Fisica degli atomi e dei nuclei

CERN Document Server

Bernardini, Carlo

1965-01-01

Evidenza della struttura atomica della materia ; le proprietà degli atomi e la meccanica atomica ; gli atomi e le radiazioni elettromagnetiche ; struttura microscopica dello stato gassoso ; struttura microscopica dello stato liquido ; struttura microscopica della stato solido ; proprietà elettriche e magnetiche delle sostanze ; proprietà dei nuclei degli atomi ; le particelle elementari.

Toxicokinetics of diethylene glycol (DEG) in the rat.

Science.gov (United States)

Heilmair, R; Lenk, W; Löhr, D

1993-01-01

Oral doses of 1 and 5 ml/kg 14C-diethylene glycol (DEG) given to rats were rapidly and almost completely absorbed, the invasion constants being 2.95 h-1 and 4.24 h-1. The kinetics of invasion were determined with the method of residuals (Rowland and Tozer 1989) and by reconstruction of the invasion curves according to Kübler (1970). 14C-DEG was rapidly distributed from the blood into the organs and tissues in the order kidneys > brain > spleen > liver > muscle > fat, i.e. the same order as the blood flow. The relative volume of distribution, app. VD, was determined at 298 ml, indicating distribution over the whole body. After oral doses of 1, 5, and 10 ml 14C-DEG/kg 64, 87, and 91% of 14C activity in rat blood disappeared in 12-16 h with a half-life of 3.4 h and the remaining 9, 5, and 4% with half-lives of 39 h, 45 h, and 49 h. A total of 73-96% of 14C activity in blood was excreted with the urine and 0.7-2.2% with the faeces. From the cumulative urinary excretion kinetics half-lives of 6 h were determined for doses of 1 and 5 ml/kg and 10 h for the dose of 10 ml/kg. After doses of 5 ml/kg and 10 ml/kg 14C-DEG semi-logarithmic plots of elimination rate versus time were constant for 5 and 9 h, respectively, indicating that DEG accelerated its renal elimination by inducing osmotic diuresis. Thereafter urinary excretion followed first order kinetics with elimination half-lives of 3.6 h. After oral doses of 5 ml/kg 14C-DEG given to rats of 336 g body weight with an app. VD of 297 ml, the total clearance of 14C activity was determined at 63 ml/h, and the renal clearance of unmetabolized DEG was 66 ml/h. The ratio of ClDEG to Cl(inulin) = 0.64 indicated that DEG and its metabolite 2-hydroxyethoxyacetate (2-HEAA) were reabsorbed from the tubuli into the blood capillaries. DEG produced metabolic acidosis, which was completely balanced after doses of 1 and 5 ml/kg, but doses greater than 10 ml/kg produced non-compensated metabolic acidosis, hydropic degeneration of the

Experimental alteration of R7T7 glass in salt brines at 90 deg C and 150 deg C

International Nuclear Information System (INIS)

Godon, N.; Vernaz, E.; Gin, S.; Beaufort, D.; Thomassin, J.H.

1991-01-01

Static experiments have been developed to investigate the R7T7 glass corrosion in four natural salt brines (brines 1 and 3: pure halite, brines 2 and 4: high Mg, K fluid inclusions rich halite), at 90 deg C and 150 deg C with 0.7 cm -1 S/V ratio and at 11 different running times. Analysis of brines after alteration (pHmeter and ICP) added to a detailed study of the crystalline phases developed at the interface glass-brine (XRD,SEM and Microprobe), showed that the influence of the compositional difference is more important on the nature of the secondary phases formed than on the corrosion rate of the glass. After 91 days of alteration at 150 deg C stady states to be reached (after 40 days at 90 deg C). A long term experiment (1 year) is necessary to confirm this hypothesis. 7 refs., 7 figs., 2 tabs

Global map of lithosphere thermal thickness on a 1 deg x 1 deg grid - digitally available

Science.gov (United States)

