a throughput as high as 803 Mbps. The experimental results show that the bitstream generated by the proposed PUFKEY can pass all standard national institute of standards and technology (NIST) randomness tests and is resilient to a wide range of security attacks.

Reflux and Belching After 270 Degree Versus 360 Degree Laparoscopic Posterior Fundoplication

NARCIS (Netherlands)

Broeders, Joris A.; Bredenoord, Albert J.; Hazebroek, Eric J.; Broeders, Ivo A.; Gooszen, Hein G.; Smout, André J.

2012-01-01

Objective: To investigate differences in effects of 270 degrees (270 degrees LPF) and 360 degrees laparoscopic posterior fundoplication (360 degrees LPF) on reflux characteristics and belching. Background: Three hundred sixty degrees LPF greatly reduces the ability of the stomach to vent ingested

Decoupling of the reparametrization degree of freedom and a generalized probability in quantum cosmology

Science.gov (United States)

Dimakis, N.; Terzis, Petros A.; Zampeli, Adamantia; Christodoulakis, T.

2016-09-01

The high degree of symmetry renders the dynamics of cosmological as well as some black hole spacetimes describable by a system of finite degrees of freedom. These systems are generally known as minisuperspace models. One of their important key features is the invariance of the corresponding reduced actions under reparametrizations of the independent variable, a fact that can be seen as the remnant of the general covariance of the full theory. In the case of a system of n degrees of freedom, described by a Lagrangian quadratic in velocities, one can use the lapse by either gauge fixing it or letting it be defined by the constraint and subsequently substitute into the rest of the equations. In the first case, the system of the second-order equations of motion is solvable for all n accelerations and the constraint becomes a restriction among constants of integration. In the second case, the system can be solved for only n -1 accelerations and the "gauge" freedom is transferred to the choice of one of the scalar degrees of freedom. In this paper, we take the second path and express all n -1 scalar degrees of freedom in terms of the remaining one, say q . By considering these n -1 degrees of freedom as arbitrary but given functions of q , we manage to extract a two-dimensional pure gauge system consisting of the lapse N and the arbitrary q : in a way, we decouple the reparametrization invariance from the rest of the equations of motion, which are thus describing the "true" dynamics. The solution of the corresponding quantum two-dimensional system is used for the definition of a generalized probability for every configuration fi(q ), be it classical or not. The main result is that, interestingly enough, this probability attains its extrema on the classical solution of the initial n -dimensional system.

True Umbilical Cord Knot Leading to Fetal Demise

African Journals Online (AJOL)

weight was 140 kg, height 1.69 m, blood pressure 120 mmHg. The booking ... The fetal heart tones were monitored using Doppler sonicaid. They remained normal throughout .... true knot, seemingly because the umbilical cord vessels can be compressed ... Therefore, the Wharton's jelly surrounding the fetal vessels has the ...

Disinhibition of negative true self for identity reconstructions in cyberspace: Advancing self-discrepancy theory for virtual setting.

Directory of Open Access Journals (Sweden)

Chuan Hu

Full Text Available In face-to-face communications, to avoid sanctions and disapproval from others, people are more likely to hide negative aspects of their true self (such as socially undesirable personalities, minds, beliefs and consciousness to avoid conflict with social norms and laws. The anonymity of cyberspace provides people a unique environment to behave more freely and openly with less restraint from the real word. Existing research related to online true self expression has mainly explored true self as an independent aspect of self. Regarding true self as a two-dimensional concept, this study investigates true self from the perspective of individuals' self-guide and identity reconstruction in both online and offline world. Using qualitative research methods, the current study investigates 57 participants through interviews and questionnaires. Content analysis reveals four factors that motivate people to express more true self (especially negative true self when reconstructing their online identity and involve true self as a part of their self-guide in anonymous environment. By incorporating true self as an important part of individuals' self-guide and identity online, the current study advances self-discrepancy theory, making it more comprehensive for cyberspace. The results are also interpreted based on self-determination theory. The theoretical contributions of this study are discussed and practical implications are also presented.

Registration of global cardiac function with real-time trueFISP in one respiratory cycle

International Nuclear Information System (INIS)

Wintersperger, B.J.; Nikolaou, K.; Huber, A.; Dietrich, O.; Reiser, M.F.; Schoenberg, S.O.; Muehling, O.; Nittka, M.; Kiefer, B.

2004-01-01

Real-time multislice cine techniques lead to inaccurate results in ventricular volumes based on limited temporal resolution. The purpose of the study is to evaluate a real-time cine technique with parallel imaging algorithms in comparison to standard segmented techniques. Twelve patients underwent cardiac cine MRI using real-time multislice cine trueFISP. Temporal resolution was improved using parallel acquisition techniques (iPAT) and data acquisition was performed in a single breath-hold along the patients' short axis. Evaluation of EDV, ESV, EF and myocardial mass was performed and results compared to a standard segmented single-slice cine trueFISP. Combination of real-time cine trueFISP and iPAT provided a temporal resolution of 48 ms. Results of the multislice approach showed an excellent correlation to standard single-slice trueFISP for EDV (0.94, p [de

Endovascular treatment of a true posterior communicating artery aneurysm.

Science.gov (United States)

Munarriz, Pablo M; Castaño-Leon, Ana M; Cepeda, Santiago; Campollo, Jorge; Alén, Jose F; Lagares, Alfonso

2014-01-01

Posterior communicating artery (PCoA) aneurysms are most commonly located at the junction of the internal carotid artery and the PCoA. "True" PCoA aneurysms, which originate from the PCoA itself, are rarely encountered. Most previously reported cases were treated surgically mainly before the endovascular option became available. A 53-year-old male presented with sudden onset of right hemiparesis and aphasia. Left middle cerebral artery stroke was diagnosed. Further studies revealed a 3 mm left PCoA aneurysm arising from the PCoA itself, attached to neither the internal carotid artery nor the posterior cerebral artery. Endovascular treatment was performed and the aneurysm was coiled completely. Technical advances in endovascular interventional technology have permitted an additional approach to these lesions. The possible endovascular significance of the treatment of true PCoA aneurysms is discussed.

Median Hetero-Associative Memories Applied to the Categorization of True-Color Patterns

Science.gov (United States)

Vázquez, Roberto A.; Sossa, Humberto

Median associative memories (MED-AMs) are a special type of associative memory based on the median operator. This type of associative model has been applied to the restoration of gray scale images and provides better performance than other models, such as morphological associative memories, when the patterns are altered with mixed noise. Despite of his power, MED-AMs have not been applied in problems involving true-color patterns. In this paper we describe how a median hetero-associative memory (MED-HAM) could be applied in problems that involve true-color patterns. A complete study of the behavior of this associative model in the restoration of true-color images is performed using a benchmark of 14400 images altered by different type of noises. Furthermore, we describe how this model can be applied to an image categorization problem.

Parent artery occlusion for ruptured "true" posterior communicating artery aneurysm.

Science.gov (United States)

Mitsuhashi, Takashi; Takeda, Nobuaki; Oishi, Hidenori; Arai, Hajime

2015-04-01

A case of a patient with a ruptured true posterior communicating artery (PCoA) aneurysm is reported, who had been managed by early endovascular parent artery occlusion with coils. The small blister aneurysm was located at the proximal PCoA itself and directed superiorly. Postoperative course was uneventful. During 1-month follow-up, the patient recovered well and could care for herself. Aneurysms of the PCoA itself are very rare. As reported to date, surgical procedures would favor microsurgical clipping over endovascular coil embolization. Endovascular treatment may be a good alternative to surgical trapping for true PCoA blister aneurysm. © The Author(s) 2015 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.

Optical resonators for true-time-delay beam steering

Science.gov (United States)

Gesell, Leslie H.; Evanko, Stephen M.

1996-06-01

Conventional true time delay beamforming and steering devices rely on switching between various lengths of delay line. Therefore only discrete delays are possible. Proposed is a new photonics concept for true time delay beamforming which provides a finely controlled continuum of delays with switching speeds on the order of 10's of nanoseconds or faster. The architecture uses an array of waveguide cavities with different resonate frequencies to channelize the signal. Each spectral component of the signal is phase shifted by an amount proportional to the frequency of that component and the desired time delay. These phase shifted spectral components are then summed to obtain the delayed signal. This paper provides an overview of the results of a Phase I SBIR contract where this concept has been refined and analyzed. The parameters for an operational system are determined and indication of the feasibility of this approach is given. Among the issues addressed are the requirements of the resonators and the methods necessary to implement fiber optic Bragg gratings as these resonators.

Detecting the True Nature of Allegations of Rape

NARCIS (Netherlands)

De Zutter, André; Horselenberg, Robert; van Koppen, Peter J.

2017-01-01

A study was conducted to test whether it is possible to build a model to distinguish true and false allegations of rape based on the theory of fabricated rape. The theory is based on the principle that a false complainant of rape has not been raped and has to fabricate a story while the story of a

True Crime: Forbrydelse, fortælling og dom

DEFF Research Database (Denmark)

Lundtofte, Thomas Enemark

2016-01-01

De seneste år har budt på en række opsigtsvækkende dokumentarkrimiserier, der har udfordret det amerikanske retssystem. Serierne inviterer os til at tage stilling til skyldsspørgsmål og blande os i debatten om retfærdighed. Angiveligt som følge af true crime-serien Making a Murderer (2015) bliver...

Why should correction values be better known than the measurand true value?

International Nuclear Information System (INIS)

Pavese, Franco

2013-01-01

Since the beginning of the history of modern measurement science, the experimenters faced the problem of dealing with systematic effects, as distinct from, and opposed to, random effects. Two main schools of thinking stemmed from the empirical and theoretical exploration of the problem, one dictating that the two species should be kept and reported separately, the other indicating ways to combine the two species into a single numerical value for the total uncertainty (often indicated as 'error'). The second way of thinking was adopted by the GUM, and, generally, adopts the method of assuming that their expected value is null by requiring, for all systematic effects taken into account in the model, that corresponding 'corrections' are applied to the measured values before the uncertainty analysis is performed. On the other hand, about the value of the measurand intended to be the object of measurement, classical statistics calls it 'true value', admitting that a value should exist objectively (e.g. the value of a fundamental constant), and that any experimental operation aims at obtaining an ideally exact measure of it. However, due to the uncertainty affecting every measurement process, this goal can be attained only approximately, in the sense that nobody can ever know exactly how much any measured value differs from the true value. The paper discusses the credibility of the numerical value attributed to an estimated correction, compared with the credibility of the estimate of the location of the true value, concluding that the true value of a correction should be considered as imprecisely evaluable as the true value of any 'input quantity', and of the measurand itself. From this conclusion, one should derive that the distinction between 'input quantities' and 'corrections' is not justified and not useful

SU-F-E-19: A Novel Method for TrueBeam Jaw Calibration

Energy Technology Data Exchange (ETDEWEB)

Corns, R; Zhao, Y; Huang, V [Fraser Valley Cancer Centre - BC Cancer Agency, Surrey, BC (United Kingdom)

2016-06-15

Purpose: A simple jaw calibration method is proposed for Varian TrueBeam using an EPID-Encoder combination that gives accurate fields sizes and a homogeneous junction dose. This benefits clinical applications such as mono-isocentric half-beam block breast cancer or head and neck cancer treatment with junction/field matching. Methods: We use EPID imager with pixel size 0.392 mm × 0.392 mm to determine the radiation jaw position as measured from radio-opaque markers aligned with the crosshair. We acquire two images with different symmetric field sizes and record each individual jaw encoder values. A linear relationship between each jaw’s position and its encoder value is established, from which we predict the encoder values that produce the jaw positions required by TrueBeam’s calibration procedure. During TrueBeam’s jaw calibration procedure, we move the jaw with the pendant to set the jaw into position using the predicted encoder value. The overall accuracy is under 0.1 mm. Results: Our in-house software analyses images and provides sub-pixel accuracy to determine field centre and radiation edges (50% dose of the profile). We verified the TrueBeam encoder provides a reliable linear relationship for each individual jaw position (R{sup 2}>0.9999) from which the encoder values necessary to set jaw calibration points (1 cm and 19 cm) are predicted. Junction matching dose inhomogeneities were improved from >±20% to <±6% using this new calibration protocol. However, one technical challenge exists for junction matching, if the collimator walkout is large. Conclusion: Our new TrueBeam jaw calibration method can systematically calibrate the jaws to crosshair within sub-pixel accuracy and provides both good junction doses and field sizes. This method does not compensate for a larger collimator walkout, but can be used as the underlying foundation for addressing the walkout issue.

Myocardial imaging with thallium-201: an experimental model for analysis of the true myocardial and background image components

International Nuclear Information System (INIS)

Narahara, K.A.; Hamilton, G.W.; Williams, D.L.; Gould, K.L.

1977-01-01

The true myocardial and background components of a resting thallium-201 myocardial image were determined in an experimental dog model. True background was determined by imaging after the heart had been removed and replaced with a water-filled balloon of equal size and shape. In all studies, the background estimated from the region surrounding the heart exceeded true background activity. Furthermore, the relationship between true myocardial background and that estimated from the pericardiac region was inconsistent. Background estimates based on the activity surrounding the heart were not accurate predictors of true background activity

The Degree Cycle

DEFF Research Database (Denmark)

Wood, Johanna

2016-01-01

, empirical data relevant to the development of the degree adverb function is presented and possible relevant constructions identified. It is argued that the degree adverb function of that possibly occurs later than the historical dictionaries indicate. The degree adverb function of this is challenging...

Accurate decisions in an uncertain world: collective cognition increases true positives while decreasing false positives.

Science.gov (United States)

Wolf, Max; Kurvers, Ralf H J M; Ward, Ashley J W; Krause, Stefan; Krause, Jens

2013-04-07

In a wide range of contexts, including predator avoidance, medical decision-making and security screening, decision accuracy is fundamentally constrained by the trade-off between true and false positives. Increased true positives are possible only at the cost of increased false positives; conversely, decreased false positives are associated with decreased true positives. We use an integrated theoretical and experimental approach to show that a group of decision-makers can overcome this basic limitation. Using a mathematical model, we show that a simple quorum decision rule enables individuals in groups to simultaneously increase true positives and decrease false positives. The results from a predator-detection experiment that we performed with humans are in line with these predictions: (i) after observing the choices of the other group members, individuals both increase true positives and decrease false positives, (ii) this effect gets stronger as group size increases, (iii) individuals use a quorum threshold set between the average true- and false-positive rates of the other group members, and (iv) individuals adjust their quorum adaptively to the performance of the group. Our results have broad implications for our understanding of the ecology and evolution of group-living animals and lend themselves for applications in the human domain such as the design of improved screening methods in medical, forensic, security and business applications.

Breaking the Barriers to True Augmented Reality

OpenAIRE

Sandor, Christian; Fuchs, Martin; Cassinelli, Alvaro; Li, Hao; Newcombe, Richard; Yamamoto, Goshiro; Feiner, Steven

2015-01-01

In recent years, Augmented Reality (AR) and Virtual Reality (VR) have gained considerable commercial traction, with Facebook acquiring Oculus VR for \\$2 billion, Magic Leap attracting more than \\$500 million of funding, and Microsoft announcing their HoloLens head-worn computer. Where is humanity headed: a brave new dystopia-or a paradise come true? In this article, we present discussions, which started at the symposium "Making Augmented Reality Real", held at Nara Institute of Science and Te...

Measuring True Sales and Underreporting with Matched Firm-Level Survey and Tax-Office Data

NARCIS (Netherlands)

Zhou, F.; Oostendorp, R.H.

2014-01-01

This paper uses firm-level survey data matched with official tax records to estimate the unobserved true sales of formal firms in Mongolia. Taking into account firm-level incentives to comply with taxes and a production function technology linking unobserved true sales with observable firm-level

Two Cases of True Uterine Artery Aneurysms Diagnosed during Pregnancy

DEFF Research Database (Denmark)

Schlütter, Jacob Mørup; Johansen, Gry; Helmig, Rikke Bek

2016-01-01

We report 2 cases of true uterine artery aneurysms diagnosed during pregnancy. Both cases presented with nonspecific symptoms such as urethral obstruction, minimal vaginal bleeding and lower abdominal pain in the 2nd trimester. Both aneurysms were diagnosed by color Doppler ultrasound. In the fir...... masses, vague bladder symptoms or radiating pelvic pain. The diagnosis is readily made by color Doppler imaging. Elective Caesarean section should be the preferred mode of delivery to avoid rupture of the aneurysm during labor.......We report 2 cases of true uterine artery aneurysms diagnosed during pregnancy. Both cases presented with nonspecific symptoms such as urethral obstruction, minimal vaginal bleeding and lower abdominal pain in the 2nd trimester. Both aneurysms were diagnosed by color Doppler ultrasound. In the first...

Feeling like you know who you are: perceived true self-knowledge and meaning in life.

Science.gov (United States)

Schlegel, Rebecca J; Hicks, Joshua A; King, Laura A; Arndt, Jamie

2011-06-01

The essence of who a person really is has been labeled the "true self," and an emerging area of research suggests that this self-concept plays an important role in the creation of a fulfilling existence. Three studies investigate the role of the subjective feeling that one possesses knowledge of one's true self in meaning in life judgments. Consistently, the perception of availability of true self-knowledge (operationalized as the metacognitive experience of ease in describing one's true self) predicted meaning in life judgments over and above other potentially related constructs such as mood and self-esteem. Conversely, the subjective availability of knowledge of how one actually behaves (i.e., one's actual self) was unrelated to meaning in life judgments. Implications and directions for future research are discussed.

True photographs and false memories.

Science.gov (United States)

Lindsay, D Stephen; Hagen, Lisa; Read, J Don; Wade, Kimberley A; Garry, Maryanne

2004-03-01

Some trauma-memory-oriented psychotherapists advise clients to review old family photo albums to cue suspected "repressed" memories of childhood sexual abuse. Old photos might cue long-forgotten memories, but when combined with other suggestive influences they might also contribute to false memories. We asked 45 undergraduates to work at remembering three school-related childhood events (two true events provided by parents and one pseudoevent). By random assignment, 23 subjects were also given their school classes' group photos from the years of the to-be-recalled events as memory cues. As predicted, the rate of false-memory reports was dramatically higher in the photo condition than in the no-photo condition. Indeed, the rate of false-memory reports in the photo condition was substantially higher than the rate in any previously published study.

True bilateral nasopharyngeal angiofibroma: report and review.

Science.gov (United States)

Mishra, Anupam; Mishra, Subhash Chandra

2016-10-01

This report describes the third case of a true bilateral Juvenile nasopharyngeal angiofibroma (JNA), i.e. two separate JNA arising from both sides simultaneously. The associated multiple recurrences in such a case have not yet been reported. A 21-year-man underwent transpalatal excision and recurred twice. The last 'neo-occurrence' encountered after 2 years was at a different site and was subsequently managed by post-embolization endoscopic resection. A complete report of its clinico-radiological features and management outcome is discussed.

Scaling rates of true polar wander in convecting planets and moons

Science.gov (United States)

Rose, Ian; Buffett, Bruce

2017-12-01

Mass redistribution in the convecting mantle of a planet causes perturbations in its moment of inertia tensor. Conservation of angular momentum dictates that these perturbations change the direction of the rotation vector of the planet, a process known as true polar wander (TPW). Although the existence of TPW on Earth is firmly established, its rate and magnitude over geologic time scales remain controversial. Here we present scaling analyses and numerical simulations of TPW due to mantle convection over a range of parameter space relevant to planetary interiors. For simple rotating convection, we identify a set of dimensionless parameters that fully characterize true polar wander. We use these parameters to define timescales for the growth of moment of inertia perturbations due to convection and for their relaxation due to true polar wander. These timescales, as well as the relative sizes of convective anomalies, control the rate and magnitude of TPW. This analysis also clarifies the nature of so called "inertial interchange" TPW events, and relates them to a broader class of events that enable large and often rapid TPW. We expect these events to have been more frequent in Earth's past.

Neuromorphic Kalman filter implementation in IBM’s TrueNorth

Science.gov (United States)

Carney, R.; Bouchard, K.; Calafiura, P.; Clark, D.; Donofrio, D.; Garcia-Sciveres, M.; Livezey, J.

2017-10-01

Following the advent of a post-Moore’s law field of computation, novel architectures continue to emerge. With composite, multi-million connection neuromorphic chips like IBM’s TrueNorth, neural engineering has now become a feasible technology in this novel computing paradigm. High Energy Physics experiments are continuously exploring new methods of computation and data handling, including neuromorphic, to support the growing challenges of the field and be prepared for future commodity computing trends. This work details the first instance of a Kalman filter implementation in IBM’s neuromorphic architecture, TrueNorth, for both parallel and serial spike trains. The implementation is tested on multiple simulated systems and its performance is evaluated with respect to an equivalent non-spiking Kalman filter. The limits of the implementation are explored whilst varying the size of weight and threshold registers, the number of spikes used to encode a state, size of neuron block for spatial encoding, and neuron potential reset schemes.

ID-Check: Online Concealed Information Test Reveals True Identity.

Science.gov (United States)

Verschuere, Bruno; Kleinberg, Bennett

2016-01-01

The Internet has already changed people's lives considerably and is likely to drastically change forensic research. We developed a web-based test to reveal concealed autobiographical information. Initial studies identified a number of conditions that affect diagnostic efficiency. By combining these moderators, this study investigated the full potential of the online ID-check. Participants (n = 101) tried to hide their identity and claimed a false identity in a reaction time-based Concealed Information Test. Half of the participants were presented with personal details (e.g., first name, last name, birthday), whereas the others only saw irrelevant details. Results showed that participants' true identity could be detected with high accuracy (AUC = 0.98; overall accuracy: 86-94%). Online memory detection can reliably and validly detect whether someone is hiding their true identity. This suggests that online memory detection might become a valuable tool for forensic applications. © 2015 American Academy of Forensic Sciences.

New true-triaxial rock strength criteria considering intrinsic material characteristics

Science.gov (United States)

Zhang, Qiang; Li, Cheng; Quan, Xiaowei; Wang, Yanning; Yu, Liyuan; Jiang, Binsong

2018-02-01

A reasonable strength criterion should reflect the hydrostatic pressure effect, minimum principal stress effect, and intermediate principal stress effect. The former two effects can be described by the meridian curves, and the last one mainly depends on the Lode angle dependence function. Among three conventional strength criteria, i.e. Mohr-Coulomb (MC), Hoek-Brown (HB), and Exponent (EP) criteria, the difference between generalized compression and extension strength of EP criterion experience a firstly increase then decrease process, and tends to be zero when hydrostatic pressure is big enough. This is in accordance with intrinsic rock strength characterization. Moreover, the critical hydrostatic pressure I_c corresponding to the maximum difference of between generalized compression and extension strength can be easily adjusted by minimum principal stress influence parameter K. So, the exponent function is a more reasonable meridian curves, which well reflects the hydrostatic pressure effect and is employed to describe the generalized compression and extension strength. Meanwhile, three Lode angle dependence functions of L_{{MN}}, L_{{WW}}, and L_{{YMH}}, which unconditionally satisfy the convexity and differential requirements, are employed to represent the intermediate principal stress effect. Realizing the actual strength surface should be located between the generalized compression and extension surface, new true-triaxial criteria are proposed by combining the two states of EP criterion by Lode angle dependence function with a same lode angle. The proposed new true-triaxial criteria have the same strength parameters as EP criterion. Finally, 14 groups of triaxial test data are employed to validate the proposed criteria. The results show that the three new true-triaxial exponent criteria, especially the Exponent Willam-Warnke criterion (EPWW) criterion, give much lower misfits, which illustrates that the EP criterion and L_{{WW}} have more reasonable meridian

BMI may underestimate the socioeconomic gradient in true obesity

NARCIS (Netherlands)

van den Berg, G.; van Eijsden, M.; Vrijkotte, T. G. M.; Gemke, R. J. B. J.

2013-01-01

Body mass index (BMI) does not make a distinction between fat mass and lean mass. In children, high fat mass appears to be associated with low maternal education, as well as low lean mass because maternal education is associated with physical activity. Therefore, BMI might underestimate true obesity

The True Ultracool Binary Fraction Using Spectral Binaries

Science.gov (United States)

Bardalez Gagliuffi, Daniella; Burgasser, Adam J.; Schmidt, Sarah J.; Gagné, Jonathan; Faherty, Jacqueline K.; Cruz, Kelle; Gelino, Chris

2018-01-01

Brown dwarfs bridge the gap between stars and giant planets. While the essential mechanisms governing their formation are not well constrained, binary statistics are a direct outcome of the formation process, and thus provide a means to test formation theories. Observational constraints on the brown dwarf binary fraction place it at 10 ‑ 20%, dominated by imaging studies (85% of systems) with the most common separation at 4 AU. This coincides with the resolution limit of state-of-the-art imaging techniques, suggesting that the binary fraction is underestimated. We have developed a separation-independent method to identify and characterize tightly-separated (dwarfs as spectral binaries by identifying traces of methane in the spectra of late-M and early-L dwarfs. Imaging follow-up of 17 spectral binaries yielded 3 (18%) resolved systems, corroborating the observed binary fraction, but 5 (29%) known binaries were missed, reinforcing the hypothesis that the short-separation systems are undercounted. In order to find the true binary fraction of brown dwarfs, we have compiled a volume-limited, spectroscopic sample of M7-L5 dwarfs and searched for T dwarf companions. In the 25 pc volume, 4 candidates were found, three of which are already confirmed, leading to a spectral binary fraction of 0.95 ± 0.50%, albeit for a specific combination of spectral types. To extract the true binary fraction and determine the biases of the spectral binary method, we have produced a binary population simulation based on different assumptions of the mass function, age distribution, evolutionary models and mass ratio distribution. Applying the correction fraction resulting from this method to the observed spectral binary fraction yields a true binary fraction of 27 ± 4%, which is roughly within 1σ of the binary fraction obtained from high resolution imaging studies, radial velocity and astrometric monitoring. This method can be extended to identify giant planet companions to young brown

Arm-associated measurements as estimates of true height in black ...

African Journals Online (AJOL)

arm-associated measurements to true height included that of the World Health ... Conclusion: Findings indicate the need for gender and race-specific height estimation ..... New. York, NY: Springer; 2012. 12. Golshan M, Amra B, Hoghoghi MA.

Degree distribution in discrete case

International Nuclear Information System (INIS)

Wang, Li-Na; Chen, Bin; Yan, Zai-Zai

2011-01-01

Vertex degree of many network models and real-life networks is limited to non-negative integer. By means of measure and integral, the relation of the degree distribution and the cumulative degree distribution in discrete case is analyzed. The degree distribution, obtained by the differential of its cumulative, is only suitable for continuous case or discrete case with constant degree change. When degree change is not a constant but proportional to degree itself, power-law degree distribution and its cumulative have the same exponent and the mean value is finite for power-law exponent greater than 1. -- Highlights: → Degree change is the crux for using the cumulative degree distribution method. → It suits for discrete case with constant degree change. → If degree change is proportional to degree, power-law degree distribution and its cumulative have the same exponent. → In addition, the mean value is finite for power-law exponent greater than 1.

Accurate decisions in an uncertain world: collective cognition increases true positives while decreasing false positives

NARCIS (Netherlands)

Wolf, M.; Kurvers, R.H.J.M.; Ward, A.J.W.; Krause, S.; Krause, J.

2013-01-01

In a wide range of contexts, including predator avoidance, medical decision-making and security screening, decision accuracy is fundamentally constrained by the trade-off between true and false positives. Increased true positives are possible only at the cost of increased false positives;

True Polar Wander of Mercury

Science.gov (United States)

Keane, J. T.; Matsuyama, I.

2018-05-01

We use new MESSENGER gravity data to investigate how impact basins and volcanic provinces alter Mercury's moments of inertia. We find that Mercury has reoriented tens of degrees over its history, affecting tectonics, volatiles, and more.

True HIV seroprevalence in Indian blood donors.

Science.gov (United States)

Choudhury, N; Ayagiri, A; Ray, V L

2000-03-01

The National AIDS Control Organization (NACO), the apex body for controlling AIDS in India, projected that HIV seroprevalence would increase from 7/1000 in 1995 to 21.2/1000 in 1997. A high incidence (8.2%) of HIV was observed in blood donors. This study was carried out to find out the true HIV positivity in Indian blood donors. Blood donors from our centre were followed for more than 5 years to determine the true HIV seroprevalence and our result was compared with similar studies from India. Voluntary and relative blood donors who visited the SGPGIMS, Lucknow, since 1993 to June 1998 were included. They were screened for HIV 1/2 by ELISA kits (WHO approved). First-time HIV-positive samples were preserved frozen for further study (stage-I). They were repeated in duplicate and retested with other kits. If found positive, the sample was labelled as ELISA positive (stage-II). ELISA-positive samples were confirmed by Western Blot (WB) at stage-III. A total of 65 288 donors were included and 834 (12.8/1000) were reactive at stage-I. But 1.1/1000 donors were found to be ELISA positive at stage-II, and 0.28/1000 donors were positive by WB at stage-III. The 'seropositivity' rate from the NACO was significantly (P commercial blood banks. The HIV prevalence of blood donors (and national prevalence) is to be reassessed.

True ownership of traditional medicines in South Africa

OpenAIRE

Gabriel Louw; André Duvenhage

2017-01-01

Background Literature postulates that traditional medicines form an important part of modern-day South African healthcare. The belief is that the traditional healer and traditional medicine is a close-knit unit, with the traditional healer as the true owner and manufacturer of traditional medicines. Various studies also postulate that the growth and development of South African traditional medicines are restricted by the pharmaceutical industries and other role players...

Methods for obtaining true particle size distributions from cross section measurements

Energy Technology Data Exchange (ETDEWEB)

Lord, Kristina Alyse [Iowa State Univ., Ames, IA (United States)

2013-01-01

Sectioning methods are frequently used to measure grain sizes in materials. These methods do not provide accurate grain sizes for two reasons. First, the sizes of features observed on random sections are always smaller than the true sizes of solid spherical shaped objects, as noted by Wicksell [1]. This is the case because the section very rarely passes through the center of solid spherical shaped objects randomly dispersed throughout a material. The sizes of features observed on random sections are inversely related to the distance of the center of the solid object from the section [1]. Second, on a plane section through the solid material, larger sized features are more frequently observed than smaller ones due to the larger probability for a section to come into contact with the larger sized portion of the spheres than the smaller sized portion. As a result, it is necessary to find a method that takes into account these reasons for inaccurate particle size measurements, while providing a correction factor for accurately determining true particle size measurements. I present a method for deducing true grain size distributions from those determined from specimen cross sections, either by measurement of equivalent grain diameters or linear intercepts.

Studies on the occurrence of true spiders as natural enemies in many Egyptian fields

Directory of Open Access Journals (Sweden)

Amira A. Ibrahim

2012-01-01

Full Text Available True spiders represent one of the most important natural predatory species in Egyptian fields. In this work, common true spiders were surveyed in wheat, cotton and maize fields, and were counted weekly by using the direct method. For evaluating the feeding consumption of true spiders, five feeding cases were tested (as preys. These cases were: eggs of Ephestia kuehniella, eggs of Phthorimaea operculella, one day eggs and larvae of E. kuehniella, larvae of E. kuehniella and P. operculella and larvae of E. kuehniella only. Results obtained revealed that, the highest average daily consumption for each spider was recorded in case of feeding on eggs of P. operculella. While, the longest survival period was recorded in case of feeding on larvae of E. kuehniella.

Clinical significance of changes of serum true insulin and proinsulin levels in relations of patients with type 2 diabetes mellitus

International Nuclear Information System (INIS)

Tian Xiaoping; Huang Huijian; Huang Haibo; Wu Yan; He Haoming

2004-01-01

Objective: To explore the degree of insulin resistance and β-cell secretory function impairment in close (1st degree) relations of patients with type 2 diabetes (DMII). Methods: Serum true insulin (TI), pro-insulin (PI), immunoreactive insulin (IRI) levels at fasting and after oral 75g glucose loading were determined in: 1) patients with DM 2, n=65 2)relations of DM 2 patients with impaired glucose tolerance (IGT), n=34 3) relations of DM 2 patients with normal glucose tolerance (NGT), n=66 and 4) controls, n=48. HOMA-IR and HOMA-β cell secretory indices were calculated from the data. Results: Fasting serum PI levels were significantly higher in DM 2 patients, relations with IGT and NGT than those in the controls (t=2.38, t=2.16, t=1.95, P 1 C percentages were significantly higher in DM 2 patients and IGT, NGT groups than those in controls (t=3.67, t=2.45, t=1.97, P 1 C percentage, fasting TI and IRI levels. Conclusion: Insulin resistance was already obvious in those relations of DM 2 patients with normal glucose tolerance and β-cell secretory function impairment was also present. Early intervention in these subjects might be beneficial. (authors)

Magnetic Resonance Imaging Study Using True versus Sham Acupuncture

Directory of Open Access Journals (Sweden)

Chunxiao Wu

2014-01-01

Full Text Available Functional magnetic resonance imaging (fMRI has been shown to detect the specificity of acupuncture points, as proved by numerous studies. In this study, resting-state fMRI was used to observe brain areas activated by acupuncture at the Taichong (LR3 acupoint. A total of 15 healthy subjects received brain resting-state fMRI before acupuncture and after sham and true acupuncture, respectively, at LR3. Image data processing was performed using Data Processing Assistant for Resting-State fMRI and REST software. The combination of amplitude of low-frequency fluctuation (ALFF and regional homogeneity (ReHo was used to analyze the changes in brain function during sham and true acupuncture. Acupuncture at LR3 can specifically activate or deactivate brain areas related to vision, movement, sensation, emotion, and analgesia. The specific alterations in the anterior cingulate gyrus, thalamus, and cerebellar posterior lobe have a crucial effect and provide a valuable reference. Sham acupuncture has a certain effect on psychological processes and does not affect brain areas related to function.

Positive Predictive Value of True Bacteremia according to the Number of Positive Culture Sets in Adult Patients.

Science.gov (United States)

Kitaura, Tsuyoshi; Chikumi, Hiroki; Fujiwara, Hiromitsu; Okada, Kensaku; Hayabuchi, Tatsuya; Nakamoto, Masaki; Takata, Miyako; Yamasaki, Akira; Igishi, Tadashi; Burioka, Naoto; Shimizu, Eiji

2014-12-01

Performing multiple blood culture sets simultaneously is a standard blood culture methodology, although it is often difficult to distinguish true bacteremia from contamination when only one of several blood culture sets is positive. This study clarified the relationship between the number of positive blood culture sets and clinical significance in patients with positive blood culture. Patients aged 18 years and over with at least 1 positive blood culture were enrolled. Positive blood culture episodes were categorized from clinical records as true bacteremia, contamination, or unknown clinical significance. The associations among episodes of true bacteremia, isolated bacteria, the number of positive blood culture sets from among the performed sets, and the clinical background of patients were analyzed. Among a total of 407 episodes, 262, 67 and 78 were true bacteremia, contamination and unknown clinical significance, respectively. The positive predictive values (PPVs) of 1 out of 1, 1 out of 2 and 2 out of 2 positive sets in cases of Staphylococcus aureus, were 81.3%, 50% and 100% respectively; those in cases of coagulase-negative Staphylococci were 20.5%, 10.8% and 63.5%, respectively. Almost all cases of Escherichia coli, Pseudomonas aeruginosa, Klebsiella species and Candida species were true bacteremia. The probability of true bacteremia was strongly associated with recent surgery in multivariate analysis (P sets from among the performed sets varies by microorganism. Therefore, PPVs calculated using this method may help physicians distinguish true bacteremia from contamination.

True and common balsams

Directory of Open Access Journals (Sweden)

Dayana L. Custódio

2012-08-01

Full Text Available Balsams have been used since ancient times, due to their therapeutic and healing properties; in the perfume industry, they are used as fixatives, and in the cosmetics industry and in cookery, they are used as preservatives and aromatizers. They are generally defined as vegetable material with highly aromatic properties that supposedly have the ability to heal diseases, not only of the body, but also of the soul. When viewed according to this concept, many substances can be considered balsams. A more modern concept is based on its chemical composition and origin: a secretion or exudate of plants that contain cinnamic and benzoic acids, and their derivatives, in their composition. The most common naturally-occurring balsams (i.e. true balsams are the Benzoins, Liquid Storaque and the Balsams of Tolu and Peru. Many other aromatic exudates, such as Copaiba Oil and Canada Balsam, are wrongly called balsam. These usually belong to other classes of natural products, such as essential oils, resins and oleoresins. Despite the understanding of some plants, many plants are still called balsams. This article presents a chemical and pharmacological review of the most common balsams.

Activation of Imaginal Information on True and False Memories

Science.gov (United States)

Chang, Sau Hou; Pierce, Benton H.

2009-01-01

The present study examined the activation of imaginal information on true and false memories. Participants studied a series of concrete objects in pictures or words. The imagery group (n = 96) was instructed to form images and the control group (n = 96) was not instructed to do so. Both groups were then given a standard recognition memory test and…

True fir-hemlock spacing trials: design and first results.

Science.gov (United States)

Robert O. Curtis; Gary W. Clendenen; Jan A. Henderson

2000-01-01

A series of 18 precommercial thinning trials was established in true fir-hemlock stands in the Olympic Mountains and along the west side of the Cascade Range in Washington and Oregon from 1987 through 1994. This paper documents establishment of these installations and presents some preliminary observations and results. Substantial differences in growth rates in height...

Current technology and advances in true re-use of effluents

International Nuclear Information System (INIS)

Cillie, G.G.

1975-01-01

Increasing exploitation of natural water resources has necessitated true re-use of effluents. Such planned re-use is preferable to the indirect or incidental re-use which has hitherto been practised, sometimes indiscriminately. Modern technology provides the means for renovating effluents to any desired quality standard, including human consumption. The major obstacles still confronting widespread application of true re-use are the removal of nitrogen compounds and trace organic residues, including insecticides, herbicides and carcinogens. The need to guarantee hygienic quality by removal or destruction of all pathogens, including viruses and parasites, constitutes a major cost item. Radiation techniques may well be applied for sterilization and for destruction of organic radicals. A combination of various unit processes, for which design criteria and hardware are readily available, can be used to produce potable water at a cost of some 10 cents/m 3 for a 45 Ml/d plant. (author)

Content Adaptive True Motion Estimator for H.264 Video Compression

Directory of Open Access Journals (Sweden)

P. Kulla

2007-12-01

Full Text Available Content adaptive true motion estimator for H.264 video coding is a fast block-based matching estimator with implemented multi-stage approach to estimate motion fields between two image frames. It considers the theory of 3D scene objects projection into 2D image plane for selection of motion vector candidates from the higher stages. The stages of the algorithm and its hierarchy are defined upon motion estimation reliability measurement (image blocks including two different directions of spatial gradient, blocks with one dominant spatial gradient and blocks including minimal spatial gradient. Parameters of the image classification into stages are set adaptively upon image structure. Due to search strategy are the estimated motion fields more corresponding to a true motion in an image sequence as in the case of conventional motion estimation algorithms that use fixed sets of motion vector candidates from tight neighborhood.

System for evaluation of the true average input-pulse rate

International Nuclear Information System (INIS)

Eichenlaub, D.P.; Garrett, P.

1977-01-01

The description is given of a digital radiation monitoring system making use of current digital circuit and microprocessor for rapidly processing the pulse data coming from remote radiation controllers. This system analyses the pulse rates in order to determine if a new datum is statistically the same as that previously received. Hence it determines the best possible average time for itself. So long as the true average pulse rate stays constant, the time required to establish an average can increase until the statistical error is under the desired level, i.e. 1%. When the digital processing of the pulse data indicates a change in the true average pulse rate, the time required to establish an average can be reduced so as to improve the response time of the system at the statistical error. This concept includes a fixed compromise between the statistical error and the response time [fr

Acquired Bilateral Longitudinal True Leukonychia in a 35-year-old Woman

Science.gov (United States)

Mokhtari, Fatemeh; Mozafarpoor, Samaneh; Nouraei, Saeid; Nilforoushzadeh, Mohammad Ali

2016-01-01

Acquired bilateral longitudinal true leukonychia is a rare disorder. We present a case of a 35-year-old healthy woman presented with this unusual and rare manifestation. She mentioned a history of unprotected exposure to detergents and bleaching chemical agents. Considering her low zinc level, she was prescribed with zinc capsules and recommended to avoid chemical substances for 6 months. During bimonthly follow-up, her zinc level turned normal, and leukonychia subsequently disappeared. Bilateral longitudinal true leukonychia in the nails due to zinc deficiency and exposure to chemical substances has not been reported previously. Direct and indirect effects of chemical substances on matrix and the effect of zinc deficiency on healing process should be considered in these cases. PMID:27857831

Gross and true ileal digestible amino acid contents of several animal body proteins and their hydrolysates.

Science.gov (United States)

Cui, J; Chong, B; Rutherfurd, S M; Wilkinson, B; Singh, H; Moughan, P J

2013-07-01

Amino acid compositions of ovine muscle, ovine myofibrillar protein, ovine spleen, ovine liver, bovine blood plasma, bovine blood globulins and bovine serum albumin and the amino acid compositions and in vivo (laboratory rat) true ileal amino acid digestibilities of hydrolysates (sequential hydrolysis with Neutrase, Alcalase and Flavourzyme) of these protein sources were determined. True ileal amino acid digestibility differed (Pprotein hydrolysates. The ovine myofibrillar protein and liver hydrolysates were the most digestible, with a mean true ileal digestibility across all amino acids of 99%. The least digestible protein hydrolysate was bovine serum albumin with a comparable mean true ileal digestibility of 93%. When the digestible amino acid contents were expressed as proportions relative to lysine, considerable differences, across the diverse protein sources, were found in the pattern of predicted absorbed amino acids. Copyright © 2013 Elsevier Ltd. All rights reserved.

Correction of the post -- necking true stress -- strain data using instrumented nanoindentation

Science.gov (United States)

Romero Fonseca, Ivan Dario

The study of large plastic deformations has been the focus of numerous studies particularly in the metal forming processes and fracture mechanics fields. A good understanding of the plastic flow properties of metallic alloys and the true stresses and true strains induced during plastic deformation is crucial to optimize the aforementioned processes, and to predict ductile failure in fracture mechanics analyzes. Knowledge of stresses and strains is extracted from the true stress-strain curve of the material from the uniaxial tensile test. In addition, stress triaxiality is manifested by the neck developed during the last stage of a tensile test performed on a ductile material. This necking phenomenon is the factor responsible for deviating from uniaxial state into a triaxial one, then, providing an inaccurate description of the material's behavior after the onset of necking. The research of this dissertation is aimed at the development of a correction method for the nonuniform plastic deformation (post-necking) portion of the true stress-strain curve. The correction proposed is based on the well-known relationship between hardness and flow (yield) stress, except that instrumented nanoindentation hardness is utilized rather than conventional macro or micro hardness. Three metals with different combinations of strain hardening behavior and crystal structure were subjected to quasi-static tensile tests: power-law strain hardening low carbon G10180 steel (BCC) and electrolytic tough pitch copper C11000 (FCC), and linear strain hardening austenitic stainless steel S30400 (FCC). Nanoindentation hardness values, measured on the broken tensile specimen, were converted into flow stress values by means of the constraint factor C from Tabor's, the representative plastic strainepsilonr and the post-test true plastic strains measured. Micro Vickers hardness testing was carried out on the sample as well. The constraint factors were 5.5, 4.5 and 4.5 and the representative plastic

True stress control asymmetric cyclic plastic behavior in SA333 C-Mn steel

International Nuclear Information System (INIS)

Paul, Surajit Kumar; Sivaprasad, S.; Dhar, S.; Tarafder, S.

2010-01-01

Asymmetric cyclic loading in the plastic region can leads to progressive accumulation of permanent strain. True stress controlled uniaxial asymmetric cycling on SA333 steel is conducted at various combinations of mean stress and stress amplitude in laboratory environment. It is investigated that fatigue life increases in the presence of mean stress. Plastic strain amplitude and hysteresis loop area are found to decrease with increasing mean stress. A huge difference of life and ratcheting strain accumulation is found in engineering and true stress controlled tests.

Hadronic vacuum polarization in true muonium

Science.gov (United States)

Lamm, Henry

2017-01-01

In order to reduce the theoretical uncertainty in the prediction, the leading-order hadronic vacuum polarization contribution to the hyperfine splitting of true muonium is reevaluated in two ways. A more complex pionic form factor and better estimates of the perturbative QCD contributions are used to study the model dependence of the previous calculation. The second, more accurate method directly integrates the Drell ratio R (s ) to obtain C1 ,HVP=-0.04874 (9 ) . This corresponds to an energy shift in the hyperfine splitting (HFS) of Δ EHFS,HVP μ=-8202 (16 ) MHz and represents a factor-of-50 reduction in the theoretical uncertainty from hadronic sources. We also compute the contribution in positronium, which is too small at present to detect.

How Fuzzy-Trace Theory Predicts True and False Memories for Words, Sentences, and Narratives

OpenAIRE

Reyna, Valerie F.; Corbin, Jonathan C.; Weldon, Rebecca B.; Brainerd, Charles J.

2016-01-01

Fuzzy-trace theory posits independent verbatim and gist memory processes, a distinction that has implications for such applied topics as eyewitness testimony. This distinction between precise, literal verbatim memory and meaning-based, intuitive gist accounts for memory paradoxes including dissociations between true and false memory, false memories outlasting true memories, and developmental increases in false memory. We provide an overview of fuzzy-trace theory, and, using mathematical model...

New approach to calculate the true-coincidence effect of HpGe detector

Energy Technology Data Exchange (ETDEWEB)

Alnour, I. A., E-mail: aaibrahim3@live.utm.my, E-mail: ibrahim.elnour@yahoo.com [Department of Physics, Faculty of Pure and Applied Science, International University of Africa, 12223 Khartoum (Sudan); Wagiran, H. [Department of Physics, Faculty of Science, Universiti Teknologi Malaysia, 81310 UTM Skudai,Johor (Malaysia); Ibrahim, N. [Faculty of Defence Science and Technology, National Defence University of Malaysia, Kem Sungai Besi, 57000 Kuala Lumpur (Malaysia); Hamzah, S.; Elias, M. S. [Malaysia Nuclear Agency (MNA), Bangi, 43000 Kajang, Selangor D.E. (Malaysia); Siong, W. B. [Chemistry Department, Faculty of Resource Science & Technology, Universiti Malaysia Sarawak, 94300 Kota Samarahan, Sarawak (Malaysia)

2016-01-22

The corrections for true-coincidence effects in HpGe detector are important, especially at low source-to-detector distances. This work established an approach to calculate the true-coincidence effects experimentally for HpGe detectors of type Canberra GC3018 and Ortec GEM25-76-XLB-C, which are in operation at neutron activation analysis lab in Malaysian Nuclear Agency (NM). The correction for true-coincidence effects was performed close to detector at distances 2 and 5 cm using {sup 57}Co, {sup 60}Co, {sup 133}Ba and {sup 137}Cs as standard point sources. The correction factors were ranged between 0.93-1.10 at 2 cm and 0.97-1.00 at 5 cm for Canberra HpGe detector; whereas for Ortec HpGe detector ranged between 0.92-1.13 and 0.95-100 at 2 and 5 cm respectively. The change in efficiency calibration curve of the detector at 2 and 5 cm after correction was found to be less than 1%. Moreover, the polynomial parameters functions were simulated through a computer program, MATLAB in order to find an accurate fit to the experimental data points.

Psychotherapy of the child with true brain damage.

Science.gov (United States)

Christ, Adolph E

1978-07-01

Psychotherapy of the child with true brain damage presents special problems and requires special approaches. Those who are cognitively primitive--at the sensorimotor or preoperational stage of development--require a crisis approach; those at the concrete or formal operational stage can be treated with a modified insight-oriented approach. Development of a therapeutic alliance, establishment of workable defense mechanisms, identification and clarification of unalterable cognitive defects and issues of termination unique to this special population are discussed.

Easy and Informative: Using Confidence-Weighted True-False Items for Knowledge Tests in Psychology Courses

Science.gov (United States)

Dutke, Stephan; Barenberg, Jonathan

2015-01-01

We introduce a specific type of item for knowledge tests, confidence-weighted true-false (CTF) items, and review experiences of its application in psychology courses. A CTF item is a statement about the learning content to which students respond whether the statement is true or false, and they rate their confidence level. Previous studies using…

Developmentally Invariant Dissociations in Children's True and False Memories: Not All Relatedness Is Created Equal

Science.gov (United States)

Howe, Mark L.

2006-01-01

The role of categorical versus associative relations in 5-, 7-, and 11-year-old children's true and false memories was examined using the Deese--Roediger--McDermott (DRM) paradigm and categorized lists of pictures or words with or without category labels as primes. For true items, recall increased with age and categorized lists were better…

Journalism as Justified True Belief

Directory of Open Access Journals (Sweden)

Sílvia Lisboa

2015-12-01

Full Text Available If it is important to think of journalism as a form of knowledge, then how does it become knowledge? How does this process work? In order to answer this question, this article proposes a new understanding of journalism as a subject; presenting it as a justified true belief. We think of journalism being based on pillars of truth and justification, conditions necessary in order for Epistemology to grant it the status of knowledge. We address the concept of truth and show how journalistic reports are justified to the public as well as consider the central role of credibility in this process. We add to the epistemic conception by using concepts of discourse that help to understand how journalism provides evidence through its intentions, its authority and its ability. This evidence acts like a guide for the reader towards forming opinions on journalistic reports and recognizing journalism as a form of knowledge.

Dicty_cDB: AFH258 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 6. 2 Translated Amino Acid sequence gllxskinikqi*k*kcqvvemvvii*kilaiilkkllfnhqkkqlql*ynkilmilk...vrqfqs*wvlinckl*iqsmvgfhqrcnkqimilkscllvf ywvplmhl*fgkvqerpq*fvdslkihfgvnkiisssirhqaqvmnisplsil*nlvipm vqyws...*nkkkl* Frame B: gllxskinikqi*k*kcqvvemvvii*kilaiilkkllfnhqkkqlql*ynkilmilkq* hhh*SQNPLVAVLVKINHHHHHHVVVVVIK

True amplitude wave equation migration arising from true amplitude one-way wave equations

Science.gov (United States)

Zhang, Yu; Zhang, Guanquan; Bleistein, Norman

2003-10-01

One-way wave operators are powerful tools for use in forward modelling and inversion. Their implementation, however, involves introduction of the square root of an operator as a pseudo-differential operator. Furthermore, a simple factoring of the wave operator produces one-way wave equations that yield the same travel times as the full wave equation, but do not yield accurate amplitudes except for homogeneous media and for almost all points in heterogeneous media. Here, we present augmented one-way wave equations. We show that these equations yield solutions for which the leading order asymptotic amplitude as well as the travel time satisfy the same differential equations as the corresponding functions for the full wave equation. Exact representations of the square-root operator appearing in these differential equations are elusive, except in cases in which the heterogeneity of the medium is independent of the transverse spatial variables. Here, we address the fully heterogeneous case. Singling out depth as the preferred direction of propagation, we introduce a representation of the square-root operator as an integral in which a rational function of the transverse Laplacian appears in the integrand. This allows us to carry out explicit asymptotic analysis of the resulting one-way wave equations. To do this, we introduce an auxiliary function that satisfies a lower dimensional wave equation in transverse spatial variables only. We prove that ray theory for these one-way wave equations leads to one-way eikonal equations and the correct leading order transport equation for the full wave equation. We then introduce appropriate boundary conditions at z = 0 to generate waves at depth whose quotient leads to a reflector map and an estimate of the ray theoretical reflection coefficient on the reflector. Thus, these true amplitude one-way wave equations lead to a 'true amplitude wave equation migration' (WEM) method. In fact, we prove that applying the WEM imaging condition

[Intel random number generator-based true random number generator].

Science.gov (United States)

Huang, Feng; Shen, Hong

2004-09-01

To establish a true random number generator on the basis of certain Intel chips. The random numbers were acquired by programming using Microsoft Visual C++ 6.0 via register reading from the random number generator (RNG) unit of an Intel 815 chipset-based computer with Intel Security Driver (ISD). We tested the generator with 500 random numbers in NIST FIPS 140-1 and X(2) R-Squared test, and the result showed that the random number it generated satisfied the demand of independence and uniform distribution. We also compared the random numbers generated by Intel RNG-based true random number generator and those from the random number table statistically, by using the same amount of 7500 random numbers in the same value domain, which showed that the SD, SE and CV of Intel RNG-based random number generator were less than those of the random number table. The result of u test of two CVs revealed no significant difference between the two methods. Intel RNG-based random number generator can produce high-quality random numbers with good independence and uniform distribution, and solves some problems with random number table in acquisition of the random numbers.

Case Report: A true median facial cleft (crano-facial dysraphia ...

African Journals Online (AJOL)

Case Report: A true median facial cleft (crano-facial dysraphia, atessier type O) in Bingham University Teaching Hospital, Jos. ... Patient had a multidisciplinary care by the obstetrician, Neonatologist, anesthesiologist and the plastic surgery team who scheduled a soft tissue repair of the upper lip defect, columella and ...

True many-particle scattering theory in oscillator representation

International Nuclear Information System (INIS)

Smirnov, Yu.F.; Shirokov, A.M.

1988-01-01

The scattering theory in oscillator representation in case of true multiparticle scattering (TMS) is generalized. All necessary expressions to construct a wave function of several particles system in a discrete or continuous spectra at TMS approximation are obtained. Essential advantage of the method suggested lies in the fact that the most difficult part: construction and diagonolization of the Hamiltonian cutted matrix is to be carried out only once, and then the wave function can be calculated at any designed energy. 23 refs

Data of evolutionary structure change: 1EP8B-1FAAA [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1EP8B-1FAAA 1EP8 1FAA B A -------------GGSVIVIDSKAAWDAQLAKGKEEHKP...IVVAFTATWCGPCKMIAPLFETLSNDYAGKVIFLKVDVD-AVAAVAEAAGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAAA LELALGT.../pdbChain> 1FAAA KLDCNQENKTL EEE HHH 1 1FAA A 1FAAA

[Actigraphy in Bipolar Disorder and First Degree Relatives].

Science.gov (United States)

Andrade Carrillo, Rommel; Gómez Cano, Sujey; Palacio Ortiz, Juan David; García Valencia, Jenny

2015-01-01

Bipolar disorder is a disabling disease that involves a significant economic costs to the health system, making it is essential to investigate possible early predictors such as changes in sleep-wake cycle in high-risk populations. To review the available literature on alterations in the sleep-wake cycle and circadian rhythm in patients with bipolar disorder and their first degree relatives. A literature search was performed in the data bases, Access Medicine, ClinicalKey, EMBASE, JAMA, Lilacs, OVID, Oxford Journals, ScienceDirect, SciELO, APA y PsycNET. Articles in both English and Spanish were reviewed, without limits by study type. Actigraphy is a non-invasive, useful method for assessing sleep-wake cycle disturbances in the active phases of bipolar disorder, and during euthymia periods. Actigraphy showed good sensitivity to predict true sleep, but low specificity, compared with polysomnography. Although studies in bipolar offspring and relatives are scarce, they show sleep changes similar to bipolar patients. Actigraphy may be a good screening tool of sleep/wake cycle in patients with bipolar disorders, because it is economic, non-invasive and sensitive. Longitudinal studies are required to evaluate its potential use as a risk marker. Copyright © 2014 Asociación Colombiana de Psiquiatría. Publicado por Elsevier España. All rights reserved.

SU-E-T-327: The Update of a XML Composing Tool for TrueBeam Developer Mode

International Nuclear Information System (INIS)

Yan, Y; Mao, W; Jiang, S

2014-01-01

Purpose: To introduce a major upgrade of a novel XML beam composing tool to scientists and engineers who strive to translate certain capabilities of TrueBeam Developer Mode to future clinical benefits of radiation therapy. Methods: TrueBeam Developer Mode provides the users with a test bed for unconventional plans utilizing certain unique features not accessible at the clinical mode. To access the full set of capabilities, a XML beam definition file accommodating all parameters including kV/MV imaging triggers in the plan can be locally loaded at this mode, however it is difficult and laborious to compose one in a text editor. In this study, a stand-along interactive XML beam composing application, TrueBeam TeachMod, was developed on Windows platforms to assist users in making their unique plans in a WYSWYG manner. A conventional plan can be imported in a DICOM RT object as the start of the beam editing process in which trajectories of all axes of a TrueBeam machine can be modified to the intended values at any control point. TeachMod also includes libraries of predefined imaging and treatment procedures to further expedite the process. Results: The TeachMod application is a major of the TeachMod module within DICOManTX. It fully supports TrueBeam 2.0. Trajectories of all axes including all MLC leaves can be graphically rendered and edited as needed. The time for XML beam composing has been reduced to a negligible amount regardless the complexity of the plan. A good understanding of XML language and TrueBeam schema is not required though preferred. Conclusion: Creating XML beams manually in a text editor will be a lengthy error-prone process for sophisticated plans. A XML beam composing tool is highly desirable for R and D activities. It will bridge the gap between scopes of TrueBeam capabilities and their clinical application potentials

Comparison of two-stage thermophilic (68 degrees C/55 degrees C) anaerobic digestion with one-stage thermophilic (55 degrees C) digestion of cattle manure.

Science.gov (United States)

Nielsen, H B; Mladenovska, Z; Westermann, P; Ahring, B K

2004-05-05

A two-stage 68 degrees C/55 degrees C anaerobic degradation process for treatment of cattle manure was studied. In batch experiments, an increase of the specific methane yield, ranging from 24% to 56%, was obtained when cattle manure and its fractions (fibers and liquid) were pretreated at 68 degrees C for periods of 36, 108, and 168 h, and subsequently digested at 55 degrees C. In a lab-scale experiment, the performance of a two-stage reactor system, consisting of a digester operating at 68 degrees C with a hydraulic retention time (HRT) of 3 days, connected to a 55 degrees C reactor with 12-day HRT, was compared with a conventional single-stage reactor running at 55 degrees C with 15-days HRT. When an organic loading of 3 g volatile solids (VS) per liter per day was applied, the two-stage setup had a 6% to 8% higher specific methane yield and a 9% more effective VS-removal than the conventional single-stage reactor. The 68 degrees C reactor generated 7% to 9% of the total amount of methane of the two-stage system and maintained a volatile fatty acids (VFA) concentration of 4.0 to 4.4 g acetate per liter. Population size and activity of aceticlastic methanogens, syntrophic bacteria, and hydrolytic/fermentative bacteria were significantly lower in the 68 degrees C reactor than in the 55 degrees C reactors. The density levels of methanogens utilizing H2/CO2 or formate were, however, in the same range for all reactors, although the degradation of these substrates was significantly lower in the 68 degrees C reactor than in the 55 degrees C reactors. Temporal temperature gradient electrophoresis profiles (TTGE) of the 68 degrees C reactor demonstrated a stable bacterial community along with a less divergent community of archaeal species. Copyright 2004 Wiley Periodicals, Inc.

Confidence Intervals for True Scores Using the Skew-Normal Distribution

Science.gov (United States)

Garcia-Perez, Miguel A.

2010-01-01

A recent comparative analysis of alternative interval estimation approaches and procedures has shown that confidence intervals (CIs) for true raw scores determined with the Score method--which uses the normal approximation to the binomial distribution--have actual coverage probabilities that are closest to their nominal level. It has also recently…

Automated fuel fabrication- a vision comes true

International Nuclear Information System (INIS)

Hemantha Rao, G.V.S.; Prakash, M.S.; Setty, C.R.P.; Gupta, U.C.

1997-01-01

When New Uranium Fuel Assembly Project at Nuclear Fuel Complex (NFC) begins production, its operator will have equipment provided with intramachine handling systems working automatically by pressing a single button. Additionally simple low cost inter machine handling systems will further help in critical areas. All these inter and intra machine handling systems will result in improved reliability, productivity and quality. The fault diagnostics, mimics and real time data acquisition systems make the plant more operator friendly. The paper deals with the experience starting from layout, selection of product carriers, different handling systems, the latest technology and the integration of which made the vision on automation in fuel fabrication come true. (author)

Coarsening and pattern formation during true morphological phase separation in unstable thin films under gravity

Science.gov (United States)

Kumar, Avanish; Narayanam, Chaitanya; Khanna, Rajesh; Puri, Sanjay

2017-12-01

We address in detail the problem of true morphological phase separation (MPS) in three-dimensional or (2 +1 )-dimensional unstable thin liquid films (>100 nm) under the influence of gravity. The free-energy functionals of these films are asymmetric and show two points of common tangency, which facilitates the formation of two equilibrium phases. Three distinct patterns formed by relative preponderance of these phases are clearly identified in "true MPS". Asymmetricity induces two different pathways of pattern formation, viz., defect and direct pathway for true MPS. The pattern formation and phase-ordering dynamics have been studied using statistical measures such as structure factor, correlation function, and growth laws. In the late stage of coarsening, the system reaches into a scaling regime for both pathways, and the characteristic domain size follows the Lifshitz-Slyozov growth law [L (t ) ˜t1 /3] . However, for the defect pathway, there is a crossover of domain growth behavior from L (t ) ˜t1 /4→t1 /3 in the dynamical scaling regime. We also underline the analogies and differences behind the mechanisms of MPS and true MPS in thin liquid films and generic spinodal phase separation in binary mixtures.

An X-ray CCD signal generator with true random arrival time

International Nuclear Information System (INIS)

Huo Jia; Xu Yuming; Chen Yong; Cui Weiwei; Li Wei; Zhang Ziliang; Han Dawei; Wang Yusan; Wang Juan

2011-01-01

An FPGA-based true random signal generator with adjustable amplitude and exponential distribution of time interval is presented. Since traditional true random number generators (TRNG) are resource costly and difficult to transplant, we employed a method of random number generation based on jitter and phase noise in ring oscillators formed by gates in an FPGA. In order to improve the random characteristics, a combination of two different pseudo-random processing circuits is used for post processing. The effects of the design parameters, such as sample frequency are discussed. Statistical tests indicate that the generator can well simulate the timing behavior of random signals with Poisson distribution. The X-ray CCD signal generator will be used in debugging the CCD readout system of the Low Energy X-ray Instrument onboard the Hard X-ray Modulation Telescope (HXMT). (authors)

The young Marx on constituent power and “true democracy.”

DEFF Research Database (Denmark)

Flohr, Mikkel

Marx and Marxism is commonly charged with having neglected politics and the development of a theory of politics. However, this presumption ignores Marx’s unfinished and unpublished 1843 Critique of Hegel’s Doctrine of State, where he engaged political theory at length – an engagement, which...... propelled him towards his subsequent critique of political economy. It is the aim of the proposed paper to reconstruct and reinterpret his argument focusing in particular on his conceptualization of constituent power and “true democracy.” In the 1843 Critique Marx argues that democracy is the foundation...... the conflicts of civil society. Marx therefore concludes that all these political forms are democracies in contradiction with themselves. Marx proceeds to suggest that it is possible to overcome these contradictions and develop an adequate political form of democracy, which he describes as “true democracy...

Third Degree Skin Burns Caused by an MRI Compatible Electrocardiographic Monitoring System

DEFF Research Database (Denmark)

Brix, Lau; Isaksen, Christin Rosendahl Graff; Kristensen, Birgitte Hornbæk

of the assigned compatibility specifications of the leads due to the use of TFE sequences with high SAR values. MRI compatible monitoring systems are only safe when used with proper care. The presented burn cases may have been avoided if space had been provided between the ECG leads and the skin using a cloth....... This holds true even in cases in which the devices are MRI compatible and therefore safe in specified MRI environments. Of particular interest to this case report is skin burns caused by the ECG monitoring equipment. In this context, several cases of ECG electrode related burns have been reported, while...... burns caused by the ECG cables are less common [1]. This case report presents two unusual cases of skin burns which were caused by MRI safe ECG leads during scanning. Cases:Two patients suffered third degree burns using MRI approved ECG leads (Medrad® Veris MR Monitor system) in a Siemens Skyra 3...

The true invariant of an arbitrage free portfolio

Science.gov (United States)

Schmidt, Anatoly B.

2003-03-01

It is shown that the arbitrage free portfolio paradigm being applied to a portfolio with an arbitrary number of shares N allows for the extended solution in which the option price F depends on N. However the resulting stock hedging expense Q= MF (where M is the number of options in the portfolio) does not depend on whether N is treated as an independent variable or as a parameter. Therefore the stock hedging expense is the true invariant of the arbitrage free portfolio paradigm.

Operational implications of accepting and denying whether a true value of risk exists

DEFF Research Database (Denmark)

Kozin, Igor

It is suggested to look on probabilistic risk quantities and concepts through the prism of accepting one of the views: whether a true value of risk exists or not. It will be argued that discussions until now have been primarily focused on closely related topics that are different from the suggested...... one. In general, the values of risks are not known precisely and the analyst has the option to consider that convergence to a precise value of risk is possible in the limit. That is, the true value exists but due to limited time, resources or other limitations in assessing probabilities...

Why do different people choose different university degrees? Motivation and the choice of degree

Directory of Open Access Journals (Sweden)

Anya eSkatova

2014-11-01

Full Text Available Different people choose which undergraduate degree to study at the university for different reasons. To date, there have been limited attempts to identify individual differences in motivation that drive the undergraduate degree choice. We identified that people choose university degrees for four reasons: career concerns (Career, intrinsic interest (Interest in the subject, an opportunity to help others (Helping and because they are looking for an easy option into higher education (Loafing. We investigated whether these motivation apply to the choice of undergraduate degree in two samples: (1 undergraduate (N = 989 and (2 prospective (N = 896 students. We developed the Motivations Influencing Course Choice (MICC questionnaire to measure these motivations. Scales of Helping, Career, Loafing and Interest showed good psychometric properties, showed validity with respect to general life goals and personality traits, and predicted actual and prospective degree choices. We demonstrated that medical degrees were chosen due to a mixture of Helping and Career, while engineering degrees were associated with Career and low interest in the degree. The choice of art and humanities degrees was driven by Interest and low concern about future career, accompanied with high Loafing. We also demonstrated gender differences: females were high in Helping (both samples and Interest (only in undergraduate sample motivation, while males scored higher in Career (only in undergraduate sample and Loafing (both samples. The findings can feed into both theoretical accounts of proximal motivation as well as help to improve degree programmes at universities and provide better career advice.

Why do different people choose different university degrees? Motivation and the choice of degree.

Science.gov (United States)

Skatova, Anya; Ferguson, Eamonn

2014-01-01

Different people choose undergraduate degrees to study at university for different reasons. To date, there have been limited attempts to identify individual differences in motivation that drive undergraduate degree choice. We identified that people choose university degrees for four reasons: career concerns (Career), intrinsic interest in the subject (Interest), an opportunity to help others (Helping) and because they are looking for an easy option to get into higher education (Loafing). We investigated whether these motivations apply to the choice of undergraduate degree in two samples: (1) undergraduate (N = 989) and (2) prospective (N = 896) students. We developed the Motivations Influencing Course Choice (MICC) questionnaire to measure these motivations. Scales of Helping, Career, Loafing, and Interest showed good psychometric properties, showed validity with respect to general life goals and personality traits, and predicted actual and prospective degree choices. We demonstrated that medical degrees were chosen due to a mixture of Helping and Career, while engineering degrees were associated with Career and low Interest in the degree. The choice of arts and humanities degrees was driven by Interest and low concern about future career, accompanied with high Loafing. We also demonstrated gender differences: females were high in Helping (both samples) and Interest (only in the undergraduate sample) motivation, while males scored higher in Career (only in the undergraduate sample) and Loafing (both samples). The findings can feed into both theoretical accounts of proximal motivation as well as provide help to improve degree programmes at universities and support better career advice.

Final report of the TRUE Block Scale project. 1. Characterisation and model development

Energy Technology Data Exchange (ETDEWEB)

Andersson, Peter; Byegaard, Johan [Geosigma AB, Uppsala (Sweden); Dershowitz, Bill; Doe, Thomas [Golder Associates Inc., Redmond, WA (United States); Hermanson, Jan [Golder Associates AB (Sweden); Meier, Peter [ANDRA, Chatenay-Malabry (France); Tullborg, Eva-Lena [Terralogica AB (Sweden); Winberg, Anders (ed.) [Conterra AB, Partille (Sweden)

2002-04-01

The general objectives of the TRUE Block Scale Project were to 1) increase understanding of tracer transport in a fracture network and to improve predictive capabilities, 2) assess the importance of tracer retention mechanisms (diffusion and sorption) in a fracture network, and 3) assess the link between flow and transport data as a means for predicting transport phenomena. During the period mid 1996 through mid 1999 a 200x250x100 m rock volume was characterised with the purpose of furnishing the basis for successful tracer experiments in a network of conductive structures in the block scale (10-100 m). In total five cored boreholes were drilled as part of the project in an iterative mode with a period of analysis following completion of characterisation, and with a strong component of inter activity with numerical modelling and experimental design, particularly towards the end of the characterisation. The combined use of pressure responses due to drilling and drilling records provided important early information/confirmation of the existence and location of a given structure. Verification of conductors identified from pressure responses was achieved through the use of various flow logging techniques. The usage of the Posiva difference flow log towards the end of the characterisation work enabled identification of discrete conductive fractures with a high resolution. Pressure responses collected during drilling were used to obtain a first assessment of connectivity between boreholes. The transient behaviour of the responses collected during cross-hole interference tests in packed-off boreholes were used to identify families of responses, which correlated well with the identified principal families of structures/fracture networks. The conductive geometry of the investigated rock block is made up of steeply dipping deterministic NW structures and NNW structures. High inflows in the boreholes were for the most part associated with geologically/geometrically identified

Final report of the TRUE Block Scale project. 1. Characterisation and model development

International Nuclear Information System (INIS)

Andersson, Peter; Byegaard, Johan; Dershowitz, Bill; Doe, Thomas; Hermanson, Jan; Meier, Peter; Tullborg, Eva-Lena; Winberg, Anders

2002-04-01

The general objectives of the TRUE Block Scale Project were to 1) increase understanding of tracer transport in a fracture network and to improve predictive capabilities, 2) assess the importance of tracer retention mechanisms (diffusion and sorption) in a fracture network, and 3) assess the link between flow and transport data as a means for predicting transport phenomena. During the period mid 1996 through mid 1999 a 200x250x100 m rock volume was characterised with the purpose of furnishing the basis for successful tracer experiments in a network of conductive structures in the block scale (10-100 m). In total five cored boreholes were drilled as part of the project in an iterative mode with a period of analysis following completion of characterisation, and with a strong component of inter activity with numerical modelling and experimental design, particularly towards the end of the characterisation. The combined use of pressure responses due to drilling and drilling records provided important early information/confirmation of the existence and location of a given structure. Verification of conductors identified from pressure responses was achieved through the use of various flow logging techniques. The usage of the Posiva difference flow log towards the end of the characterisation work enabled identification of discrete conductive fractures with a high resolution. Pressure responses collected during drilling were used to obtain a first assessment of connectivity between boreholes. The transient behaviour of the responses collected during cross-hole interference tests in packed-off boreholes were used to identify families of responses, which correlated well with the identified principal families of structures/fracture networks. The conductive geometry of the investigated rock block is made up of steeply dipping deterministic NW structures and NNW structures. High inflows in the boreholes were for the most part associated with geologically/geometrically identified

How Fuzzy-Trace Theory Predicts True and False Memories for Words, Sentences, and Narratives

Science.gov (United States)

Reyna, Valerie F.; Corbin, Jonathan C.; Weldon, Rebecca B.; Brainerd, Charles J.

2016-01-01

Fuzzy-trace theory posits independent verbatim and gist memory processes, a distinction that has implications for such applied topics as eyewitness testimony. This distinction between precise, literal verbatim memory and meaning-based, intuitive gist accounts for memory paradoxes including dissociations between true and false memory, false memories outlasting true memories, and developmental increases in false memory. We provide an overview of fuzzy-trace theory, and, using mathematical modeling, also present results demonstrating verbatim and gist memory in true and false recognition of narrative sentences and inferences. Results supported fuzzy-trace theory's dual-process view of memory: verbatim memory was relied on to reject meaning-consistent, but unpresented, sentences (via recollection rejection). However, verbatim memory was often not retrieved, and gist memory supported acceptance of these sentences (via similarity judgment and phantom recollection). Thus, mathematical models of words can be extended to explain memory for complex stimuli, such as narratives, the kind of memory interrogated in law. PMID:27042402

Using Story Contexts to Bias Children's True and False Memories

Science.gov (United States)

Howe, Mark L.; Wilkinson, Samantha

2011-01-01

The effects of embedding standard Deese/Roediger-McDermott (DRM) lists into stories whose context biased interpretation either toward or away from the overall themes of the DRM lists on both true and false recognition were investigated with 7- and 11-year-olds. These biased story contexts were compared with the same children's susceptibility to…

Importance of small-degree nodes in assortative networks with degree-weight correlations

Science.gov (United States)

Ma, Sijuan; Feng, Ling; Monterola, Christopher Pineda; Lai, Choy Heng

2017-10-01

It has been known that assortative network structure plays an important role in spreading dynamics for unweighted networks. Yet its influence on weighted networks is not clear, in particular when weight is strongly correlated with the degrees of the nodes as we empirically observed in Twitter. Here we use the self-consistent probability method and revised nonperturbative heterogenous mean-field theory method to investigate this influence on both susceptible-infective-recovered (SIR) and susceptible-infective-susceptible (SIS) spreading dynamics. Both our simulation and theoretical results show that while the critical threshold is not significantly influenced by the assortativity, the prevalence in the supercritical regime shows a crossover under different degree-weight correlations. In particular, unlike the case of random mixing networks, in assortative networks, the negative degree-weight correlation leads to higher prevalence in their spreading beyond the critical transmissivity than that of the positively correlated. In addition, the previously observed inhibition effect on spreading velocity by assortative structure is not apparent in negatively degree-weight correlated networks, while it is enhanced for that of the positively correlated. Detailed investigation into the degree distribution of the infected nodes reveals that small-degree nodes play essential roles in the supercritical phase of both SIR and SIS spreadings. Our results have direct implications in understanding viral information spreading over online social networks and epidemic spreading over contact networks.

A Case Study of True and Fair View Override in Financial Reporting

Directory of Open Access Journals (Sweden)

Ho Horace

2016-12-01

Full Text Available This paper documents a case study of true and fair view override in financial reporting by a multinational firm subject to International Financial Reporting Standards (IFRSs. The 2009 Interim Report of HSBC Holdings plc states that HSBC departed from the requirements of IAS 32 Financial Instruments: Presentation (IAS 32. Notwithstanding its noncompliance with the IFRSs, HSBC (2009 concluded that “the interim consolidated financial statements prepared on this basis presented fairly, and gave a true and fair view of the Group’s financial position, financial performance and cash flows” (p. 2. The purpose of this paper is to evaluate critically the accounting treatment in light of the relevant requirements of the IFRSs and the implications for professional accounting standards arising from this departure.

True versus spurious state dependence in firm performance

DEFF Research Database (Denmark)

Kaiser, Ulrich; Kongsted, Hans Christian

2008-01-01

This paper analyzes the persistence of firms' exporting behavior in a panel of German manufacturing firms using dynamic binary choice models. We distinguish between true and spurious state dependence in exports and apply fixed effects methods that allow us to verify the robustness of our results ...... determinants. Our results, which are consistent with the findings of previous studies on firms in developing countries and in the United States, show the presence of important sunk costs in export market entry and a depreciation of knowledge and experience in export markets....

True Versus Spurious State Dependence in Firm Performance

DEFF Research Database (Denmark)

Kaiser, Ulrich; Kongsted, Hans Christian

This paper analyzes the persistence of firms' exporting behavior in a panel of German manufacturing firms using dynamic binary choice models. We distinguish between true and spurious state dependence in exports and apply fixed effects methods that allow us to verify the robustness of our results ...... determinants. Our results, which are consistent with the findings of previous studies on firms in developing countries and in the United States, show the presence of important sunk costs in export market entry and a depreciation of knowledge and experience in export markets...

True Triaxial Strength and Failure Modes of Cubic Rock Specimens with Unloading the Minor Principal Stress

Science.gov (United States)

Li, Xibing; Du, Kun; Li, Diyuan

2015-11-01

True triaxial tests have been carried out on granite, sandstone and cement mortar using cubic specimens with the process of unloading the minor principal stress. The strengths and failure modes of the three rock materials are studied in the processes of unloading σ 3 and loading σ 1 by the newly developed true triaxial test system under different σ 2, aiming to study the mechanical responses of the rock in underground excavation at depth. It shows that the rock strength increases with the raising of the intermediate principal stress σ 2 when σ 3 is unloaded to zero. The true triaxial strength criterion by the power-law relationship can be used to fit the testing data. The "best-fitting" material parameters A and n ( A > 1.4 and n plastic deformation. The maximum extension strain criterion Stacey (Int J Rock Mech Min Sci Geomech Abstr 651 18(6):469-474, 1981) can be used to explain the change of failure mode from shear to slabbing for strong and hard rocks under true triaxial unloading test condition.

Perfusion MR imaging of the heart with TrueFISP

International Nuclear Information System (INIS)

Schreiber, W.G.; Schmitt, M.; Kalden, P.; Mohrs, O.; Kreitner, K.F.; Thelen, M.; Horstick, G.; Gumbrich, T.; Petersen, S.; Voigtlaender, T.

2001-01-01

Objective: Development and test of a saturation-recovery TrueFISP (SR-Trufi) pulse sequence for myocardial perfusion MR imaging (MRI) using improved gradient hardware. Material and methods: Measurements were performed on a 1.5 T scanner with prototype gradients (50 mT/m, minimum rise time 300 μs). T 1 -weighted first-pass MRI of Gd-DTPA (0.025 μmol/kg) kinetics in the myocardium was performed using an SR-Trufi pulse sequence (T R /T E /α=2.6 ms/1.4 ms/55 ) with a saturation preparation of TD-30 ms before the TrueFISP readout. Measurements were performed in volunteers (n=4) and in a pig model of chronic ischemia (n=1). Results: In phantoms, the signal intensity was linear with contrast concentration up to 0.9 mmol/kg Gd-DTPA. MR images obtained with SR-Trufi had a good image quality and high spatial resolution of 2.1 mmx2.1 mm. Differences of the contrast agent's kinetics between a subendocardial perfusion deficit and neighboring myocardium were well visible on both MR images and signal-time curves derived from the region-of-interest analysis. Conclusion: SR-Trufi appears to be an interesting new technique for the assessment of myocardial microcirculation using dedicated cardiovascular MR systems. (orig.) [de

Neural correlates of true and false memory in mild cognitive impairment.

Science.gov (United States)

Sweeney-Reed, Catherine M; Riddell, Patricia M; Ellis, Judi A; Freeman, Jayne E; Nasuto, Slawomir J

2012-01-01

The goal of this research was to investigate the changes in neural processing in mild cognitive impairment. We measured phase synchrony, amplitudes, and event-related potentials in veridical and false memory to determine whether these differed in participants with mild cognitive impairment compared with typical, age-matched controls. Empirical mode decomposition phase locking analysis was used to assess synchrony, which is the first time this analysis technique has been applied in a complex cognitive task such as memory processing. The technique allowed assessment of changes in frontal and parietal cortex connectivity over time during a memory task, without a priori selection of frequency ranges, which has been shown previously to influence synchrony detection. Phase synchrony differed significantly in its timing and degree between participant groups in the theta and alpha frequency ranges. Timing differences suggested greater dependence on gist memory in the presence of mild cognitive impairment. The group with mild cognitive impairment had significantly more frontal theta phase locking than the controls in the absence of a significant behavioural difference in the task, providing new evidence for compensatory processing in the former group. Both groups showed greater frontal phase locking during false than true memory, suggesting increased searching when no actual memory trace was found. Significant inter-group differences in frontal alpha phase locking provided support for a role for lower and upper alpha oscillations in memory processing. Finally, fronto-parietal interaction was significantly reduced in the group with mild cognitive impairment, supporting the notion that mild cognitive impairment could represent an early stage in Alzheimer's disease, which has been described as a 'disconnection syndrome'.

Neural Correlates of True and False Memory in Mild Cognitive Impairment

Science.gov (United States)

Sweeney-Reed, Catherine M.; Riddell, Patricia M.; Ellis, Judi A.; Freeman, Jayne E.; Nasuto, Slawomir J.

2012-01-01

The goal of this research was to investigate the changes in neural processing in mild cognitive impairment. We measured phase synchrony, amplitudes, and event-related potentials in veridical and false memory to determine whether these differed in participants with mild cognitive impairment compared with typical, age-matched controls. Empirical mode decomposition phase locking analysis was used to assess synchrony, which is the first time this analysis technique has been applied in a complex cognitive task such as memory processing. The technique allowed assessment of changes in frontal and parietal cortex connectivity over time during a memory task, without a priori selection of frequency ranges, which has been shown previously to influence synchrony detection. Phase synchrony differed significantly in its timing and degree between participant groups in the theta and alpha frequency ranges. Timing differences suggested greater dependence on gist memory in the presence of mild cognitive impairment. The group with mild cognitive impairment had significantly more frontal theta phase locking than the controls in the absence of a significant behavioural difference in the task, providing new evidence for compensatory processing in the former group. Both groups showed greater frontal phase locking during false than true memory, suggesting increased searching when no actual memory trace was found. Significant inter-group differences in frontal alpha phase locking provided support for a role for lower and upper alpha oscillations in memory processing. Finally, fronto-parietal interaction was significantly reduced in the group with mild cognitive impairment, supporting the notion that mild cognitive impairment could represent an early stage in Alzheimer’s disease, which has been described as a ‘disconnection syndrome’. PMID:23118992

True polar wander on convecting planets

Science.gov (United States)

Rose, Ian Robert

Rotating planets are most stable when spinning around their maximum moment of inertia, and will tend to reorient themselves to achieve this configuration. Geological activity redistributes mass in the planet, making the moment of inertia a function of time. As the moment of inertia of the planet changes, the spin axis shifts with respect to a mantle reference frame in order to maintain rotational stability. This process is known as true polar wander (TPW). Of the processes that contribute to a planet's moment of inertia, convection in the mantle generates the largest and longest-period fluctuations, with corresponding shifts in the spin axis. True polar wander has been hypothesized to explain several physiographic features on planets and moons in our solar system. On Earth, TPW events have been invoked in some interpretations of paleomagnetic data. Large swings in the spin axis could have enormous ramifications for paleogeography, paleoclimate, and the history of life. Although the existence of TPW is well-verified, it is not known whether its rate and magnitude have been large enough for it to be an important process in Earth history. If true polar wander has been sluggish compared to plate tectonic speeds, then it would be difficult to detect and its consequences would be minor. I investigate rates of true polar wander on convecting planets using scaling, numerics, and inverse problems. I perform a scaling analysis of TPW on a convecting planet, identifying a minimal set of nondimensional parameters which describe the problem. The primary nondimensional numbers that control the rate of TPW are the ratio of centrifugal to gravitational forces m and the Rayleigh number Ra. The parameter m sets the size of a planet's rotational bulge, which determines the amount of work that needs to be done to move the spin axis. The Rayleigh number controls the size, distribution, and rate of change of moment of inertia anomalies, all of which affect the rate of TPW. I find that

A material-sparing method for simultaneous determination of true density and powder compaction properties--aspartame as an example.

Science.gov (United States)

Sun, Changquan Calvin

2006-12-01

True density results for a batch of commercial aspartame are highly variable when helium pycnometry is used. Alternatively, the true density of the problematic aspartame lot was obtained by fitting tablet density versus pressure data. The fitted true density was in excellent agreement with that predicted from single crystal structure. Tablet porosity was calculated from the true density and tablet apparent density. After making the necessary measurements for calculating tablet apparent density, the breaking force of each intact tablet was measured and tensile strength was calculated. With the knowledge of compaction pressure, tablet porosity and tensile strength, powder compaction properties were characterized using tabletability (tensile strength versus pressure), compactibility (tensile strength versus porosity), compressibility (porosity versus pressure) and Heckel analysis. Thus, a wealth of additional information on the compaction properties of the powder was obtained through little added work. A total of approximately 4 g of powder was used in this study. Depending on the size of tablet tooling, tablet thickness and true density, 2-10 g of powder would be sufficient for characterizing most pharmaceutical powders.

Fluctuating confidence: the dynamic consequences of true/false affirmatives and denials on how a listener appraises their personal past.

Science.gov (United States)

Davis, Jolee; Bayantemur, Sharon Y; Seecharan, Sasha; Unger, Leslie D; Hellgren, Johanna; Stone, Charles B

2018-08-01

The present study examined the mnemonic consequences of true/false denials and affirmatives on how a listener appraises their personal past. To this end, participants (listeners) rated the extent to which they were confident certain events occurred during their childhood. They rated these events both before and after a confederate (speaker) denied or affirmed the occurrence of four different childhood events each, for a total of eight "rehearsed" events. For each set (denials and affirmatives) of events, half were true and half were false. In turn, this created four types of events (two each): true denials, true affirmatives, false denials, and false affirmatives. Additionally, half of the participants were told that the speaker was provided independent information about the veracity of the event's occurrence ("expert" condition). Overall, listeners were less confident in the occurrence of false denial events, but more so when they believed the speaker to be more knowledgeable of the listeners memories, more confident in false affirmative events and, counter intuitively, more confident in the occurrence of true denial events. These results underscore the importance of a nuanced approach to the mnemonic consequences of true and false denials and affirmations in the course of social interactions.

Endovascular treatment of a true posterior communicating artery aneurysm

OpenAIRE

Munarriz, Pablo M.; Castaño-Leon, Ana M.; Cepeda, Santiago; Campollo, Jorge; Alén, Jose F.; Lagares, Alfonso

2014-01-01

Background: Posterior communicating artery (PCoA) aneurysms are most commonly located at the junction of the internal carotid artery and the PCoA. "True" PCoA aneurysms, which originate from the PCoA itself, are rarely encountered. Most previously reported cases were treated surgically mainly before the endovascular option became available. Case Description: A 53-year-old male presented with sudden onset of right hemiparesis and aphasia. Left middle cerebral artery stroke was diagnosed. F...

Apparent and true resistant hypertension: definition, prevalence and outcomes

OpenAIRE

Judd, E; Calhoun, DA

2014-01-01

Resistant hypertension, defined as blood pressure (BP) remaining above goal despite the use of ≥3 antihypertensive medications at maximally tolerated doses (one ideally being a diuretic) or BP that requires ≥4 agents to achieve control, has received more attention with increased efforts to improve BP control rates and the emergence of device-based therapies for hypertension. This classically defined resistant group consists of patients with true resistant hypertension, controlled resistant hy...

Standardization of the TRUE Test imidazolidinyl urea and diazolidinyl urea patches

DEFF Research Database (Denmark)

Agner, T; Andersen, Klaus Ejner; Björkner, B

2001-01-01

The preservatives imidazolidinyl urea (IMID, Germall 115) and diazolidinyl urea (DU, Germall II) are commonly used in cosmetic products and are well-known sensitizers. The aim of the present study was to establish the optimal patch test concentration in hydrophilic dried-in vehicle (TRUE Test...

Performance and microbial community composition dynamics of aerobic granular sludge from sequencing batch bubble column reactors operated at 20 degrees C, 30 degrees C, and 35 degrees C.

Science.gov (United States)

Ebrahimi, Sirous; Gabus, Sébastien; Rohrbach-Brandt, Emmanuelle; Hosseini, Maryam; Rossi, Pierre; Maillard, Julien; Holliger, Christof

2010-07-01

Two bubble column sequencing batch reactors fed with an artificial wastewater were operated at 20 degrees C, 30 degrees C, and 35 degrees C. In a first stage, stable granules were obtained at 20 degrees C, whereas fluffy structures were observed at 30 degrees C. Molecular analysis revealed high abundance of the operational taxonomic unit 208 (OTU 208) affiliating with filamentous bacteria Leptothrix spp. at 30 degrees C, an OTU much less abundant at 20 degrees C. The granular sludge obtained at 20 degrees C was used for the second stage during which one reactor was maintained at 20 degrees C and the second operated at 30 degrees C and 35 degrees C after prior gradual increase of temperature. Aerobic granular sludge with similar physical properties developed in both reactors but it had different nutrient elimination performances and microbial communities. At 20 degrees C, acetate was consumed during anaerobic feeding, and biological phosphorous removal was observed when Rhodocyclaceae-affiliating OTU 214 was present. At 30 degrees C and 35 degrees C, acetate was mainly consumed during aeration and phosphorous removal was insignificant. OTU 214 was almost absent but the Gammaproteobacteria-affiliating OTU 239 was more abundant than at 20 degrees C. Aerobic granular sludge at all temperatures contained abundantly the OTUs 224 and 289 affiliating with Sphingomonadaceae indicating that this bacterial family played an important role in maintaining stable granular structures.