Artemieva, Irina

2014-05-01

This presentation reports a 1 deg ×1 deg global thermal model for the continental lithosphere (TC1). The model is digitally available from the author's web-site: www.lithosphere.info. Geotherms for continental terranes of different ages (early Archean to present) are constrained by reliable data on borehole heat flow measurements (Artemieva and Mooney, 2001), checked with the original publications for data quality, and corrected for paleo-temperature effects where needed. These data are supplemented by cratonic geotherms based on xenolith data. Since heat flow measurements cover not more than half of the continents, the remaining areas (ca. 60% of the continents) are filled by the statistical numbers derived from the thermal model constrained by borehole data. Continental geotherms are statistically analyzed as a function of age and are used to estimate lithospheric temperatures in continental regions with no or low quality heat flow data. This analysis requires knowledge of lithosphere age globally. A compilation of tectono-thermal ages of lithospheric terranes on a 1 deg × 1 deg grid forms the basis for the statistical analysis. It shows that, statistically, lithospheric thermal thickness z (in km) depends on tectono-thermal age t (in Ma) as: z=0.04t+93.6. This relationship formed the basis for a global thermal model of the continental lithosphere (TC1). Statistical analysis of continental geotherms also reveals that this relationship holds for the Archean cratons in general, but not in detail. Particularly, thick (more than 250 km) lithosphere is restricted solely to young Archean terranes (3.0-2.6 Ga), while in old Archean cratons (3.6-3.0 Ga) lithospheric roots do not extend deeper than 200-220 km. The TC1 model is presented by a set of maps, which show significant thermal heterogeneity within continental upper mantle. The strongest lateral temperature variations (as large as 800 deg C) are typical of the shallow mantle (depth less than 100 km). A map of the

Neutron damage of silicon detectors at 20 deg C

International Nuclear Information System (INIS)

Bardos, R.; Gorfine, G.; Guy, L.; Moorhead, G.; Taylor, G.; Tovey, S.

1992-01-01

This contribution reports new data on the damage of silicon detectors by low energy (1 MeV) neutrons. The data were taken at the end of 1991. Three exposures of UA2 Inner Silicon detectors were made: at +20 deg C, -15 deg C and -95 deg C. A high neutron flux enabled the required fluences to be achieved in relatively short times. This increases the sensitivity of the experiment to damage types with shorter self-annealing time constants. This note discusses the new data taken at +20 deg C. Analysis of the low temperature exposures is in progress. 5 refs., 15 figs

Microcalorimetric studies on lithium thionyl chloride cells: temperature effects between 25deg C and -40deg C

Energy Technology Data Exchange (ETDEWEB)

Hill, I.R.; Sibbald, A.M.; Donepudi, V.S.; Adams, W.A. (Ottawa Univ., ON (Canada). Electrochemical Science and Technology Centre); Donaldson, G.J. (Dept. of National Defence, Ottawa, ON (Canada))

1992-06-01

Microcalorimetry studies were performed on commercial lithium/thionyl chloride cells to investigate whether there was a change in reaction mechanisms in the temperature range between 25deg C and -40deg C. The entropy change associated with cell discharge was calculated from the calorimetry data and was also determined from the temperature dependence of the open-circuit potential. The entropy changes determined by the two methods are compared and discussed in terms of the electrolyte composition variable. (orig.).

Free tropospheric measurements of CS2 over a 45 deg N to 45 deg S latitude range

Science.gov (United States)

Tucker, B. J.; Maroulis, P. J.; Bandy, A. R.

1985-01-01

The mean value obtained from 52 free tropospheric measurements of CS2 over the 45 deg N-45 deg S latitude range was 5.7 pptv, with standard deviation and standard error of 1.9 and 0.3 pptv, respectively. Large fluctuations in the CS2 concentration are observed which reflect the apparent short atmospheric residence time and inhomogeneities in the surface sources of CS2. The amounts of CS2 in the Northern and Southern Hemispheres are statistically equal.

Evaluation of cartilage surface injuries using 3D-double echo steady state (3D-DESS): Effect of changing flip angle from 40 deg to 90 deg

International Nuclear Information System (INIS)

Moriya, Susumu; Yokobayashi, Tsuneo; Ishikawa, Mitsunori; Miki, Yukio; Kanagaki, Mitsunori; Yamamoto, Akira; Okudaira, Shuzo; Nakamura, Shinichiro