Prion protein immunocytochemistry helps to establish the true incidence of prion diseases.

Science.gov (United States)

Lantos, P L; McGill, I S; Janota, I; Doey, L J; Collinge, J; Bruce, M T; Whatley, S A; Anderton, B H; Clinton, J; Roberts, G W

1992-11-23

Creutzfeldt-Jakob disease (CJD) and Gerstmann-Strüssler-Scheinker disease (GSSD) are transmissible spongiform encephalopathies or prion diseases affecting man. It has been reported that prion diseases may occur without the histological hallmarks of spongiform encephalopathies: vacuolation of the cerebral grey matter, neuronal loss and astrocytosis. These cases without characteristic neuropathology may go undiagnosed and consequently the true incidence of transmissible dementias is likely to have been under-estimated. Immunocytochemistry using antibodies to prion protein gives positive staining of these cases, albeit the pattern of immunostaining differs from that seen in typical forms. Accumulation of prion protein is a molecular hallmark of prion diseases, and thus a reproducible, speedy and cost-efficient immunocytochemical screening of unusual dementias may help to establish the true incidence of prion diseases.

A true random number generator based on mouse movement and chaotic cryptography

International Nuclear Information System (INIS)

Hu Yue; Liao Xiaofeng; Wong, Kwok-wo; Zhou Qing

2009-01-01

True random number generators are in general more secure than pseudo random number generators. In this paper, we propose a novel true random number generator which generates a 256-bit random number by computer mouse movement. It is cheap, convenient and universal for personal computers. To eliminate the effect of similar movement patterns generated by the same user, three chaos-based approaches, namely, discretized 2D chaotic map permutation, spatiotemporal chaos and 'MASK' algorithm, are adopted to post-process the captured mouse movements. Random bits generated by three users are tested using NIST statistical tests. Both the spatiotemporal chaos approach and the 'MASK' algorithm pass the tests successfully. However, the latter has a better performance in terms of efficiency and effectiveness and so is more practical for common personal computer applications.

Is That Graduate Degree Worth It? Comparing the Recruitment of Undergraduate and Graduate Degree Job Applicants

Science.gov (United States)

Richardson, R. M.

2001-12-01

One could argue from a business prospective that colleges and universities are not working hard enough to train students for life in the business and civic world, at either the undergraduate or graduate levels. What is it that employers are looking for in students? How different are the skills and attributes employers are looking for between undergraduate and graduate students? How unique are the geosciences in this respect? At the undergraduate level recruiters have spoken loud and clear about what they want. According to the dean of the business school here at the University of Arizona, recruiters at the undergraduate degree level in business base less than half of their hiring decision on specific content knowledge in the discipline, and correspondingly more than half on the so-called soft skills ... ability to apply knowledge in new situations, ability to think critically, ability to communicate with others in both written and oral forms, ability to work in teams, ability to work with a diverse set of employees and customers (especially, but not limited to, the global job market), etc. How true is this at the graduate level, where students have typically spent 4-6 years specializing in a discipline? Is there a set of fundamental knowledge that employers are looking for at the graduate level? Are the so-called soft skills correspondingly less important? I will present results from a survey of graduate programs and industry recruiters addressing these questions, and highlight the areas of overlap and difference between undergraduates and graduates looking for jobs. I will concentrate specifically on jobs in the oil industry and on both masters and Ph.D. programs.

True to Yourself Leading a Values-Based Business

CERN Document Server

Albion, Mark

2006-01-01

How do you build the kind of company you've always wanted to work in--one that serves people and the planet while being financially successful, too? What do you do when you believe that business should serve the common good, but everyday business pressures--meeting payroll, battling competition, keeping customers and investors happy--are at a fever pitch? Leading a small business when you measure success more broadly than with a single financial bottom line is no easy task. True to Yourself is a practical guide to doing just that. It provides tools you can use to combine profit with purpose, m

The incidence and prognosis of true duodenal carcinomas

DEFF Research Database (Denmark)

Buchbjerg, Thomas; Fristrup, C.; Mortensen, M. B.

2015-01-01

the criteria for true PDC. The incidence was 5.4 per 1,000,000, and the pathological classification was: Adenocarcinoma 87%, mucinous adenocarcinoma 7%, carcinoma 4% and signet ring cell carcinoma 1%. Intended curative resection was performed in 28 patients (39%) (22 Whipple procedures and 6 local resections......), and all but one patient had negative resection margins. Thirteen patients (46%) had lymph node metastasis. Twenty-nine (67%) of the palliative treated patients had a single (n = 24) or double by-pass procedure (n = 5). The median and 5-year survival for the resected patients were 23 months (CI 7...

A Comparison between the Rhesus Monkey and the Human on the Effect of Atropine on the Electroencephalogram. Volume 2. Preliminary Statistical Analysis of Spectral EEG Waveforms in Rhesus Monkeys Exposed to Atropine.

Science.gov (United States)

1994-11-01

000000 000000 000000 000000 000000 C) H rHI HHHH HHHHH - rIr- - rIr H HHHHH 1 1 l H HHHHH- rIr- -I ri - HHHHHH H E-1~~ o~o ~ N H W~r ~ ~ W~MqU) co ýH H aiI...NMlCMMH’DHOO I-NNNMNIr- I- NNNNOnMH U) toH H H z. 000000000 000000000 Cl) H HHHHHH HHHHHHqHHH H- E-4 N MWr-N H Mr- N wMn0~r-oMMN Wl MNHOMM0O’ ro m olq~w H...ý C4k 44 4 ýL 4C 00000 HHH.-4 1- HH H HHHH HHHH U) /u) co* o nvr r-IO NOHM H0(-if0 m i c4 HooD- 00 Z 0000 000000000 00000 VI) H HHHHHH HHHHH HHHH 1

Determination of true digestible amino acids of feedstuffs utilizing cecectomized roosters

Directory of Open Access Journals (Sweden)

Eliane Aparecida da Silva

2012-09-01

Full Text Available The objective of this study was to estimate the true digestibility coefficients of amino acids and digestible amino acid values of some poultry feedstuffs. The feedstuffs were: babassu meal, sunflower meal, corn gluten meal, babassu starchy meal, meat and bone meal, common beans, pearl millet and residues of cookies, pasta and bread. The precise feeding method of Sibbald was used with adult cecectomized Leghorn roosters distributed in a completely randomized design, consisting of ten treatments and six replications with a rooster in each. The treatments were represented by the feedstuffs evaluated. The roosters were kept in a period of fasting for 36 hours and then fed 30 grams of feed. Samples were collected during 56 hours. Simultaneously, six roosters were kept fasting to make corrections to the metabolic and endogenous losses of amino acids. At the end of collections, the excreta obtained were weighed, freeze-dried and subsequently processed, so laboratory analyses were carried out and the coefficients of true digestibility of amino acids were determined. The mean values of the coefficients of true digestibility of essential and non-essential amino acids in percentage were respectively: 0.702 and 0.652 for the babassu meal; 0.852 and 0.786 for the sunflower meal; 0.928 and 0.887 for the corn gluten meal; 0.797 and 0.720 for the meat and bone meal; 0.364 and 0.339 for ground raw beans; 0.924 and 0.837 for ground pearl millet; 0.839 and 0.810 for cookie residue; 0.929 and 0.914 for pasta residue; and 0.904 and 0.899 for bread residue.

Three degree-of-freedom piezoelectric ultrasonic micro-motor with a major diameter of 350 µm

International Nuclear Information System (INIS)

Rogers, G

2010-01-01

A three degree-of-freedom (DOF) micro-motor comprising a hollow cylindrical transducer with slots novelly inserted, mounted to a lead zirconium titanate (PZT) piezoelectric element, was developed. Reversible rotation about three orthogonal axes was obtained at frequencies above 190 kHz. The peak torque about the transverse (x and y) and longitudinal (z) axes was 1.33, 1.23 and 2.38 nNm, respectively, at 21.2 V RMS . An electrical control scheme was employed to demonstrate the ability to operate these micro-motors at the low speeds necessary for many applications, including minimally invasive surgery (MIS). This micro-motor represents a significant step towards the development of true microscopic multi-DOF actuators, which can be integrated with MIS equipment, for example, in order to provide surgeons with better operability, dexterity and control deep within a patient's body

Data of evolutionary structure change: 1BYPA-1FA4A [Confc[Archive

Lifescience Database Archive (English)

Full Text Available dbChain>A 1BYPA SVTLT---EKGTY cture...>EEEE --- EEE> ATOM 522 CA SER A ...n> STTFPADAPAGEY ucture>EE ture...ucture> -- cture> ATOM 860 CA LYS A 57 7.87...yIDChain> TKISMPEEDLLN >HHH >

Data of evolutionary structure change: 1PVDA-2VBIG [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1PVDA-2VBIG 1PVD 2VBI A G SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKGMSCIITTFGVGELSALNGIAGSYAEHVG.../ss_2> 0 1PVD A 1PVDA SFNDN-SKIRM HHH ...ine>PRO CA 225 GLU CA 183 1PVD... A 1PVDA LQTPIDMSLKP

Broadband true time delay for microwave signal processing, using slow light based on stimulated Brillouin scattering in optical fibers.

Science.gov (United States)

Chin, Sanghoon; Thévenaz, Luc; Sancho, Juan; Sales, Salvador; Capmany, José; Berger, Perrine; Bourderionnet, Jérôme; Dolfi, Daniel

2010-10-11

We experimentally demonstrate a novel technique to process broadband microwave signals, using all-optically tunable true time delay in optical fibers. The configuration to achieve true time delay basically consists of two main stages: photonic RF phase shifter and slow light, based on stimulated Brillouin scattering in fibers. Dispersion properties of fibers are controlled, separately at optical carrier frequency and in the vicinity of microwave signal bandwidth. This way time delay induced within the signal bandwidth can be manipulated to correctly act as true time delay with a proper phase compensation introduced to the optical carrier. We completely analyzed the generated true time delay as a promising solution to feed phased array antenna for radar systems and to develop dynamically reconfigurable microwave photonic filters.

Volumetric analysis demonstrates that true and false lumen remodeling persists for 12 months after thoracic endovascular aortic repair

Directory of Open Access Journals (Sweden)

Ga-Young Suh, PhD

2016-09-01

Full Text Available A 62-year-old man underwent an elephant trunk procedure followed by thoracic endovascular aortic repair (TEVAR. Computed tomography angiography-based models were built to quantify volume of the whole aorta and true and false lumens preoperatively, before TEVAR, after TEVAR, and at follow-up at 3, 6, and 12 months. With TEVAR, descending aortic true lumen volume increased by 54%, then increased additionally by 60% during 12 months. The descending aortic false lumen volume regressed continuously for 12 months following TEVAR, with the most rapid rate from 6 to 12 months at 16 cm3/month. TEVAR immediately increased true lumen volume and continued to remodel the true and false lumens throughout the following 12 months.

Can Maltreated Children Inhibit True and False Memories for Emotional Information?

Science.gov (United States)

Howe, Mark L.; Toth, Sheree L.; Cicchetti, Dante

2011-01-01

The authors examined 284 maltreated and nonmaltreated children's (6- to 12-year-olds) ability to inhibit true and false memories for neutral and emotional information using the Deese/Roediger-McDermott (DRM) paradigm. Children studied either emotional or neutral DRM lists in a control condition or were given directed-remembering or…

Validation of Tendril TrueHome Using Software-to-Software Comparison

Energy Technology Data Exchange (ETDEWEB)

Maguire, Jeffrey B [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Horowitz, Scott G [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Moore, Nathan [Tendril, Boulder, CO (United States); Sullivan, Patrick [Tendril, Boulder, CO (United States)

2017-09-01

This study performed comparative evaluation of EnergyPlus version 8.6 and Tendril TrueHome, two physics-based home energy simulation models, to identify differences in energy consumption predictions between the two programs and resolve discrepancies between them. EnergyPlus is considered a benchmark, best-in-class software tool for building energy simulation. This exercise sought to improve both software tools through additional evaluation/scrutiny.

HRD Degrees.

Science.gov (United States)

Geber, Beverly

1987-01-01

The author describes the growing movement toward accreditation for human resources development professionals. She covers the issue of diversity, undergraduate versus graduate degrees, and future trends. (CH)

True-3D accentuating of grids and streets in urban topographic maps enhances human object location memory.

Directory of Open Access Journals (Sweden)

Dennis Edler

Full Text Available Cognitive representations of learned map information are subject to systematic distortion errors. Map elements that divide a map surface into regions, such as content-related linear symbols (e.g. streets, rivers, railway systems or additional artificial layers (coordinate grids, provide an orientation pattern that can help users to reduce distortions in their mental representations. In recent years, the television industry has started to establish True-3D (autostereoscopic displays as mass media. These modern displays make it possible to watch dynamic and static images including depth illusions without additional devices, such as 3D glasses. In these images, visual details can be distributed over different positions along the depth axis. Some empirical studies of vision research provided first evidence that 3D stereoscopic content attracts higher attention and is processed faster. So far, the impact of True-3D accentuating has not yet been explored concerning spatial memory tasks and cartography. This paper reports the results of two empirical studies that focus on investigations whether True-3D accentuating of artificial, regular overlaying line features (i.e. grids and content-related, irregular line features (i.e. highways and main streets in official urban topographic maps (scale 1/10,000 further improves human object location memory performance. The memory performance is measured as both the percentage of correctly recalled object locations (hit rate and the mean distances of correctly recalled objects (spatial accuracy. It is shown that the True-3D accentuating of grids (depth offset: 5 cm significantly enhances the spatial accuracy of recalled map object locations, whereas the True-3D emphasis of streets significantly improves the hit rate of recalled map object locations. These results show the potential of True-3D displays for an improvement of the cognitive representation of learned cartographic information.

Free to be me: The relationship between the true self, rejection sensitivity, and use of online dating sites.

Science.gov (United States)

Hance, Margaret A; Blackhart, Ginette; Dew, Megan

2018-01-01

Prior research (Blackhart et al., 2014) found that rejection-sensitive individuals are more likely to use online dating sites. The purpose of the current research was to explain the relationship between rejection sensitivity and online dating site usage. Study 1 examined whether true self mediated the relation between rejection sensitivity and online dating. Study 2 sought to replicate the findings of Study 1 and to examine whether self-disclosure moderated the relationship between true self and online dating in the mediation model. Results replicated those found by Blackhart et al. and also found that true self mediated the relationship between rejection sensitivity and online dating site usage. These findings suggest that rejection-sensitive individuals feel they can more easily represent their "true" selves in online environments, such as online dating sites, which partially explains why they are more likely to engage in online dating.

HadISST (1-degree)/HadISST (1-degree)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Monthly version of HadISST sea surface temperature component (1-degree). See Rayner, N. A., Parker, D. E., Horton, E. B., Folland, C. K., Alexander, L. V., Rowell,...

Set our Master's degrees free

Science.gov (United States)

Padman, Rachael

2010-04-01

Making UK undergraduate physics degrees longer must have seemed like a good idea at the time. Back in the early 1990s the standard three-year Bachelor's physics degree (four years in Scotland) was under pressure at both ends. The A-level curriculum - one of the requirements for entry onto a degree course - was being increasingly modularized, and dumbed down. Physics students were arriving at university less well prepared than in the past and there was an increasing awareness that graduates of five-year continental degree courses were better equipped for a professional scientific career than those in the UK. At the same time, local education authorities in the UK were required to provide full funding for a first degree, whether for three or four years.

Data of evolutionary structure change: 1PVDA-2VBIA [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1PVDA-2VBIA 1PVD 2VBI A A SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKGMSCIITTFGVGELSALNGIAGSYAEHVG.../ss_2> 0 1PVD A 1PVDA SFNDN-SKIRM HHH ... 1PVD A 1PVD...A 233 ARG CA 308 GLN CA 388 1PVD

Data of evolutionary structure change: 1EWOA-5PADA [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1EWOA-5PADA 1EWO 5PAD A A APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWF...ryChain> 5PAD A 5PADA...>5PAD A 5PADA KRGTGNSYGVCGLY ...>A 5PADA LVAQY---GIHYR HHH...Chain>A 5PADA TYPYE---GVQRY

Commissioning measurements for photon beam data on three TrueBeam linear accelerators, and comparison with Trilogy and Clinac 2100 linear accelerators

Science.gov (United States)

2013-01-01

This study presents the beam data measurement results from the commissioning of three TrueBeam linear accelerators. An additional evaluation of the measured beam data within the TrueBeam linear accelerators contrasted with two other linear accelerators from the same manufacturer (i.e., Clinac and Trilogy) was performed to identify and evaluate any differences in the beam characteristics between the machines and to evaluate the possibility of beam matching for standard photon energies. We performed a comparison of commissioned photon beam data for two standard photon energies (6 MV and 15 MV) and one flattening filter‐free (“FFF”) photon energy (10 FFF) between three different TrueBeam linear accelerators. An analysis of the beam data was then performed to evaluate the reproducibility of the results and the possibility of “beam matching” between the TrueBeam linear accelerators. Additionally, the data from the TrueBeam linear accelerator was compared with comparable data obtained from one Clinac and one Trilogy linear accelerator models produced by the same manufacturer to evaluate the possibility of “beam matching” between the TrueBeam linear accelerators and the previous models. The energies evaluated between the linear accelerator models are the 6 MV for low energy and the 15 MV for high energy. PDD and output factor data showed less than 1% variation and profile data showed variations within 1% or 2 mm between the three TrueBeam linear accelerators. PDD and profile data between the TrueBeam, the Clinac, and Trilogy linear accelerators were almost identical (less than 1% variation). Small variations were observed in the shape of the profile for 15 MV at shallow depths (linear accelerators; the TrueBeam data resulted in a slightly greater penumbra width. The diagonal scans demonstrated significant differences in the profile shapes at a distance greater than 20 cm from the central axis, and this was more notable for the 15 MV energy. Output factor

Construction of Chained True Score Equipercentile Equatings under the Kernel Equating (KE) Framework and Their Relationship to Levine True Score Equating. Research Report. ETS RR-09-24

Science.gov (United States)

Chen, Haiwen; Holland, Paul

2009-01-01

In this paper, we develop a new chained equipercentile equating procedure for the nonequivalent groups with anchor test (NEAT) design under the assumptions of the classical test theory model. This new equating is named chained true score equipercentile equating. We also apply the kernel equating framework to this equating design, resulting in a…

True Nature of Supply Network Communication Structure

Directory of Open Access Journals (Sweden)

Lokhman Hakim bin Osman

2016-04-01

Full Text Available Globalization of world economy has altered the definition of organizational structure. Global supply chain can no longer be viewed as an arm-length structure. It has become more complex. The complexity demands deeper research and understanding. This research analyzed a structure of supply network in an attempt to elucidate the true structure of the supply network. Using the quantitative Social Network Analysis methodology, findings of this study indicated that, the structure of the supply network differs depending on the types of network relations. An important implication of these findings would be a more focus resource management upon network relationship development that is based on firms’ positions in the different network structure. This research also contributes to the various strategies of effective and efficient supply chain management.

The effects of religion, superstition, and perceived gender inequality on the degree of suicide intent: a study of serious attempters in China.

Science.gov (United States)

Zhang, Jie; Xu, Huilan

2007-01-01

Previous studies have tried to account for the uniqueness of gender ratios in Chinese suicide through physiological and psychological differences between men and women, and the means employed in the fatal act. From the point of view of the socio-psychological traits, this study examines the effects of religion (religiosity), superstition, and perceived gender inequality among Chinese women on the degree of their suicide intent. A four-page structured interviews were performed to the consecutively sampled serious attempters of suicide hospitalized to emergency rooms immediately after the suicidal act in Dalian areas, China. Both univariate analyses and the multiple regression model have found that the higher the degree the religiosity and superstition on metempsychosis, the stronger the suicide intent Chinese women had. The perceived gender inequality is positively correlated with suicide intent, and it is especially true for Chinese women. The socio-psychological traits and traditional culture values and norms have important impacts on suicide patterns in Chinese societies.

Digestibility coefficient and true digestible amino acid values of different cultivars of maize for poultry

Directory of Open Access Journals (Sweden)

Márcia Antonia Bartolomeu Agustini

2015-04-01

Full Text Available The digestibility and true digestible amino acid content of eight cultivars of maize was determined using the method of force-feeding roosters cecectomized. The experimental design was completely randomized, represented by eight cultivars, five replicates and a rooster each. Five roosters were kept fasting for corrections corresponding to metabolic and endogenous losses of amino acids. Significant differences (P <0.05 among maize cultivars for the true digestibility of amino acids, methionine, threonine, arginine, cystine and serine were observed. The values of true digestibility coefficients for essential amino acids, for methionine, threonine and arginine ranged from 85.61 to 93.57%, from 66.27 to 84.97% and 83.39 to 93.10% respectively. For the other essential amino acids, the average values were: 72.84% for lysine, 85.64% for methionine+cystine, 87.29% for histidine, 85.33% for valine, 87.11% for isoleucine, 94.04% for leucine and 90.65% for phenylalanine. The true digestibility coefficients of nonessential amino acids cystine and serine that showed significant difference ranged from 73.97 to 89.21% and from 77.31 to 92.68%, respectively. For other non-essential amino acids, average values were 88.28% for alanine, 82.68% for aspartic acid, 92.19% for glutamic acid and 87.84% for tyrosine. Due to the variations observed, it is recommended periodic analyzes of maize cultivars used to formulate diets, to ensure the feed quality and the performance of the animals.

A Qualitative Assessment of the My True Body Bariatric Surgery Preparation Program

Science.gov (United States)

Nakamura, Tracy; Mamary, Edward

2013-01-01

Background: The My True Body (MTB) group intervention incorporates cognitive restructuring and social support into bariatric surgery preparation. Purpose: To identify and describe program components that support long-term behavioral modifications and influence confidence in healthy weight maintenance. Methods: Semistructured telephone interviews…

On the necessity of identifying the true parameter in adaptive LQ control

NARCIS (Netherlands)

Polderman, Jan W.

1986-01-01

In adaptive control problems one may drop the requirement of identifying the true system in order to simplify the problem of control. It will be shown that in the adaptive LQ control problem this does not at all lead to an easier problem.

Opposite Degree Algorithm and Its Applications

Directory of Open Access Journals (Sweden)

Xiao-Guang Yue

2015-12-01

Full Text Available The opposite (Opposite Degree, referred to as OD algorithm is an intelligent algorithm proposed by Yue Xiaoguang et al. Opposite degree algorithm is mainly based on the concept of opposite degree, combined with the idea of design of neural network and genetic algorithm and clustering analysis algorithm. The OD algorithm is divided into two sub algorithms, namely: opposite degree - numerical computation (OD-NC algorithm and opposite degree - Classification computation (OD-CC algorithm.

On the relationship between degree of hand-preference and degree of language lateralization

NARCIS (Netherlands)

Somers, Metten; Ophoff, Roel A; Boks, Marco P; Fleer, Willemien; de Visser, Kees C L; Kahn, René S; Sommer, Iris E; Aukes, M.F.

2015-01-01

Language lateralization and hand-preference show inter-individual variation in the degree of lateralization to the left- or right, but their relation is not fully understood. Disentangling this relation could aid elucidating the mechanisms underlying these traits. The relation between degree of

A Screening Mechanism Differentiating True from False Pain during Empathy.

Science.gov (United States)

Sun, Ya-Bin; Lin, Xiao-Xiao; Ye, Wen; Wang, Ning; Wang, Jin-Yan; Luo, Fei

2017-09-13

Empathizing with another's suffering is important in social interactions. Empathic behavior is selectively elicited from genuine, meaningful pain but not from fake, meaningless scenarios. However, the brain's screening mechanism of false information from meaningful events and the time course for the screening process remains unclear. Using EEG combined with principle components analysis (PCA) techniques, here we compared temporal neurodynamics between the observation of pain and no-pain pictures as well as between true (painful expressions and needle-penetrated arms) and false (needle-penetrated faces with neutral expressions) pain pictures. The results revealed that pain vs. no-pain information is differentiated in the very early ERP components, i.e., the N1/P1 for the face and arm pictures categories and the VPP/N170 for the facial expression category while the mid-latency ERP components, N2 and P3, played key roles in differentiating true from false situations. The complex of N2 and P3 components may serve as a screening mechanism through which observers allocate their attentions to more important or relevant events and screen out false environmental information. This is the first study to describe and provide a time course of the screening process during pain empathy. These findings shed new light on the understanding of empathic processing.

True mean rate measuring system

International Nuclear Information System (INIS)

Eichenlaub, D.P.

1980-01-01

A digital radiation-monitoring system for nuclear power plants uses digital and microprocessor circuitry to enable rapid processing of pulse information from remote radiation monitors. The pulse rates are analyzed to determine whether new pulse-rate information is statisticaly the same as that previously received and to determine the best possible averaging time, which can be changed so that the statistical error remains below a specified level while the system response time remains short. Several data modules each process the pulse-rate information from several remote radiation monitors. Each data module accepts pulse data from each radiation monitor and measures the true average or mean pulse rate of events occurring with a Poisson distribution to determine the radiation level. They then develop digital output signals which indciate the respective radiation levels and which can be transmitted via multiplexer circuits for additional processing and display. The data modules can accept signals from remote control stations or computer stations via the multiplexer circuit to change operating thresholds and alarm levels in their memories. A check module scans the various data modules to determine whether the output signals are valid. It also acts as a redundant data module and will automatically replace an inoperative unit. (DN)

Diploma to degree 1976 to 1993

International Nuclear Information System (INIS)

Price, Richard

2009-01-01

The debate on degree education for radiographers began in earnest in the mid-1970s. Initially the debate hinged around whether a degree education was necessary for radiographers. One argument was that it was felt that a degree would separate academic and clinical training but eventually when degrees were introduced practical skills were assessed formally for the first time; something that had not been achieved with the Diploma of the College of Radiographers (DCR). The DCR itself became a barrier to degree education as the College of Radiographers (CoR) insisted that it was the only qualification recognised for state registration and as such would have to remain embedded as a distinct qualification within a degree. A major breakthrough came when the Council for National Academic Awards (CNAA) recognised the DCR at the same level as an ordinary degree. Around the same time the CoR published its Degree Rationale which announced a change in policy by not insisting that the DCR was sacrosanct. Developments followed rapidly and the first honours degree in radiography was validated in 1989 despite opposition from scientific officers at the Department of Health. Degrees were approved for state registration and radiography became a graduate profession by 1993 following years of debate and after overcoming opposition from both within and external to the profession.

Fracture toughness testing of V-4Cr-4Ti at 25{degrees}C and -196{degrees}C

Energy Technology Data Exchange (ETDEWEB)

Li, H.X.; Kurtz, R.J. [Pacific Northwest National Lab., Richland, WA (United States)

1996-10-01

Measurements of the fracture toughness of the production-scale heat (832665) of V-4Cr-4Ti have been performed at 25{degrees}C and {minus}196{degrees}C using compact tension (CT) specimens. Test specimens were vacuum annealed at either 1000{degrees}C for 1 hour (HT1) or 1050{degrees}C for two hours (HT2). Specimens given the HT1 treatment were annealed after final machining, whereas the HT2 specimens received the 1050{degrees}C anneal at Teledyne Wah Chang prior to final machining. Following machining HT2 specimens were then vacuum annealed at 180{degrees}C for two hours to remove hydrogen. Specimens treated using HT1 had a partially recrystallized microstructure and those treated using HT2 had a fully recrystallized microstructure. The fracture toughness at 25{degrees}C was determined by J-integral tests and at {minus}196{degrees}C by ASTM E 399 type tests. Toughness values obtained at {minus}196{degrees}C were converted to J-integral values for comparison to the 25{degrees}C data. The 25{degrees}C fracture toughness was very high with none of the specimens giving valid results per ASTM criteria. Specimens fractured by microvoid coalescence. The fracture toughness at {minus}196{degrees}C was much lower than that at 25{degrees}C and the fracture surface showed predominantly cleavage features. The present results show a transition from ductile to brittle behavior with decreasing test temperature which is not observed from one-third scale Charpy impact tests. The fracture toughness at {minus}196{degrees}C was still quite high, however, at about 75 kJ/m{sup 2}. Delaminations in planes normal to the thickness direction were seen at both test temperatures. Fracture surfaces inside the delaminations exhibited nearly 100% cleavage facets. The cause of the brittle delaminations was not determined, but will be a subject for further investigation.

Accelerator Physics Code Web Repository

CERN Document Server

Zimmermann, Frank; Bellodi, G; Benedetto, E; Dorda, U; Giovannozzi, Massimo; Papaphilippou, Y; Pieloni, T; Ruggiero, F; Rumolo, G; Schmidt, F; Todesco, E; Zotter, Bruno W; Payet, J; Bartolini, R; Farvacque, L; Sen, T; Chin, Y H; Ohmi, K; Oide, K; Furman, M; Qiang, J; Sabbi, G L; Seidl, P A; Vay, J L; Friedman, A; Grote, D P; Cousineau, S M; Danilov, V; Holmes, J A; Shishlo, A; Kim, E S; Cai, Y; Pivi, M; Kaltchev, D I; Abell, D T; Katsouleas, Thomas C; Boine-Frankenheim, O; Franchetti, G; Hofmann, I; Machida, S; Wei, J

2006-01-01

In the framework of the CARE HHH European Network, we have developed a web-based dynamic acceleratorphysics code repository. We describe the design, structure and contents of this repository, illustrate its usage, and discuss our future plans, with emphasis on code benchmarking.

Data of evolutionary structure change: 1VL8A-2UVDE [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1VL8A-2UVDE 1VL8 2UVD A E FDLRGRVALVTGGSRGLGFGIAQGLAEAGCSVVVASRN-...eq1> -MLKGKVALVTGASRGIGRAIAIDLAKQGANVVVNYAGNEQKANEVVDEIKKL-GSDAIAVRADVANAED...>E 2UVDE VNYAGNEQKAN EEE H...in>E 2UVDE EIKKL-GSDAI HHH...yChain> 2UVD E 2UVDE VGVTG-NPGQA<

ACCELERATION PHYSICS CODE WEB REPOSITORY.

Energy Technology Data Exchange (ETDEWEB)

WEI, J.

2006-06-26

In the framework of the CARE HHH European Network, we have developed a web-based dynamic accelerator-physics code repository. We describe the design, structure and contents of this repository, illustrate its usage, and discuss our future plans, with emphasis on code benchmarking.

Comparison of two-stage thermophilic (68 degrees C/55 degrees C) anaerobic digestion with one-stage thermophilic (55 degrees C) digestion of cattle manure

DEFF Research Database (Denmark)

Nielsen, H.B.; Mladenovska, Zuzana; Westermann, Peter

2004-01-01

A two-stage 68degreesC/55degreesC anaerobic degradation process for treatment of cattle manure was studied. In batch experiments, an increase of the specific methane yield, ranging from 24% to 56%, was obtained when cattle manure and its fractions (fibers and liquid) were pretreated at 68degrees......, was compared with a conventional single-stage reactor running at 55degreesC with 15-days HRT. When an organic loading of 3 g volatile solids (VS) per liter per day was applied, the two-stage setup had a 6% to 8% higher specific methane yield and a 9% more effective VS-removal than the conventional single......-stage reactor. The 68degreesC reactor generated 7% to 9% of the total amount of methane of the two-stage system and maintained a volatile fatty acids (VFA) concentration of 4.0 to 4.4 g acetate per liter. Population size and activity of aceticlastic methanogens, syntrophic bacteria, and hydrolytic...

A true branchial fistula in the context of branchiootic syndrome: challenges of diagnosis and management.

Science.gov (United States)

Jovic, Thomas H; Saldanha, Francesca; Kuo, Rachel; Ahmad, Tariq

2014-09-01

The presence of a branchial fistula with communication both internally and externally: a 'true' branchial fistula is rare, and may arise in the context of autosomal dominant conditions such as branchiootic syndrome and branchiootorenal syndrome. We discuss the case of a true branchial fistula, which recurred after initial surgical excision, in a patient with branchiootic syndrome. The residual tract was dissected in a second operation through stepladder neck incisions and removed in toto via an intraoral approach. No renal abnormalities were detected on investigation with ultrasound. Incomplete excision of a branchial sinus is likely to cause recurrence however intraoperative visualisation of the tract can can sometimes prove challenging. An combined intraoral and external approach aids delineation and tract definition when there is a true branchial fistula and can therefore facilitate a complete excision. Suspicion of an hereditary aetiology should be raised in patients with bilateral or preauricular features, or a positive family history, which may then prompt additional renal and genetic investigation. Copyright © 2014 British Association of Plastic, Reconstructive and Aesthetic Surgeons. Published by Elsevier Ltd. All rights reserved.

Treatment of benign brain lesions True Beam radiosurgery in the first year of experience; Tratamiento de lesiones cerebrales benignas con radiocirugia en el True-Beam: Primer ano de experiencia

Energy Technology Data Exchange (ETDEWEB)

Lliso, F.; Carmona, V.; Gimeno, J.; Candela, C.; Bautista, J. A.; Perez-Calatayud, J.

2015-07-01

The purpose of the work is analyse the first year of experience in the treatment of injury brain benign with Rapid Arc in the patients treated in a throttle True Beam STX with radiosurgery who achieved an adequate level of efficiency and accuracy. (Author)

Higgs Pair Production in the $H(\\rightarrow \\tau\\tau)H(\\rightarrow b\\bar{b})$ channel at the High-Luminosity LHC

CERN Document Server

The ATLAS collaboration

2015-01-01

Prospects studies are presented for the observation of double Higgs production in the channel $H(\\rightarrow b \\overline{b})H(\\rightarrow \\tau \\tau)$ for a total integrated luminosity of 3000~fb$ ^{-1}$ of $\\sqrt{s}=$14~TeV proton-proton collisions at the HL-LHC. A cut-based analysis strategy using MC data and a parametrisation of the ATLAS detector provide assessment to the measurement prospects performed under different assumptions for the trilinear Higgs couplings values. Assuming SM background and SM signal, we expect to set an upper limit of the cross section for the di-Higgs production of $4.3 \\times \\sigma(HH \\rightarrow b\\bar{b}\\tau^+\\tau^-)$ at 95\\% Confidence Level. Using an effective Lagrangian for the Higgs potential, and allowing its trilinear coupling to vary, we can project an exclusion of $\\lambda_{HHH}/\\lambda_{SM} \\leq -4$ and $\\lambda_{HHH}/\\lambda_{SM} \\geq 12$.

A CSMP Commutation Model for Design Study of a Brushless DC Motor Power Conditioner for a Cruise Missile Fin Control Actuator.

Science.gov (United States)

1985-06-01

miU PICJ 4- 00 OH ~0HH tiiI~ H L10 iP. iiiiUiiIIL’ Of 04 c HHHHHH go) 0000 MM3M M M HHII 1:0P 000000 01011 k-4 -4 000 ..44muWNWmu-4MU HHHHH H...14343(. HL4OH Qu).. "-(UI ) 06-40 k-iHU2(./24HUHw HHHHHHQ 71 H NO %0 00HNN 004H Hw* *4 HAQ* -4- 04W34 0104 c FIH EM *Ln2M N rz + 8 -14 Im HHHHHH ...HHH U) * * 02TC4 r4 A 4r1my (𔃾(N1 01010 wM1 ; -0w= .4 mm W004r rzl p HHHHHH P 110 pw Mm22 01 + + 0193 CDJ~ D CD 04 C00000 Q HHH -H" 0 00+0 Z: 010’ )CaM

5-O T AFISI-IS AFRICAN SCIENCE A TRUE SCIENCE-FT- VOL 5 ...

African Journals Online (AJOL)

JONATHAN

extinguishes the idea of a single self-consistent mode of rationality that could be universalized. .... verification principle to demarcate science from non-science. ... true scientific attitude, according to Popper, is witnessed in Newton's theory of.

What’s the Gist? The influence of schemas on the neural correlates underlying true and false memories

Science.gov (United States)

Webb, Christina E.; Turney, Indira C.; Dennis, Nancy A.

2017-01-01

The current study used a novel scene paradigm to investigate the role of encoding schemas on memory. Specifically, the study examined the influence of a strong encoding schema on retrieval of both schematic and non-schematic information, as well as false memories for information associated with the schema. Additionally, the separate roles of recollection and familiarity in both veridical and false memory retrieval were examined. The study identified several novel results. First, while many common neural regions mediated both schematic and non-schematic retrieval success, schematic recollection exhibited greater activation in visual cortex and hippocampus, regions commonly shown to mediate detailed retrieval. More effortful cognitive control regions in the prefrontal and parietal cortices, on the other hand, supported non-schematic recollection, while lateral temporal cortices supported familiarity-based retrieval of non-schematic items. Second, both true and false recollection, as well as familiarity, were mediated by activity in left middle temporal gyrus, a region associated with semantic processing and retrieval of schematic gist. Moreover, activity in this region was greater for both false recollection and false familiarity, suggesting a greater reliance on lateral temporal cortices for retrieval of illusory memories, irrespective of memory strength. Consistent with previous false memory studies, visual cortex showed increased activity for true compared to false recollection, suggesting that visual cortices are critical for distinguishing between previously viewed targets and related lures at retrieval. Additionally, the absence of common visual activity between true and false retrieval suggests that, unlike previous studies utilizing visual stimuli, when false memories are predicated on schematic gist and not perceptual overlap, there is little reliance on visual processes during false memory retrieval. Finally, the medial temporal lobe exhibited an

True Visions The Emergence of Ambient Intelligence

CERN Document Server

Aarts, Emile

2006-01-01

Ambient intelligence (AI) refers to a developing technology that will increasingly make our everyday environment sensitive and responsive to our presence. The AI vision requires technology invisibly embedded in our everyday surroundings, present whenever we need it that will lead to the seamless integration of lighting, sounds, vision, domestic appliances, and personal healthcare products to enhance our living experience. Written for the non-specialist seeking an authoritative but accessible overview of this interdisciplinary field, True Visions explains how the devices making up the AI world will operate collectively using information and intelligence hidden in the wireless network connecting them. Expert contributions address key AI components such as smart materials and textiles, system architecture, mobile computing, broadband communication, and underlying issues of human-environment interactions. It seeks to unify the perspectives of scientists from diverse backgrounds ranging from the physics of materia...

The Kilo-Degree Survey

NARCIS (Netherlands)

de Jong, J. T. A.; Kuijken, K.; Applegate, D.; Begeman, K.; Belikov, A.; Blake, C.; Bout, J.; Boxhoorn, D.; Buddelmeijer, H.; Buddendiek, A.; Cacciato, M.; Capaccioli, M.; Choi, A.; Cordes, O.; Covone, G.; Dall'Ora, M.; Edge, A.; Erben, T.; Franse, J.; Getman, F.; Grado, A.; Harnois-Deraps, J.; Helmich, E.; Herbonnet, R.; Heymans, C.; Hildebrandt, H.; Hoekstra, H.; Huang, Z.; Irisarri, N.; Joachimi, B.; Köhlinger, F.; Kitching, T.; La Barbera, F.; Lacerda, P.; McFarland, J.; Miller, L.; Nakajima, R.; Napolitano, N. R.; Paolillo, M.; Peacock, J.; Pila-Diez, B.; Puddu, E.; Radovich, M.; Rifatto, A.; Schneider, P.; Schrabback, T.; Sifon, C.; Sikkema, G.; Simon, P.; Sutherland, W.; Tudorica, A.; Valentijn, E.; van der Burg, R.; van Uitert, E.; van Waerbeke, L.; Velander, M.; Kleijn, G. V.; Viola, M.; Vriend, W.-J.

2013-01-01

The Kilo-Degree Survey (KiDS), a 1500-square-degree optical imaging survey with the recently commissioned OmegaCAM wide-field imager on the VLT Survey Telescope (VST), is described. KiDS will image two fields in u-,g-,r- and i-bands and, together with the VIKING survey, produce nine-band (u- to

TrueFisp versus HASTE sequences in 3T cine MRI: Evaluation of image quality during phonation in patients with velopharyngeal insufficiency

International Nuclear Information System (INIS)

Kulinna-Cosentini, Christiane; Czerny, Christian; Weber, Michael; Baumann, Arnulf; Sinko, Klaus

2016-01-01

To evaluate the image quality of two fast dynamic magnetic resonance imaging (MRI) sequences: True fast imaging with steady state precession (TrueFisp) was compared with half-Fourier acquired single turbo-spin-echo (HASTE) sequence for the characterization of velopharyngeal insufficiency (VPI) in repaired cleft palate patients. Twenty-two patients (10 female and 12 male; mean age, 17.7 ± 10.6 years; range, 9-31) with suspected VPI underwent 3-T MRI using TrueFisp and HASTE sequences. Imaging was performed in the sagittal plane at rest and during phonation of ''ee'' and ''k'' to assess the velum, tongue, posterior pharyngeal wall and a potential VP closure. The results were analysed independently by one radiologist and one orthodontist. HASTE performed better than TrueFisp for all evaluated items, except the tongue evaluation by the orthodontist during phonation of ''k'' and ''ee''. A statistically significant difference in favour of HASTE was observed in assessing the velum at rest and during phonation of ''k'' and ''ee'', and also in assessing VP closure in both raters (p < 0.05). TrueFisp imaging was twice as fast as HASTE (0.36 vs. 0.75 s/image). Dynamic HASTE images were of superior quality to those obtained with TrueFisp, although TrueFisp imaging was twice as fast. (orig.)

Noninvasive Recording of True-to-Form Fetal ECG during the Third Trimester of Pregnancy

Directory of Open Access Journals (Sweden)

Istvan Peterfi

2014-01-01

Full Text Available Objective. The aim of the study was to develop a complex electrophysiological measurement system (hardware and software which uses the methods of electrophysiology and provides significant information about the intrauterine status of the fetus, intending to obtain true-to-form, morphologically evaluated fetal ECG from transabdominal maternal lead. Results. The present method contains many novel ideas that allow creating true-to-form noninvasive fetal ECG in the third trimester of the pregnancy in 80% of the cases. Such ideas are the telemetric data collection, the “cleanse” of the real time recording from the maternal ECG, and the use of the cardiotocograph (CTG that allows identifying the fetal heart events. The advantage of this developed system is that it does not require any qualified staff, because both the extraction of the information from the abdominal recording and the processing of the data are automatic. Discussion. Although the idea of a noninvasive fetal electrocardiography is more than 100 years old still there is no simple, effective, and cheap method available that would enable an extensive use. This developed system can be used in the third trimester of the pregnancy efficiently. It can produce true-to-form fetal ECGs with amplitude less than 10 µV.

True ileal amino acid digestibility of goat and cow milk infant formulas

NARCIS (Netherlands)

Rutherfurd, S.M.; Darragh, A.J.; Hendriks, W.H.; Prosser, C.G.; Lowry, D.

2006-01-01

Goat milk is used as an alternative to cow milk for the production of infant formulas. However, little is known about the protein quality and, specifically, about the digestible AA pattern of goat milk formulas compared with their cow milk counterparts. In this study, the true ileal AA digestibility

Classification of EC 3.1.1.3 bacterial true lipases using phylogenetic ...

African Journals Online (AJOL)

To obtain an overview of this industrially and very important class of enzymes and their characteristics, we collected and classified bacterial lipases sequences available from protein databases. Here we proposed an updated and revised classification of family I bacterial "true" lipases based mainly on a comparison of their ...

Knowledge Management: “What If That’s Not True?”

International Nuclear Information System (INIS)

Barnes, S.

2016-01-01

Full text: Knowledge management, critical thinking, creativity, and innovation would seem to be different ideas and disciplines, but in fact they can and do enable and enrich each other as in the process of addressing the question: what if that’s not true. This technical brief explores the connections between critical thinking, creativity, innovation, and knowledge management. The result of this interconnectedness is observed in efficiency and effectiveness, competitive advantage as well as in risk informed decision making. (author

The impact of sleep on true and false memory across long delays.

Science.gov (United States)

Pardilla-Delgado, Enmanuelle; Payne, Jessica D

2017-01-01

While the influence of sleep on memory has a long history, sleep's role in the formation of false memories is less clear. Moreover, virtually nothing is known about the development of false memories beyond delays of about 12h. Here, for the first time, we assess post-sleep development of true and false memories across longer delay intervals of 24 and 48h. Although technically a false memory, remembering information that is related to the theme, or gist, of an experience can be considered an adaptive process. Some evidence suggests that sleep, compared to a wake period, increases both true and gist-based false memories in the Deese-Roediger-McDermott (DRM) task, but not all studies have returned this result, and most studies cannot rule out the possibility that sleep is merely protecting the information from interference, as opposed to actively aiding its consolidation. Here, to equate amount of time spent awake and asleep across groups, we assess how the positioning of sleep relative to memory encoding impacts retention across longer delays of 24 and 48h. Participants encoded 16 DRM lists in the morning (WAKE 1st Groups) or evening (SLEEP 1st Groups), and were tested either 24 or 48h later at the same time of day. Results demonstrate that true memory is better when participants sleep soon after learning. Sleeping first also increased false memory, but only in low performers. Importantly, and similar to previous studies, we found a negative correlation between slow-wave sleep (SWS) and false memory, suggesting that SWS may be detrimental for semantic/gist processing. Copyright © 2016 Elsevier Inc. All rights reserved.

Data of evolutionary structure change: 1A5CB-2QUTC [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 8 2QUT C 2QUTC ...ain>C 2QUTC ence>INKCPLLKPWA HH...T C 2QUTC ence>LKIGE--HTPSA...1A5CB-2QUTC 1A5C 2QUT B C ------LPADVAEELATTAQKLVQAGKGILAADESTQTI... 1A5CB LFGTK-GLGKFence> HHH - <

Data of evolutionary structure change: 1CG5A-2QU0C [Confc[Archive

Lifescience Database Archive (English)

Full Text Available D> C 2QU0C ence>YFPHF-DLSHGence> 0 A C VLSSQNKKAIEELGNLIKANAEAWGADALARLFELHPQT...n> 1CG5 A 1CG5A ence>VNLQA-FTPVT...line> THR CA 269 2QU0 C 2QU...0C ence>CHLPNDFTPAVence> HHHH HHH

Data of evolutionary structure change: 1A5CB-2QUVA [Confc[Archive

Lifescience Database Archive (English)

Full Text Available n14> 2QUV A 2QUVA ...V A 2QUVA ... 2QUVA LKIGE--HTPSAence> E -- H...1A5CB-2QUVA 1A5C 2QUV B A ------LPADVAEELATTAQKLVQAGKGILAADESTQTI... 1A5CB ence>LFGTK-GLGKFence> HHH -

The Fanconi anemia associated protein FAAP24 uses two substrate specific binding surfaces for DNA recognition

NARCIS (Netherlands)

Wienk, H.L.J.; Slootweg, J.C.; Speerstra, S.; Kaptein, R.; Boelens, R.; Folkers, G.E.

2013-01-01

To maintain the integrity of the genome, multiple DNA repair systems exist to repair damaged DNA. Recognition of altered DNA, including bulky adducts, pyrimidine dimers and interstrand crosslinks (ICL), partially depends on proteins containing helix-hairpin-helix (HhH) domains. To understand how ICL

True-and-error models violate independence and yet they are testable

Directory of Open Access Journals (Sweden)

Michael H. Birnbaum

2013-11-01

Full Text Available Birnbaum (2011 criticized tests of transitivity that are based entirely on binary choice proportions. When assumptions of independence and stationarity (iid of choice responses are violated, choice proportions could lead to wrong conclusions. Birnbaum (2012a proposed two statistics (correlation and variance of preference reversals to test iid, using random permutations to simulate p-values. Cha, Choi, Guo, Regenwetter, and Zwilling (2013 defended methods based on marginal proportions but conceded that such methods wrongly diagnose hypothetical examples of Birnbaum (2012a. However, they also claimed that ``true and error'' models also satisfy independence and also fail in such cases unless they become untestable. This article presents correct true-and-error models; it shows how these models violate iid, how they might correctly identify cases that would be misdiagnosed by marginal proportions, and how they can be tested and rejected. This note also refutes other arguments of Cha et al. (2013, including contentions that other tests failed to violate iid ``with flying colors'', that violations of iid ``do not replicate'', that type I errors are not appropriately estimated by the permutation method, and that independence assumptions are not critical to interpretation of marginal choice proportions.

A preliminary assessment of the true morels (Morchella) in Newfoundland and Labrador

Science.gov (United States)

A preliminary assessment of true morels (Morchella) from Newfoundland and Labrador (NL) was obtained by using DNA sequence data from portions of three genes to identify 20 collections from Newfoundland and one from a remote location in Labrador. To place this work in a broader context, data on 25 co...

True to the Language Game: African American Discourse, Cultural Politics, and Pedagogy

Science.gov (United States)

Gilyard, Keith

2011-01-01

In "True to the Language Game", Keith Gilyard, one of the major African American figures to emerge in language and cultural studies, makes his most seminal work available in one volume. This collection of new and previously published essays contains Gilyard's most relevant scholarly contributions to deliberations about linguistic diversity,…

Deep Brain Stimulation, Continuity over Time, and the True Self.

Science.gov (United States)

Nyholm, Sven; O'Neill, Elizabeth

2016-10-01

One of the topics that often comes up in ethical discussions of deep brain stimulation (DBS) is the question of what impact DBS has, or might have, on the patient's self. This is often understood as a question of whether DBS poses a threat to personal identity, which is typically understood as having to do with psychological and/or narrative continuity over time. In this article, we argue that the discussion of whether DBS is a threat to continuity over time is too narrow. There are other questions concerning DBS and the self that are overlooked in discussions exclusively focusing on psychological and/or narrative continuity. For example, it is also important to investigate whether DBS might sometimes have a positive (e.g., a rehabilitating) effect on the patient's self. To widen the discussion of DBS, so as to make it encompass a broader range of considerations that bear on DBS's impact on the self, we identify six features of the commonly used concept of a person's "true self." We apply these six features to the relation between DBS and the self. And we end with a brief discussion of the role DBS might play in treating otherwise treatment-refractory anorexia nervosa. This further highlights the importance of discussing both continuity over time and the notion of the true self.

How well do ITS rDNA sequences differentiate species of true morels (Morchella)?

Science.gov (United States)

Arguably more mycophiles hunt true morels (Morchella) during their brief fruiting season each spring in the Northern Hemisphere than any other wild edible fungus. Concerns about overharvesting by individual collectors and commercial enterprises make it essential that science-based management practic...

First TRUE Stage - Transport of solutes in an interpreted single fracture. Proceedings from the 4th international seminar

Energy Technology Data Exchange (ETDEWEB)

NONE

2001-08-01

The First Stage of the Tracer Retention Understanding Experiments (TRUE-1) was initiated in 1994 and the experimental activities were officially concluded in December 1998 with the termination of the final test with radioactive sorbing tracers. The programme also included a laboratory programme focused on both generic (Aespoe HRL) and site-specific (Feature A) geological material. Modelling, both scopings, predictions and evaluation of the final tests with sorbing tracers has been performed parallel to the experimental work. The work and conclusions of the SKB TRUE project team have been published in a SKB technical report. The TRUE-1 experiments have also been subject to blind prediction and evaluation by an international group of modelling teams within the auspices of the Aespoe Task Force on Groundwater on Modelling of Groundwater Flow and Solute Transport. A list of relevant reports and publications related to the First TRUE Stage are presented in Appendix A. The present seminar provides a venue to present and discuss the results of the TRUE-1 experiments in terms of identified transport and retention processes and concepts/approaches used to model. However, given the fact that may international programs, including that of SKB, are either underway or preparing for site characterisation programs, the seminar provides a possibility to discuss research priorities and the specific data needs for development of a geological repository. In his opening address, the director of the Aespoe Hard Rock Laboratory emphasised the need to carefully integrate available experience from other research sites, e.g. Grimsel (Switzerland), Stripa (Sweden) and El Berrocal (Spain). The two important questions to be asked are; What do we know? What is the way forward? For the subsequent discussions four different discussion themes were identified; 1. Identification of transport processes. 2. Model concepts. 3. Site-specific data needs for a geological repository. 4. Research priorities

A three-dimensional `Kaiser damage-memory' effect through true-triaxial loading

Science.gov (United States)

Meredith, P. G.; Browning, J.; Harland, S. R.; Healy, D.; Stuart, C.; Mitchell, T. M.

2017-12-01

Microcrack damage leading to failure in rocks evolves in response to differential loading. The vast majority of experimental studies investigate damage evolution, the `Kaiser damage-memory' effect, and rock failure using conventional triaxial stress states (σ1 > σ2 = σ3). Such stress states develop a crack population that displays cylindrical transverse isotropy. However, in nature the stress state is in general truly triaxial (σ1 > σ2 > σ3) and experiments that utilise such loading conditions can generate crack populations that display planar transverse isotropy which in turn influences properties such as permeability and strength. We investigate the evolution of crack damage under both conventional and true triaxial stress conditions using results from measurements made on cubic samples of sandstone deformed in three orthogonal directions with independently controlled stress paths. We have measured, simultaneously with stress and strain, the changes in ultrasonic compressional and shear wave velocities in the three principal directions, together with the bulk acoustic emission (AE) output. Changes in acoustic wave velocities are associated with both elastic closure and opening of pre-existing cracks, and the inelastic formation of new cracks. By contrast, AE is only associated with the inelastic growth of new crack damage and as such, we use the onset of AE to determine the initiation of new crack damage. By mapping these damage onsets under both conventional triaxial and true triaxial sequential cyclic loading, we have shown that `damage envelopes' evolve dynamically and can be pushed closer to the failure envelope. Whether a stress state has been `visited' before is key to determining and understanding damage states. Crack damage populations can be generated with multiple orientations depending on the arrangement of loading directions and hence principal stress directions. The sequential cyclic loading tests show that further damage in any one population

True versus perturbed forest inventory plot locations for modeling: a simulation study

Science.gov (United States)

John W. Coulston; Kurt H. Riitters; Ronald E. McRoberts; William D. Smith

2006-01-01

USDA Forest Service Forest Inventory and Analysis plot information is widely used for timber inventories, forest health assessments, and environmental risk analyses. With few exceptions, true plot locations are not revealed; the plot coordinates are manipulated to obscure the location of field plots and thereby preserve plot integrity. The influence of perturbed plot...

Outcomes of torsional microcoaxial phacoemulsification performed by 12-degree and 22-degree bent tips.

Science.gov (United States)

Helvacioglu, Firat; Yeter, Celal; Tunc, Zeki; Sencan, Sadik

2013-08-01

To compare the safety and efficacy of Ozil Intelligent Phaco torsional microcoaxial phacoemulsification surgeries performed with 12-degree and 22-degree bent tips using the Infiniti Vision System. Maltepe University School of Medicine Department of Ophthalmology, Istanbul, Turkey. Comparative case series. Eyes were assigned to 2.2 mm microcoaxial phacoemulsification using the torsional mode with a 22-degree bent tip (Group 1) or a 12-degree bent tip (Group 2). The primary outcome measures were ultrasound time (UST), cumulative dissipated energy (CDE), longitudinal and torsional ultrasound (US) amplitudes, mean surgical time, mean volume of balanced salt solution used, and surgical complications. Both groups included 45 eyes. The mean UST, CDE, longitudinal US amplitude, and torsional US amplitude were 65 seconds ± 27.23 (SD), 11.53 ± 6.99, 0.22 ± 0.26, and 42.86 ± 15.64, respectively, in Group 1 and 84 ± 45.04 seconds, 16.68 ± 10.66, 0.48 ± 0.68, and 46.27 ± 14.74, respectively, in Group 2. The mean UST, CDE, and longitudinal amplitudes were significantly lower in Group 1 (P=.003, P=.008, and P=.022, respectively). The mean volume of balanced salt solution was 73.33 ± 28.58 cc in Group 1 and 82.08 ± 26.21 cc in Group 2 (P=.134). Torsional phacoemulsification performed with 22-degree bent tips provided more effective lens removal than 12-degree bent tips, with a lower UST and CDE. Copyright © 2013 ASCRS and ESCRS. Published by Elsevier Inc. All rights reserved.

Families of Smooth Rational Curves of Small Degree on the Fano Variety of Degree 5 of Main Series

Directory of Open Access Journals (Sweden)

M. S. Omelkova

2013-01-01

Full Text Available In this paper we consider some families of smooth rational curves of degree 2, 3 and 4 on a smooth Fano threefold X which is a linear section of the Grassmanian G(1, 4 under the Pl¨ucker embedding. We prove that these families are irreducible. The proof of the irreducibility of the families of curves of degree d is based on the study of degeneration of a rational curve of degree d into a curve which decomposes into an irreducible rational curve of degree d−1 and a projective line intersecting transversally at a point. We prove that the Hilbert scheme of curves of degree d on X is smooth at the point corresponding to such a reducible curve. Then calculations in the framework of deformation theory show that such a curve varies into a smooth rational curve of degree d. Thus, the set of reducible curves of degree d of the above type lies in the closure of a unique component of the Hilbert scheme of smooth rational curves of degree d on X. From this fact and the irreducibility of the Hilbert scheme of smooth rational curves of degree d on the Grassmannian G(1, 4 one deduces the irreducibility of the Hilbert scheme of smooth rational curves of degree d on a general Fano threefold X.

45 CFR 2400.41 - Degree programs.

Science.gov (United States)

2010-10-01

... degree in history or political science (including government or politics), the degree of Master of Arts in Teaching in history or political science (including government or politics), or a related master's degree in education that permits a concentration in American history, American government, social studies...

"That never happened": adults' discernment of children's true and false memory reports.

Science.gov (United States)

Block, Stephanie D; Shestowsky, Donna; Segovia, Daisy A; Goodman, Gail S; Schaaf, Jennifer M; Alexander, Kristen Weede

2012-10-01

Adults' evaluations of children's reports can determine whether legal proceedings are undertaken and whether they ultimately lead to justice. The current study involved 92 undergraduates and 35 laypersons who viewed and evaluated videotaped interviews of 3- and 5-year-olds providing true or false memory reports. The children's reports fell into the following categories based on a 2 (event type: true vs. false) × 2 (child report: assent vs. denial) factorial design: accurate reports, false reports, accurate denials, and false denials. Results revealed that adults were generally better able to correctly judge accurate reports, accurate denials, and false reports compared with false denials: For false denials, adults were, on average, "confident" that the event had not occurred, even though the event had in fact been experienced. Participant age predicted performance. These findings underscore the greater difficulty adults have in evaluating young children's false denials compared with other types of reports. Implications for law-related situations in which adults are called upon to evaluate children's statements are discussed. PsycINFO Database Record (c) 2012 APA, all rights reserved.

Terminal Area Forecasts, FY 1993-2005

Science.gov (United States)

1993-07-01

4 6 0 H -4 ~ M 0~) mo~io oo o o moo- ~ ~ 7~I~~ HHHHH HHHH H H HHHHHH H H C~6HHHHHHH- HHHH H H 0 I Iv En 6O 01~0 0 0HH H HH H H H0 HHHNHHHH 0H0H H H Ci...OD o IWWWn W 0no-D A % MMH NM ww H mo 1-4IHr- i14 4H - ’ H~~ H. HOHOHHH 444 HHH N H r, In~o- v v𔃺wr, - - C4~~4CC( C44Ce (4 C4C M4 C NMVMV NNNm HHHHHH ...HHHH H ei I ~ u~o- O~0H a)I 4 HHHHHH HHHH r-4 Nl H xmoHmm virewee o In HHnw Hwm0H HHH H HnW 0 H 0C4lHO 1HH H HM M M MMMMO 0 0 0 0 4HHHH-OHHHHHN N

Virtual displays for 360-degree video

Science.gov (United States)

Gilbert, Stephen; Boonsuk, Wutthigrai; Kelly, Jonathan W.

2012-03-01

In this paper we describe a novel approach for comparing users' spatial cognition when using different depictions of 360- degree video on a traditional 2D display. By using virtual cameras within a game engine and texture mapping of these camera feeds to an arbitrary shape, we were able to offer users a 360-degree interface composed of four 90-degree views, two 180-degree views, or one 360-degree view of the same interactive environment. An example experiment is described using these interfaces. This technique for creating alternative displays of wide-angle video facilitates the exploration of how compressed or fish-eye distortions affect spatial perception of the environment and can benefit the creation of interfaces for surveillance and remote system teleoperation.

True posterior communicating artery aneurysms: are they more prone to rupture? A biomorphometric analysis.

Science.gov (United States)

He, Wenzhuan; Hauptman, Jason; Pasupuleti, Latha; Setton, Avi; Farrow, Maria G; Kasper, Lydia; Karimi, Reza; Gandhi, Chirag D; Catrambone, Jeffrey E; Prestigiacomo, Charles J

2010-03-01

Posterior communicating artery (PCoA) aneurysms can occur at the junction with the internal carotid artery, posterior cerebral artery (PCA), or the proximal PCoA itself. Hemodynamic stressors contribute to aneurysm formation and may be associated with parent vessel size and aneurysm location. This study evaluates the correlation of various biomorphometric characteristics in 2 of the aforementioned types of PCoA aneurysms. Patients with PCoA aneurysms were analyzed using CT angiography. Source images and reconstructions were used to determine which aneurysms originated purely from the PCoA and those that originated from the internal carotid artery/PCoA junction. Morphometric analysis was performed on the aneurysm, the precommunicating segment of the PCA (P(1)), the ambient segment of the PCA (P(2)), and both PCoA arteries and were correlated to clinical presentation. Parametric and nonparametric analyses were performed to test for significance. A total of 77 PCoA aneurysms were analyzed, and 10 were found to be true PCoA aneurysms (13.0%). The ipsilateral PCoA/P(1) ratio (1.77 +/- 0.44 vs 0.82 +/- 0.46, p = 0.0001) and ipsilateral P(2)/P(1) ratio (1.73 +/- 0.40 vs 1.22 +/- 0.41, p = 0.0003) were significantly larger in true PCoA aneurysms. Interestingly, aneurysm size was statistically larger in the junctional aneurysms (0.14 +/- 0.1 vs 0.072 +/- 0.04 cm(3), p = 0.03). The prevalence of ruptured aneurysms was similar in both groups (approximately 80%, p value not significant). These data suggest that true PCoA aneurysms have a larger PCoA relative to the ipsilateral P(1) segment. To the authors' knowledge, this represents the first such biomorphometric comparison of these different types of PCoA aneurysms. Although statistically smaller in size, true PCoA aneurysms also have a similar prevalence of presenting as a ruptured aneurysm, suggesting that they might be more prone to rupture than a junctional aneurysms of similar size. Further analysis will be required to

Are relations in thesauri "context-free, definitional, and true in all possible worlds"?

DEFF Research Database (Denmark)

Hjørland, Birger

2015-01-01

Much of the literature of information science and knowledge organization has accepted and built upon Elaine Svenonius’ (2004) claim that “paradigmatic relationships are those that are context-free, definitional, and true in all possible worlds” (p. 583). At the same time, the literature...

Multigene molecular phylogenetics reveals true morels (Morchella) are especially species-rich in China

Science.gov (United States)

The phylogenetic diversity of true morels (Morchella) in China was estimated by initially analyzing nuclear ribosomal internal transcribed spacer (ITS) rDNA sequences from 361 specimens collected in 21 provinces during the 2003-2011 growing seasons, together with six collections obtained on loan fro...

Measuring Direct Teaching Costs: Does an Undergraduate Business Degree Cost More to Produce than a Nonbusiness Degree?

Science.gov (United States)

Barth, Michael M.; Karagiannidis, Iordanis

2016-01-01

Many universities have implemented tuition differentials for certain undergraduate degree programs, citing higher degree costs or higher demand. However, most college accounting systems are unsuited for measuring cost differentials by degree program. This research outlines a method that can convert commonly available financial data to a more…

Labeling schemes for bounded degree graphs

DEFF Research Database (Denmark)

Adjiashvili, David; Rotbart, Noy Galil

2014-01-01

We investigate adjacency labeling schemes for graphs of bounded degree Δ = O(1). In particular, we present an optimal (up to an additive constant) log n + O(1) adjacency labeling scheme for bounded degree trees. The latter scheme is derived from a labeling scheme for bounded degree outerplanar...... graphs. Our results complement a similar bound recently obtained for bounded depth trees [Fraigniaud and Korman, SODA 2010], and may provide new insights for closing the long standing gap for adjacency in trees [Alstrup and Rauhe, FOCS 2002]. We also provide improved labeling schemes for bounded degree...

True aneurysm of the proximal occipital artery: Case report.

Science.gov (United States)

Illuminati, Giulio; Cannistrà, Marco; Pizzardi, Giulia; Pasqua, Rocco; Frezzotti, Francesca; Calio', Francesco G

2018-01-01

True aneurysms of the proximal occipital artery are rare, may cause neurological symptoms due to compression of the hypoglossal nerve and their resection may be technically demanding. The case of an aneurysm of the proximal occipital artery causing discomfort and tongue deviation by compression on the hypoglossal nerve is reported. Postoperative course after resection was followed by complete regression of symptoms. Surgical resection, as standard treatment of aneurysms of the occipital artery, with the eventual technical adjunct of intubation by the nose is effective in durably relieving symptoms and preventing aneurysm-related complication. Copyright © 2018 The Authors. Published by Elsevier Ltd.. All rights reserved.

True aneurysm of the proximal occipital artery: Case report

Directory of Open Access Journals (Sweden)

Giulio Illuminati

Full Text Available Introduction: True aneurysms of the proximal occipital artery are rare, may cause neurological symptoms due to compression of the hypoglossal nerve and their resection may be technically demanding. Presentation of case: The case of an aneurysm of the proximal occipital artery causing discomfort and tongue deviation by compression on the hypoglossal nerve is reported. Postoperative course after resection was followed by complete regression of symptoms. Conclusion: Surgical resection, as standard treatment of aneurysms of the occipital artery, with the eventual technical adjunct of intubation by the nose is effective in durably relieving symptoms and preventing aneurysm-related complication. Keywords: Arterial aneurysm, Occipital artery, Case report

Lunar true polar wander inferred from polar hydrogen.

Science.gov (United States)

Siegler, M A; Miller, R S; Keane, J T; Laneuville, M; Paige, D A; Matsuyama, I; Lawrence, D J; Crotts, A; Poston, M J

2016-03-24

The earliest dynamic and thermal history of the Moon is not well understood. The hydrogen content of deposits near the lunar poles may yield insight into this history, because these deposits (which are probably composed of water ice) survive only if they remain in permanent shadow. If the orientation of the Moon has changed, then the locations of the shadowed regions will also have changed. The polar hydrogen deposits have been mapped by orbiting neutron spectrometers, and their observed spatial distribution does not match the expected distribution of water ice inferred from present-day lunar temperatures. This finding is in contrast to the distribution of volatiles observed in similar thermal environments at Mercury's poles. Here we show that polar hydrogen preserves evidence that the spin axis of the Moon has shifted: the hydrogen deposits are antipodal and displaced equally from each pole along opposite longitudes. From the direction and magnitude of the inferred reorientation, and from analysis of the moments of inertia of the Moon, we hypothesize that this change in the spin axis, known as true polar wander, was caused by a low-density thermal anomaly beneath the Procellarum region. Radiogenic heating within this region resulted in the bulk of lunar mare volcanism and altered the density structure of the Moon, changing its moments of inertia. This resulted in true polar wander consistent with the observed remnant polar hydrogen. This thermal anomaly still exists and, in part, controls the current orientation of the Moon. The Procellarum region was most geologically active early in lunar history, which implies that polar wander initiated billions of years ago and that a large portion of the measured polar hydrogen is ancient, recording early delivery of water to the inner Solar System. Our hypothesis provides an explanation for the antipodal distribution of lunar polar hydrogen, and connects polar volatiles to the geologic and geophysical evolution of the Moon

Time-reversed ultrasonically encoded (TRUE) focusing for deep-tissue optogenetic modulation

Science.gov (United States)

Brake, Joshua; Ruan, Haowen; Robinson, J. Elliott; Liu, Yan; Gradinaru, Viviana; Yang, Changhuei

2018-02-01

The problem of optical scattering was long thought to fundamentally limit the depth at which light could be focused through turbid media such as fog or biological tissue. However, recent work in the field of wavefront shaping has demonstrated that by properly shaping the input light field, light can be noninvasively focused to desired locations deep inside scattering media. This has led to the development of several new techniques which have the potential to enhance the capabilities of existing optical tools in biomedicine. Unfortunately, extending these methods to living tissue has a number of challenges related to the requirements for noninvasive guidestar operation, speed, and focusing fidelity. Of existing wavefront shaping methods, time-reversed ultrasonically encoded (TRUE) focusing is well suited for applications in living tissue since it uses ultrasound as a guidestar which enables noninvasive operation and provides compatibility with optical phase conjugation for high-speed operation. In this paper, we will discuss the results of our recent work to apply TRUE focusing for optogenetic modulation, which enables enhanced optogenetic stimulation deep in tissue with a 4-fold spatial resolution improvement in 800-micron thick acute brain slices compared to conventional focusing, and summarize future directions to further extend the impact of wavefront shaping technologies in biomedicine.

Lessons Learned: Creating an Online Business Degree from a Successful On-Campus Business Degree

Science.gov (United States)

Cordeiro, William P.; Muraoka, Dennis

2015-01-01

The horse has left the barn. Distance education is here to stay and the number of degree programs offered online is growing rapidly. California State University Channel Islands (CI) admitted its first students in 2002, and the undergraduate and graduate degrees in business were among its first program offerings. From its inception, the…

Cooling hyperthermic firefighters by immersing forearms and hands in 10 degrees C and 20 degrees C water.

Science.gov (United States)

Giesbrecht, Gordon G; Jamieson, Christopher; Cahill, Farrell

2007-06-01

Firefighters experience significant heat stress while working with heavy gear in a hot, humid environment. This study compared the cooling effectiveness of immersing the forearms and hands in 10 and 20 degrees C water. Six men (33 +/- 10 yr; 180 +/- 4 cm; 78 +/- 9 kg; 19 +/- 5% body fat) wore firefighter 'turn-out gear' (heavy clothing and breathing apparatus weighing 27 kg) in a protocol including three 20-min exercise bouts (step test, 78 W, 40 degrees C air, 40% RH) each followed by a 20-min rest/cooling (21 degrees C air); i.e., 60 min of exercise, 60 min of cooling. Turn-out gear was removed during rest/cooling periods and subjects either rested (Control), immersed their hands in 10 or 20 degrees C water (H-10, H-20), or immersed their hands and forearms in 10 or 20 degrees C water (HF-10, HF-20). In 20 degrees C water, hand immersion did not reduce core temperature compared with Control; however, including forearm immersion decreased core temperature below Control values after both the second and final exercise periods (p hand immersion produced a lower core temperature (0.8 degrees C above baseline) than all other conditions (1.1 to 1.4 degrees C above baseline) after the final exercise period (p Hand and forearm immersion in cool water is simple, reduces heat strain, and may increase work performance in a hot, humid environment. With 20 degrees C water, forearms should be immersed with the hands to be effective. At lower water temperatures, forearm and/or hand immersion will be effective, although forearm immersion will decrease core temperature further.

3D laser imaging for ODOT interstate network at true 1-mm resolution.

Science.gov (United States)

2014-12-01

With the development of 3D laser imaging technology, the latest iteration of : PaveVision3D Ultra can obtain true 1mm resolution 3D data at full-lane coverage in all : three directions at highway speed up to 60MPH. This project provides rapid survey ...

Arendt on Hobbes as the true philosopher of the bourgeoisie

Directory of Open Access Journals (Sweden)

Adriano Correia

2015-07-01

Full Text Available In The Origins of Totalitarianism, when examine the elements and origins of total domination, Hannah Arendt devotes special attention to the political emancipation of the bourgeoisie. For Arendt imperialism is the truth of the bourgeois understanding of politics, according to which politics should not be more than a well-organized police force. The truth of bourgeois politics is the reduction of politics to mere force. Our purpose is to reconstruct this movement from the vantage point of arendtian appropriation of Hobbes, "the true philosopher of the bourgeoisie."

True ternary fission and quasifission of superheavy nuclear systems

Directory of Open Access Journals (Sweden)

Greiner Walter

2011-10-01

Full Text Available We found that a true ternary fission with formation of a heavy third fragment (a new kind of radioactivity is quite possible for superheavy nuclei due to the strong shell effects leading to a three-body clusterization with the two doubly magic tin-like cores. The three-body quasifission process could be even more pronounced for giant nuclear systems formed in collisions of heavy actinide nuclei. In this case a three-body clusterization might be proved experimentally by detection of two coincident lead-like fragments in low-energy U+U collisions.

Data of evolutionary structure change: 1CG8A-2QU0A [Confc[Archive

Lifescience Database Archive (English)

Full Text Available /pdbChain> 2QU0A ence>YFPHF-DLSHGence> G - 0 A A VLSSQNKKAIEELGNLIKANAEAWGADALARLFELHPQT...hain> 1CG8 A 1CG8A ence>VNLQA-FTPVT...ine>THR CA 278 2QU0 A 2QU...0A ence>CHLPNDFTPAV HH HHHH HHH

Data of evolutionary structure change: 2QU0A-2DXMB [Confc[Archive

Lifescience Database Archive (English)

Full Text Available n>A 2QU0A WGKVGGNAGAYGence> HHH...2QU0A-2DXMB 2QU0 2DXM A B -VLSAADKSNVKAAWGKVGGNAGAYGAEALERMFLSFPT...ID> 0 2DXM B 2DXMB ...ence>WGKVN--VDEVGence> GGG --HHHHH VAL CA 716 GLY CA 753 2QU0

«Odessa branch of «the True Orthodox Church» 1935: Tragic Scenario of the Soviet Secret Service

Directory of Open Access Journals (Sweden)

Nikolay I. Mikhaylutsa

2012-12-01

Full Text Available The article is concerned with the bolshevists’ violence against adepts of “the True Orthodox Church” in Odessa in the middle 30s of the XX century. The article is focused on the case, framed up in January, 1935 by local authorities of NKVD (People's Commissariat for Internal Affairs against “Odessa branch of “the True Orthodox Church”. Investigator chose monk-pilgrim Leonid Vasilevich Salkov as the founder and ideological instigator of the branch. Besides, F.S. Pospelov, V.I. Ivanov, G.I. Balukhatin and S.Ya. Kokh were arrested in January, 1935 pursuant to the decrees by Odessa Oblast Authority of NKVD and Odessa Oblast Attorney Office. Investigation didn’t manage to collect any material evidence, but almost all the interrogated, pressed by the NKVD investigators confessed the participation in illegal branch of “the True Orthodox Church”, except former secretary of Odessa Diocesan Authority F.S. Pospelov. Yet, L. Salkov was sentenced to 5 years in labour camps, V. Ivanov and G. Balakhutin to 3 years in labour camps and S. Kokh and F. Pospelov to 3 years of exile by the decision of the special council of NKVD of the USSR d.d. 13 September, 1935.The article considers the factors, which were crucial in framing up of “the True Orthodox Church case”, shows the geography of Odessa branch relationship with other regions of the country, methods and techniques, used by officers of NKVD authorities to frame up the cases of the investigated persons, gravamen and consequences of the repressions of “Odessa branch of “the True Orthodox Church” participants.

Pathways to a Four-Year Degree: Determinants of Degree Completion among Socioeconomically Disadvantaged Students.

Science.gov (United States)

Cabrera, Alberto F.; Burkum, Kurt R.; La Nasa, Steven M.

The High School Sophomore Cohort of 1980 followed nine different pathways to a 4-year college degree. These paths were formed by a combination of different levels of academic preparation secured in high school and the first type of postsecondary institution attended. The pathway most likely to lead to a 4-year degree is one defined by acquiring…

Influence of casein as a percentage of true protein and protein level on color and texture of milks containing 1 and 2% fat.

Science.gov (United States)

Misawa, Noriko; Barbano, David M; Drake, MaryAnne

2016-07-01

Combinations of fresh liquid microfiltration retentate of skim milk, ultrafiltered retentate and permeate produced from microfiltration permeate, cream, and dried lactose monohydrate were used to produce a matrix of 20 milks. The milks contained 5 levels of casein as a percentage of true protein of about 5, 25, 50, 75, and 80% and 4 levels of true protein of 3.0, 3.76, 4.34, and 5.0% with constant lactose percentage of 5%. The experiment was replicated twice and repeated for both 1 and 2% fat content. Hunter color measurements, relative viscosity, and fat globule size distribution were measured, and a trained panel documented appearance and texture attributes on all milks. Overall, casein as a percentage of true protein had stronger effects than level of true protein on Hunter L, a, b values, relative viscosity, and fat globule size when using fresh liquid micellar casein concentrates and milk serum protein concentrates produced by a combination of microfiltration and ultrafiltration. As casein as a percentage of true protein increased, the milks became more white (higher L value), less green (lower negative a value), and less yellow (lower b value). Relative viscosity increased and d(0.9) generally decreased with increasing casein as a percentage of true protein. Panelists perceived milks with increasing casein as a percentage of true protein as more white, more opaque, and less yellow. Panelists were able to detect increased throat cling and mouthcoating with increased casein as a percentage of true protein in 2% milks, even when differences in appearance among milks were masked. Copyright © 2016 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

Measurement of true ileal phosphorus digestibility in meat and bone meal for broiler chickens.

Science.gov (United States)

Mutucumarana, R K; Ravindran, V; Ravindran, G; Cowieson, A J

2015-07-01

An experiment was conducted to estimate true ileal phosphorus (P:) digestibility of 3 meat and bone meal samples (MBM-1, MBM-2: , and MBM-3:) for broiler chickens. Four semipurified diets were formulated from each sample to contain graded concentrations of P. The experiment was conducted as a completely randomized design with 6 replicates (6 birds per replicate) per dietary treatment. A total of 432 Ross 308 broilers were assigned at 21 d of age to the 12 test diets. The apparent ileal digestibility coefficient of P was determined by the indicator method, and the linear regression method was used to determine the true P digestibility coefficient. The apparent ileal digestibility coefficient of P in birds fed diets containing MBM-1 and MBM-2 was unaffected by increasing dietary concentrations of P (P > 0.05). The apparent ileal digestibility coefficient of P in birds fed the MBM-3 diets decreased with increasing P concentrations (linear, P digestibility of MBM-1, MBM-2, and MBM-3 was determined to be 0.693, 0.608, and 0.420, respectively. True ileal P digestibility coefficients determined for MBM-1 and MBM-2 were similar (P digestible P contents of MBM-1, MBM-2, and MBM-3 were determined to be 37.5 and 26.0; 60.2 and 36.6; and 59.8 and 25.1 g/kg, respectively, on an as-fed basis. © 2015 Poultry Science Association Inc.

Superficial Dorsal Venous Rupture of the Penis: False Penile Fracture That Needs to be Treated as a True Urologic Emergency.

Science.gov (United States)

Truong, Hong; Ferenczi, Basil; Cleary, Ryan; Healy, Kelly A

2016-11-01

A 38-year-old man with history of repaired penile fracture presented with rapid detumescence, penile pain, and ecchymosis during vaginal sexual intercourse concerning for recurrent fracture. Surgical exploration revealed ruptured superficial dorsal vein of the penis, which was subsequently ligated. Patients with traumatic penile vascular injuries often present with clinical features indistinguishable from a true penile fracture. Gradual detumescence and an absence of characteristic popping sound may indicate a vascular injury but they cannot safely rule out a true penile fracture. Both true and false penile fractures require emergent surgical exploration and repair to prevent long-term complications. Copyright © 2016 Elsevier Inc. All rights reserved.

Tunable Optical True-Time Delay Devices Would Exploit EIT

Science.gov (United States)

Kulikov, Igor; DiDomenico, Leo; Lee, Hwang

2004-01-01

Tunable optical true-time delay devices that would exploit electromagnetically induced transparency (EIT) have been proposed. Relative to prior true-time delay devices (for example, devices based on ferroelectric and ferromagnetic materials) and electronically controlled phase shifters, the proposed devices would offer much greater bandwidths. In a typical envisioned application, an optical pulse would be modulated with an ultra-wideband radio-frequency (RF) signal that would convey the information that one seeks to communicate, and it would be required to couple differently delayed replicas of the RF signal to the radiating elements of a phased-array antenna. One or more of the proposed devices would be used to impose the delays and/or generate the delayed replicas of the RF-modulated optical pulse. The beam radiated or received by the antenna would be steered by use of a microprocessor-based control system that would adjust operational parameters of the devices to tune the delays to the required values. EIT is a nonlinear quantum optical interference effect that enables the propagation of light through an initially opaque medium. A suitable medium must have, among other properties, three quantum states (see Figure 1): an excited state (state 3), an upper ground state (state 2), and a lower ground state (state 1). These three states must form a closed system that exhibits no decays to other states in the presence of either or both of two laser beams: (1) a probe beam having the wavelength corresponding to the photon energy equal to the energy difference between states 3 and 1; and (2) a coupling beam having the wavelength corresponding to the photon energy equal to the energy difference between states 3 and 2. The probe beam is the one that is pulsed and modulated with an RF signal.

A Novel Device for True Lumen Re-Entry After Subintimal Recanalization of Superficial Femoral Arteries: First-in-Man Experience and Technical Description

International Nuclear Information System (INIS)

Airoldi, Flavio; Faglia, Ezio; Losa, Sergio; Tavano, Davide; Latib, Azeem; Mantero, Manuela; Lanza, Gaetano; Clerici, Giacomo

2011-01-01

Subintimal angioplasty (SAP) is frequently performed for the treatment of critical limb ischemia (CLI) and has been recognized as an effective technique for these patients. Nevertheless, this approach is limited by the lack of controlled re-entry into the true lumen of the target vessel. We describe a novel device for true lumen re-entry after subintimal recanalization of superficial femoral arteries (SFA). We report our experience with six patients treated between April 2009 and January 2010 with a novel system designed to facilitate true lumen re-entry. The device was advanced by ipsilateral antegrade approach through a 6-French sheath. Successful reaccess into the true lumen was obtained in five of six patients without complications. The patient in whom the reaccess to the true lumen was not possible underwent successful bypass surgery. At 30 days follow-up, the SFA was patent in all patients according to echo-Doppler examination. Our preliminary experience indicates that this novel re-entry device increases the success rate of percutaneous revascularization of chronically occluded SFA.

Integrated High-Speed Digital Optical True-Time-Delay Modules for Synthetic Aperture Radars, Phase I

Data.gov (United States)

National Aeronautics and Space Administration — Crystal Research, Inc. proposes an integrated high-speed digital optical true-time-delay module for advanced synthetic aperture radars. The unique feature of this...

Pseudorandom number generation using chaotic true orbits of the Bernoulli map

Energy Technology Data Exchange (ETDEWEB)

Saito, Asaki, E-mail: saito@fun.ac.jp [Future University Hakodate, 116-2 Kamedanakano-cho, Hakodate, Hokkaido 041-8655 (Japan); Yamaguchi, Akihiro [Fukuoka Institute of Technology, 3-30-1 Wajiro-higashi, Higashi-ku, Fukuoka 811-0295 (Japan)

2016-06-15

We devise a pseudorandom number generator that exactly computes chaotic true orbits of the Bernoulli map on quadratic algebraic integers. Moreover, we describe a way to select the initial points (seeds) for generating multiple pseudorandom binary sequences. This selection method distributes the initial points almost uniformly (equidistantly) in the unit interval, and latter parts of the generated sequences are guaranteed not to coincide. We also demonstrate through statistical testing that the generated sequences possess good randomness properties.

Asymptotic Standard Errors for Item Response Theory True Score Equating of Polytomous Items

Science.gov (United States)

Cher Wong, Cheow

2015-01-01

Building on previous works by Lord and Ogasawara for dichotomous items, this article proposes an approach to derive the asymptotic standard errors of item response theory true score equating involving polytomous items, for equivalent and nonequivalent groups of examinees. This analytical approach could be used in place of empirical methods like…

Authentication of true cinnamon (Cinnamon verum) utilising direct analysis in real time (DART)-QToF-MS.

Science.gov (United States)

Avula, Bharathi; Smillie, Troy J; Wang, Yan-Hong; Zweigenbaum, Jerry; Khan, Ikhlas A

2015-01-01

The use of cinnamon as a spice and flavouring agent is widespread throughout the world. Many different species of plants are commonly referred to as 'cinnamon'. 'True cinnamon' refers to the dried inner bark of Cinnamomum verum J. S. Presl (syn. C. zeylanicum) (Lauraceae). Other 'cinnamon' species, C. cassia (Nees & T. Nees) J. Presl (syn. C. aromaticum Nees) (Chinese cassia), C. loureiroi Nees (Saigon cassia), and C. burmannii (Nees & T. Nees) Blume (Indonesian cassia), commonly known as cassia, are also marketed as cinnamon. Since there is a prevalence of these various types of 'cinnamons' on the market, there is a need to develop a rapid technique that can readily differentiate between true cinnamon (C. verum) and other commonly marketed species. In the present study, coumarin and other marker compounds indicative of 'cinnamon' were analysed using DART-QToF-MS in various samples of cinnamon. This method involved the use of [M + H](+) ions in positive mode in addition to principal component analysis (PCA) using Mass Profiler Professional software to visualise several samples for quality and to discriminate 'true cinnamon' from other Cinnamomum species using the accurate mass capabilities of QToF-MS.

Measurement of true ileal calcium digestibility in meat and bone meal for broiler chickens using the direct method.

Science.gov (United States)

Anwar, M N; Ravindran, V; Morel, P C H; Ravindran, G; Cowieson, A J

2016-01-01

The objective of the study that is presented herein was to determine the true ileal calcium (Ca) digestibility in meat and bone meal (MBM) for broiler chickens using the direct method. Four MBM samples (coded as MBM-1, MBM-2, MBM-3 and MBM-4) were obtained and analyzed for nutrient composition, particle size distribution and bone to soft tissue ratio. The Ca concentrations of MBM-1, MBM-2, MBM-3 and MBM-4 were determined to be 71, 118, 114 and 81 g/kg, respectively. The corresponding geometric mean particle diameters and bone to soft tissue ratios were 0.866, 0.622, 0.875 and 0.781 mm, and 1:1.49, 1:0.98, 1:0.92 and 1:1.35, respectively. Five experimental diets, including four diets with similar Ca concentration (8.3 g/kg) from each MBM and a Ca and phosphorus-free diet, were developed. Meat and bone meal served as the sole source of Ca in the MBM diets. Titanium dioxide (3 g/kg) was incorporated in all diets as an indigestible marker. Each experimental diet was randomly allotted to six replicate cages (eight birds per cage) and offered from d 28 to 31 post-hatch. Apparent ileal Ca digestibility was calculated by the indicator method and corrected for ileal endogenous Ca losses to determine the true ileal Ca digestibility. Ileal endogenous Ca losses were determined to be 88 mg/kg dry matter intake. True ileal Ca digestibility coefficients of MBM-1, MBM-2, MBM-3 and MBM-4 were determined to be 0.560, 0.446, 0.517 and 0.413, respectively. True Ca digestibility of MBM-1 was higher (P 0.05) to that of MBM-3. True Ca digestibility of MBM-2 was similar (P > 0.05) to MBM-3 and MBM-4, while that of MBM-3 was higher (P digestibility in feed ingredients and that Ca in MBM is not highly available as often assumed. The variability in true Ca digestibility of MBM samples could not be attributed to Ca content, percentage bones or particle size. © 2015 Poultry Science Association Inc.