2011-01-01

Background. In magnetic resonance imaging (MRI) with 3D-double-echo steady-state (3D-DESS) sequences, the cartilage-synovial fluid contrast is reported to be better with a flip angle of 90 deg than with the conventional flip angle of 40 deg, and the detection rate of knee cartilage injury may be improved. Purpose. To compare the diagnostic performance and certainty of diagnosis with 3D-DESS images made using two flip angle settings, 40 deg and 90 deg, for knee cartilage surface lesions of Grade 2 or above confirmed by arthroscopy. Material and Methods. Images were obtained with 3D-DESS flip angles of 40 deg and 90 deg at 1.0T in 13 consecutive patients (2 men, 11 women, age range 18-68 years) evaluated for superficial cartilage injury by arthroscopy. Two radiologists classified the presence or absence of cartilage damage of ≥Grade 2 as 'positive (p)' or 'negative (n)', respectively. The rate of agreement with arthroscopic diagnosis was then examined, and the diagnostic performance compared. Diagnostic confidence was assessed scoring the presence or absence of cartilage damage into three categories: 3 = can diagnose with absolute confidence; 2 = can diagnose with a level of certainty as probably present or probably absent; and 1 = cannot make a diagnosis. Results. In a comparison of the rate of agreement between diagnosis by 3D-DESS images and arthroscopy, the rate of agreement was significantly higher and diagnostic performance was better in 90 deg images for the medial femoral condyle only. Diagnostic confidence was significantly better with 90 deg flip angle images than with 40 deg flip angle images for all six cartilage surfaces. Conclusion. In evaluating knee cartilage surface lesions with 3D-DESS sequences, a flip angle setting of 90 deg is more effective than the conventional setting of 40 deg

Evaluation of cartilage surface injuries using 3D-double echo steady state (3D-DESS): Effect of changing flip angle from 40 deg to 90 deg

Energy Technology Data Exchange (ETDEWEB)

Moriya, Susumu; Yokobayashi, Tsuneo; Ishikawa, Mitsunori (Ishikawa Clinic, Kyoto (Japan)), email: smoyari@yahoo.co.jp; Miki, Yukio (Dept. of Radiology, Osaka City Univ. Graduate School of Medicine, Osaka (Japan)); Kanagaki, Mitsunori; Yamamoto, Akira (Dept. of Diagnostic Imaging and Nuclear Medicine, Kyoto Univ., Kyoto (Japan)); Okudaira, Shuzo (Dept. of Orthopaedics, Kyoto Police Hospital, Kyoto (Japan)); Nakamura, Shinichiro (Center for Musculoskeletal Research, Univ. of Tennessee, Knoxville, TN (United States))

2011-12-15

Background. In magnetic resonance imaging (MRI) with 3D-double-echo steady-state (3D-DESS) sequences, the cartilage-synovial fluid contrast is reported to be better with a flip angle of 90 deg than with the conventional flip angle of 40 deg, and the detection rate of knee cartilage injury may be improved. Purpose. To compare the diagnostic performance and certainty of diagnosis with 3D-DESS images made using two flip angle settings, 40 deg and 90 deg, for knee cartilage surface lesions of Grade 2 or above confirmed by arthroscopy. Material and Methods. Images were obtained with 3D-DESS flip angles of 40 deg and 90 deg at 1.0T in 13 consecutive patients (2 men, 11 women, age range 18-68 years) evaluated for superficial cartilage injury by arthroscopy. Two radiologists classified the presence or absence of cartilage damage of >=Grade 2 as 'positive (p)' or 'negative (n)', respectively. The rate of agreement with arthroscopic diagnosis was then examined, and the diagnostic performance compared. Diagnostic confidence was assessed scoring the presence or absence of cartilage damage into three categories: 3 = can diagnose with absolute confidence; 2 = can diagnose with a level of certainty as probably present or probably absent; and 1 = cannot make a diagnosis. Results. In a comparison of the rate of agreement between diagnosis by 3D-DESS images and arthroscopy, the rate of agreement was significantly higher and diagnostic performance was better in 90 deg images for the medial femoral condyle only. Diagnostic confidence was significantly better with 90 deg flip angle images than with 40 deg flip angle images for all six cartilage surfaces. Conclusion. In evaluating knee cartilage surface lesions with 3D-DESS sequences, a flip angle setting of 90 deg is more effective than the conventional setting of 40 deg

Low Temperature (320 deg C and 340 deg C) Creep Crack Growth in Low Alloy Reactor Pressure Vessel Steel

International Nuclear Information System (INIS)