Linguistic and Cross-Cultural Complexities of A Specialized Legal Item: The ‘True And Fair’ Case

Directory of Open Access Journals (Sweden)

Annalisa Zanola

2014-01-01

The aim of our contribution is that of analysing the possible linguistic and cross-cultural contexts where the hendiadys true and fair was born, and exploring the meaning implications of the same ‘formula’ during the centuries. We start from the hypothesis that true and fair is a hendiadys, to show that the two terms take strength and completeness one from the other, so as to generate an only complex meaning, whose original usage was, last but not least,  a literary and poetical one. The analysis of the hendiadys moves from the non-legal to the legal context, following steps of the etymological and lexical research methodology.

TrueAllele casework on Virginia DNA mixture evidence: computer and manual interpretation in 72 reported criminal cases.

Directory of Open Access Journals (Sweden)

Mark W Perlin

Full Text Available Mixtures are a commonly encountered form of biological evidence that contain DNA from two or more contributors. Laboratory analysis of mixtures produces data signals that usually cannot be separated into distinct contributor genotypes. Computer modeling can resolve the genotypes up to probability, reflecting the uncertainty inherent in the data. Human analysts address the problem by simplifying the quantitative data in a threshold process that discards considerable identification information. Elevated stochastic threshold levels potentially discard more information. This study examines three different mixture interpretation methods. In 72 criminal cases, 111 genotype comparisons were made between 92 mixture items and relevant reference samples. TrueAllele computer modeling was done on all the evidence samples, and documented in DNA match reports that were provided as evidence for each case. Threshold-based Combined Probability of Inclusion (CPI and stochastically modified CPI (mCPI analyses were performed as well. TrueAllele's identification information in 101 positive matches was used to assess the reliability of its modeling approach. Comparison was made with 81 CPI and 53 mCPI DNA match statistics that were manually derived from the same data. There were statistically significant differences between the DNA interpretation methods. TrueAllele gave an average match statistic of 113 billion, CPI averaged 6.68 million, and mCPI averaged 140. The computer was highly specific, with a false positive rate under 0.005%. The modeling approach was precise, having a factor of two within-group standard deviation. TrueAllele accuracy was indicated by having uniformly distributed match statistics over the data set. The computer could make genotype comparisons that were impossible or impractical using manual methods. TrueAllele computer interpretation of DNA mixture evidence is sensitive, specific, precise, accurate and more informative than manual

Physics to a degree

CERN Document Server

Thomas, EG

2014-01-01

Physics to a Degree provides an extensive collection of problems suitable for self-study or tutorial and group work at the level of an undergraduate physics course. This novel set of exercises draws together the core elements of an undergraduate physics degree and provides students with the problem solving skills needed for general physics' examinations and for real-life situations encountered by the professional physicist. Topics include force, momentum, gravitation, Bernoulli's Theorem, magnetic fields, blackbody radiation, relativistic travel, mechanics near the speed of light, radioactive

Data of evolutionary structure change: 1A5CB-2QUTA [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 4> 2QUT A 2QUTA ...yChain> 2QUT A 2QUTA ...hain>A 2QUTA ence>LKIGE--HTPSAence> ...1A5CB-2QUTA 1A5C 2QUT B A ------LPADVAEELATTAQKLVQAGKGILAADESTQTI...entryIDChain>1A5CB ence>LFGTK-GLGKFence> HHH -

Safety of Mixed Model Access Control in a Multilevel System

Science.gov (United States)

2014-06-01

42  H.  FIREWALL AND IPS LANGUAGES...Research Laboratory AIS automated information system ANOA advance notice of arrival APT advanced persistent threat BFM boundary flow modeling...of Investigation FW firewall GENSER general service xvi GUI graphical user interface HAG high-assurance guard HGS high-grade service H-H-H High

The value of true-FISP sequence added to conventional gadolinium-enhanced MRA of abdominal aorta and its major branches

Energy Technology Data Exchange (ETDEWEB)

Iozzelli, Andrea [University of Milan School of Medicine, Department of Medical and Surgical Sciences, Radiology Unit, IRCCS Policlinico San Donato, via Morandi 30, 20097 San Donato Milanese, Milan (Italy)], E-mail: andrea.iozzelli@poste.it; D' Orta, Giovanni [University of Milan School of Medicine, Department of Medical and Surgical Sciences, Radiology Unit, IRCCS Policlinico San Donato, via Morandi 30, 20097 San Donato Milanese, Milan (Italy)], E-mail: ammos@tiscali.it; Aliprandi, Alberto [University of Milan School of Medicine, Department of Medical and Surgical Sciences, Radiology Unit, IRCCS Policlinico San Donato, via Morandi 30, 20097 San Donato Milanese, Milan (Italy)], E-mail: a.aliprandi@grupposandonato.it; Secchi, Francesco [University of Milan School of Medicine, Department of Medical and Surgical Sciences, Radiology Unit, IRCCS Policlinico San Donato, via Morandi 30, 20097 San Donato Milanese, Milan (Italy)], E-mail: francisecchi@virgilio.it; Di Leo, Giovanni [University of Milan School of Medicine, Department of Medical and Surgical Sciences, Radiology Unit, IRCCS Policlinico San Donato, via Morandi 30, 20097 San Donato Milanese, Milan (Italy)], E-mail: gianni.dileo77@virgilio.it; Sardanelli, Francesco [University of Milan School of Medicine, Department of Medical and Surgical Sciences, Radiology Unit, IRCCS Policlinico San Donato, via Morandi 30, 20097 San Donato Milanese, Milan (Italy)], E-mail: f.sardanelli@grupposandonato.it

2009-12-15

To test true-fast imaging with steady-state precession (true-FISP) added to gadolinium-based MR angiography (Gd-MRA) for imaging abdominal aorta and major abdominal vessels, 35 consecutive patients (age 67 {+-} 11 years) with known or suspected abdominal and/or peripheral vascular disease were studied with sagittal and axial 2D true-FISP during free breathing and coronal 3D fast low-angle shot (FLASH) Gd-MRA (breath-holding, 0.2 mmol/kg of Gd-DOTA at 2 ml/s). We evaluated: suprarenal aorta, celiac trunk, superior mesenteric artery, right renal artery, left renal artery, infrarenal aorta, inferior mesenteric artery, aortic bifurcation/common iliac arteries, lumbar arteries and aortic atheromasia. The possible presence of accessory renal arteries, collateral vasculature and vascular prosthesis/stent was evaluated. A quality four-point score was assigned to each item on both sequences, from 0 (not visible) to 3 (good-to-excellent image quality) and Wilcoxon test was used. Main diagnoses resulted: normal or atheromasic aorta (n = 25); aortic aneurysm (n = 2); patent aorto-iliac surgical prosthesis (n = 2); patent vascular iliac stent (n = 2); aneurysm of iliac artery (n = 1); patent aortic endovascular prosthesis (n = 1); patent aorto-femural bypass (n = 1) and aorto-iliac surgical prosthesis endoleak (n = 1). We also found three patients with accessory renal arteries, two with collateral circulation, and three with surgical aorto-iliac prosthesis. The score of true-FISP (25.9 {+-} 4.1, median 27) was significantly higher (p = 0.003) than that of Gd-MRA (23.9 {+-} 3.6, median 24). True-FISP was superior for visualizing inferior mesenteric artery (score 2.5 {+-} 1.1 vs. 1.0 {+-} 1.4; p < 0.001) and atheromasic plaques (2.5 {+-} 1.1 vs. 1.2 {+-} 1.1; p < 0.001). One collateral vasculature was demonstrated only with Gd-MRA. Summarizing, true-FISP is a power and fast non-breath-hold sequence to be added to Gd-MRA, obtaining an information increase.

Does a bachelor’s degree pay off?

DEFF Research Database (Denmark)

Neugebauer, Martin; Weiss, Felix

Academic education is generally rewarded by employers, but what happens to graduates if they are trained for two years less and have to compete with vocationally trained labor market entrants in a similar field of study? Focusing on Germany, we analyze labor market entries of individuals eligible...... for higher education, who either opted for newly introduced short bachelor’s degrees, or for well-established vocational degrees. Based on Microcensus data, we find that bachelor’s degrees from classical universities are associated with higher earnings and more prestigious jobs than initial vocational...... training degrees, and with higher prestige (but similar earnings) than further vocational degrees. However, bachelor’s degrees from universities are also related to higher risks of unemployment or fixed-term employment. Universities of applied sciences, which combine academic and practical training, offer...

Articular cartilage and labral lesions of the glenohumeral joint: diagnostic performance of 3D water-excitation true FISP MR arthrography

Energy Technology Data Exchange (ETDEWEB)

Dietrich, Tobias Johannes [Orthopedic University Hospital Balgrist, Department of Radiology, Zurich (Switzerland); Kantonsspital Muensterlingen, Department of Radiology, PO Box 8596, Muensterlingen (Switzerland); Zanetti, Marco; Saupe, Nadja; Pfirrmann, Christian W.A.; Hodler, Juerg [Orthopedic University Hospital Balgrist, Department of Radiology, Zurich (Switzerland); Fucentese, Sandro F. [Hospital Balgrist, Department of Orthopedic Surgery, Orthopedic University, Zurich (Switzerland)

2010-05-15

To evaluate the diagnostic performance of MR arthrography in the detection of articular cartilage and labral lesions of the glenohumeral joint using a transverse 3D water-excitation true fast imaging with steady-state precession (FISP) sequence. Seventy-five shoulders were included retrospectively. Shoulder arthroscopy was performed within 6 months of MR arthrography. MR images were evaluated separately by two radiologists. They were blinded to clinical and arthroscopic information. Arthroscopy served as the reference standard. For the detection of humeral cartilage lesions, sensitivities and specificities were 86% (12/14)/89% (50/56) for observer 1 and 93%/86% for observer 2) for the transverse true FISP sequence and 64%/86% (50%/82% for observer 2) for the coronal intermediate-weighted spin-echo images. The corresponding values for the glenoidal cartilage were 60% (6/10)/88% (51/58) (80%/76% for observer 2) and 70%/86% (60%/74% for observer 2) respectively. For the detection of abnormalities of the anterior labrum (only assessed on true FISP images) the values were 94% (15/16)/84% (36/43) (88%/79% for observer 2). The corresponding values for the posterior labrum were 67% (8/12)/77% (36/47) (observer 2: 25%/74%). The kappa values for the grading of the humeral and glenoidal cartilage lesions were 0.81 and 0.55 for true FISP images compared with 0.49 and 0.43 for intermediate-weighted fast spin-echo images. Kappa values for true FISP evaluation of the anterior and posterior part of the labrum were 0.81 and 0.70. Transverse 3D true FISP MR arthrography images are useful for the difficult diagnosis of glenohumeral cartilage lesions and suitable for detecting labral abnormalities. (orig.)

Separating true V0's from combinatoric background with a neural network

International Nuclear Information System (INIS)

Justice, M.

1997-01-01

A feedforward multilayered neural network has been trained to ''recognize'' true V0's in the presence of a large combinatoric background using simulated data for 2 GeV/nucleon Ni + Cu interactions. The resulting neural network filter has been applied to actual data from the EOS TPC experiment. An enhancement of signal to background over more traditional selection mechanisms has been observed. (orig.)

Astrometric studies of the regions BD + 17 degree 4946, BD -5 degree 3071, and Ross 730-1

International Nuclear Information System (INIS)

Russell, J.; Gatewood, G.

1975-01-01

Positions, proper motions, and absolute parallaxes were found for 46 stars in the regions of BD +17 degree4946, BD -5 degree3071, and Ross 730-1. BD +17 degree4946 showed some evidence of irregular variations in position and magnitude. The residuals for Ross 730-1 were used in a preliminary study to test for an appropriate weighting system; a weak weighting system was indicated. (auth)

its absence) in both his paintings and in his prison memoir, The True ...

African Journals Online (AJOL)

2016-04-08

Apr 8, 2016 ... its absence) in both his paintings and in his prison memoir, The True Confessions of an Albino Terrorist (1984). While Saayman makes a promis- ing case for an oeuvre-wide reading of. Breytenbach's creative output, her own reading lacks depth and insight. Whereas the book argues that different genres ...

Exact sampling of graphs with prescribed degree correlations

Science.gov (United States)

Bassler, Kevin E.; Del Genio, Charo I.; Erdős, Péter L.; Miklós, István; Toroczkai, Zoltán

2015-08-01

Many real-world networks exhibit correlations between the node degrees. For instance, in social networks nodes tend to connect to nodes of similar degree and conversely, in biological and technological networks, high-degree nodes tend to be linked with low-degree nodes. Degree correlations also affect the dynamics of processes supported by a network structure, such as the spread of opinions or epidemics. The proper modelling of these systems, i.e., without uncontrolled biases, requires the sampling of networks with a specified set of constraints. We present a solution to the sampling problem when the constraints imposed are the degree correlations. In particular, we develop an exact method to construct and sample graphs with a specified joint-degree matrix, which is a matrix providing the number of edges between all the sets of nodes of a given degree, for all degrees, thus completely specifying all pairwise degree correlations, and additionally, the degree sequence itself. Our algorithm always produces independent samples without backtracking. The complexity of the graph construction algorithm is {O}({NM}) where N is the number of nodes and M is the number of edges.

True-personality-assisted self-awareness expert system

International Nuclear Information System (INIS)

Laleuf, M.

1988-01-01

Based on psychoanalytic theory, the Who am I? expert system explains in simple terms the individual's true personality, even it its unconscious or hidden aspects. Our overt personality traits are deeply rooted. The Who am I? expert system gives access to an individual's primary personality, starting from his habitual everyday-life behavior: (1) describes the individual's basic personality, (2) explains this personality through the individual's deeply rooted experience and motivation, and (3) makes links with other people with a similar profile. The following are the primary features of the system: easy individual access, results in <20 minutes, and guaranteed confidentiality. Business applications include the following: (1) Individual training: Self-awareness improves a person's ability to fit in and to succeed within the group. (2) Communication: a homogeneous team has a better chance of success. (3) Human reliability: A close-knit team remains reliable even when faced with serious difficulties. (4) Recruitment: This technique enables the selection of individuals who will fit an existing homogeneous team. The system also enables a psychological diagnosis to be confirmed

ALICE Zero Degree Calorimeter

CERN Multimedia

De Marco, N

2013-01-01

Two identical sets of calorimeters are located on both sides with respect to the beam Interaction Point (IP), 112.5 m away from it. Each set of detectors consists of a neutron (ZN) and a proton (ZP) Zero Degree Calorimeter (ZDC), positioned on remotely controlled platforms. The ZN is placed at zero degree with respect to the LHC beam axis, between the two beam pipes, while the ZP is positioned externally to the outgoing beam pipe. The spectator protons are separated from the ion beams by means of the dipole magnet D1.

Modeling the influence of investigator bias on the elicitation of true and false confessions.

Science.gov (United States)

Narchet, Fadia M; Meissner, Christian A; Russano, Melissa B

2011-12-01

The aim of this study was to model various social and cognitive processes believed to be associated with true and false confessions by exploring the link between investigative biases and what occurs in the interrogation room. Using the Russano et al. (Psychol Sci 16:481-486, 2005) paradigm, this study explored how perceptions of guilt influenced the frequency and type of interrogation tactics used, suspect's perceptions of the interrogation process, the likelihood of confession, and investigator's resulting perceptions of culpability. Results suggested that investigator bias led to the increased use of minimization tactics and thereby increased the likelihood of false confessions by innocent participants. In contrast, the manipulation of investigator bias had no direct or indirect influence on guilty participants. These findings confirm the important role of investigator bias and improve our understanding of the decision-making process associated with true and false confessions.

Research Degrees as Professional Education?

Science.gov (United States)

Barnacle, Robyn; Dall'Alba, Gloria

2011-01-01

There is an increasing trend within higher education and, more specifically, in higher degrees by research, to treat a professional skills set as a desirable graduate outcome. The increasing value that is being placed on a professional skills set in large part reflects growing interest around the world in the role of research degrees in labour…

Variability of the inclination of anatomic horizontal reference planes of the craniofacial complex in relation to the true horizontal line in orthognathic patients.

Science.gov (United States)

Zebeib, Ameen M; Naini, Farhad B

2014-12-01

The purpose of this study was to assess the reliability of the Frankfort horizontal (FH), sella-nasion horizontal, and optic planes in terms of their variabilities in relation to a true horizontal line in orthognathic surgery patients. Thirty-six consecutive presurgical orthognathic patients (13 male, 23 female; age range, 16-35 years; 30 white, 6 African Caribbean) had lateral cephalometric radiographs taken in natural head position, with a plumb line orientating the true vertical line, and the true horizontal line perpendicular to the true vertical. The inclinations of the anatomic reference planes were compared with the true horizontal. The FH plane was found to be on average closest to the true horizontal, with a mean of -1.6° (SD, 3.4°), whereas the sella-nasion horizontal and the optic plane had means of 2.1° (SD, 5.1°) and 3.2° (SD, 4.7°), respectively. The FH showed the least variability of the 3 anatomic planes. The ranges of variability were high for all anatomic planes: -8° to 8° for the FH, -8° to 15° for the sella-nasion horizontal, and -6° to 13° for the optic plane. No significant differences were found in relation to patients' sex, skeletal patterns, or ethnic backgrounds. The clinically significant variability in the inclinations of anatomic reference planes in relation to the true horizontal plane makes their use unreliable in orthognathic patients. Copyright © 2014 American Association of Orthodontists. Published by Elsevier Inc. All rights reserved.

Measurement of the oxidation of spent fuel between 140/degree/ and 225/degree/C by thermogravimetric analysis

International Nuclear Information System (INIS)

Woodley, R.E.; Einziger, R.E.; Buchanan, H.C.

1988-09-01

A series of PWR spent fuel samples from Turkey Point Unit 3 have been oxidized at temperatures between 140/degree/ and 225/degree/C in air atmospheres with dew points between 14.5/degree/ and /minus/70/degree/C, using a thermogravimetric analysis system (TGA). Tests lasted between 400 and 2100 hours. At the conclusion of a test, the atmosphere was sampled to determine the release of fission gas during testing, and the fuel samples were analyzed for microstructural changes. It appears that the mechanism for oxidation of spent fuel to U/sub 3/O/sub 7/ takes place in two steps that occur somewhat simultaneously. Oxygen migrates along the grain boundaries, which are oxidized and enlarged. The grains oxidize by the inward progression of a layer of U/sub 4/O/sub 9/ saturated with oxygen. A simplified model of the mechanism, which considers oxygen diffusion through the product layer as the rate-controlling step, yields an activation energy of 27 /plus minus/ 4 kcal/mol. Moisture, between dew points of /minus/70/degree/ to +14.5/degree/C, i.e., water vapor partial pressures varying over four orders of magnitude, had no significant effect on the oxidation rate. 34 refs., 12 figs., 6 tabs

Dysphagia, hoarseness, and unilateral true vocal fold motion impairment following anterior cervical diskectomy and fusion.

Science.gov (United States)

Baron, Eli M; Soliman, Ahmed M S; Gaughan, John P; Simpson, Lisa; Young, William F

2003-11-01

The charts of 100 patients who underwent anterior cervical diskectomy with fusion performed at our institution between January 1996 and February 1999 were reviewed. The incidences of hoarseness, dysphagia, and unilateral true vocal fold motion impairment were calculated. Univariate logistic regression was used to estimate the relationship of several patient and technical factors to the rates of occurrence of hoarseness and dysphagia. Patient age was found to be a significant predictor of postoperative dysphagia (p dysphagia, hoarseness, and unilateral true vocal fold motion impairment in the literature were calculated as 12.3%, 4.9%, and 1.4%, respectively. We conclude that dysphagia, hoarseness, and unilateral vocal fold motion impairment continue to remain significant complications of anterior cervical diskectomy with fusion. Older patients may be at higher risk for dysphagia.

Broadband demonstrations of true-time delay using linear sideband chirped programming and optical coherent transients

International Nuclear Information System (INIS)

Reibel, R.R.; Barber, Z.W.; Fischer, J.A.; Tian, M.; Babbitt, W.R.

2004-01-01

Linear sideband chirped (LSC) programming is introduced as a means of configuring spatial-spectral holographic gratings for optical coherent transient processors. Similar to linear frequency chirped programming, LSC programming allows the use of broadband integrated electro-optic phase modulators to produce chirps instead of using elaborate broadband chirped lasers. This approach has several advantages including the ability to use a stabilized laser for the optical carrier as well as stable, reproducible chirped optical signals when the modulator is driven digitally. Using LSC programming, we experimentally demonstrate broadband true-time delay as a proof of principle for the optical control of phased array radars. Here both cw phase modulated and binary phase shift keyed probe signals are true-time delayed with bandwidths of 1 GHz and delay resolutions better than 60 ps

A Gadamerian Phenomenological Study Examining the Meaning of Having a Bachelor's Degree Expressed by Associate Degree Nurses (ADN) Who Educationally Transitioned to a Baccalaureate Degree in Nursing (BSN)

Science.gov (United States)

Sauld, Jill Pierpont

2017-01-01

Since the inception of associate degree nursing programs, professional nursing conversations and debate have grappled with reckoning differences between the associate degree in nursing (ADN) and the bachelor's degree in nursing (BSN). Research reporting better patient outcomes with more baccalaureate prepared nurses has been a driving force for…

Phylogenetic relationships of true butterflies (Lepidoptera: Papilionoidea) inferred from COI, 16S rRNA and EF-1α sequences.

Science.gov (United States)

Kim, Man Il; Wan, Xinlong; Kim, Min Jee; Jeong, Heon Cheon; Ahn, Neung-Ho; Kim, Ki-Gyoung; Han, Yeon Soo; Kim, Iksoo

2010-11-01

The molecular phylogenetic relationships among true butterfly families (superfamily Papilionoidea) have been a matter of substantial controversy; this debate has led to several competing hypotheses. Two of the most compelling of those hypotheses involve the relationships of (Nymphalidae + Lycaenidae) + (Pieridae + Papilionidae) and (((Nymphalidae + Lycaenidae) + Pieridae) + Papilionidae). In this study, approximately 3,500 nucleotide sequences from cytochrome oxidase subunit I (COI), 16S ribosomal RNA (16S rRNA), and elongation factor-1 alpha (EF-1α) were sequenced from 83 species belonging to four true butterfly families, along with those of three outgroup species belonging to three lepidopteran superfamilies. These sequences were subjected to phylogenetic reconstruction via Bayesian Inference (BI), Maximum Likelihood (ML), and Maximum Parsimony (MP) algorithms. The monophyletic Pieridae and monophyletic Papilionidae evidenced good recovery in all analyses, but in some analyses, the monophylies of the Lycaenidae and Nymphalidae were hampered by the inclusion of single species of the lycaenid subfamily Miletinae and the nymphalid subfamily Danainae. Excluding those singletons, all phylogenetic analyses among the four true butterfly families clearly identified the Nymphalidae as the sister to the Lycaenidae and identified this group as a sister to the Pieridae, with the Papilionidae identified as the most basal linage to the true butterfly, thus supporting the hypothesis: (Papilionidae + (Pieridae + (Nymphalidae + Lycaenidae))).

Solution structure and DNA-binding properties of the C-terminal domain of UvrC from E.coli

NARCIS (Netherlands)

Singh, S.; Folkers, G.E.; Bonvin, A.M.J.J.; Boelens, R.; Wechselberger, R.W.; Niztayev, A.; Kaptein, R.

2002-01-01

The C-terminal domain of the UvrC protein (UvrC CTD) is essential for 5' incision in the prokaryotic nucleotide excision repair process. We have determined the three-dimensional structure of the UvrC CTD using heteronuclear NMR techniques. The structure shows two helix±hairpin±helix (HhH) motifs

SU-E-J-85: The Effect of Different Imaging Modalities On the Delineation of the True Spinal Cord for Spinal Stereotactic Body Radiation Therapy

Energy Technology Data Exchange (ETDEWEB)

Goddard, L; Brodin, P; Mani, K; Lee, A; Garg, M; Tome, W; Kalnicki, S [Montefiore Medical Center, Bronx, NY (United States)

2015-06-15

Purpose: SBRT allows the delivery of high dose radiation treatments to localized tumors while minimizing dose to surrounding tissues. Due to the large doses delivered, accurate contouring of organs at risk is essential. In this study, differences between the true spinal cord as seen using MRI and CT myelogram (CTM) have been assessed in patients with spinal metastases treated using SBRT. Methods: Ten patients were identified that have both a CTM and a MRI. Using rigid registration tools, the MRI was fused to the CTM. The thecal sac and true cord were contoured using each imaging modality. Images were exported and analyzed for similarity by computing the Dice similarity coefficient and the modified Hausdorff distance (greatest distance from a point in one set to the closest point in the other set). Results: The Dice coefficient was calculated for the thecal sac (0.81 ±0.06) and true cord (0.63 ±0.13). These two measures are correlated; however, some points show a low true cord overlap despite a high overlap for the thecal sac. The Hausdorff distance for structure comparisons was also calculated. For thecal sac structures, the average value, 1.6mm (±1.1), indicates good overlap. For true cord comparison, the average value, 0.3mm (±0.16), indicates very good overlap. The minimum Hausdorff distance between the true cord and thecal sac was on average 1.6mm (±0.9) Conclusion: The true cord position as seen in MRI and CTM is fairly constant, although care should be taken as large differences can be seen in individual patients. Avoidning the true cord in spine SBRT is critical, so the ability to visualize the true cord before performing SBRT to the vertebrae is essential. Here, CT myelogram appears an excellent, robust option, that can be obtained the day of treatment planning and is unaffected by uncertainties in image fusion.

Nuclear engineering enrollments and degrees, 1981

International Nuclear Information System (INIS)

Little, J.R.; Shirley, D.L.

1982-05-01

This report presents data on the number of students enrolled and the degrees awarded in academic year 1980-81 from 73 US institutions offering degree programs in nuclear engineering or nuclear options within other engineering fields. Presented here are historical data for the last decade, which provide information such as trends by degree level, foreign national student participation, female and minority student participation, and placement of graduates. Also included is a listing of the universities by type of program and number of students

Combined 30-degree bevel up and down technique against 0-degree phaco tip for phacoemulsification surgery of hard cataracts

Directory of Open Access Journals (Sweden)

Joshi RS

2017-06-01

Full Text Available Rajesh Subhash Joshi, Sonal Jayant Muley Department of Ophthalmology, Vasantrao Naik Government Medical College, Yavatmal, Maharashtra, India Purpose: To evaluate the effective phaco time (EPT, cumulative dissipated energy (CDE and nucleus emulsification time (NET as phaco parameters with 0- and 30-degree phaco tip. Patients and methods: This prospective, interventional and observational case series included 294 patients scheduled for cataract removal by phacoemulsification technique. Patients with nuclear cataracts of grade 4 and 5 nuclear opalescence of Lens Opacities Classification System III were included in the study. Patients were consecutively allocated to phaco chop technique with 0-degree (0-degree group, n=147 and combined bevel up and down position using 30-degree phaco tip (combined bevel up/down group, n=147. The 0-degree group had phacoemulsification with 0-degree phaco tip, while the 30-degree group had chopping of the nucleus with bevel down phaco tip and emulsification of nuclear fragments was accomplished with bevel up tip. EPT, CDE, NET and intraoperative complications were noted and compared between the groups using analysis of variance. Results: Average EPT, CDE and NET were lower in the 30-degree group than in the 0-degree group. However, no statistically significant difference was found in EPT (P=0.0733, CDE (P=0.0663 and NET (P=0.0633 between the two groups. No serious intraoperative complications were noted. The anterior chamber was maintained throughout the procedure in both groups. No patients had wound burn and miosis during the procedure. None of the patients developed bullous keratopathy, uveitis and cystoid macular edema during the follow-up period. Conclusion: Combined bevel up and down 30-degree tip can yield effective hard nucleus phacoemulsification. Bevel down tip of 30-degree helps in effective chopping and bevel up tip assists in emulsification of the nuclear fragments. Although combined bevel up and down 30

Variation in meroplankton along 78 degrees E Meridian

Digital Repository Service at National Institute of Oceanography (India)

Balachandran, T.; Peter, K.J.

Variations along the meridian 78 degrees E between 8 degrees N and 25 degrees S, based on 43 zooplankton samples were studied. Fish larvae exhibited fluctuations in abundance (26 to 57 specimens/IOSN haul) in the three zones studied (8 degrees N-5...

An Evaluation of the MMPI-2 and MMPI-A True Response Inconsistency (TRIN) Scales

Science.gov (United States)

Handel, Richard W.; Arnau, Randolph C.; Archer, Robert P.; Dandy, Kristina L.

2006-01-01

The Minnesota Multiphasic Personality Inventory--Adolescent (MMPI-A) and Minnesota Multiphasic Personality Inventory--2 (MMPI-2) True Response Inconsistency (TRIN) scales are measures of acquiescence and nonacquiescence included among the standard validity scales on these instruments. The goals of this study were to evaluate the effectiveness of…

The True Seed of Shalott (TSS Technology Production on Trisula Variety in East Java

Directory of Open Access Journals (Sweden)

P.E.R. Prahardini

2018-01-01

Full Text Available One of the onion increasing production problem is the lack of quality seeds availability. In order to provide high quality seeds of high yield and available throughout the year, an improvement of seed technology is required. One of the developing onion seed technologies is onion seeding through TSS (true seed of shallot. TSS technology development is expected to overcome the problem of onion seeding in Indonesia. East Java as one of the production centers of onion requires in developing onion seeding technology through TSS. This study aims to apply and develop TSS production technology using Trisula varieties which has been done from April to December 2016 in Tulungrejo village, Bumiaji district, Batu. The result of TSS production technology implementation indicates that Trisula variety is able to produce 110,5 kg TSS. Based on its agro-ecology, Batu area has the potential as the center of TSS production in East Java. Keywords: Onion, Technology, Trisula Varieties, True Seed of Shalot

The True Ponte Osteotomy: By the One Who Developed It.

Science.gov (United States)

Ponte, Alberto; Orlando, Giuseppe; Siccardi, Gian Luigi

2018-01-01

Technique and applications. To define the anatomy, biomechanics, indications, and surgical technique of the true Ponte osteotomy. The Ponte osteotomy, originally developed for thoracic kyphosis, was the first one to obtain posterior shortening of the thoracic spine, maintaining the anterior column load-sharing capacity. It has become a widely applied technique in various types of spine deformities and a frequent topic of presentations at meetings and in scientific articles. Several of them offer unquestionable evidence of an incorrect execution, with consequently distorted outcomes and erroneous conclusions. A clearing up became essential. Our original experience is based on a series of 240 patients with thoracic hyperkyphosis operated in the years 1969-2015, at first with a standard posterior Harrington technique and then by using the Ponte osteotomy with different instrumentations. A series of 78 of them, operated in the years 1987-1997, who had Ponte osteotomies at every level, is presented. The average preoperative kyphosis has been corrected from 80° (range 61°-102°) to 31° (range 15°-50°) by a substantial posterior shortening. A number of publications use the term Ponte osteotomy loosely for by far incomplete resections and mixing it up with Smith-Petersen's osteotomy. The true Ponte osteotomy is capable of producing marked flexibility in extension, flexion and rotation, justifying its wide use in thoracic deformities, mainly in scoliosis. An exact performance of the osteotomy with adequate bony resections, including the laminae, is an absolute condition to take full advantage of its properties. Level IV, therapeutic study. Copyright © 2017 Scoliosis Research Society. Published by Elsevier Inc. All rights reserved.

Uniaxial tension test on Rubber at constant true strain rate

Directory of Open Access Journals (Sweden)

Sourne H.L.

2012-08-01

Full Text Available Elastomers are widely used for damping parts in different industrial contexts because of their remarkable dissipation properties. Indeed, they can undergo severe mechanical loading conditions, i.e., high strain rates and large strains. Nevertheless, the mechanical response of these materials can vary from purely rubber-like to glassy depending on the strain rate undergone. Classically, uniaxial tension tests are made in order to find a relation between the stress and the strain in the material at various strain rates. However, even if the strain rate is searched to be constant, it is the nominal strain rate that is considered. Here we develop a test at constant true strain rate, i.e. the strain rate that is experienced by the material. In order to do such a test, the displacement imposed by the machine is an exponential function of time. This test has been performed with a high speed hydraulic machine for strain rates between 0.01/s and 100/s. A specific specimen has been designed, yielding a uniform strain field (and so a uniform stress field. Furthermore, an instrumented aluminum bar has been used to take into account dynamic effects in the measurement of the applied force. A high speed camera enables the determination of strain in the sample using point tracking technique. Using this method, the stress-strain curve of a rubber-like material during a loading-unloading cycle has been determined, up to a stretch ratio λ = 2.5. The influence of the true strain rate both on stiffness and on dissipation of the material is then discussed.

Deriving the true mass of an unresolved Brown Dwarf companion to an M-Dwarf with AO aided astrometry*

Directory of Open Access Journals (Sweden)

Kürster M.

2011-07-01

Full Text Available From radial velocity (RV detections alone one does not get all orbital parameters needed to derive the true mass of a non-transiting, unresolved substellar companion to a star. Additional astrometric measurements are needed to calculate the inclination and the longitude of the ascending node. Until today only few true substellar companion masses have been determined by this method with the HST fine guidance sensor [1, 2]. We aim to derive the true mass of a brown dwarf candidate companion to an early M 2.5V dwarf with groundbased high-resolution astrometry aided by adaptive optics. We found this unique brown dwarf desert object, whose distance to the host star is only 0.42 AU, in our UVES precision RV survey of M dwarfs, inferring a minimum companion mass of 27 Jupiter masses [3]. Combining the data with HIPPARCOS astrometry, we found a probability of only 2.9% that the companion is stellar. We therefore observed the host star together with a reference star within a monitoring program with VLT/NACO to derive the true mass of the companion and establish its nature (brown dwarf vs. star. Simultaneous observations of a reference field in a globular cluster are performed to determine the stability of the adaptive optics (AO plus detector system and check its suitability for such high-precision astrometric measurements over several epochs which are needed to find and analyse extrasolar planet systems.

Brain ventricular wall movement assessed by a gated cine MR trueFISP sequence in patients treated with endoscopic third ventriculostomy

International Nuclear Information System (INIS)

Hodel, Jerome; Decq, Philippe; Rahmouni, Alain; Bastuji-Garin, Sylvie; Maraval, Anne; Combes, Catherine; Gaston, Andre; Jarraya, Bechir; Le Guerinel, Caroline

2009-01-01

The purpose of this study was to investigate the value of brain ventricular wall movement assessment with a gated cine trueFISP MR sequence for the diagnosis of endoscopic third ventriculostomy (ETV) patency. Sixteen healthy volunteers and ten consecutive patients with noncommunicating hydrocephalus were explored with a MR scanner (Siemens, Avanto 1.5 T) before, 1 week and 3 months after ETV. TrueFISP was evaluated qualitatively (ventricular wall movement and CSF flow through ETV) and quantitatively [distance moved (DMLT) during a cardiac cycle by the lamina terminalis]. The third ventricle volume (TVV) was assessed. Statistical analysis was performed using nonparametric tests. There was no motion of the lamina terminalis (LT) detected on preoperative data. A pulsatile motion of the LT was found for patients with a patent ETV and for controls. DMLT and TVV were correlated (r = 0.79, P = 0.006). A transient dysfunction of ETV was successfully diagnosed on the trueFISP sequence with no motion of the LT or CSF flow observed. The trueFISP sequence appears reliable for the diagnosis of ETV patency and provides non-invasive assessment of the movement of the ventricular wall related to CSF pressure changes. (orig.)

Brain ventricular wall movement assessed by a gated cine MR trueFISP sequence in patients treated with endoscopic third ventriculostomy

Energy Technology Data Exchange (ETDEWEB)

Hodel, Jerome [Unite Analyse et Restauration du mouvement, UMR-CNRS, Paris (France); Faculte de Medecine Paris XII, Paris (France); Assistance Publique-Hopitaux de Paris, Paris (France); Hopital Henri MONDOR, Department of Neuroradiology, Creteil (France); Hopital Henri Mondor, Creteil (France); Decq, Philippe [Unite Analyse et Restauration du mouvement, UMR-CNRS, Paris (France); Faculte de Medecine Paris XII, Paris (France); Assistance Publique-Hopitaux de Paris, Paris (France); Hopital Henri MONDOR, Department of Neurosurgery, Creteil (France); Rahmouni, Alain [Faculte de Medecine Paris XII, Paris (France); Assistance Publique-Hopitaux de Paris, Paris (France); Hopital Henri MONDOR, Department of Radiology, Creteil (France); Bastuji-Garin, Sylvie [Faculte de Medecine Paris XII, Paris (France); Assistance Publique-Hopitaux de Paris, Paris (France); Hopital Henri MONDOR, Department of Public Health, Creteil (France); Maraval, Anne; Combes, Catherine; Gaston, Andre [Faculte de Medecine Paris XII, Paris (France); Assistance Publique-Hopitaux de Paris, Paris (France); Hopital Henri MONDOR, Department of Neuroradiology, Creteil (France); Jarraya, Bechir [Faculte de Medecine Paris XII, Paris (France); Assistance Publique-Hopitaux de Paris, Paris (France); Hopital Henri MONDOR, Department of Neurosurgery, Creteil (France); Le Guerinel, Caroline [Assistance Publique-Hopitaux de Paris, Paris (France); Hopital Henri MONDOR, Department of Neurosurgery, Creteil (France)

2009-12-15

The purpose of this study was to investigate the value of brain ventricular wall movement assessment with a gated cine trueFISP MR sequence for the diagnosis of endoscopic third ventriculostomy (ETV) patency. Sixteen healthy volunteers and ten consecutive patients with noncommunicating hydrocephalus were explored with a MR scanner (Siemens, Avanto 1.5 T) before, 1 week and 3 months after ETV. TrueFISP was evaluated qualitatively (ventricular wall movement and CSF flow through ETV) and quantitatively [distance moved (DMLT) during a cardiac cycle by the lamina terminalis]. The third ventricle volume (TVV) was assessed. Statistical analysis was performed using nonparametric tests. There was no motion of the lamina terminalis (LT) detected on preoperative data. A pulsatile motion of the LT was found for patients with a patent ETV and for controls. DMLT and TVV were correlated (r = 0.79, P = 0.006). A transient dysfunction of ETV was successfully diagnosed on the trueFISP sequence with no motion of the LT or CSF flow observed. The trueFISP sequence appears reliable for the diagnosis of ETV patency and provides non-invasive assessment of the movement of the ventricular wall related to CSF pressure changes. (orig.)

Cosmetic appreciation of lateralization of peripheral facial palsy: 'preference for left or right, true or mirror image?'.

Science.gov (United States)

Pouwels, Sjaak; Ingels, Koen; van Heerbeek, Niels; Beurskens, Carien

2014-09-01

There have been several studies in the past depicting asymmetry in 'normal' human faces. Evidence supports the fact that the right hemisphere is superior in the recognition of emotions expressed by the human face and indicates a right hemispheric specialization for processing emotional information. The primary aim of this study is to determine whether there is a difference in cosmetic appreciation of a left peripheral facial palsy compared to a right peripheral facial palsy? Pictures of patients with a facial palsy with House-Brackmann II-VI were reversed as a mirror image and offered as a pair of pictures, together with the true image. Forty-two patients and 24 medical professionals familiar with facial palsy were asked to choose the most attractive photograph. The primary 'end' point was the most attractive side in the pictures chosen by medical professionals and patients. The secondary 'end' points consisted of the preferences for the mirror or true image, and influences of the House-Brackmann score and age. Medical professionals preferred the photographs from patients with a right and left peripheral facial palsy (PFP) in, respectively, a mean of 44 % (41-48 %) and 56 % (52-59 %) of the pictures (p = 0.02). When comparing mirror and true image, patients with a left-sided facial palsy chose their mirror and true image as most attractive in 90 and 10 %, respectively (p 0.05). Subanalysis of patients with a PFP House-Brackmann score V and VI showed that medical professionals did not have a significant preference for a left nor right-sided facial palsy. Patients with a left-sided facial palsy chose their mirror image in all cases and patients with a right-sided palsy chose their mirror and true image in resp. 33 and 67 %. The House-Brackmann score (p = 0.52) and age (p = 0.73) of the patients did not influence preferences. This study, demonstrating that medical professionals find a right-sided facial palsy cosmetically less attractive than a left-sided, has

True Multilateral Indexes for International Comparisons of Purchasing Power and Real Income

OpenAIRE

J.P. Neary

1997-01-01

I consider the problem of choosing index numbers of purchasing power and real income for international comparisons. I show that the desirable properties of methods based on the Fisher "Ideal" index do not extend to multilateral comparisons, except when tastes are homothetic. By contrast, the Geary method, which underlies the Penn World Tables, provides an approximation to a set of "true" exchange rate indexes which have many desirable properties. In particular, if demands exhibit generalized ...

How Adult Online Graduates Portray Their Degree

Science.gov (United States)

Hagan, Eric J.

2013-01-01

This qualitative case study investigated how adult graduates of online Bachelor's degree programs describe the online aspect of their degree. Online education is promoted as a method for adult students to access the benefits of a college degree. Therefore, it is important for prospective online students, higher education institutions and…

Career Paths for Physics Degree Recipients

Science.gov (United States)

Mulvey, Patrick

Physics degree holders have a diverse set of career opportunities open to them. So what are these opportunities? Where are they employed? How much do they earn? What skills will they need? Physics degrees make up a small proportion of the degrees conferred in the US but they play an important role in meeting workforce needs at many levels. This talk will give an overview of the employment outcomes of physics bachelors, masters and PhDs. It will discuss the diverse set fields they work in and the skills they use.

High precision instrumentation for measuring the true exposure time in diagnostic X-ray examinations

International Nuclear Information System (INIS)

Silva, Danubia B.; Santos, Marcus A.P.; Barros, Fabio R.; Santos, Luiz A.P.

2013-01-01

One of the most important physical quantities to be evaluated in diagnostic radiology is the radiation exposure time experimented by the patient during the X-ray examination. IAEA and WHO organizations have suggested that any country must create a quality surveillance program to verify if each type of ionizing radiation equipment used in the hospitals and medical clinics are in conformity with the accepted uncertainties following the international standards. The purpose of this work is to present a new high precision methodology for measuring true exposure time in diagnostic X-ray examinations: pulsed, continuous or digital one. An electronic system named CronoX, which will be soon registered at the Brazilian Patent Office (INPI), is the equipment that provides such a high precision measurement. The principle of measurement is based on the electrical signal captured by a sensor that enters in a regeneration amplifier to transform it in a digital signal, which is treated by a microprocessor (uP). The signal treatment results in a two measured times: 1) T rx , the true X-ray exposure time; 2) T nx , the time in which the X-ray machine is repeatedly cut off during the pulsed irradiation and there is no delivery dose to the patient. Conventional Polymat X-ray equipment and dental X-ray machines were used to generate X-ray photons and take the measurements with the electronic systems. The results show that such a high precision instrumentation displays the true exposure time in diagnostic X-ray examinations and indicates a new method to be purposed for the quality surveillance programs in radiology. (author)

Degree and connectivity of the Internet's scale-free topology

International Nuclear Information System (INIS)

Zhang Lian-Ming; Wu Xiang-Sheng; Deng Xiao-Heng; Yu Jian-Ping

2011-01-01

This paper theoretically and empirically studies the degree and connectivity of the Internet's scale-free topology at an autonomous system (AS) level. The basic features of scale-free networks influence the normalization constant of degree distribution p(k). It develops a new mathematic model for describing the power-law relationships of Internet topology. From this model we theoretically obtain formulas to calculate the average degree, the ratios of the k min -degree (minimum degree) nodes and the k max -degree (maximum degree) nodes, and the fraction of the degrees (or links) in the hands of the richer (top best-connected) nodes. It finds that the average degree is larger for a smaller power-law exponent λ and a larger minimum or maximum degree. The ratio of the k min -degree nodes is larger for larger λ and smaller k min or k max . The ratio of the k max -degree ones is larger for smaller λ and k max or larger k min . The richer nodes hold most of the total degrees of Internet AS-level topology. In addition, it is revealed that the increased rate of the average degree or the ratio of the k min -degree nodes has power-law decay with the increase of k min . The ratio of the k max -degree nodes has a power-law decay with the increase of k max , and the fraction of the degrees in the hands of the richer 27% nodes is about 73% (the ‘73/27 rule’). Finally, empirically calculations are made, based on the empirical data extracted from the Border Gateway Protocol, of the average degree, ratio and fraction using this method and other methods, and find that this method is rigorous and effective for Internet AS-level topology. (interdisciplinary physics and related areas of science and technology)

A Reactive and Cycle-True IP Emulator for MPSoC Exploration

DEFF Research Database (Denmark)

Mahadevan, Shankar; Angiolini, Federico; Sparsø, Jens

2008-01-01

The design of MultiProcessor Systems-on-Chip (MPSoC) emphasizes intellectual-property (IP)-based communication-centric approaches. Therefore, for the optimization of the MPSoC interconnect, the designer must develop traffic models that realistically capture the application behavior as executing...... on the IP core. In this paper, we introduce a Reactive IP Emulator (RIPE) that enables an effective emulation of the IP-core behavior in multiple environments, including bit and cycle-true simulation. The RIPE is built as a multithreaded abstract instruction-set processor, and it can generate reactive...