Rui Wu; Sandstroem, Rolf; Seitisleam, Facredin

2004-02-01

Uni-axial creep and creep crack growth (CCG) tests at 320 deg C and 340 deg C as well as post test metallography have been carried out in a low alloy reactor pressure vessel steel (ASTM A508 class 2) having simulated coarse grained heat affected zone microstructure. The CCG behaviour is studied in terms of steady crack growth rate, creep fracture parameter C*, stress intensity factor and reference stress at given testing conditions. It has been found that CCG does occur at both tested temperatures. The lifetimes for the CCG tests are considerably shorter than those for the uni-axial creep tests. This is more pronounced at longer lifetimes or lower stresses. Increasing temperature from 320 deg C to 340 deg C causes a reduction of lifetime by approximately a factor of five and a corresponding increase of steady crack growth rate. For the CCG tests, there are three regions when the crack length is plotted against time. After incubation, the crack grows steadily until it accelerates when rupture is approached. Notable crack growth takes place at later stage of the tests. No creep cavitation is observed and transgranular fracture is dominant for the uni-axial creep specimens. In the CT specimens the cracks propagate intergranularly, independent of temperature and time. Some relations between time to failure, reference stress and steady crack growth rate are found for the CCG tests. A linear extrapolation based on the stress-time results indicates that the reference stress causing failure due to CCG at a given lifetime of 350,000 hours at 320 deg C is clearly lower than both yield and tensile strengths, on which the design stress may have based. Therefore, caution must be taken to prevent premature failure due to low temperature CCG. Both uni-axial and CCG tests on real welded joint at 320 deg C, study of creep damage zone at crack tip as well as numerical simulation are recommended for future work

Temperature dependent dynamics of DegP-trimer: A molecular dynamics study

Directory of Open Access Journals (Sweden)

Nivedita Rai

2015-01-01

Full Text Available DegP is a heat shock protein from high temperature requirement protease A family, which reacts to the environmental stress conditions in an ATP independent way. The objective of the present analysis emerged from the temperature dependent functional diversity of DegP between chaperonic and protease activities at temperatures below and above 28 °C, respectively. DegP is a multimeric protein and the minimal functional unit, DegP-trimer, is of great importance in understanding the DegP pathway. The structural aspects of DegP-trimer with respect to temperature variation have been studied using molecular dynamics simulations (for 100 ns and principal component analysis to highlight the temperature dependent dynamics facilitating its functional diversity. The DegP-trimer revealed a pronounced dynamics at both 280 and 320 K, when compared to the dynamics observed at 300 K. The LA loop is identified as the highly flexible region during dynamics and at extreme temperatures, the residues 46–80 of LA loop express a flip towards right (at 280 and left ( at 320 K with respect to the fixed β-sheet connecting the LA loop of protease for which Phe46 acts as one of the key residues. Such dynamics of LA loop facilitates inter-monomeric interaction with the PDZ1 domain of the neighbouring monomer and explains its active participation when DegP exists as trimer. Hence, the LA loop mediated dynamics of DegP-trimer is expected to provide further insight into the temperature dependent dynamics of DegP towards the understanding of its assembly and functional diversity in the presence of substrate.

Oxidation of Alloy 82 in nominal PWR primary water at 340 deg. C and in hydrogenated steam at 400 deg. C

International Nuclear Information System (INIS)

Chaumun, Elizabeth; Guerre Catherine; Duhamel, Cecilie; Sennour, Mohamed; Curieres, Ian-de

2012-09-01

Nickel-base weld metals are susceptible to stress corrosion cracking (SCC) in Pressurized Water Reactor (PWR) primary water. As tests in laboratory need to last, in some cases, at least several thousand hours to get stress corrosion crack initiation or propagation in simulated primary water, pure hydrogenated steam at 400 deg. C was used to perform accelerated tests. To confirm that these conditions are still representative of primary water conditions, results of oxidation tests of coupons in hydrogenated steam at 400 deg. C and in primary water at 340 deg. C have been compared. Surface oxide layers have been characterized in order to discuss the influence of the temperature and of the media (water or steam). (authors)

True Detective

OpenAIRE

Gajhede, Andreas; Westmark, [No Value; Bantoulidis, Georgios

2016-01-01

This paper examines the HBO’s television-series True Detective, a 2014 crime drama, attempting to point out the central elements of detective-fiction, to be found in its narrative. True Detective narrative is a heavy text with a number of references from various well-known, non-adjacent texts within the field of weird fiction, horror fiction and detective fiction. Therefore, the case study of this research will focus on narratological and literary analysis, in order to discover the predominan...