Degree-based graph construction

International Nuclear Information System (INIS)

Kim, Hyunju; Toroczkai, Zoltan; Erdos, Peter L; Miklos, Istvan; Szekely, Laszlo A

2009-01-01

Degree-based graph construction is a ubiquitous problem in network modelling (Newman et al 2006 The Structure and Dynamics of Networks (Princeton Studies in Complexity) (Princeton, NJ: Princeton University Press), Boccaletti et al 2006 Phys. Rep. 424 175), ranging from social sciences to chemical compounds and biochemical reaction networks in the cell. This problem includes existence, enumeration, exhaustive construction and sampling questions with aspects that are still open today. Here we give necessary and sufficient conditions for a sequence of nonnegative integers to be realized as a simple graph's degree sequence, such that a given (but otherwise arbitrary) set of connections from an arbitrarily given node is avoided. We then use this result to present a swap-free algorithm that builds all simple graphs realizing a given degree sequence. In a wider context, we show that our result provides a greedy construction method to build all the f-factor subgraphs (Tutte 1952 Can. J. Math. 4 314) embedded within K n setmn S k , where K n is the complete graph and S k is a star graph centred on one of the nodes. (fast track communication)

[A study on the true nature of "Chinese jinseng"].

Science.gov (United States)

Yang, Jeong-pil; Yeo, In-sok

2003-12-01

Studies generally, it is believed that the ancient 'Chinese ginseng' did exist due to the fact that it is clearly recorded in the Chinese historical and medicine-related sources. Although it is hard to deny that such 'ginseng' did exist in ancient China, the re-examination of its true nature is also necessary. In other words, certain refutation can be made against the claim that ancient 'Chinese jinseng' was in fact 'Panax jinseng' (C. A. Mey.), since the Chinese jinseng accounts do not tell that it is such. For example, when looking into its shape based on descriptions, the 'Chinese Jinseng' has black seed, hairy stem, and violet flower. ' Panax jinseng' on the other hand, has opal seed, no-hair stem, and light-green flower. In terms of cultivation centre, most of mainland China is unsuitable for Jinseng production with the exception of the Shangdang area of Shanxi province, which solely had the reputation of being the production centre of ancient 'Chinese jinseng'. However, when looking into the Chinese sources for jinseng-producing areas, they show that Hepei and Liaoning province and Jiangnan (south of the Yangtze river) areas also have had some jinseng-related history. Regardless of such instance, these regions did not cultivate Panax jinseng. As shown above, ancient 'Chinese jinseng' was far from being identical, in respect to its shape or production areas, to Panax jinseng. Hence, this study came to the conclusion that there is indeed very high skepticism about whether the true nature of 'jinseng' in ancient China was in fact Panax jinseng. On the contrary, there is higher possibility that the ancient 'Chinese jinseng' is totally different plant from Panax jinseng which is actually Codonopsis pilosula. When examining the shape and production areas of Codonopsis pilosula, it is closely matched with many parts of ancient 'Chinese jinseng' texts. In short, it is presumed that the 'Chinese jinseng' did indeed exist in ancient China but it was Codonopsis pilosula

Competency-Based Business Degree. Issue Brief

Science.gov (United States)

Washington State Board for Community and Technical Colleges, 2014

2014-01-01

In January 2015, thirteen Washington community colleges launched an online, competency-based business transfer degree--the first in the state's community and technical college system. This issue brief provides answers to commonly asked questions about the new competency-based degree.

Actuator with Multi Degrees of Freedom(Actuator)

OpenAIRE

矢野, 智昭; Tomoaki, YANO; 産業技術総合研究所

2006-01-01

The advantages, problems and the recent developments of the actuator with multi degrees of freedom are presented. At first, the advantages of the actuator with multi degrees of freedom are described. Next, the problems needed to solve for practical use are presented. The recent applications of the actuator with multi degrees of freedom are also reviewed.

Lens positioner with five degrees of freedom

International Nuclear Information System (INIS)

Kobierecki, M.W.; Rienecker, F. Jr.

1978-01-01

A device for positioning lenses precisely with five degrees of freedom (three translations and two angular rotations). The unique features of the device are its compact design, large clear aperture, and high degree of positioning accuracy combined with five degrees of freedom in axis motion. Thus, the device provides precision and flexibility in positioning of optical components

High degree modes and instrumental effects

Energy Technology Data Exchange (ETDEWEB)

Korzennik, S G [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA (United States); Rabello-Soares, M C; Schou, J [Stanford University, Stanford, CA (United States)], E-mail: skorzennik@cfa.harvard.edu

2008-10-15

Full-disk observations taken with the Michelson Doppler Imager (MDI) on board the Solar and Heliospheric Observatory (SOHO) spacecraft, or the upgraded Global Oscillations Network Group (GONG) instruments, have enough spatial resolution to resolve modes up to {iota} = 1000 if not {iota} = 1500. The inclusion of such high-degree modes (i.e., {iota} {<=} 1000) improves dramatically inferences near the surface. Unfortunately, observational and instrumental effects cause the characterization of high degree modes to be quite complicated. Indeed, the characteristics of the solar acoustic spectrum are such that, for a given order, mode lifetimes get shorter and spatial leaks get closer in frequency as the degree of a mode increases. A direct consequence of this property is that individual modes are resolved only at low and intermediate degrees. At high degrees the individual modes blend into ridges and the power distribution of the ridge defines the ridge central frequency, masking the underlying mode frequency. An accurate model of the amplitude of the peaks that contribute to the ridge power distribution is needed to recover the underlying mode frequency from fitting the ridge. We present a detailed discussion of the modeling of the ridge power distribution, and the contribution of the various observational and instrumental effects on the spatial leakage, in the context of the MDI instrument. We have constructed a physically motivated model (rather than an ad hoc correction scheme) that results in a methodology that can produce unbiased estimates of high-degree modes. This requires that the instrumental characteristics are well understood, a task that has turned out to pose a major challenge. We also present our latest results, where most of the known instrumental and observational effects that affect specifically high-degree modes were removed. These new results allow us to focus our attention on changes with solar activity. Finally, we present variations of mode

Effect of limestone particle size and calcium to non-phytate phosphorus ratio on true ileal calcium digestibility of limestone for broiler chickens.

Science.gov (United States)

Anwar, M N; Ravindran, V; Morel, P C H; Ravindran, G; Cowieson, A J

2016-10-01

The purpose of this study was to determine the effect of limestone particle size and calcium (Ca) to non-phytate phosphorus (P) ratio on the true ileal Ca digestibility of limestone for broiler chickens. A limestone sample was passed through a set of sieves and separated into fine (digestibility of Ca was calculated using the indicator method and corrected for basal endogenous losses to determine the true Ca digestibility. The basal ileal endogenous Ca losses were determined to be 127 mg/kg of dry matter intake. Increasing Ca:non-phytate P ratios reduced the true Ca digestibility of limestone. The true Ca digestibility coefficients of limestone with Ca:non-phytate P ratios of 1.5, 2.0 and 2.5 were 0.65, 0.57 and 0.49, respectively. Particle size of limestone had a marked effect on the Ca digestibility, with the digestibility being higher in coarse particles (0.71 vs. 0.43).

The Development of Automatic and Controlled Inhibitory Retrieval Processes in True and False Recall

Science.gov (United States)

Knott, Lauren M.; Howe, Mark L.; Wimmer, Marina C.; Dewhurst, Stephen A.

2011-01-01

In three experiments, we investigated the role of automatic and controlled inhibitory retrieval processes in true and false memory development in children and adults. Experiment 1 incorporated a directed forgetting task to examine controlled retrieval inhibition. Experiments 2 and 3 used a part-set cue and retrieval practice task to examine…

Meson degrees of freedom in nuclei

International Nuclear Information System (INIS)

Delorme, J.

1982-01-01

A review is presented of the successes and shortcomings of the theory of meson degrees of freedom in nuclei with special emphasis on recent progress and on the necessity to bridge the gap with the degrees of freedom of QCD theory. (orig.)

Astronomy Enrollments and Degrees: Results from the 2012 Survey of Astronomy Enrollments and Degrees. Focus On

Science.gov (United States)

Mulvey, Patrick; Nicholson, Starr

2014-01-01

Interest in astronomy degrees in the U.S. remains strong, with astronomy enrollments at or near all-time highs for the 2012-13 academic year. The total number of students taking an introductory astronomy course at a degree-granting physics or astronomy department is approaching 200,000. Enrollments in introductory astronomy courses have been…

Branding the bio/biomedical engineering degree.

Science.gov (United States)

Voigt, Herbert F

2011-01-01

The future challenges to medical and biological engineering, sometimes referred to as biomedical engineering or simply bioengineering, are many. Some of these are identifiable now and others will emerge from time to time as new technologies are introduced and harnessed. There is a fundamental issue regarding "Branding the bio/biomedical engineering degree" that requires a common understanding of what is meant by a B.S. degree in Biomedical Engineering, Bioengineering, or Biological Engineering. In this paper we address some of the issues involved in branding the Bio/Biomedical Engineering degree, with the aim of clarifying the Bio/Biomedical Engineering brand.

SU-F-T-470: Implementation of a Daily Quality Assurance Phantom for Six Degrees-Of-Freedom Couch Testing

Energy Technology Data Exchange (ETDEWEB)

Gaballa, H; O’Brien, M; Riegel, A; Jamshidi, A; Klein, E [Northwell Health, Lake Success, NY (United States)

2016-06-15

Purpose: To develop a daily quality assurance (QA) device that can test the 6DoF (degrees of freedom) couch repositioning accuracy, prior to SBRT treatment deliveries, with an accuracy of ±0.3 degrees and ±0.3 mm. Methods: A daily QA phantom is designed with a focus on the derived center of projections of its markers, rather than tracking its individual markers one at a time. This approach can be the most favorable to address the intended machining accuracy of the QA phantom and the CBCT spatial resolution limitations, primarily 1 mm min slice thickness, simultaneously. With the current design, ±0.1 mm congruence of the resultant center of gravity of the markers with reference CT (0.6 mm minimum slice thickness) vs CBCT (1.0 mm minimum slice thickness) can be achieved. If successful, the QA device should be qualified to test 6DoF couch performance with a gauged accuracy of ±0.3 degrees/±0.3 mm. Testing is performed for the Varian True Beam 2.0 6DoF system. Results: Once the QA phantom is constructed and tested, agreement of the center of gravity of the reference CT scan and the CBCT scan of ±0.1 mm is achieved. This has translated into a consistent 3D-3D match on the treatment machine, CT vs CBCT, with a repetitive ±0.1 mm variation, thus exceeding our expectations. We have deployed the phantom for daily QA on one of our accelerators, and found that the QA time has increased by only 10 minutes. Conclusion: A 6DoF phantom has been designed (patent pending) and built with a realistic work flow in mind where the daily couch accuracy QA checks taking less than 10 minutes. Current developments include integration with the Varian’s Machine Performance Check consistency module.

Final report of the TRUE Block Scale project. 2. Tracer tests in the block scale

Energy Technology Data Exchange (ETDEWEB)

Andersson, Peter; Byegaard, Johan [Geosigma AB, Uppsala (Sweden); Winberg, Anders [Conterra AB, Partille (Sweden)

2002-05-01

The tracer test programme of the TRUE Block Scale Project involved 14 tracer tests campaigns, including performance of 32 tracer injections in 16 different combinations of source and sink sections (flow paths) varying in length between 10 to 130 metres, and involving one or more structures. Average, travel times varied between 1.5 and >2000 hours. Tracer dilution tests performed in conjunction with cross-hole hydraulic pumping tests were found to be a very important part of the pre-tests, where the results were used to identify and screen among possible injection points, and to verify the hydrostructural model valid at a given time. The main problem faced in the block scale tests was to select a test geometry, which gave a sufficiently high mass recovery, and at the same time enabled performance of cross-hole sorbing tracer tests within reasonable time frames. Three different injection methods were applied during the test programme; decaying pulse, finite pulse and forced pulse (unequal dipole). During the later phases of the tracer test programme it was identified that forced injection had to be employed in order to enable detection of tracer at the sink due to strong dilution, and also to avoid problems with artificially induced tailing in the injection signal. Sorbing (reactive) tracers were selected among the radioactive isotopes of the alkali and alkaline earth metals previously used in the TRUE- 1 experiments. It was decided that at least one slightly sorbing tracer and one strongly sorbing tracer should be used in each injection. Non-sorbing tracers were used for conservative reference, e.g., {sup 82}Br{sup -}, {sup 186}ReO{sub 4}, HTO (tritiated water) and {sup 131}I{sup -}. In two of the injections the radioactive non-sorbing tracers were rather short-lived and Uranine and Naphthionate were used as complementary conservative tracers. Surface distribution coefficients, K{sub a}, were evaluated from TRUE-1 and TRUE Block Scale data, making use of the

Final report of the TRUE Block Scale project. 2. Tracer tests in the block scale

International Nuclear Information System (INIS)

Andersson, Peter; Byegaard, Johan; Winberg, Anders

2002-05-01

The tracer test programme of the TRUE Block Scale Project involved 14 tracer tests campaigns, including performance of 32 tracer injections in 16 different combinations of source and sink sections (flow paths) varying in length between 10 to 130 metres, and involving one or more structures. Average, travel times varied between 1.5 and >2000 hours. Tracer dilution tests performed in conjunction with cross-hole hydraulic pumping tests were found to be a very important part of the pre-tests, where the results were used to identify and screen among possible injection points, and to verify the hydrostructural model valid at a given time. The main problem faced in the block scale tests was to select a test geometry, which gave a sufficiently high mass recovery, and at the same time enabled performance of cross-hole sorbing tracer tests within reasonable time frames. Three different injection methods were applied during the test programme; decaying pulse, finite pulse and forced pulse (unequal dipole). During the later phases of the tracer test programme it was identified that forced injection had to be employed in order to enable detection of tracer at the sink due to strong dilution, and also to avoid problems with artificially induced tailing in the injection signal. Sorbing (reactive) tracers were selected among the radioactive isotopes of the alkali and alkaline earth metals previously used in the TRUE- 1 experiments. It was decided that at least one slightly sorbing tracer and one strongly sorbing tracer should be used in each injection. Non-sorbing tracers were used for conservative reference, e.g., 82 Br - , 186 ReO 4 , HTO (tritiated water) and 131 I - . In two of the injections the radioactive non-sorbing tracers were rather short-lived and Uranine and Naphthionate were used as complementary conservative tracers. Surface distribution coefficients, K a , were evaluated from TRUE-1 and TRUE Block Scale data, making use of the retardation noted in the injection

A true love story. Young people's romantic and sexual development in the context of everyday life

Directory of Open Access Journals (Sweden)

Henderien Steenbeek

2017-06-01

Full Text Available Wieke Dalenberg. A true love story. Young people’s romantic and sexual development in the context of everyday life. Groningen: University of Groningen, 2016, 147 p., ISBN 978 94 6332 100 6

Data on ground-water quality for the Lovelock 1 degree by 2 degree quadrangle, western Nevada

Science.gov (United States)

Welch, Alan H.; Williams, Rhea P.

1987-01-01

Water quality data for groundwater has been compiled for the Lovelock 1 degree x 2 degree quadrangle which covers a portion of western Nevada. Chemical characteristics of the water are shown on a map (at a scale of 1:250,000) and on trilinear diagrams for the major ions. The data for the area are also presented in a table. (USGS)

Emissions Trading Schemes under IFRS - Towards a “true and fair view”

OpenAIRE

Haupt, Madlen; Ismer, Roland

2011-01-01

This research paper seeks to contribute to the latest discussions on the financial reporting for emissions trading schemes. It starts out by giving an overview of the International Financial Reporting Standards (IFRS) accounting policies, which are currently applied by the majority of participants in the EU Emissions Trading Scheme. It then argues that in order to fulfil the aims of financial reporting under IFRS, namely to provide a true and fair view, accounting must depict CO2 as a cost of...

Fingerprint re-alignment: a solution based on the true fingerprint center point

CSIR Research Space (South Africa)

Msiza, IS

2011-02-01

Full Text Available Solution Based on the True Fingerprint Center Point Ishmael S. Msiza, Brain Leke-Betechuoh, and Tendani Malumedzha Biometrics Research Group ? Information Security CSIR, Modelling & Digital Science Unit Pretoria, Republic of South Africa e... with a pattern that belongs to the Tented Arch (TA) fingerprint class. Fingerprints that belong to the TA class have a single core and a single delta, with the core located almost directly above the delta, as depicted in figure 3 (b). Many singular...

Evaluation Method of Collision Risk by Using True Motion

Directory of Open Access Journals (Sweden)

Hayama Imazu

2017-03-01

Full Text Available It is necessary to develop a useful application to use big data like as AIS for safety and efficiency of ship operation. AIS is very useful system to collect targets information, but this information is not effective use yet. The evaluation method of collision risk is one of the cause disturb. Usually the collision risk of ship is evaluated by the value of the Closest Point of Approach (CPA which is related to a relative motion. So, it becomes difficult to find out a safety pass in a congested water. Here, Line of Predicted Collision (LOPC and Obstacle Zone by Target (OZT for evaluation of collision risk are introduced, these values are related to a true motion and it became visible of dangerous place, so it will make easy to find out a safety pass in a congested water.

Alpha-event and surface characterisation in segmented true-coaxial HPGe detectors

Energy Technology Data Exchange (ETDEWEB)

Abt, I.; Garbini, L., E-mail: luciagarbini86@gmail.com.mpg.de; Gooch, C.; Irlbeck, S.; Liu, X.; Palermo, M.; Schulz, O.

2017-06-21

A detailed study of alpha interactions on the passivation layer on the end-plate of a true-coaxial high-purity germanium detector is presented. The observation of alpha events on such a surface indicates an unexpectedly thin so-called “effective dead layer” of less than 20 µm thickness. In addition, the influence of the metalisation close to the end-plate on the time evolution of the output pulses is discussed. The results indicate that alpha contamination can result in events which could be mistaken as signals for neutrinoless double beta decay and provide some guidance on how to prevent this.

Feedback-controlled diffusion: From self-trapping to true self-avoiding walks

International Nuclear Information System (INIS)

Schulz, B.M.; Trimper, S.; Schulz, M.

2005-01-01

We study the asymptotic behavior of a Brownian particle under the influence of a dynamical feedback by numerical simulations and analytical considerations. The feedback is controlled by a memory coupling of strength λ. Whereas a negative memory strength yields a true self avoiding walk, a positive memory leads to a self-trapping of the particle. The localization is manifested by a constant mean square displacement in the long time limit which appears after an initial diffusive regime. The probability distribution function of the trapping distance shows an exponential decay. The numerical simulations are compared with an analytical modeling

Differences between true mean temperatures and means calculated with four different approaches: a case study from three Croatian stations

Science.gov (United States)

Bonacci, Ognjen; Željković, Ivana

2018-01-01

Different countries use varied methods for daily mean temperature calculation. None of them assesses precisely the true daily mean temperature, which is defined as the integral of continuous temperature measurements in a day. Of special scientific as well as practical importance is to find out how temperatures calculated by different methods and approaches deviate from the true daily mean temperature. Five mean daily temperatures were calculated (T0, T1, T2, T3, T4) using five different equations. The mean of 24-h temperature observations during the calendar day is accepted to represent the true, daily mean T0. The differences Δ i between T0 and four other mean daily temperatures T1, T2, T3, and T4 were calculated and analysed. In the paper, analyses were done with hourly data measured in a period from 1 January 1999 to 31 December 2014 (149,016 h, 192 months and 16 years) at three Croatian meteorological stations. The stations are situated in distinct climatological areas: Zagreb Grič in a mild climate, Zavižan in the cold mountain region and Dubrovnik in the hot Mediterranean. Influence of fog on the temperature is analysed. Special attention is given to analyses of extreme (maximum and minimum) daily differences occurred at three analysed stations. Selection of the fixed local hours, which is in use for calculation of mean daily temperature, plays a crucial role in diminishing of bias from the true daily temperature.

Estimating true human and animal host source contribution in quantitative microbial source tracking using the Monte Carlo method.

Science.gov (United States)

Wang, Dan; Silkie, Sarah S; Nelson, Kara L; Wuertz, Stefan

2010-09-01

Cultivation- and library-independent, quantitative PCR-based methods have become the method of choice in microbial source tracking. However, these qPCR assays are not 100% specific and sensitive for the target sequence in their respective hosts' genome. The factors that can lead to false positive and false negative information in qPCR results are well defined. It is highly desirable to have a way of removing such false information to estimate the true concentration of host-specific genetic markers and help guide the interpretation of environmental monitoring studies. Here we propose a statistical model based on the Law of Total Probability to predict the true concentration of these markers. The distributions of the probabilities of obtaining false information are estimated from representative fecal samples of known origin. Measurement error is derived from the sample precision error of replicated qPCR reactions. Then, the Monte Carlo method is applied to sample from these distributions of probabilities and measurement error. The set of equations given by the Law of Total Probability allows one to calculate the distribution of true concentrations, from which their expected value, confidence interval and other statistical characteristics can be easily evaluated. The output distributions of predicted true concentrations can then be used as input to watershed-wide total maximum daily load determinations, quantitative microbial risk assessment and other environmental models. This model was validated by both statistical simulations and real world samples. It was able to correct the intrinsic false information associated with qPCR assays and output the distribution of true concentrations of Bacteroidales for each animal host group. Model performance was strongly affected by the precision error. It could perform reliably and precisely when the standard deviation of the precision error was small (≤ 0.1). Further improvement on the precision of sample processing and q

TU-AB-BRC-05: Creation of a Monte Carlo TrueBeam Model by Reproducing Varian Phase Space Data

International Nuclear Information System (INIS)

O’Grady, K; Davis, S; Seuntjens, J

2016-01-01

Purpose: To create a Varian TrueBeam 6 MV FFF Monte Carlo model using BEAMnrc/EGSnrc that accurately reproduces the Varian representative dataset, followed by tuning the model’s source parameters to accurately reproduce in-house measurements. Methods: A BEAMnrc TrueBeam model for 6 MV FFF has been created by modifying a validated 6 MV Varian CL21EX model. Geometric dimensions and materials were adjusted in a trial and error approach to match the fluence and spectra of TrueBeam phase spaces output by the Varian VirtuaLinac. Once the model’s phase space matched Varian’s counterpart using the default source parameters, it was validated to match 10 × 10 cm"2 Varian representative data obtained with the IBA CC13. The source parameters were then tuned to match in-house 5 × 5 cm"2 PTW microDiamond measurements. All dose to water simulations included detector models to include the effects of volume averaging and the non-water equivalence of the chamber materials, allowing for more accurate source parameter selection. Results: The Varian phase space spectra and fluence were matched with excellent agreement. The in-house model’s PDD agreement with CC13 TrueBeam representative data was within 0.9% local percent difference beyond the first 3 mm. Profile agreement at 10 cm depth was within 0.9% local percent difference and 1.3 mm distance-to-agreement in the central axis and penumbra regions, respectively. Once the source parameters were tuned, PDD agreement with microDiamond measurements was within 0.9% local percent difference beyond 2 mm. The microDiamond profile agreement at 10 cm depth was within 0.6% local percent difference and 0.4 mm distance-to-agreement in the central axis and penumbra regions, respectively. Conclusion: An accurate in-house Monte Carlo model of the Varian TrueBeam was achieved independently of the Varian phase space solution and was tuned to in-house measurements. KO acknowledges partial support by the CREATE Medical Physics Research

When Fiction Is Just as Real as Fact: No Differences in Reading Behavior between Stories Believed to be Based on True or Fictional Events

Science.gov (United States)

Hartung, Franziska; Withers, Peter; Hagoort, Peter; Willems, Roel M.

2017-01-01

Experiments have shown that compared to fictional texts, readers read factual texts faster and have better memory for described situations. Reading fictional texts on the other hand seems to improve memory for exact wordings and expressions. Most of these studies used a “newspaper” vs. “literature” comparison. In the present study, we investigated the effect of reader's expectation to whether information is true or fictional with a subtler manipulation by labeling short stories as either based on true or fictional events. In addition, we tested whether narrative perspective or individual preference in perspective taking affects reading true or fictional stories differently. In an online experiment, participants (final N = 1,742) read one story which was introduced as based on true events or as fictional (factor fictionality). The story could be narrated in either 1st or 3rd person perspective (factor perspective). We measured immersion in and appreciation of the story, perspective taking, as well as memory for events. We found no evidence that knowing a story is fictional or based on true events influences reading behavior or experiential aspects of reading. We suggest that it is not whether a story is true or fictional, but rather expectations toward certain reading situations (e.g., reading newspaper or literature) which affect behavior by activating appropriate reading goals. Results further confirm that narrative perspective partially influences perspective taking and experiential aspects of reading. PMID:28983269

When Fiction Is Just as Real as Fact: No Differences in Reading Behavior between Stories Believed to be Based on True or Fictional Events

Directory of Open Access Journals (Sweden)

Franziska Hartung

2017-09-01

Full Text Available Experiments have shown that compared to fictional texts, readers read factual texts faster and have better memory for described situations. Reading fictional texts on the other hand seems to improve memory for exact wordings and expressions. Most of these studies used a “newspaper” vs. “literature” comparison. In the present study, we investigated the effect of reader's expectation to whether information is true or fictional with a subtler manipulation by labeling short stories as either based on true or fictional events. In addition, we tested whether narrative perspective or individual preference in perspective taking affects reading true or fictional stories differently. In an online experiment, participants (final N = 1,742 read one story which was introduced as based on true events or as fictional (factor fictionality. The story could be narrated in either 1st or 3rd person perspective (factor perspective. We measured immersion in and appreciation of the story, perspective taking, as well as memory for events. We found no evidence that knowing a story is fictional or based on true events influences reading behavior or experiential aspects of reading. We suggest that it is not whether a story is true or fictional, but rather expectations toward certain reading situations (e.g., reading newspaper or literature which affect behavior by activating appropriate reading goals. Results further confirm that narrative perspective partially influences perspective taking and experiential aspects of reading.

Strategies for Pursuing a Master's Degree.

Science.gov (United States)

Thomas, Cynthia M; McIntosh, Constance E; Mensik, Jennifer S

2016-01-01

Health care has become very complex and is in a constant state of change. As a result of the evolving change and increasing complexity, a more educated nursing workforce is needed (Dracup K. Master's nursing programs. American Association of Colleges of Nursing. 2015; Institute of Medicine. The Future of Nursing: Leading Change, Advancing Health. 2010). It is now becoming necessary for registered nurses to earn an advanced degree to work at the highest level of their practice authority (Dracup K. Master's nursing programs. American Association of Colleges of Nursing. 2015; Institute of Medicine. The Future of Nursing: Leading Change, Advancing Health. 2010.). Preparing to reenter college may be an overwhelming prospect for some registered nurses seeking an advanced degree. However, there are some simple strategies that may help sort out the many degree options, financial obligations, decisions about brick and mortar versus online learning, commitment to degree completion, and changing career paths. This article will provide the registered nurse valuable information that will assist in the exciting process of returning to college.

Diagnostic evaluation of chronic inflammatory intestinal diseases in children and adolescents: MRI with true-FISP as new gold standard?

International Nuclear Information System (INIS)

Hohl, C.; Haage, P.; Krombach, G.A.; Schmidt, T.; Guenther, R.W.; Staatz, G.; Ahaus, M.

2005-01-01

Purpose: to evaluate the impact of magnetic resonance imaging (MRI) with use of True-FISP sequences in the evaluation of inflammatory bowel-wall changes in children and adolescents with Crohn's disease. Furthermore, the diagnostic procedure in children and adolescents with chronic inflammatory bowel disease (IBD) will be discussed in light of the relevant literature. Material and methods: twenty-four children and adolescents aged between 7 and 21 years with suspected or known IBD underwent MRI on a 1.5T-scanner (Philips ACS-NT, Best, Netherlands). One hour after 11 of a 2.5% mannitol solution was given orally, MR imaging was performed using coronal HASTE-M2D, coronal fat-suppressed T2-TSE, axial dynamic T1-weighted GE-sequences before and after i.v.-contrast material injection (0.1 mmol/kg Gd-DTPA) and using a 2D-balanced-FFE-sequence (True-FISP) before and after i.v.-contrast material injection in coronal and axial planes. The MR-images were correlated with endoscopy and the clinical findings. In 14 patients, a recently performed conventional radiographic enteroclysis was available. Each performed MRI sequence was evaluated by three experienced radiologists regarding the sensitivity and specificity of each sequence in the detection of inflammatory bowel wall changes. In addition, the image quality was assessed regarding the different tissue contrasts and the susceptibility to artifacts. The distension of the bowel wall and the patients' acceptance of the MRI examination were recorded. Results: with a sensitivity in detecting inflammatory small bowel changes of 93.3% (axial pre-contrast, coronal post-contrast) and 100% (axial post-contrast, coronal pre-contrast), the True-FISP outnumbers the other performed sequences (T1 = 80%, HASTE = 13.3% and T2-TSE = 53.3%). The difference between True-FISP and contrast-enhanced T1 was not statistically significant, whereas the difference between True-FISP and HASTE and T2-TSE, respectively. (orig.)

The degree of irreversibility in deterministic finite automata

DEFF Research Database (Denmark)

Axelsen, Holger Bock; Holzer, Markus; Kutrib, Martin

2016-01-01

the language, and show that the degree induces a strict infinite hierarchy of languages. We examine how the degree of irreversibility behaves under the usual language operations union, intersection, complement, concatenation, and Kleene star, showing tight bounds (some asymptotically) on the degree....

Time to Degree: A National View of the Time Enrolled and Elapsed for Associate and Bachelor's Degree Earners. (Signature Report No. 11)

Science.gov (United States)

Shapiro, Doug; Dundar, Afet; Wakhungu, Phoebe Khasiala; Yuan, Xin; Nathan, Angel; Hwang, Youngsik

2016-01-01

This report examines time to degree completion for a cohort of students who earned an associate degree as their first and only postsecondary degree or a bachelor's degree as their first four-year degree between July 1, 2014, and June 30, 2015. Overall, the average time enrolled for associate and bachelor's degree earners was 3.3 years and 5.1…

Astronautics Degrees for Space Industry

Science.gov (United States)

Gruntman, M.; Brodsky, R.; Erwin, D.; Kunc, J.

The Astronautics Program (http://astronautics.usc.edu) of the University of Southern California (USC) offers a full set of undergraduate and graduate degree programs in Aerospace Engineering with emphasis in Astronautics. The Bachelor of Science degree program in Astronautics combines basic science and engineering classes with specialized astronautics classes. The Master of Science degree program in Astronautics offers classes in various areas of space technology. The Certificate in Astronautics targets practicing engineers and scientists who enter space-related fields and/or who want to obtain training in specific space-related areas. Many specialized graduate classes are taught by adjunct faculty working at the leading space companies. The Master of Science degree and Certificate are available through the USC Distance Education Network (DEN). Today, the Internet allows us to reach students anywhere in the world through webcasting. The majority of our graduate students, as well as those pursuing the Certificate, work full time as engineers in the space industry and government research and development centers. The new world of distance learning presents new challenges and opens new opportunities. We show how the transformation of distance learning and particularly the introduction of webcasting transform organization of the program and class delivery. We will describe in detail the academic focus of the program, student reach, and structure of program components. Program development is illustrated by the student enrollment dynamics and related industrial trends; the lessons learned emphasize the importance of feedback from the students and from the space industry.

Solution-Processed Carbon Nanotube True Random Number Generator.

Science.gov (United States)

Gaviria Rojas, William A; McMorrow, Julian J; Geier, Michael L; Tang, Qianying; Kim, Chris H; Marks, Tobin J; Hersam, Mark C

2017-08-09

With the growing adoption of interconnected electronic devices in consumer and industrial applications, there is an increasing demand for robust security protocols when transmitting and receiving sensitive data. Toward this end, hardware true random number generators (TRNGs), commonly used to create encryption keys, offer significant advantages over software pseudorandom number generators. However, the vast network of devices and sensors envisioned for the "Internet of Things" will require small, low-cost, and mechanically flexible TRNGs with low computational complexity. These rigorous constraints position solution-processed semiconducting single-walled carbon nanotubes (SWCNTs) as leading candidates for next-generation security devices. Here, we demonstrate the first TRNG using static random access memory (SRAM) cells based on solution-processed SWCNTs that digitize thermal noise to generate random bits. This bit generation strategy can be readily implemented in hardware with minimal transistor and computational overhead, resulting in an output stream that passes standardized statistical tests for randomness. By using solution-processed semiconducting SWCNTs in a low-power, complementary architecture to achieve TRNG, we demonstrate a promising approach for improving the security of printable and flexible electronics.

The effect of cognitive load on hemispheric asymmetries in true and false memory.

Science.gov (United States)

Tat, Michael J; Azuma, Tamiko

2016-01-01

Studies examining hemispheric asymmetries in false memory have shown that the right hemisphere (RH) is more susceptible to false memories compared to the left hemisphere (LH). Theories suggest that hemispheric asymmetries in true and false memory may be due to differences in representational coding and the use of top-down mechanisms in each hemisphere. In the current study, the Deese-Roediger-McDermott false memory paradigm was used in conjunction with divided visual field presentation to examine the role of top-down mechanisms in hemispheric asymmetries of true and false memory. In Experiment 1, participants studied lists of related words while completing secondary cognitive load tasks. In Experiment 2, the secondary tasks were administered during memory retrieval instead of memory encoding. Results revealed that cognitive loads imposed during the study phase influenced veridical memory in the LH more than the RH, but cognitive loads imposed during retrieval did not influence veridical memory in either hemisphere. Surprisingly, false memory rates were not influenced by cognitive loads and were higher in the LH. These data provide evidence that, at least for veridical memory, top-down control mechanisms are used more readily for the encoding of information into memory in the LH compared to the RH.

How Much Does It Cost Institutions to Produce Stem Degrees? Data Brief. The Price and Cost of Science Degrees Series

Science.gov (United States)

Delta Cost Project at American Institutes for Research, 2013

2013-01-01

This AIR Data Brief breaks down the "cost per degree" estimates for 28 disciplines, including those in the STEM fields, which among the most expensive degrees to produce. The brief points to ways colleges can change their tuition structure to finance STEM degrees more affordably. This data brief is the fourth of four in the series. (See…

Characteristics of regents college nontraditional nuclear technology degrees

International Nuclear Information System (INIS)

DeSain, G.W.

1989-01-01

In 1971, the Board of Regents of The University of The State of New York created Regents College Degrees to assess academic knowledge of working adults and award college degrees based on demonstrated knowledge rather than time spent in a college classroom. It was founded on a basic premise that seemed radical to some but which is now widely accepted: What a person knows is more important than how or where that knowledge was acquired. Regents College degrees, therefore, are a different concept of a college: one that is an assessing institution rather than a teaching institution. It has no campus and offers no courses. Students can combine college credits from a variety of different sources int an accredited degree program. Staff and faculty evaluate that credit according to the requirements of the particular degree program. When all requirements are met, the Board or Regents of The University of The State of New York confers the degree

True or false? Memory is differentially affected by stress-induced cortisol elevations and sympathetic activity at consolidation and retrieval.

Science.gov (United States)

Smeets, Tom; Otgaar, Henry; Candel, Ingrid; Wolf, Oliver T

2008-11-01

Adrenal stress hormones released in response to acute stress may yield memory-enhancing effects when released post-learning and impairing effects at memory retrieval, especially for emotional memory material. However, so far these differential effects of stress hormones on the various memory phases for neutral and emotional memory material have not been demonstrated within one experiment. This study investigated whether, in line with their effects on true memory, stress and stress-induced adrenal stress hormones affect the encoding, consolidation, and retrieval of emotional and neutral false memories. Participants (N=90) were exposed to a stressor before encoding, during consolidation, before retrieval, or were not stressed and then were subjected to neutral and emotional versions of the Deese-Roediger-McDermott word list learning paradigm. Twenty-four hours later, recall of presented words (true recall) and non-presented critical lure words (false recall) was assessed. Results show that stress exposure resulted in superior true memory performance in the consolidation stress group and reduced true memory performance in the retrieval stress group compared to the other groups, predominantly for emotional words. These memory-enhancing and memory-impairing effects were strongly related to stress-induced cortisol and sympathetic activity measured via salivary alpha-amylase levels. Neutral and emotional false recall, on the other hand, was neither affected by stress exposure, nor related to cortisol and sympathetic activity following stress. These results demonstrate the importance of stress-induced hormone-related activity in enhancing memory consolidation and in impairing memory retrieval, in particular for emotional memory material.

Nuclear Engineering Enrollments and Degrees Survey, 2005 Data

International Nuclear Information System (INIS)

Oak Ridge Institute for Science and Education

2006-01-01

This annual report details the number of nuclear engineering bachelor's, master's, and doctoral degrees awarded at a sampling of academic programs from 1998-2005. it also looks at nuclear engineering degrees by curriculum and the number of students enrolled in nuclear engineering degree programs at 30 U.S. universities in 2005

Scholarship in nursing: Degree-prepared nurses versus diploma ...

African Journals Online (AJOL)

All but one (n = 18) nursing educators who obtained a degree as first qualification are educators in the private sector that include both universities as well as nursing colleges of private hospital groups. Data further revealed that most nurse educators and those in managerial positions were degree prepared. More degree ...

Degree-regular triangulations of torus and Klein bottle

Indian Academy of Sciences (India)

Home; Journals; Proceedings – Mathematical Sciences; Volume 115; Issue 3 ... A triangulation of a connected closed surface is called degree-regular if each of its vertices have the same degree. ... In [5], Datta and Nilakantan have classified all the degree-regular triangulations of closed surfaces on at most 11 vertices.

Health Physics Enrollments and Degrees Survey, 2005 Data

International Nuclear Information System (INIS)

Oak Ridge Institute for Science and Education

2006-01-01

This annual report details the number of health physics bachelor's, master's, and postdoctoral degrees awarded at a sampling of academic programs from 1998-2005. It also looks at health physics degrees by curriculum and the number of students enrolled in health physics degree programs at 30 U.S. universities in 2005

Health Physics Enrollments and Degrees Survey, 2004 Data

International Nuclear Information System (INIS)

Oak Ridge Institute for Science and Education

2005-01-01

This annual report details the number of health physics bachelor's, master's, and doctoral degrees awarded at a sampling of academic programs from 1998-2004. It also looks at health physics degrees by curriculum and the number of students enrolled in health physics degree programs at 28 U.S. universities in 2004

True to life English for adult learners : pre-intermediate : teacher's book

CERN Document Server

Gairns, Ruth

1995-01-01

True to Life is a five-level course for adults. To ensure a high level of motivation, the course focuses on contemporary themes, language and learning styles that are relevant to adult learners. The Starter level provides between 40 and 60 hours of class work. The other levels provide between 72 and 96 hours of class work, depending on the various options used. The range of extra materials (photocopiable worksheets, tests and videos) create a comprehensive and flexible teaching package. The ready-made lessons can be used as they stand, saving teacher time, or adapted using the optional activities suggested in the Teacher's Book.

Robot off-line programming and simulation as a true CIME-subsystem

DEFF Research Database (Denmark)

Nielsen, L.F; Trostmann, S; Trostmann, Erik

1992-01-01

A robot off-line programming and real-time simulation system, ROPSIM, which is based on the neutral interface concept and features simulation of the dynamics of both the controller and robot arm, has been developed. To avoid dependency on dedicated robot models, ROPSIM is based on generic models...... describing the robot controller, robot arm geometry, and the robot and arm kinetics. The software was developed using the C++ programming language. The key modules are discussed. The system is a true computer-integrated manufacturing and engineering subsystem which facilitates the exchange and reuse of robot...... model definition data and robot program definition data with systems of other origin or different functionality...

Electromagnetic guided couch and multileaf collimator tracking on a TrueBeam accelerator

DEFF Research Database (Denmark)

Hansen, Rune; Ravkilde, Thomas; Worm, Esben Schjødt

2016-01-01

Purpose: Couch and MLC tracking are two promising methods for real-time motion compensation during radiation therapy. So far, couch and MLC tracking experiments have mainly been performed by different research groups, and no direct comparison of couch and MLC tracking of volumetric modulated arc...... to characterize the geometric and dosimetric performance of electromagnetic guided couch and MLC tracking on a TrueBeam accelerator equipped with a Millennium MLC. The tracking system latency was determined without motion prediction as the time lag between sinusoidal target motion and the compensating motion...

Not strange but not true: self-reported interest in a topic increases false memory.

Science.gov (United States)

O'Connell, Anthony; Greene, Ciara M

2017-09-01

People are more likely to recall both true and false information that is consistent with their pre-existing stereotypes, schemata and desires. In addition, experts in a particular field are more likely to experience false memory in relation to their area of expertise. Here, we investigate whether level of interest, as distinct from level of knowledge, and in the absence of self-professed expertise, is associated with increased false memory. 489 participants were asked to rank 7 topics from most to least interesting. They were then asked if they remembered the events described in four news items related to the topic they selected as the most interesting and four items related to the topic selected as least interesting. In each case, three of the events depicted had really happened and one was fictional. A high level of interest in a topic increased true memories for the topic and doubled the frequency of false memories, even after controlling for level of knowledge. We interpret the results in the context of the source-monitoring framework and suggest that false memories arise as a result of interference from existing information stored in domain-related schemata.

Posthumous Humans, Modern Vampires: Re-use, seriality, chorality of horror tropes in True Blood

Directory of Open Access Journals (Sweden)

Giulia Iannuzzi

2016-06-01

Full Text Available Why are some of us – inhabitants of increasingly dense and complex narrative ecosystems – compulsive spectators of horrors? What determines the liveliness of horror tropes that already have a long history of being used and re-used in narratives across different media, and what favors their being used incessantly on the small screen? This essay argues that in analyzing contemporary television series, we need to takes into account specific productive and narrative aspects, and (intra- and inter-textual elements as well as sociological ones, starting from the theoretical assumption that the fortune of horror series (and not only of them is in fact determined by those territories where these elements come together. As a case in point, this essay takes a look at True Blood, which was created in 2008 for HBO by Alan Ball, and came to an end with its seventh season in 2014. Positioned within the broader context of horror proliferation in contemporary television series, True Blood offers striking examples of the new mechanisms and distinction practices utilized by the television genre which is bringing about an increasing differentiation of audience segment.

Determination of the rCBF in the Amygdala and Rhinal Cortex Using a FAIR-TrueFISP Sequence

International Nuclear Information System (INIS)

Ludescher, Burkhard; Martirosian, Petros; Klose, Uwe; Naegele, Thomas; Schick, Fritz; Ernemann, Ulrike

2011-01-01

Brain perfusion can be assessed non-invasively by modern arterial spin labeling MRI. The FAIR (flow-sensitive alternating inversion recovery)-TrueFISP (true fast imaging in steady precession) technique was applied for regional assessment of cerebral blood flow in brain areas close to the skull base, since this approach provides low sensitivity to magnetic susceptibility effects. The investigation of the rhinal cortex and the amygdala is a potentially important feature for the diagnosis and research on dementia in its early stages. Twenty-three subjects with no structural or psychological impairment were investigated. FAIR-True-FISP quantitative perfusion data were evaluated in the amygdala on both sides and in the pons. A preparation of the radiofrequency FOCI (frequency offset corrected inversion) pulse was used for slice selective inversion. After a time delay of 1.2 sec, data acquisition began. Imaging slice thickness was 5 mm and inversion slab thickness for slice selective inversion was 12.5 mm. Image matrix size for perfusion images was 64 X 64 with a field of view of 256 X 256 mm, resulting in a spatial resolution of 4 X 4 X 5 mm. Repetition time was 4.8 ms; echo time was 2.4 ms. Acquisition time for the 50 sets of FAIR images was 6:56 min. Data were compared with perfusion data from the literature. Perfusion values in the right amygdala, left amygdala and pons were 65.2 (± 18.2) mL/100 g/minute, 64.6 (± 21.0) mL/100 g/minute, and 74.4 (± 19.3) mL/100 g/minute, respectively. These values were higher than formerly published data using continuous arterial spin labeling but similar to 15O-PET (oxygen-15 positron emission tomography) data. The FAIR-TrueFISP approach is feasible for the quantitative assessment of perfusion in the amygdala. Data are comparable with formerly published data from the literature. The applied technique provided excellent image quality, even for brain regions located at the skull base in the vicinity of marked susceptibility steps.

Determination of the rCBF in the Amygdala and Rhinal Cortex Using a FAIR-TrueFISP Sequence

Energy Technology Data Exchange (ETDEWEB)

Ludescher, Burkhard; Martirosian, Petros; Klose, Uwe; Naegele, Thomas; Schick, Fritz; Ernemann, Ulrike [Eberhard-Karls-University, Tuebingen (Germany)

2011-10-15

Brain perfusion can be assessed non-invasively by modern arterial spin labeling MRI. The FAIR (flow-sensitive alternating inversion recovery)-TrueFISP (true fast imaging in steady precession) technique was applied for regional assessment of cerebral blood flow in brain areas close to the skull base, since this approach provides low sensitivity to magnetic susceptibility effects. The investigation of the rhinal cortex and the amygdala is a potentially important feature for the diagnosis and research on dementia in its early stages. Twenty-three subjects with no structural or psychological impairment were investigated. FAIR-True-FISP quantitative perfusion data were evaluated in the amygdala on both sides and in the pons. A preparation of the radiofrequency FOCI (frequency offset corrected inversion) pulse was used for slice selective inversion. After a time delay of 1.2 sec, data acquisition began. Imaging slice thickness was 5 mm and inversion slab thickness for slice selective inversion was 12.5 mm. Image matrix size for perfusion images was 64 X 64 with a field of view of 256 X 256 mm, resulting in a spatial resolution of 4 X 4 X 5 mm. Repetition time was 4.8 ms; echo time was 2.4 ms. Acquisition time for the 50 sets of FAIR images was 6:56 min. Data were compared with perfusion data from the literature. Perfusion values in the right amygdala, left amygdala and pons were 65.2 ({+-} 18.2) mL/100 g/minute, 64.6 ({+-} 21.0) mL/100 g/minute, and 74.4 ({+-} 19.3) mL/100 g/minute, respectively. These values were higher than formerly published data using continuous arterial spin labeling but similar to 15O-PET (oxygen-15 positron emission tomography) data. The FAIR-TrueFISP approach is feasible for the quantitative assessment of perfusion in the amygdala. Data are comparable with formerly published data from the literature. The applied technique provided excellent image quality, even for brain regions located at the skull base in the vicinity of marked susceptibility

Robust Scale Transformation Methods in IRT True Score Equating under Common-Item Nonequivalent Groups Design

Science.gov (United States)

He, Yong

2013-01-01

Common test items play an important role in equating multiple test forms under the common-item nonequivalent groups design. Inconsistent item parameter estimates among common items can lead to large bias in equated scores for IRT true score equating. Current methods extensively focus on detection and elimination of outlying common items, which…

A Study Regarding the Possibility of True Polar Wander on the Asteroid Vesta

Science.gov (United States)

Karimi, M.; Dombard, A. J.

2014-12-01

The asteroid 4 Vesta, with an average diameter of ~525 km, is the second most massive asteroid in the solar system. Most of our knowledge about this differentiated asteroid comes from the Howardite-Eucrite-Diogenite class of meteorites that originated from Vesta, images provided by Hubble Space Telescope, and data from the Dawn spacecraft that orbited Vesta from July 2011 to September 2012. Notably, these close-range data confirmed what Hubble images suggested: a highly oblate shape in which the equatorial radius is ~60 km greater than the polar radius, a shape consistent with Vesta's short rotational period of ~5.3 hr. These images also revealed the presence of two large impact craters near the asteroid's south pole. Rheasilvia, the younger and larger crater at ~500 km in diameter, is superimposed over Veneneia, ~400 km in diameter. The occurrence of two large impacts near a pole, which possesses a relatively small area (less than 30% of the surface), is highly improbable. Thus, we investigate the possibility of True Polar Wander. We hypothesize that the integrated mass deficit of these two basins applied a torque to the lithosphere to reorient the surface relative to the spin axis and thereby placing these basins near the pole. In order for this phenomenon to occur, however, the lithosphere needs to be pliable enough to allow relaxation of the ancient rotational bulge and concurrent development of the current bulge. We have previously explored whether the lithosphere of Vesta could support the large-scale (~20 vertical km) topography of the basins (short answer: it can). Here, we explore whether this lithosphere could also permit True Polar Wander. We use the Finite Element Method and a viscoelastic rheology to simulate the relaxation of an oblate Vesta under a range of plausible thermal scenarios consistent with Vesta's expected budget of long-lived radiogenic nuclides. Our results indicate that under reasonable thermal conditions, the relaxation of the

High-Degree Neurons Feed Cortical Computations.

Directory of Open Access Journals (Sweden)

Nicholas M Timme

2016-05-01

Full Text Available Recent work has shown that functional connectivity among cortical neurons is highly varied, with a small percentage of neurons having many more connections than others. Also, recent theoretical developments now make it possible to quantify how neurons modify information from the connections they receive. Therefore, it is now possible to investigate how information modification, or computation, depends on the number of connections a neuron receives (in-degree or sends out (out-degree. To do this, we recorded the simultaneous spiking activity of hundreds of neurons in cortico-hippocampal slice cultures using a high-density 512-electrode array. This preparation and recording method combination produced large numbers of neurons recorded at temporal and spatial resolutions that are not currently available in any in vivo recording system. We utilized transfer entropy (a well-established method for detecting linear and nonlinear interactions in time series and the partial information decomposition (a powerful, recently developed tool for dissecting multivariate information processing into distinct parts to quantify computation between neurons where information flows converged. We found that computations did not occur equally in all neurons throughout the networks. Surprisingly, neurons that computed large amounts of information tended to receive connections from high out-degree neurons. However, the in-degree of a neuron was not related to the amount of information it computed. To gain insight into these findings, we developed a simple feedforward network model. We found that a degree-modified Hebbian wiring rule best reproduced the pattern of computation and degree correlation results seen in the real data. Interestingly, this rule also maximized signal propagation in the presence of network-wide correlations, suggesting a mechanism by which cortex could deal with common random background input. These are the first results to show that the extent to

Optical true-time-delay microwave beam-steering with 1 Gb/s wireless transmission for in-building networks

NARCIS (Netherlands)

Cao, Z.; Li, F.; Boom, van den H.P.A.; Tangdiongga, E.; Koonen, A.M.J.

2013-01-01

An optical true time delay based microwave beam-steering (OTTD-MBS) scheme integrated with a radio-over-fibre system is demonstrated. Properties of 1Gb/s data wireless transmission with OTTD-MBS are studied.

Evidence of CP violation in B -> hhh charmless decays

CERN Multimedia

CERN. Geneva

2012-01-01

We present the first evidence of CP violation in the B+→ pi+pi-pi+,  B+→ K+pi+pi-, B+→ K+K-pi+ and B+→K+K-K+ decays using the 1.0 fb-1 of data collected by the LHCb experiment during 2011. The results show that the 3pi and Kpipi channels present a positive asymmetry while the KKpi and KKK modes present a negative asymmetry. We also study the variation of the CP violation effects in the phase space of each three-body decay.  We find significant inhomogeneities that reveal regions with particularly large asymmetries in the pipi and KK low mass regions in B+→pi+pi-pi+ and B+→K+K-pi+ respectively.

Identification of distinct layers within the stratified squamous epithelium of the adult human true vocal fold.

Science.gov (United States)

Dowdall, Jayme R; Sadow, Peter M; Hartnick, Christopher; Vinarsky, Vladimir; Mou, Hongmei; Zhao, Rui; Song, Phillip C; Franco, Ramon A; Rajagopal, Jayaraj

2015-09-01

A precise molecular schema for classifying the different cell types of the normal human vocal fold epithelium is lacking. We hypothesize that the true vocal fold epithelium has a cellular architecture and organization similar to that of other stratified squamous epithelia including the skin, cornea, oral mucosa, and esophagus. In analogy to disorders of the skin and gastrointestinal tract, a molecular definition of the normal cell types within the human vocal fold epithelium and a description of their geometric relationships should serve as a foundation for characterizing cellular changes associated with metaplasia, dysplasia, and cancer. Qualitative study with adult human larynges. Histologic sections of normal human laryngeal tissue were analyzed for morphology (hematoxylin and eosin) and immunohistochemical protein expression profile, including cytokeratins (CK13 and CK14), cornified envelope proteins (involucrin), basal cells (NGFR/p75), and proliferation markers (Ki67). We demonstrated that three distinct cell strata with unique marker profiles are present within the stratified squamous epithelium of the true vocal fold. We used these definitions to establish that cell proliferation is restricted to certain cell types and layers within the epithelium. These distinct cell types are reproducible across five normal adult larynges. We have established that three layers of cells are present within the normal adult stratified squamous epithelium of the true vocal fold. Furthermore, replicating cell populations are largely restricted to the parabasal strata within the epithelium. This delineation of distinct cell populations will facilitate future studies of vocal fold regeneration and cancer. N/A. © 2015 The American Laryngological, Rhinological and Otological Society, Inc.

True Yellow Light-Emitting Diodes as Phosphor for Tunable Color-Rendering Index Laser-Based White Light

KAUST Repository

Janjua, Bilal; Ng, Tien Khee; Zhao, Chao; Prabaswara, Aditya; Consiglio, Giuseppe Bernardo; Priante, Davide; Shen, Chao; Elafandy, Rami T.; Anjum, Dalaver H.; Alhamoud, Abdullah A.; Alatawi, Abdullah A.; Yang, Yang; Alyamani, Ahmed Y.; El-Desouki, Munir M.; Ooi, Boon S.

2016-01-01

An urgent challenge for the lighting research community is the lack of efficient optical devices emitting in between 500 and 600 nm, resulting in the “green-yellow gap”. In particular, true green (∼555 nm) and true yellow (∼590 nm), along with blue and red, constitute four technologically important colors. The III-nitride material system, being the most promising choice of platform to bridge this gap, still suffers from high dislocation density and poor crystal quality in realizing high-power, efficient devices. Particularly, the high polarization fields in the active region of such 2D quantum confined structures prevent efficient recombination of carriers. Here we demonstrate a true yellow nanowire (NW) light emitting diode (LED) with peak emission of 588 nm at 29.5 A/cm2 (75 mA in a 0.5 × 0.5 mm2 device) and a low turn-on voltage of ∼2.5 V, while having an internal quantum efficiency of 39%, and without “efficiency droop” up to an injection current density of 29.5 A/cm2. By mixing yellow light from a NW LED in reflective configuration with that of a red, green, and blue laser diode (LD), white light with a correlated color temperature of ∼6000 K and color-rendering index of 87.7 was achieved. The nitride-NW-based device offers a robust, long-term stability for realizing yellow light emitters for tunable color-rendering index solid-state lighting, on a scalable, low-cost, foundry-compatible titanium/silicon substrate, suitable for industry uptake.

True Yellow Light-Emitting Diodes as Phosphor for Tunable Color-Rendering Index Laser-Based White Light

KAUST Repository

Janjua, Bilal

2016-10-11

An urgent challenge for the lighting research community is the lack of efficient optical devices emitting in between 500 and 600 nm, resulting in the “green-yellow gap”. In particular, true green (∼555 nm) and true yellow (∼590 nm), along with blue and red, constitute four technologically important colors. The III-nitride material system, being the most promising choice of platform to bridge this gap, still suffers from high dislocation density and poor crystal quality in realizing high-power, efficient devices. Particularly, the high polarization fields in the active region of such 2D quantum confined structures prevent efficient recombination of carriers. Here we demonstrate a true yellow nanowire (NW) light emitting diode (LED) with peak emission of 588 nm at 29.5 A/cm2 (75 mA in a 0.5 × 0.5 mm2 device) and a low turn-on voltage of ∼2.5 V, while having an internal quantum efficiency of 39%, and without “efficiency droop” up to an injection current density of 29.5 A/cm2. By mixing yellow light from a NW LED in reflective configuration with that of a red, green, and blue laser diode (LD), white light with a correlated color temperature of ∼6000 K and color-rendering index of 87.7 was achieved. The nitride-NW-based device offers a robust, long-term stability for realizing yellow light emitters for tunable color-rendering index solid-state lighting, on a scalable, low-cost, foundry-compatible titanium/silicon substrate, suitable for industry uptake.

Astronomy Enrollments and Degrees: Results from the 2009 & 2010 Surveys of Physics & Astronomy Enrollments and Degrees. Focus On

Science.gov (United States)

Nicholson, Starr; Mulvey, Patrick

2011-01-01

The Statistical Research Center of the American Institute of Physics conducts an annual census from October through February of all departments that offer degrees in astronomy (78) in the United States. Astronomy departments consist of stand-alone degree-granting departments (39) and departments that are administered along with a physics program…

Quality of life and personality traits in patients with malignant pleural mesothelioma and their first-degree caregivers

Directory of Open Access Journals (Sweden)

Granieri A

2013-08-01

Full Text Available Antonella Granieri,1 Stella Tamburello,2 Antonino Tamburello,2 Silvia Casale,3 Chiara Cont,1 Fanny Guglielmucci,1 Marco Innamorati21Università degli Studi di Torino, Turin, Italy; 2Università Europea di Roma, Rome, Italy; 3Università di Firenze, Firenze, ItalyAbstract: Asbestos exposure causes significant pleural diseases, including malignant pleural mesothelioma (MPM. Taking into account the impact of MPM on emotional functioning and wellbeing, this study aimed to evaluate the quality of life and personality traits in patients with MPM and their first-degree caregivers through the World Health Organization Quality of Life–BREF (WHOQOL-BREF and the Minnesota Multiphasic Personality Inventory-2 Restructured Form (MMPI-2-RF. The sample was composed of 27 MPM patients, 55 first-degree relatives enrolled in Casale Monferrato and Monfalcone (Italy, and 40 healthy controls (HC. Patients and relatives reported poorer physical health than the HC. Patients had a higher overall sense of physical debilitation and poorer health than relatives and the HC, more numerous complaints of memory problems and difficulties in concentrating, and a greater belief that goals cannot be reached or problems solved, while often claiming that they were more indecisive and inefficacious than the HC. First-degree relatives reported lower opinions of others, a greater belief that goals cannot be reached or problems solved, support for the notion that they are indecisive and inefficacious, and were more likely to suffer from fear that significantly inhibited normal activities than were HC. In multinomial regression analyses, partial models indicated that sex, physical comorbidities, and the True Response Inconsistency (TRIN-r, Malaise (MLS, and Behavior-Restricting Fears (BRF dimensions of the MMPI-2-RF had significant effects on group differences. In conclusion, health care providers should assess the ongoing adjustment and emotional wellbeing of people with MPM and their

No-Report Paradigms: Extracting the True Neural Correlates of Consciousness.

Science.gov (United States)

Tsuchiya, Naotsugu; Wilke, Melanie; Frässle, Stefan; Lamme, Victor A F

2015-12-01

The goal of consciousness research is to reveal the neural basis of phenomenal experience. To study phenomenology, experimenters seem obliged to ask reports from the subjects to ascertain what they experience. However, we argue that the requirement of reports has biased the search for the neural correlates of consciousness over the past decades. More recent studies attempt to dissociate neural activity that gives rise to consciousness from the activity that enables the report; in particular, no-report paradigms have been utilized to study conscious experience in the full absence of any report. We discuss the advantages and disadvantages of report-based and no-report paradigms, and ask how these jointly bring us closer to understanding the true neural basis of consciousness. Crown Copyright © 2015. Published by Elsevier Ltd. All rights reserved.

Effects of Different Types of True-False Questions on Memory Awareness and Long-Term Retention

Science.gov (United States)

Schaap, Lydia; Verkoeijen, Peter; Schmidt, Henk

2014-01-01

This study investigated the effects of two different true-false questions on memory awareness and long-term retention of knowledge. Participants took four subsequent knowledge tests on curriculum learning material that they studied at different retention intervals prior to the start of this study (i.e. prior to the first test). At the first and…

Estimating the true energy value of a wind farm

International Nuclear Information System (INIS)

Bass, J.

1995-01-01

To assess the true energy yield of a wind farm taking into account real-world effects such as control losses in individual turbines, losses in the distribution network and wake and topographic effects, this report from the Energy Technology Support Unit, has developed a more appropriate methodology for making economic assessments of wind farm projects. Simulations of wind turbines are used to enable control losses to be quantified, and long term performance data from wind turbines in operational United Kingdom wind farms adds to the accuracy of assessment. A model has also been used to estimate performance of a power distribution system for a wind farm, to enable losses associated with wind turbine, wind speed and various distribution layouts to be predicted. Data on wake effects are drawn from a separate study. All these are drawn into an economic simulation model which predicts a wind farm's likely achievement of its target energy yield, thus demonstrating the risk factors involved. (UK)

Measuring tongue volumes and visualizing the chewing and swallowing process using real-time TrueFISP imaging - initial clinical experience in healthy volunteers and patients with acromegaly

International Nuclear Information System (INIS)

Ajaj, W.; Goyen, M.; Herrmann, B.; Massing, S.; Goehde, S.; Lauenstein, T.; Ruehm, S.G.

2005-01-01

This study assessed both two-dimensional (2D) TrueFISP imaging for quantifying tongue volume and real-time TrueFISP imaging for evaluating chewing and swallowing in healthy volunteers and patients with acromegaly. In 50 healthy volunteers, tongue volumes were measured using a 2D TrueFISP sequence. Chewing and swallowing were visualized using a real-time TrueFISP sequence. Ten patients with acromegaly were examined twice with the same magnetic resonance imaging protocol: once prior to therapy and a second time 6 months after therapy. Prior to therapy, healthy volunteers had an average tongue volume of 140 ml for men and 90 ml for women, and patients with acromegaly had an average tongue volume of 180 ml for men and 145 ml for women. However, 6 months after therapy the mean tongue volumes in patients with acromegaly had decreased to 154 ml in the men and to 125 ml in the women. The chewing and swallowing process was normal in all volunteers. Prior to therapy, just two patients showed a chewing and swallowing pathology, which disappeared after therapy. Patients with acromegaly had larger tongue volumes than healthy volunteers, and TrueFISP imaging proved feasible for visualizing chewing and swallowing in real time and is capable of detecting possible pathologies. Furthermore, TrueFISP imaging can be used to monitor therapeutic approaches in patients with acromegaly. (orig.)

Measuring tongue volumes and visualizing the chewing and swallowing process using real-time TrueFISP imaging - initial clinical experience in healthy volunteers and patients with acromegaly

Energy Technology Data Exchange (ETDEWEB)

Ajaj, W.; Goyen, M.; Herrmann, B.; Massing, S.; Goehde, S.; Lauenstein, T.; Ruehm, S.G. [University Hospital, Department of Diagnostic and Interventional Radiology, Essen (Germany)

2005-05-01

This study assessed both two-dimensional (2D) TrueFISP imaging for quantifying tongue volume and real-time TrueFISP imaging for evaluating chewing and swallowing in healthy volunteers and patients with acromegaly. In 50 healthy volunteers, tongue volumes were measured using a 2D TrueFISP sequence. Chewing and swallowing were visualized using a real-time TrueFISP sequence. Ten patients with acromegaly were examined twice with the same magnetic resonance imaging protocol: once prior to therapy and a second time 6 months after therapy. Prior to therapy, healthy volunteers had an average tongue volume of 140 ml for men and 90 ml for women, and patients with acromegaly had an average tongue volume of 180 ml for men and 145 ml for women. However, 6 months after therapy the mean tongue volumes in patients with acromegaly had decreased to 154 ml in the men and to 125 ml in the women. The chewing and swallowing process was normal in all volunteers. Prior to therapy, just two patients showed a chewing and swallowing pathology, which disappeared after therapy. Patients with acromegaly had larger tongue volumes than healthy volunteers, and TrueFISP imaging proved feasible for visualizing chewing and swallowing in real time and is capable of detecting possible pathologies. Furthermore, TrueFISP imaging can be used to monitor therapeutic approaches in patients with acromegaly. (orig.)

Adolescent obesity and future college degree attainment.

Science.gov (United States)

Fowler-Brown, Angela G; Ngo, Long H; Phillips, Russell S; Wee, Christina C

2010-06-01

The current impact of adolescent obesity on educational attainment is not clear. The objectives of our study were to determine whether adolescent obesity is associated with college degree attainment and how this association may have changed over time. We used data from a contemporary national cohort of over 4,000 persons who were adolescents (aged 14-18) in 1997 to assess the relationship between adolescent obesity and education. To assess for changes in this relationship over time, we also analyzed an older, similarly structured cohort of over 3,000 persons who were adolescents (aged 16-18) in 1981. Our primary outcome was college degree completion. We found that in the older cohort (adolescents in 1979), there were no differences in college degree attainment by adolescent weight status before and after adjustment. However, unadjusted analysis of the contemporary cohort (adolescents in 1997) demonstrated that those who were normal weight as adolescents had a higher prevalence of college degree attainment at follow-up compared to obese adolescents (24% vs. 10%). After adjustment for socio-demographic variables (age, sex, race, height, parental income-to-poverty ratio, parental education, aptitude test scores), obese adolescents were less likely to have attained a college degree compared to normal weight peers (adjusted risk ratio 0.61 95% confidence interval 0.38-0.83). Expectations for a future college degree did not vary by weight status and did not explain this observation. In conclusion, adolescent obesity is associated with lower likelihood of college completion. This relationship was not observed in an older cohort of adolescents.

True resolution enhancement for optical spectroscopy

Science.gov (United States)

Cooper, Justin T.; Oleske, Jeffrey B.

2018-02-01

Resolving spectrally adjacent peaks is important for techniques, such as tracking small shifts in Raman or fluorescence spectra, quantifying pharmaceutical polymorph ratios, or molecular orientation studies. Thus, suitable spectral resolution is a vital consideration when designing most spectroscopic systems. Most parameters that influence spectral resolution are fixed for a given system (spectrometer length, grating groove density, excitation source, CCD pixel size, etc.). Inflexible systems are non-problematic if the spectrometer is dedicated for a single purpose; however, these specifications cannot be optimized for different applications with wider range resolution requirements. Data processing techniques, including peak fitting, partial least squares, or principal component analysis, are typically used to achieve sub-optical resolution information. These techniques can be plagued by spectral artifacts introduced by post-processing as well as the subjective implementation of statistical parameters. TruRes™, from Andor Technology, uses an innovative optical means to greatly improve and expand the range of spectral resolutions accessible on a single setup. True spectral resolution enhancement of >30% is achieved without mathematical spectral alteration, dataprocessing, or spectrometer component changes. Discreet characteristic spectral lines from Laser-Induced Breakdown Spectroscopy (LIBS) and atomic calibration sources are now fully resolved from spectrally-adjacent peaks under otherwise identical configuration. TruRes™ has added advantage of increasing the spectral resolution without sacrificing bandpass. Using TruRes™ the Kymera 328i resolution can approach that of a 500 mm focal spectrometer. Furthermore, the bandpass of a 500 mm spectrograph with would be 50% narrower than the Kymera 328i with all other spectrometer components constant. However, the Kymera 328i with TruRes™ is able to preserve a 50% wider bandpass.

Study on the relationship between changes of serum true insulin (Tl) C-peptide, GAD-Ab, INS-Ab contents and age, course of disease, degree of obesity in patients with DM2

International Nuclear Information System (INIS)

Du Tongxin; Wang Zizheng; Cao Jiwei; Wu Jindan; Tao Xiaojun

2009-01-01

Objective: To study the changes of serum TI, C-peptide, GAD-Ab and INS-Ab in different groups of patients with DM2 (age,course of disease and degree of obesity). Methods: Serum C-peptide(with CLIA), INS-Ab(with RIA) and TI, GAD-Ab(with ELISA) contents were measured in altogether 428 patients with DM2. Relationship between changes of the above parameters and different groups of patients was studide in accordance with age, course of disease and degree of obesity respectively. Results: 1)Relationship among different age groups:(below 50, n=86, 51-70, n=216, over 71 n=126). The serum levels of the 4 parameters were significantly higher in all age group than those in the controls(n=40). Among the various age groups, the levels of all parameters were significantly lower in age group below 50 than the levels,in the other 2 groups with the only exception of INS-Ab, which was not significantly different from that in age group 51-70.The levels were significantly different between age-group 51-70 and age groups over 70, with the only exception of GAD-Ab, which was about the same in the two age-groups. 2)Relationship between changes of serum levels and course of disease(below 5yrs n=157, 6-10yrs n=168,over 1yrs,n=103). The serum levels in patients with disease less than 5years were significantly lower than those in other groups with the exception of GAD-Ab, which was not significantly different from that in patients with disease 6-10 years. 3) Relationship among different degree of obesity(non-obese, BMI BMI≥25, n=202, super-obese BMI≥32 n=50): The serum levels of all the parameters were significantly lower in the non-obese subjects than those in the other two groups.The levels in the super-obese group were also significantly higher than those in the obese group (P<0.01, P<0.05). Conclusion: Serum levels of the 4 parameters (TI, C-peptide, GAD-Ab, INS-Ab)were significantly increased in patients with DM2, especially in the older patients with prolonged course of disease as

Quasi-monoenergetic neutron energy spectra for 246 and 389 MeV (7)Li(p,n) reactions at angles from 0 degrees to 300 degrees

CERN Document Server

Iwamoto, Y; Nakamura, T; Nakashima, H; Mares, V; Itoga, T; Matsumoto, T; Nakane, Y; Feldbaumer, E; Jaegerhofer, L; Pioch, C; Tamii, A; Satoh, D; Masuda, A; Sato, T; Iwase, H; Yashima, H; Nishiyama, J; Hagiwara, M; Hatanaka, K; Sakamoto, Y

2011-01-01

The authors measured the neutron energy spectra of a quasi-monoenergetic (7)Li(p,n) neutron source with 246 and 389 MeV protons set at seven angles (0 degrees, 2.5 degrees, 5 degrees, 10 degrees, 15 degrees, 20 degrees and 30 degrees), using a time-of-flight (TOF) method employing organic scintillators NE213 at the Research Center for Nuclear Physics (RCNP) of Osaka University. The energy spectra of the source neutrons were precisely deduced down to 2 MeV at 0 degrees and 10 MeV at other angles. The cross-sections of the peak neutron production reaction at 0 degrees were on the 35-40 mb line of other experimental data, and the peak neutron angular distribution agreed well with the Taddeucci formula. Neutron energy spectra below 100 MeV at all angles were comparable, but the shapes of the continuum above 150 MeV changed considerably with the angle. In order to consider the correction required to derive the response in the peak region from the measured total response for high-energy neutron monitors such as DAR...

When true memory availability promotes false memory: evidence from confabulating patients.

Science.gov (United States)

Ciaramelli, Elisa; Ghetti, Simona; Frattarelli, Massimo; Làdavas, Elisabetta

2006-01-01

We explored the extent to which confabulators are susceptible to false recall and false recognition, and whether false recognition is reduced when memory for studied items is experimentally enhanced. Five confabulating patients, nine non-confabulating amnesics--including patients with (F amnesics) and without frontal-lobe dysfunction (NF amnesics)--and 14 control subjects underwent the DRM paradigm [Roediger, H. L., & McDermott, K. B. (1995). Creating false memories: Remembering words not presented in lists. Journal of Experimental Psychology: Learning, Memory and Cognition, 21, 803-814.] in two experimental conditions. In both conditions participants studied eight lists of semantic associates, and free recall was tested after the presentation of each list. In the Standard condition recognition was tested after the presentation of all the lists, whereas in the Proximal condition patients were administered a six-item recognition task after the presentation of each list. Participants also provided remember or know judgements, and described the content of their recollections. All groups of patients recalled a lower proportion of targets and critical lures than did control subjects, but confabulators recalled more words unrelated to the studied lists than did NF amnesics and controls. All groups of participants improved true recognition across conditions. However, whereas normal controls suppressed false recognition to critical lures in the Proximal compared to the Standard condition, and non-confabulating amnesics showed comparable gist-based false recognition, confabulators showed increased levels of false recognition to critical lures across conditions. Furthermore, NF amnesics significantly reduced false recognition to unrelated lures in the Proximal compared to the Standard condition, whereas confabulators were unable to suppress false recognition to unrelated lures across conditions. Analysis of the phenomenological experience showed that, unlike non

Reaching for the true overlay in advanced nodes

Science.gov (United States)

Koay, Chiew-seng; Hamieh, Bassem; Felix, Nelson; Gaudiello, John

2017-03-01

Traditionally, the total measurement uncertainty (TMU) of overlay metrology focuses on dynamic precision, toolinduced-shift, and matching, while rarely examining inaccuracy. However, some researchers have recently shown that measurement inaccuracy can still be large despite optimized small TMU. Moreover, this inaccuracy can consume a significant portion of the overlay budget in the advanced nodes. In addition to qualifying the overlay error of inline wafers, overlay metrology is also used for improving on-product overlay as it provides corrective feedback to the lithography scanner. The accuracy of the correction terms as a result depends directly upon the measurement accuracy. As such, enhanced overlay accuracy will improve the overlay performance of reworked wafers, or subsequently exposed wafers. We have previously shown that a segmented Blossom target is more prone to asymmetry-induced inaccuracy than a nonsegmented target is [1]. Since target segmentation is inevitable for SADP and SAQP patterning processes, their resulting overlay performance leaves a lot to be desired. In our quest to reach for the true overlay, this paper reports our investigations on accuracy enhancement techniques for image-based targets, such as redundancy and self-calibration, and on the use of simulation-optimized scatterometry-based targets.

Unfolding of true distributions from experimental data distorted by detectors with finite resolutions

International Nuclear Information System (INIS)

Gagunashvili, N.D.

1993-01-01

A new procedure for unfolding the true distribution from experimental data distorted by a detector is proposed. For the given detector a result can be found by the least squares method, hence, without bias and involving minimal statistical errors. Stability of the result is achieved at the expense of its information content and/or using additional information on the shape of the distributions to be measured. The method may be applied for detectors with linear or nonlinear distortions. 8 refs.; 5 figs

Statistical Mechanics of On-line Learning When a Moving Teacher Goes around an Unlearnable True Teacher

Science.gov (United States)

Urakami, Masahiro; Miyoshi, Seiji; Okada, Masato

2007-04-01

In the framework of on-line learning, a learning machine might move around a teacher due to the differences in structures or output functions between the teacher and the learning machine. In this paper we analyze the generalization performance of a new student supervised by a moving machine. A model composed of a fixed true teacher, a moving teacher, and a student is treated theoretically using statistical mechanics, where the true teacher is a nonmonotonic perceptron and the others are simple perceptrons. Calculating the generalization errors numerically, we show that the generalization errors of a student can temporarily become smaller than that of a moving teacher and can reach the lowest value, even if the student only uses examples from the moving teacher. However, the generalization error of the student eventually becomes the same value with that of the moving teacher. This behavior is qualitatively different from that of a linear model.

True coincidence summing corrections for an extended energy range HPGe detector

Energy Technology Data Exchange (ETDEWEB)

Venegas-Argumedo, Y. [Centro de Investigación en Materiales Avanzados (CIMAV), Miguel de Cervantes 120, Chihuahua, Chih 31109 (Mexico); M.S. Student at CIMAV (Mexico); Montero-Cabrera, M. E., E-mail: elena.montero@cimav.edu.mx [Centro de Investigación en Materiales Avanzados (CIMAV), Miguel de Cervantes 120, Chihuahua, Chih 31109 (Mexico)

2015-07-23

True coincidence summing (TCS) effect for natural radioactive families of U-238 and Th-232 represents a problem when an environmental sample with a close source-detector geometry measurement is performed. By using a certified multi-nuclide standard source to calibrate an energy extended range (XtRa) HPGe detector, it is possible to obtain an intensity spectrum slightly affected by the TCS effect with energies from 46 to 1836 keV. In this work, the equations and some other considerations required to calculate the TCS correction factor for isotopes of natural radioactive chains are described. It is projected a validation of the calibration, performed with the IAEA-CU-2006-03 samples (soil and water)

Increasingly Global: Combining an International Business Degree with a Post-Degree Designation

Science.gov (United States)

Smith, Rachel; Terry, Andy; Vibhakar, Ashvin

2006-01-01

In the increasingly complex and competitive global marketplace, many students seek to gain multiple skills and credentials that can aid them in their career goals. One such career strategy weds a general overarching comprehensive degree with a specific and targeted skill set. This paper provides a viable curriculum path for students who seek…

Slow light in a semiconductor waveguide for true-time delay applications in microwave photonics

DEFF Research Database (Denmark)

Öhman, Filip; Yvind, Kresten; Mørk, Jesper

2007-01-01

We have investigated the slowand fast light properties of a semiconductor waveguide device employing concatenated gain and absorber sections. This letter presents the experimental results as well as theoretical modeling. A large phase shift of 110 and a true-time delay of more than 150 ps are dem...... are demonstrated. The combination of amplitude and phase control of the modulated signal shows great promise for applications within microwave photonics....

Effects of sulpiride on true and false memories of thematically related pictures and associated words in healthy volunteers

Directory of Open Access Journals (Sweden)

Regina V Guarnieri

2016-03-01

Full Text Available Episodic memory, working memory, emotional memory and attention are subject to dopaminergic modulation. However, the potential role of dopamine on the generation of false memories is unknown. This study defined the role of the dopamine D2 receptor on true and false memories. Twenty-four young, healthy volunteers ingested a single dose of placebo or 400 mg oral sulpiride, a dopamine D2-receptor antagonist, just before starting the recognition memory task in a randomized, double-blind, placebo-controlled trial. The sulpiride group made more false recognitions during visual and verbal processing than the placebo group although both groups had the same indices of true memory. These findings demonstrate that dopamine blockade in healthy volunteers can specifically increase the rate of false recognitions.

Tried And True Integrating Active And Reserve Components

Science.gov (United States)

2016-02-16

from home station to work and train with experienced maintainers in the Reserve Component. Since there are no dorms or dining facilities, young... smart and experienced leadership out given limited progression. In a new test of the Integrated Wing, the Air Force proposes restructuring the Active...degree or for shorter term family reasons (i.e. to care for an elderly parent or child). I believe it will benefit only a small percentage of Airmen who

Chernobyl, the true, the false and the uncertain; Tchernobyl: le vrai, le faux et l'incertain

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-04-01

This work makes the part between the true and the false information in France about the Chernobyl accident that have been read in different newspapers during the last years. This document is divide in three parts: what is true, what is false, what is uncertain. In each part are noticed extracts from newspapers face to the synthesis of thoughts about them. It is the fourth edition, the first one was in April 1990, the second one was in 1992 after a report from IAEA on the radiological consequences, the third edition was born in 1994 with the emergence of thyroid cancers especially among children, this fourth edition of 1996 takes into account the sanitary report given by the World Health Organisation experts in 1995. It confirms the progression of thyroid cancers and the absence of any other cancer as well leukemia. (N.C.)

Copper (II) Lead (II) and Zinc (II) reduce growth and zoospore release in four zoosporic true fungi from soils of NSW, Australia

DEFF Research Database (Denmark)

Henderson, Linda; Pilgaard, Bo; Gleason, Frank

2015-01-01

This study examined the responses of a group of four zoosporic true fungi isolated from soils in NSW Australia, to concentrations of toxic metals in the laboratory that may be found in polluted soils. All isolates showed greatest sensitivity to Cu and least sensitivity to Pb. All isolates showed ...... in 60 ppm Cu. If these metals cause similar effects in the field, Cu, Pb and Zn contamination of NSW soils is likely to reduce biomass of zoosporic true fungi. Loss of the fungi may reduce the rate of mineralisation of soil organic matter.......This study examined the responses of a group of four zoosporic true fungi isolated from soils in NSW Australia, to concentrations of toxic metals in the laboratory that may be found in polluted soils. All isolates showed greatest sensitivity to Cu and least sensitivity to Pb. All isolates showed...

True beam commissioning experience at Nordland Hospital Trust, Norway

Energy Technology Data Exchange (ETDEWEB)

Daci, Lulzime, E-mail: lulzime.daci@nodlandssykehuset.no [Nordland Hospital Trust, Bodø (Norway); Malkaj, Partizan, E-mail: malkaj-p@hotmail.com [Faculty of Mathematics Engineering and Physics Engineering, Polytechnic University of Tirana (Albania)

2016-03-25

To evaluate the measured of all photon beam data of first Varian True Beam version 2.0 slim model, recently commissioned at Nordland Hospital Trust, Bodø. To compare and evaluate the possibility of beam matching with the Clinac2300, for the energies of 6MV and 15 MV. Materials/Methods: Measurements of PDD, OAR, and Output factors were realized with the IBA Blue-phantom with different detectors and evaluated between them for all photon energies: 6MV, 15MV, 6MV FFF and 10MV FFF. The ionization chambers used were Pin Point CC01, CC04, Semiflex CC13 and photon diode by Iba dosimetry. The data were processed using Beizer algorithm with a resolution of 1 mm. The measured depth dose curves, diagonals, OAR, and output factors were imported into Eclipse in order to calculate beam data for the anisotropic analytical algorithm (AAA version 10.0.28) for both the dataset measured with CC04 and CC13 and compared. The model head of 23EX was selected as the most near model to True Beam as a restriction of our version of Aria. It was seen that better results were achieved with the CC04 measured data as a result of better resolution. For the biggest field after 10 cm depth a larger difference is seen between measured and calculated for both dataset, but it is within the criteria for acceptance. Results: The Beam analysis criteria of 2 mm at 50% dose is achieved for all the fields accept for 40x40 that is within 3%. Depth difference at maximum dose is within 1 mm for all the fields and dose difference at 100 mm and 200 mm is lower than 1% for or all the fields. The PDD between two machines for all the fields differ after Dmax with less than 1%. For profiles in the field zone and outside field the difference is within 1% for all the fields. In the penumbra region the difference is from 2% up to 12% for big fields. As for diagonals they differ as a result of the head construction at the edge of the field and the penumbra region. The output factors differ for big fields

True beam commissioning experience at Nordland Hospital Trust, Norway

International Nuclear Information System (INIS)

Daci, Lulzime; Malkaj, Partizan

2016-01-01

To evaluate the measured of all photon beam data of first Varian True Beam version 2.0 slim model, recently commissioned at Nordland Hospital Trust, Bodø. To compare and evaluate the possibility of beam matching with the Clinac2300, for the energies of 6MV and 15 MV. Materials/Methods: Measurements of PDD, OAR, and Output factors were realized with the IBA Blue-phantom with different detectors and evaluated between them for all photon energies: 6MV, 15MV, 6MV FFF and 10MV FFF. The ionization chambers used were Pin Point CC01, CC04, Semiflex CC13 and photon diode by Iba dosimetry. The data were processed using Beizer algorithm with a resolution of 1 mm. The measured depth dose curves, diagonals, OAR, and output factors were imported into Eclipse in order to calculate beam data for the anisotropic analytical algorithm (AAA version 10.0.28) for both the dataset measured with CC04 and CC13 and compared. The model head of 23EX was selected as the most near model to True Beam as a restriction of our version of Aria. It was seen that better results were achieved with the CC04 measured data as a result of better resolution. For the biggest field after 10 cm depth a larger difference is seen between measured and calculated for both dataset, but it is within the criteria for acceptance. Results: The Beam analysis criteria of 2 mm at 50% dose is achieved for all the fields accept for 40x40 that is within 3%. Depth difference at maximum dose is within 1 mm for all the fields and dose difference at 100 mm and 200 mm is lower than 1% for or all the fields. The PDD between two machines for all the fields differ after Dmax with less than 1%. For profiles in the field zone and outside field the difference is within 1% for all the fields. In the penumbra region the difference is from 2% up to 12% for big fields. As for diagonals they differ as a result of the head construction at the edge of the field and the penumbra region. The output factors differ for big fields

Roster of Astronomy Departments with Enrollment and Degree Data, 2012: Results from the 2012 Survey of Enrollments and Degrees. Focus On

Science.gov (United States)

Nicholson, Starr; Mulvey, Patrick J.

2013-01-01

The U.S. has experienced a sharp increase in the number of bachelor astronomy degrees awarded in recent years with about twice as many degrees now being awarded than a decade ago. There were 385 astronomy bachelor's degrees awarded in the 2011-12 academic year. The number of astronomy PhDs awarded in recent years is up about 50% from a decade…

Elephant trunk in a small-calibre true lumen for chronic aortic dissection: cause of haemolytic anaemia?

Science.gov (United States)

Araki, Haruna; Kitamura, Tadashi; Horai, Tetsuya; Shibata, Ko; Miyaji, Kagami

2014-12-01

The elephant trunk technique for aortic dissection is useful for reducing false lumen pressure; however, a folded vascular prosthesis inside the aorta can cause haemolysis. The purpose of this study was to investigate whether an elephant trunk in a small-calibre lumen can cause haemolysis. Inpatient and outpatient records were retrospectively reviewed. Two cases of haemolytic anaemia after aortic surgery using the elephant trunk technique were identified from 2011 to 2013. A 64-year-old man, who underwent graft replacement of the ascending aorta for acute Stanford type A aortic dissection, presented with enlargement of the chronic dissection of the descending aorta and moderate aortic regurgitation. A two-stage surgery was scheduled. Total arch replacement with an elephant trunk in the true lumen and concomitant aortic valve replacement were performed. Postoperatively, he developed severe haemolytic anaemia because of the folded elephant trunk. The anaemia improved after the second surgery, including graft replacement of the descending aorta. Similarly, a 61-year-old man, who underwent total arch replacement for acute Stanford type A aortic dissection, presented with enlargement of the chronic dissection of the descending aorta. Graft replacement of the descending aorta with an elephant trunk inserted into the true lumen was performed. The patient postoperatively developed haemolytic anaemia because of the folded elephant trunk, which improved after additional stent grafting into the elephant trunk. A folded elephant trunk in a small-calibre lumen can cause haemolysis. Therefore, inserting an elephant trunk in a small-calibre true lumen during surgery for chronic aortic dissection should be avoided. © The Author 2014. Published by Oxford University Press on behalf of the European Association for Cardio-Thoracic Surgery. All rights reserved.

Current Trends in Associate Degree Nursing Programs.

Science.gov (United States)

Blackstone, Elaine Grant

This study was designed to ascertain current trends in associate degree nursing programs and to discover innovative ideas and techniques which could be applied to the existing program at Miami-Dade Community College (Florida). Data was compiled from interviews with representatives of ten associate degree nursing programs in six states. Information…

True Nature of Supply Network Communication Structure (P.1-14

Directory of Open Access Journals (Sweden)

Lokhman Hakim bin Osman

2017-02-01

Full Text Available Globalization of world economy has altered the definition of organizational structure. Global supply chain can no longer be viewed as an arm-length structure. It has become more complex. The complexity demands deeper research and understanding. This research analyzed a structure of supply network in an attempt to elucidate the true structure of the supply network. Using the quantitative Social Network Analysis methodology, findings of this study indicated that, the structure of the supply network differs depending on the types of network relations. An important implication of these findings would be a more focus resource management upon network relationship development that is based on firms’ positions in the different network structure. This research also contributes to the various strategies of effective and efficient supply chain management.Keywords: Supply Chain Management, Network Studies, Inter-Organizational Relations, Social Capital

Development and Implementation of Degree Programs in Electric Drive Vehicle Technology

Energy Technology Data Exchange (ETDEWEB)

Ng, Simon [Wayne State Univ., Detroit, MI (United States)

2013-09-30

The Electric-drive Vehicle Engineering (EVE) MS degree and graduate certificate programs have been continuing to make good progress, thanks to the funding and the guidance from DOE grant management group, the support from our University and College administrations, and to valuable inputs and feedback from our Industrial Advisory Board as well as our project partners Macomb Community College and NextEnergy. Table 1 below lists originally proposed Statement of Project Objectives (SOPO), which have all been completed successfully. Our program and course enrollments continue to be good and increasing, as shown in later sections. Our graduating students continue to get good job offers from local EV-related companies. Following the top recommendation from our Industrial Advisory Board, we were fortunate enough to be accepted into the prestigious EcoCAR2 (http://www.ecocar2.org/) North America university design competition, and have been having some modest success with the competition. But most importantly, EcoCAR2 offers the most holistic educational environment for integrating real-world engineering and design with our EVE graduate curriculum. Such integrations include true real-world hands-on course projects based on EcoCAR2 related tasks for the students, and faculty curricular and course improvements based on lessons and best practices learned from EcoCAR2. We are in the third and last year of EcoCAR2, and we have already formed a core group of students in pursuit of EcoCAR”3”, for which the proposal is due in early December.

True Detective Stories: Media Textuality and the Anthology Format between Remediation and Transmedia Narratives

Directory of Open Access Journals (Sweden)

Cristina Demaria

2014-12-01

Full Text Available Through the analysis of the recent HBO first season TV series True Detective (2014-, the essays focuses on the renewed anthology format of contemporary seriality as a way to inscribe the form of the novel in the transmedia imagination and its narrative models. While the first part of the essay concentrates on Media and Literary Studies’ debates on the statute of media texts, their materiality and the transformations of their contents in the participatory and convergent culture of prosumers, the second part is devoted to an in-depth reading of some of the main features of True Detective’s first season: from the ways it remediates many other genres and media, to how – as an audiovisual sychretyc text -  it plays with dialogues, cinematography, music and its temporal, spatial and seeing enunciative strategies and positions in order to construct a (quasidystopic narrative of America as an after-image, or, better, a post-collapse America and its Southern Gothic landscapes. In the lst paragraph, this writing briefly engages with how this particular format of TV series helps developing narrative models that fan we bpages and fanfic archives are still struggling not so much to comprehend, but to actually transform into an expanded textuality  able to tell a more ‘true’ story.

The effects of interaction with the device described by procedural text on recall, true/false, and task performance.

Science.gov (United States)

Diehl, V A; Mills, C B

1995-11-01

In two experiments, subjects interacted to different extents with relevant devices while reading two complex multistep procedural texts and were then tested with task performance time, true/false, and recall measures. While reading, subjects performed the task (read and do), saw the experimenter perform the task (read and see experimenter do), imagined doing the task (read and imagine), looked at the device while reading (read and see), or only read (read only). Van Dijk and Kintsch's (1983) text representation theory led to the prediction that exposure to the task device (in the read-and-do, read-and-see, and read-and-see-experimenter-do conditions) would lead to the development of a stronger situation model and therefore faster task performance, whereas the read-only and read-and-see conditions would lead to a better textbase, and therefore better performance on the true/false and recall tasks. Paivio's (1991) dual coding theory led to the opposite prediction for recall. The results supported the text representation theory with task performance and recall. The read-and-see condition produced consistently good performance on the true/false measure. Amount of text study time contributed to recall performance. These findings support the notion that information available while reading leads to differential development of representations in memory, which, in turn, causes differences in performance on various measures.

Requirements of British universities for higher medical degrees.

OpenAIRE

Johnson, R

1991-01-01

OBJECTIVE--To examine the requirements and opportunities for obtaining a doctor of medicine or master of surgery degree from a university in the United Kingdom other than the graduate's own, particularly in the case of foreign graduates. DESIGN--Review of regulations governing the award of doctor of medicine and master of surgery degrees in British universities. SETTING--All 19 universities in the United Kingdom offering clinical courses. MAIN OUTCOME MEASURE--Availability of degrees to gradu...

Protograph LDPC Codes with Node Degrees at Least 3

Science.gov (United States)

Divsalar, Dariush; Jones, Christopher

2006-01-01

In this paper we present protograph codes with a small number of degree-3 nodes and one high degree node. The iterative decoding threshold for proposed rate 1/2 codes are lower, by about 0.2 dB, than the best known irregular LDPC codes with degree at least 3. The main motivation is to gain linear minimum distance to achieve low error floor. Also to construct rate-compatible protograph-based LDPC codes for fixed block length that simultaneously achieves low iterative decoding threshold and linear minimum distance. We start with a rate 1/2 protograph LDPC code with degree-3 nodes and one high degree node. Higher rate codes are obtained by connecting check nodes with degree-2 non-transmitted nodes. This is equivalent to constraint combining in the protograph. The condition where all constraints are combined corresponds to the highest rate code. This constraint must be connected to nodes of degree at least three for the graph to have linear minimum distance. Thus having node degree at least 3 for rate 1/2 guarantees linear minimum distance property to be preserved for higher rates. Through examples we show that the iterative decoding threshold as low as 0.544 dB can be achieved for small protographs with node degrees at least three. A family of low- to high-rate codes with minimum distance linearly increasing in block size and with capacity-approaching performance thresholds is presented. FPGA simulation results for a few example codes show that the proposed codes perform as predicted.

Authentication of true cinnamon (Cinnamon verum) utilising direct analysis in real time (DART)-QWToF-MS

Science.gov (United States)

The use of cinnamon as a spice and 'avouring agent is widespread throughout the world. Many different species of plants are commonly referred to as ‘cinnamon’. ‘True cinnamon’ refers to the dried inner bark of Cinnamomum verum J. S. Presl (syn. C zeylanicum) (Lauraceae). Other ‘cinnamon’ species, C....

Measurement of target and double-spin asymmetries for the '>e→true'>p→→eπ+(n) reaction in the nucleon resonance region at low $Q^2$

Energy Technology Data Exchange (ETDEWEB)

Zheng, X.; Adhikari, K. P.; Bosted, P.; Deur, A.; Drozdov, V.; El Fassi, L.; Kang, Hyekoo; Kovacs, K.; Kuhn, S.; Long, E.; Phillips, S. K.; Ripani, M.; Slifer, K.; Smith, L. C.; Adikaram, D.; Akbar, Z.; Amaryan, M. J.; Anefalos Pereira, S.; Asryan, G.; Avakian, H.; Badui, R. A.; Ball, J.; Baltzell, N. A.; Battaglieri, M.; Batourine, V.; Bedlinskiy, I.; Biselli, A. S.; Briscoe, W. J.; Bültmann, S.; Burkert, V. D.; Carman, D. S.; Celentano, A.; Chandavar, S.; Charles, G.; Chen, J. -P.; Chetry, T.; Choi, Seonho; Ciullo, G.; Clark, L.; Colaneri, L.; Cole, P. L.; Compton, N.; Contalbrigo, M.; Crede, V.; D' Angelo, A.; Dashyan, N.; De Vita, R.; De Sanctis, E.; Djalali, C.; Dodge, G. E.; Dupre, R.; Egiyan, H.; El Alaoui, A.; Elouadrhiri, L.; Eugenio, P.; Fanchini, E.; Fedotov, G.; Fersch, R.; Filippi, A.; Fleming, J. A.; Gevorgyan, N.; Ghandilyan, Y.; Gilfoyle, G. P.; Giovanetti, K. L.; Girod, F. X.; Gleason, C.; Golovach, E.; Gothe, R. W.; Griffioen, K. A.; Guidal, M.; Guler, N.; Guo, L.; Hanretty, C.; Harrison, N.; Hattawy, M.; Hicks, K.; Holtrop, M.; Hughes, S. M.; Ilieva, Y.; Ireland, D. G.; Ishkhanov, B. S.; Isupov, E. L.; Jenkins, D.; Jiang, H.; Jo, H. S.; Joosten, S.; Keller, D.; Khachatryan, G.; Khandaker, M.; Kim, A.; Kim, W.; Klein, F. J.; Kubarovsky, V.; Lanza, L.; Lenisa, P.; Livingston, K.; MacGregor, I. J. D.; Markov, N.; McKinnon, B.; Mirazita, M.; Mokeev, V.; Movsisyan, A.; Munevar, E.; Munoz Camacho, C.; Murdoch, G.; Nadel-Turonski, P.; Net, L. A.; Ni, A.; Niccolai, S.; Niculescu, G.; Niculescu, I.; Osipenko, M.; Ostrovidov, A. I.; Paolone, M.; Paremuzyan, R.; Park, K.; Pasyuk, E.; Peng, P.; Pisano, S.; Pogorelko, O.; Price, J. W.; Puckett, A. J. R.; Raue, B. A.; Rizzo, A.; Rosner, G.; Rossi, P.; Roy, P.; Sabatié, F.; Salgado, C.; Schumacher, R. A.; Sharabian, Y. G.; Skorodumina, Iu.; Smith, G. D.; Sokhan, D.; Sparveris, N.; Stankovic, I.; Strakovsky, I. I.; Strauch, S.; Taiuti, M.; Tian, Ye; Ungaro, M.; Voskanyan, H.; Voutier, E.; Walford, N. K.; Watts, D. P.; Wei, X.; Weinstein, L. B.; Wood, M. H.; Zachariou, N.; Zhang, J.; Zonta, I.

2016-10-01

We report measurements of target- and double-spin asymmetries for the exclusive channel in the nucleon resonance region at Jefferson Lab using the CEBAF Large Acceptance Spectrometer (CLAS). These asymmetries were extracted from data obtained using a longitudinally polarized NH3 target and a longitudinally polarized electron beam with energies 1.1, 1.3, 2.0, 2.3, and 3.0 GeV. The new results are consistent with previous CLAS publications but are extended to a low Q² range from 0.0065 to 0.35 (GeV/c)². The Q² access was made possible by a custom-built Cherenkov detector that allowed the detection of electrons for scattering angles as low as 6 degrees. These results are compared with the unitary isobar models JANR and MAID, the partial-wave analysis prediction from SAID, and the dynamic model DMT. In many kinematic regions our results, in particular results on the target asymmetry, help to constrain the polarization-dependent components of these models.

Development of a Distributed Breach for the Conical Shock Tube.

Science.gov (United States)

1983-01-01

Ti - «<M’»<Mosm —vocvicocviosm —VO(VI cr»—vo •*— ro cvi ro • * m m is. vo N OO CO OS <c<c<c<c<r<c<coc<c<E<c«<c<c<coc<coi hht-HHI-1-Khhhl- hHhhHh

Structure and origin of the 85 degrees E ridge

Digital Repository Service at National Institute of Oceanography (India)

Ramana, M.V.; Subrahmanyam, V.; Chaubey, A.K.; Ramprasad, T.; Sarma, K.V.L.N.S.; Krishna, K.S.; Desa, M.; Murty, G.P.S.; Subrahmanyam, C

The submerged 85 degrees E Ridge in the Bay of Bengal trends approximately N-S between 19 degrees N and 6 degrees N latitudes. Off the southeast coast of Sri Lanka it takes an arcuate shape and seems to terminate with the northweard extension...

Shrinkage Degree in $L_{2}$ -Rescale Boosting for Regression.

Science.gov (United States)

Xu, Lin; Lin, Shaobo; Wang, Yao; Xu, Zongben

2017-08-01

L 2 -rescale boosting ( L 2 -RBoosting) is a variant of L 2 -Boosting, which can essentially improve the generalization performance of L 2 -Boosting. The key feature of L 2 -RBoosting lies in introducing a shrinkage degree to rescale the ensemble estimate in each iteration. Thus, the shrinkage degree determines the performance of L 2 -RBoosting. The aim of this paper is to develop a concrete analysis concerning how to determine the shrinkage degree in L 2 -RBoosting. We propose two feasible ways to select the shrinkage degree. The first one is to parameterize the shrinkage degree and the other one is to develop a data-driven approach. After rigorously analyzing the importance of the shrinkage degree in L 2 -RBoosting, we compare the pros and cons of the proposed methods. We find that although these approaches can reach the same learning rates, the structure of the final estimator of the parameterized approach is better, which sometimes yields a better generalization capability when the number of sample is finite. With this, we recommend to parameterize the shrinkage degree of L 2 -RBoosting. We also present an adaptive parameter-selection strategy for shrinkage degree and verify its feasibility through both theoretical analysis and numerical verification. The obtained results enhance the understanding of L 2 -RBoosting and give guidance on how to use it for regression tasks.

True pancreaticoduodenal artery aneurysms: A decision analysis

International Nuclear Information System (INIS)

Takao, Hidemasa; Nojo, Takeshi; Ohtomo, Kuni

2010-01-01

Purpose: True pancreaticoduodenal artery aneurysms are rare. No definitive study evaluating the natural history of these lesions or their preferred method of treatment has been published. The purpose of this study was to evaluate the outcome of preventive treatment of unruptured pancreaticoduodenal artery aneurysms using a Markov model. Materials and methods: With the use of a Markov model, we performed a decision analysis to evaluate the outcome of preventive treatment of unruptured pancreaticoduodenal artery aneurysms. The risk of rupture and the mortality of preventive treatment are unknown. Therefore, we performed sensitivity analysis using these parameters. Effectiveness was measured in life expectancy. Results: For 80-year-old patients, preventive treatment was dominated by no treatment if mortality rates of preventive treatment were greater than 1.4%, greater than 2.6%, greater than 3.8%, and greater than 4.8% at annual rupture rates of 1%, 2%, 3%, and 4%, respectively. For 50-year-old patients, preventive treatment was dominated by no treatment if mortality rates of preventive treatment were greater than 3.3%, greater than 5.9%, greater than 8.0%, and greater than 9.7% at annual rupture rates of 1%, 2%, 3%, and 4%, respectively. Conclusion: The effectiveness of preventive treatment of unruptured pancreaticoduodenal artery aneurysms depends on the aneurysm rupture rate, mortality rate of preventive treatment, and patient age. Taking into account the effects of these parameters is important in making treatment decisions.

Maximizing the Spread of Influence via Generalized Degree Discount.

Science.gov (United States)

Wang, Xiaojie; Zhang, Xue; Zhao, Chengli; Yi, Dongyun

2016-01-01

It is a crucial and fundamental issue to identify a small subset of influential spreaders that can control the spreading process in networks. In previous studies, a degree-based heuristic called DegreeDiscount has been shown to effectively identify multiple influential spreaders and has severed as a benchmark method. However, the basic assumption of DegreeDiscount is not adequate, because it treats all the nodes equally without any differences. To consider a general situation in real world networks, a novel heuristic method named GeneralizedDegreeDiscount is proposed in this paper as an effective extension of original method. In our method, the status of a node is defined as a probability of not being influenced by any of its neighbors, and an index generalized discounted degree of one node is presented to measure the expected number of nodes it can influence. Then the spreaders are selected sequentially upon its generalized discounted degree in current network. Empirical experiments are conducted on four real networks, and the results show that the spreaders identified by our approach are more influential than several benchmark methods. Finally, we analyze the relationship between our method and three common degree-based methods.

Dirac's minimum degree condition restricted to claws

NARCIS (Netherlands)

Broersma, Haitze J.; Ryjacek, Z.; Schiermeyer, I.

1997-01-01

Let G be a graph on n 3 vertices. Dirac's minimum degree condition is the condition that all vertices of G have degree at least . This is a well-known sufficient condition for the existence of a Hamilton cycle in G. We give related sufficiency conditions for the existence of a Hamilton cycle or a

A Degree Distribution Optimization Algorithm for Image Transmission

Science.gov (United States)

Jiang, Wei; Yang, Junjie

2016-09-01

Luby Transform (LT) code is the first practical implementation of digital fountain code. The coding behavior of LT code is mainly decided by the degree distribution which determines the relationship between source data and codewords. Two degree distributions are suggested by Luby. They work well in typical situations but not optimally in case of finite encoding symbols. In this work, the degree distribution optimization algorithm is proposed to explore the potential of LT code. Firstly selection scheme of sparse degrees for LT codes is introduced. Then probability distribution is optimized according to the selected degrees. In image transmission, bit stream is sensitive to the channel noise and even a single bit error may cause the loss of synchronization between the encoder and the decoder. Therefore the proposed algorithm is designed for image transmission situation. Moreover, optimal class partition is studied for image transmission with unequal error protection. The experimental results are quite promising. Compared with LT code with robust soliton distribution, the proposed algorithm improves the final quality of recovered images obviously with the same overhead.

Epilogue: degrees of transparency

NARCIS (Netherlands)

Hengeveld, K.

2011-01-01

In this epilogue the results of the analyses of four different languages in the preceding papers are compared. It is shown that the degrees of transparency of these languages can be represented on an implicational scale, and that the features themselves can be ranked on a transparency scale as well.

Degrees of polarization for a quantum field

International Nuclear Information System (INIS)

Sanchez-Soto, L L; Soederholm, J; Yustas, E C; Klimov, A B; Bjoerk, G

2006-01-01

Unpolarized light is invariant with respect to any SU(2) polarization transformation. Since this fully characterizes the set of density matrices representing unpolarized states, we introduce the degree of polarization of a quantum state as its distance to the set of unpolarized states. We discuss different candidates of distance, and show that they induce fundamentally different degrees of polarization

Degree Output in the South, 1975-76: Distribution by Race.

Science.gov (United States)

Mingle, James R.

The first systematic national count of degree output by race is presented for use by institutional curriculum planners to help give students the opportunity to make realistic choices in career planning. Included are summary tables of degree production by level (doctoral, master's, bachelor's, and first-professional degrees awarded); degree changes…

Making Sense of the Combined Degree Experience: The Example of Criminology Double Degrees

Science.gov (United States)

Wimshurst, Kerry; Manning, Matthew

2017-01-01

Little research has been undertaken on student experiences of combined degrees. The few studies report that a considerable number of students experienced difficulty with the contrasting epistemic/disciplinary demands of the component programmes. A mixed-methods approach was employed to explore the experiences of graduates from four double degrees…

First discoveries of z ˜ 6 quasars with the Kilo-Degree Survey and VISTA Kilo-Degree Infrared Galaxy survey

NARCIS (Netherlands)

Venemans, B. P.; Verdoes Kleijn, G. A.; Mwebaze, J.; Valentijn, E. A.; Bañados, E.; Decarli, R.; de Jong, J. T. A.; Findlay, J. R.; Kuijken, K. H.; Barbera, F. La; Mc Farland, John; McMahon, R. G.; Napolitano, N.; Sikkema, G.; Sutherland, W. J.

2015-01-01

We present the results of our first year of quasar search in the ongoing ESO public Kilo-Degree Survey (KiDS) and VISTA Kilo-Degree Infrared Galaxy (VIKING) surveys. These surveys are among the deeper wide-field surveys that can be used to uncover large numbers of z ˜ 6 quasars. This allows us to

Open Pollinated Offspring for Producing Potatoes from True Seed

Directory of Open Access Journals (Sweden)

Golmirzaie, AM.

2004-01-01

Full Text Available Open pollinated (OP offspring offers a cheap propagule for potato production from true seed (TPS. A series of trials in contrasting Peruvian locations including several generations derived by open pollination were carried out to determine the potential of OP for TPS. The results suggest that several generations of OP did not affect the performance of TPS for tuber characteristics. On average, F1 hybrids out-yielded first generation OP offspring, but tuber yield per plot of advanced OP generations (OP5 across locations did not differ significantly from that shown by F1 hybrids. It seems that the effect of potential inbreeding in early OP generations was absent in advanced OP generations, maybe due to selection of heterozygous parents in the preceding generations. Results from sequential harvests showed that initiation and bulking of tubers are slower in advanced generations of OP than in the first OP generation, particularly in the warm tropics. Nonetheless, some OP TPS did not differ significantly for tuber yield across generations, suggesting that farmers may grow commercially selected OP offspring.

Astronautics degrees for the space industry

Science.gov (United States)

Gruntman, M.; Brodsky, R. F.; Erwin, D. A.; Kunc, J. A.

2004-01-01

The Astronautics Program (http://astronautics.usc.edu) of the University of Southern California (USC) offers a full set of undergraduate and graduate degree programs in Aerospace Engineering with emphasis in Astronautics. The Bachelor of Science and Master of Science degree programs in Astronautics combine basic science and engineering classes with specialized classes in space technology. The Certificate in Astronautics targets practicing engineers and scientists who enter space-related fields and/or who want to obtain training in specific space-related areas. Many specialized graduate classes are taught by adjunct faculty working at the leading space companies. The Master of Science degree and Certificate are available entirely through the USC Distance Education Network (DEN). Today, the Internet allows us to reach students anywhere in the world through webcasting. The majority of our graduate students, as well as those pursuing the Certificate, work full time as engineers in the space industry and government research and development centers while earning their degrees. The new world of distance learning presents new challenges and opens new opportunities. Distance learning, and particularly the introduction of webcasting, transform the organization of the graduate program and class delivery. We describe in detail the program's academic focus, student reach, and structure of program components. Program development is illustrated by the student enrollment dynamics and related industrial trends; the lessons learned emphasize the importance of feedback from the students and from the space industry.

Two new species of true morels from Newfoundland and Labrador: cosmopolitan Morchella eohespera and parochial M. laurentiana

Science.gov (United States)

Morphological and molecular phylogenetic studies of true morels (Morchella) in the Canadian province of Newfoundland and Labrador (NL) resulted in the surprising discovery of two undescribed species in the M. elata clade, which we initially distinguished by the informal designations Mel-19 and Mel-3...

Measurement of true ileal digestibility of phosphorus in some feed ingredients for broiler chickens.

Science.gov (United States)

Mutucumarana, R K; Ravindran, V; Ravindran, G; Cowieson, A J

2014-12-01

An experiment was conducted to estimate the true ileal digestibility of P in wheat, sorghum, soybean meal, and corn distiller's dried grains with solubles (DDGS) in broiler chickens. Four semipurified diets were formulated from each ingredient (wheat and sorghum: 236.5, 473, 709.5, and 946 g/kg; soybean meal and corn DDGS: 135, 270, 405, and 540 g/kg) to contain graded concentrations of nonphytate P. The experiment was conducted as a randomized complete block design with 4 weight blocks of 16 cages each (5 birds per cage). A total of 320 21-d-old broilers (Ross 308) were assigned to the 16 test diets with 4 replicates per diet. Apparent ileal digestibility coefficients of P were determined by the indicator method and the linear regression method was used to determine the true P digestibility coefficients. The results showed that the apparent ileal P digestibility coefficients of wheat-based diets were not influenced (P>0.05) by increasing dietary P concentrations, whereas those of diets based on sorghum, soybean meal, and corn DDGS differed (Pdigestibility in broilers fed diets with soybean meal and corn DDGS linearly (Pdigestibility coefficients of wheat, sorghum, soybean meal, and corn DDGS were determined to be 0.464, 0.331, 0.798, and 0.727, respectively. Ileal endogenous P losses in birds fed diets with wheat, soybean meal, and corn DDGS were estimated to be 0.080, 0.609, and 0.418 g/kg DMI, respectively. In birds fed sorghum-based diets, endogenous P losses were estimated to be negative (-0.087 g/kg DMI). True digestible P contents of wheat, sorghum, soybean meal, and corn DDGS were determined to be 1.49, 0.78, 5.16, and 5.94 g/kg, respectively. The corresponding nonphytate P contents in wheat, sorghum, soybean meal, and corn DDGS were 1.11, 0.55, 2.15, and 4.36 g/kg, respectively. These differences between digestible P and nonphytate P contents may be suggestive, at least in part, of overestimation of P digestibility under the calcium-deficient conditions

Registered Nurse (Associate Degree).

Science.gov (United States)

Ohio State Univ., Columbus. Center on Education and Training for Employment.

This document, which is designed for use in developing a tech prep competency profile for the occupation of registered nurse (with an associate degree), lists technical competencies and competency builders for 19 units pertinent to the health technologies cluster in general and 5 units specific to the occupation of registered nurse. The following…

Spontaneous resolution of hemorrhagic polyps of the true vocal fold.

Science.gov (United States)

Klein, Adam M; Lehmann, Marcus; Hapner, Edie R; Johns, Michael M

2009-01-01

Hemorrhagic polyps are the most common benign lesions surgically removed from the vocal folds. Although this modality does offer satisfactory results in most of the cases, there is a subset of polyps that seems to resolve with conservative therapy. This study was performed to examine this subset of polyps. Thirty-four consecutive subjects diagnosed with hemorrhagic polyps of the true vocal fold were retrospectively reviewed to determine the incidence of spontaneous resolution of the lesions with nonsurgical therapy. Sixteen subjects began conservative therapy, consisting of voice therapy and proper vocal hygiene, often while awaiting an optimal personal time for surgical intervention. Of these subjects, nine (56.3%) experienced a resolution of their lesion and symptoms without undergoing surgical therapy. Surgical removal of hemorrhagic polyps is often considered the standard of treatment for these benign lesions. However, these observations support a regimen of voice therapy and observation in select cases.

Adjusted drug treatment is superior to renal sympathetic denervation in patients with true treatment-resistant hypertension.

Science.gov (United States)

Fadl Elmula, Fadl Elmula M; Hoffmann, Pavel; Larstorp, Anne C; Fossum, Eigil; Brekke, Magne; Kjeldsen, Sverre E; Gjønnæss, Eyvind; Hjørnholm, Ulla; Kjaer, Vibeke N; Rostrup, Morten; Os, Ingrid; Stenehjem, Aud; Høieggen, Aud

2014-05-01

We aimed to investigate for the first time the blood pressure (BP)-lowering effect of renal sympathetic denervation (RDN) versus clinically adjusted drug treatment in true treatment-resistant hypertension (TRH) after excluding patients with confounding poor drug adherence. Patients with apparent TRH (n=65) were referred for RDN, and those with secondary and spurious hypertension (n=26) were excluded. TRH was defined as office systolic BP (SBP) >140 mm Hg, despite maximally tolerated doses of ≥3 antihypertensive drugs including a diuretic. In addition, ambulatory daytime SBP >135 mm Hg after witnessed intake of antihypertensive drugs was required, after which 20 patients had normalized BP and were excluded. Patients with true TRH were randomized and underwent RDN (n=9) performed with Symplicity Catheter System versus clinically adjusted drug treatment (n=10). The study was stopped early for ethical reasons because RDN had uncertain BP-lowering effect. Office SBP and diastolic BP in the drug-adjusted group changed from 160±14/88±13 mm Hg (±SD) at baseline to 132±10/77±8 mm Hg at 6 months (P<0.0005 and P=0.02, SBP and diastolic BP, respectively) and in the RDN group from 156±13/91±15 to 148±7/89±8 mm Hg (P=0.42 and P=0.48, SBP and diastolic BP, respectively). SBP and diastolic BP were significantly lower in the drug-adjusted group at 6 months (P=0.002 and P=0.004, respectively), and absolute changes in SBP were larger in the drug-adjusted group (P=0.008). Ambulatory BPs changed in parallel to office BPs. Our data suggest that adjusted drug treatment has superior BP lowering effects compared with RDN in patients with true TRH. Clinical Trial Registration- URL: http://www.clinicaltrials.gov. Unique identifier: NCT01673516.

Glomerular epithelial foot processes in normal man and rats. Distribution of true width and its intra- and inter-individual variation.

Science.gov (United States)

Gundersen, H J; Seefeldt, T; Osterby, R

1980-01-01

The width of individual glomerular epithelial foot processes appears very different on electron micrographs. A method for obtainining distributions of the true width of foot processes from that of their apparent width on electron micrographs has been developed based on geometric probability theory pertaining to a specific geometric model. Analyses of foot process width in humans and rats show a remarkable interindividual invariance implying rigid control and therefore great biological significance of foot process width or a derivative thereof. The very low inter-individual variation of the true width, shown in the present paper, makes it possible to demonstrate slight changes in rather small groups of patients or experimental animals.

Tonsillar pulsatility before and after surgical decompression for children with Chiari malformation type 1: an application for true fast imaging with steady state precession

International Nuclear Information System (INIS)

Radmanesh, Alireza; Greenberg, Jacob K.; Smyth, Matthew D.; Limbrick, David D.; Chatterjee, Arindam; Sharma, Aseem

2015-01-01

We hypothesize that surgical decompression for Chiari malformation type 1 (CM-1) is associated with statistically significant decrease in tonsillar pulsatility and that the degree of pulsatility can be reliably assessed regardless of the experience level of the reader. An Institutional Review Board (IRB)-approved Health Insurance Portability and Accountability Act (HIPAA)-compliant retrospective study was performed on 22 children with CM-1 (8 males; mean age 11.4 years) who had cardiac-gated true-FISP sequence and phase-contrast cerebrospinal fluid (CSF) flow imaging as parts of routine magnetic resonance (MR) imaging before and after surgical decompression. The surgical technique (decompression with or without duraplasty) was recorded for each patient. Three independent radiologists with different experience levels assessed tonsillar pulsatility qualitatively and quantitatively and assessed peritonsillar CSF flow qualitatively. Results were analyzed. To evaluate reliability, Fleiss kappa for multiple raters on categorical variables and intra-class correlation for agreement in pulsatility ratings were calculated. After surgical decompression, the degree of tonsillar pulsatility appreciably decreased, confirmed by t test, both qualitatively (p values <0.001, <0.001, and 0.045 for three readers) and quantitatively (amount of decrease/p value for three readers 0.7 mm/<0.001, 0.7 mm/<0.001, and 0.5 mm/0.022). There was a better agreement among the readers in quantitative assessment of tonsillar pulsatility (kappa 0.753-0.834), compared to qualitative assessment of pulsatility (kappa 0.472-0.496) and qualitative assessment of flow (kappa 0.056 to 0.203). Posterior fossa decompression with duraplasty led to a larger decrease in tonsillar pulsatility, compared to posterior fossa decompression alone. Tonsillar pulsatility in CM-1 is significantly reduced after surgical decompression. Quantitative assessment of tonsillar pulsatility was more reliable across readers than

Tonsillar pulsatility before and after surgical decompression for children with Chiari malformation type 1: an application for true fast imaging with steady state precession

Energy Technology Data Exchange (ETDEWEB)

Radmanesh, Alireza [University of California, San Francisco, Department of Radiology and Biomedical Imaging, San Francisco, CA (United States); Washington University School of Medicine, Mallinckrodt Institute of Radiology, St Louis, MO (United States); Greenberg, Jacob K.; Smyth, Matthew D.; Limbrick, David D. [Washington University School of Medicine, Department of Neurosurgery, St Louis, MO (United States); Chatterjee, Arindam; Sharma, Aseem [Washington University School of Medicine, Mallinckrodt Institute of Radiology, St Louis, MO (United States)

2015-04-01

We hypothesize that surgical decompression for Chiari malformation type 1 (CM-1) is associated with statistically significant decrease in tonsillar pulsatility and that the degree of pulsatility can be reliably assessed regardless of the experience level of the reader. An Institutional Review Board (IRB)-approved Health Insurance Portability and Accountability Act (HIPAA)-compliant retrospective study was performed on 22 children with CM-1 (8 males; mean age 11.4 years) who had cardiac-gated true-FISP sequence and phase-contrast cerebrospinal fluid (CSF) flow imaging as parts of routine magnetic resonance (MR) imaging before and after surgical decompression. The surgical technique (decompression with or without duraplasty) was recorded for each patient. Three independent radiologists with different experience levels assessed tonsillar pulsatility qualitatively and quantitatively and assessed peritonsillar CSF flow qualitatively. Results were analyzed. To evaluate reliability, Fleiss kappa for multiple raters on categorical variables and intra-class correlation for agreement in pulsatility ratings were calculated. After surgical decompression, the degree of tonsillar pulsatility appreciably decreased, confirmed by t test, both qualitatively (p values <0.001, <0.001, and 0.045 for three readers) and quantitatively (amount of decrease/p value for three readers 0.7 mm/<0.001, 0.7 mm/<0.001, and 0.5 mm/0.022). There was a better agreement among the readers in quantitative assessment of tonsillar pulsatility (kappa 0.753-0.834), compared to qualitative assessment of pulsatility (kappa 0.472-0.496) and qualitative assessment of flow (kappa 0.056 to 0.203). Posterior fossa decompression with duraplasty led to a larger decrease in tonsillar pulsatility, compared to posterior fossa decompression alone. Tonsillar pulsatility in CM-1 is significantly reduced after surgical decompression. Quantitative assessment of tonsillar pulsatility was more reliable across readers than

[Study of the reineta protein modifications (Brama australis), put under freezing and storage to -18 degrees C and -30 degrees C].

Science.gov (United States)

Abugoch, Lilian; Quitral, Vilma; Larraín, M Angélica; Vinagre, Julia; Kriukov, Andrei; Chávez, Gloria

2006-12-01

The objective of the present work was to study functional and thermal properties of reineta (Brama australis) frozen meat, analysed by water retention capacity (WRC), gel forming capacity (GFC), texture, emulsifying capacity and differential scanning calorimetry (DSC). For this study, reineta fillets were obtained and extracted by the same conditions, and cutted, packaged, frozen and stored at -18 degrees C and -30 degrees C for 7 months. The results obtained, showed that there were no signifficant differences in the responses to thermal treatment for all the specimens. For samples frozen at -18 degrees C and -30 degrees C, the protein contents were 23.5 + 0.0 and 25.4 + 1.0%, respectively. The WRC values were 0.45 + 0.1 and 1.59 +/- 0.0 g water/g protein, respectively. The gel forming capacity was only present in the fresh samples, whereas the frozen stored ones only form protein aggregates. The emulsifying capacity was between 960 and 1400 g oil / g protein, and the storage time increased this value. The miosin denaturation temperature (Td) and denaturation enthalpy (?H), obtained by DSC, fluctuated between 39.2 +/- 0.5 to 44.8 +/- 0.8 degrees C and 1.12 +/- 0.3 to 0.52 +/- 0.2 J/g, respectively. The actina values were between 71.0 +/- 0.6 to 75.3 +/- 0.5 degrees C and between 0.5 +/- 0.1 to 0.7 +/- 0.1 J/g. Cooperativity decreased as the storage time increased. This is showing a certain degree of protein displacement. The values found by thermal analyses showed a direct relationship with the functional properties, both decreasing with storage time.

Successful flow reduction surgery for a ruptured true posterior communicating artery aneurysm caused by the common carotid artery ligation for epistaxis.

Science.gov (United States)

Yamao, Yukihiro; Takahashi, Jun C; Satow, Tetsu; Iihara, Koji; Miyamoto, Susumu

2014-01-01

Carotid artery occlusion can lead to the development of rare true posterior communicating artery (PCoA) aneurysms because of hemodynamic stress on the PCoA. Surgical treatment of these lesions is challenging. The authors report a case of a true PCoA aneurysm that developed and ruptured 37 years after ligation of the ipsilateral common carotid artery for epistaxis. The lesion was successfully treated with clipping of the distal M1 segment of the middle cerebral artery (MCA) after the occipital artery-radial artery free graft-MCA bypass, which led to extreme reduction in collateral flow through the PCoA. A cortical branch, located just proximal to the obliteration site, functioned as a sufficient flow outlet. The aneurysm shrank, and the patient has been doing well without any symptoms for 5 years after surgery. M1 obliteration combined with high-flow extra-intracranial bypass might be a promising option for a true PCoA aneurysm, and therapeutic design that leaves a sufficient flow outlet on the M1 is mandatory to avoid unexpected occlusion of the M1 and its perforators.

Developing 360 degree feedback system for KINS

Energy Technology Data Exchange (ETDEWEB)

Han, In Soo; Cheon, B. M.; Kim, T. H.; Ryu, J. H. [Chungman National Univ., Daejeon (Korea, Republic of)

2003-12-15

This project aims to investigate the feasibility of a 360 degree feedback systems for KINS and to design guiding rules and structures in implementing that systems. Literature survey, environmental analysis and questionnaire survey were made to ensure that 360 degree feedback is the right tool to improve performance in KINS. That review leads to conclusion that more readiness and careful feasibility review are needed before implementation of 360 degree feedback in KINS. Further the project suggests some guiding rules that can be helpful for successful implementation of that system in KINS. Those include : start with development, experiment with one department, tie it to a clear organization's goal, train everyone involve, make sure to try that system in an atmosphere of trust.

Developing 360 degree feedback system for KINS

International Nuclear Information System (INIS)

Han, In Soo; Cheon, B. M.; Kim, T. H.; Ryu, J. H.

2003-12-01

This project aims to investigate the feasibility of a 360 degree feedback systems for KINS and to design guiding rules and structures in implementing that systems. Literature survey, environmental analysis and questionnaire survey were made to ensure that 360 degree feedback is the right tool to improve performance in KINS. That review leads to conclusion that more readiness and careful feasibility review are needed before implementation of 360 degree feedback in KINS. Further the project suggests some guiding rules that can be helpful for successful implementation of that system in KINS. Those include : start with development, experiment with one department, tie it to a clear organization's goal, train everyone involve, make sure to try that system in an atmosphere of trust

Copula-based modeling of degree-correlated networks

International Nuclear Information System (INIS)

Raschke, Mathias; Schläpfer, Markus; Trantopoulos, Konstantinos

2014-01-01

Dynamical processes on complex networks such as information exchange, innovation diffusion, cascades in financial networks or epidemic spreading are highly affected by their underlying topologies as characterized by, for instance, degree–degree correlations. Here, we introduce the concept of copulas in order to generate random networks with an arbitrary degree distribution and a rich a priori degree–degree correlation (or ‘association’) structure. The accuracy of the proposed formalism and corresponding algorithm is numerically confirmed, while the method is tested on a real-world network of yeast protein–protein interactions. The derived network ensembles can be systematically deployed as proper null models, in order to unfold the complex interplay between the topology of real-world networks and the dynamics on top of them. (paper)

Radiation protection enrollments and degrees, 1979 and 1980

International Nuclear Information System (INIS)

Gove, R.M.; Little, J.R.; Shirley, D.L.

1981-07-01

Public concern over the effects of low-level radiation and other aspects of the use of nuclear energy has grown in recent years, and the demand for radiation protection has continued to increase. Radiation Protection Enrollments and Degrees presents the results of the latest survey of institutions offering degree programs in this field. Students obtaining such degrees are vital to the development of industry, medicine, research, power production, construction, and agriculture. These surveys assist state and federal governments in their search for such personnel

The quest for a true One Health perspective of brucellosis

Science.gov (United States)

One Health is an interdisciplinary collaboration aiming at mitigating risks to human health arising from microorganisms present in non-human animal species, which have the potential to be transmitted and cause disease in humans. Different degrees of scientific collaboration and sectoral integration ...

Health Physics Enrollments and Degrees Survey, 2006 Data

International Nuclear Information System (INIS)

Oak Ridge Institute for Science and Education

2007-01-01

This annual survey collects 2006 data on the number of health physics degrees awarded as well as the number of students enrolled in health physics academic programs. Thirty universities offer health physics degrees; all responded to the survey

Geometric evolution of complex networks with degree correlations

Science.gov (United States)

Murphy, Charles; Allard, Antoine; Laurence, Edward; St-Onge, Guillaume; Dubé, Louis J.

2018-03-01

We present a general class of geometric network growth mechanisms by homogeneous attachment in which the links created at a given time t are distributed homogeneously between a new node and the existing nodes selected uniformly. This is achieved by creating links between nodes uniformly distributed in a homogeneous metric space according to a Fermi-Dirac connection probability with inverse temperature β and general time-dependent chemical potential μ (t ) . The chemical potential limits the spatial extent of newly created links. Using a hidden variable framework, we obtain an analytical expression for the degree sequence and show that μ (t ) can be fixed to yield any given degree distributions, including a scale-free degree distribution. Additionally, we find that depending on the order in which nodes appear in the network—its history—the degree-degree correlations can be tuned to be assortative or disassortative. The effect of the geometry on the structure is investigated through the average clustering coefficient 〈c 〉 . In the thermodynamic limit, we identify a phase transition between a random regime where 〈c 〉→0 when β 0 when β >βc .

IMPORTANCE AND VULNERABILITY OF TRUE AND FAIR VIEW IN THE ROMANIAN ACCOUNTING ENVIRONMENT – CASE STUDY

Directory of Open Access Journals (Sweden)

Matis Dumitru

2012-07-01

Full Text Available This empirical study comprises items related to the operationalization of the concept True and Fair View in day to day accounting issues in Romanian accounting environment, demarche based on which we were interested in assessing the vulnerability of the concept and also the importance attributed by Romanian practitioners. If the vulnerability is high and the importance attributed low, the concept True and Fair View `s importance as an overall basis of accounting is limited, fact that will affect the quality of accounting information. The categories approached were chosen based on their implication related to the operationalization of the concept. The company’s financial directors are responsible for ensuring that the financial statements give True and Fair View and in the same manner the expert accountants must consider it important in order to prepare the financial statements in accordance to its requirements and finally the financial auditors must assess its existence, otherwise if this principle is neglected the companies would consequently present spurious results of their activity. All the categories above asserted that the concept doesn’t have only a symbolic role at the national level and their implication in achieving its requirements can be characterized by a proactive attitude. When it comes to assessing the potential vulnerability of TFV, our respondents agreed that items like legislative ambiguity and accounting estimates have the potential to affect TFV construct in the practical side of accounting.

The Striking Progress of African Americans in Degree Attainments.

Science.gov (United States)

Journal of Blacks in Higher Education, 2002

2002-01-01

While the number of blacks earning bachelor's and master's degrees has risen significantly since 1985, and the number of black doctoral degrees rose 110 percent, the percentage of all degrees awarded to blacks at all levels is far lower than the black percentage of the U.S. population. Black women earn 65.7 percent of all doctorates awarded to…

Multivariate correlation analysis of eye cyclotorsion degree in corneal refractive surgery

Directory of Open Access Journals (Sweden)

Xiao-Guang Niu

2015-06-01

Full Text Available AIM: To explore the correlation between eye cyclotorsion degrees and patient's age, gender, diopter and other factors in corneal refractive surgery. METHODS: A total of 762 wavefront-guided LASIK patients with 1524 eyes were retrospectively analyzed from January 2010 to December 2013 in our hospital. Iris recognition was accomplished successfully and eye cyclotorsion degrees were recorded intraoperatively for all the patients. The correlations between eye cyclotorsion degrees and patient's age, gender, different eye, diopter and the dominant eye or not were statistically analyzed. In which correlation analysis was used to analyze the relationship between eye cyclotorsion degrees and age and diopter, while the correlations with gender, different eye and the dominant eye or not were analyzed using t-test.RESULTS: The eye cyclotorsion degrees of patients were 0 to 9.7 degrees with an average of 3.08±2.22 degrees. Amongst the average cyclotorsion of 444 men with 888 eyes were 3.05±2.26 degrees, 318 women with 636 eyes were 3.12±2.15 degrees and there were no significant differences(t=1.905, P=0.168. The average age of all the patients was 22.6±5.4y. No significant correlation was found between cyclotorsion degrees and age(r=-0.012, P=0.748. The mean spherical equivalent was -4.76±1.77 degrees, and there was no significant correlation between the eye cyclotorsion degrees and spherical equivalent(r=0.017, P=0.633. The mean cylinder was -0.60±0.64 degrees of no significant correlation with eye cyclotorsion degrees(r=-0.004, P=0.910. The cyclotorsion of dominant eyes of all the patients was 3.0±2.17 degrees, and the non-dominant eyes were 3.11±2.12 degrees. No significant differences were found(t=-0.521,P=0.603. CONCLUSION: The eye cyclotorsion degrees occurred in LASIK surgery had no correlation with age, gender, different eye, diopter and the dominant eye or not.

Most probable degree distribution at fixed structural entropy

Indian Academy of Sciences (India)

Here we derive the most probable degree distribution emerging ... the structural entropy of power-law networks is an increasing function of the expo- .... tition function Z of the network as the sum over all degree distributions, with given energy.