Very true operators on MTL-algebras

Directory of Open Access Journals (Sweden)

Wang Jun Tao

2016-01-01

Full Text Available The main goal of this paper is to investigate very true MTL-algebras and prove the completeness of the very true MTL-logic. In this paper, the concept of very true operators on MTL-algebras is introduced and some related properties are investigated. Also, conditions for an MTL-algebra to be an MV-algebra and a Gödel algebra are given via this operator. Moreover, very true filters on very true MTL-algebras are studied. In particular, subdirectly irreducible very true MTL-algebras are characterized and an analogous of representation theorem for very true MTL-algebras is proved. Then, the left and right stabilizers of very true MTL-algebras are introduced and some related properties are given. As applications of stabilizer of very true MTL-algebras, we produce a basis for a topology on very true MTL-algebras and show that the generated topology by this basis is Baire, connected, locally connected and separable. Finally, the corresponding logic very true MTL-logic is constructed and the soundness and completeness of this logic are proved based on very true MTL-algebras.

Il teatro degli spiriti.

Directory of Open Access Journals (Sweden)

Chiara Pussetti

2013-07-01

Full Text Available Questo saggio è dedicato a un culto di possessione, in cui tutte ledonne, investite dagli spiriti degli uomini morti prima dell’iniziazione, compiono un percorso iniziatico parallelo a quello maschile, consentendo a queste anime, potenzialmente pericolose, di completare il cammino che non hanno potuto percorrere da vivi e quindi di raggiungere serenamente il mondo dei morti, come antenati protettori del villaggio

Phosphorylation of DegU is essential for activation of amyE ...

Indian Academy of Sciences (India)

Gel filtration chromatography of DegU on Sephacryl. S100 (Methods). The native molecular weight of DegU was determined on a pre-calibrated Sephacryl S-100 ... Transferrin (80kDa), Alcohol Dehydrogenase (150 kDa). All the above markers were loaded individually. Purified DegU. (~1 mg), in a total volume of 1 mL was ...

Molecular transformers in the cell: lessons learned from the DegP protease-chaperone.

Science.gov (United States)

Sawa, Justyna; Heuck, Alexander; Ehrmann, Michael; Clausen, Tim

2010-04-01

Structure-function analysis of DegP revealed a novel mechanism for protease and chaperone regulation. Binding of unfolded proteins induces the oligomer reassembly from the resting hexamer (DegP6) into the functional protease-chaperone DegP12/24. The newly formed cage exhibits the characteristics of a proteolytic folding chamber, shredding those proteins that are severely misfolded while stabilizing and protecting proteins present in their native state. Isolation of native DegP complexes with folded outer membrane proteins (OMPs) highlights the importance of DegP in OMP biogenesis. The encapsulated OMP beta-barrel is significantly stabilized in the hydrophobic chamber of DegP12/24 and thus DegP seems to employ a reciprocal mechanism to those chaperones assisting the folding of water soluble proteins via polar interactions. In addition, we discuss in this review similarities to other complex proteolytic machines that, like DegP, are under control of a substrate-induced or stress-induced oligomer conversion.

Study of elementary mechanisms of creep in uranium as a function of temperature (150 deg. to 760 deg. C) by activation energy measurements

International Nuclear Information System (INIS)

Grenier, P.

1966-06-01

Creep tests were carried out on single crystals and polycrystalline specimens of uranium in both the α and β phases over the temperature range 150 - 760 deg. C. The determination of the activation energy for creep and the study of its variation with temperature made it possible to distinguish various temperature ranges in which one or more elementary mechanisms govern deformation. Micrographic observations after creep and the study of the variation of creep-rate with load support the conclusions. The creep behavior of single crystals is identical with that of polycrystalline material below 325 deg. C. From 325 deg. C to one upper limiting temperature whose value depends on the purity and previous history of the metal, the creep deformation of uranium is controlled by cross-slip. From this limiting temperature up to 520 deg. C, the creep of uranium involves two independent mechanisms operating simultaneously, the movement of screw dislocation by cross-slip and the climbing of edge dislocations out of their slip plane. Between 520 deg. C and the α - β transformation temperature creep in polycrystals is governed by the climb of edge dislocations out of their slip planes, by a pile up mechanism in the case of primary creep and by dipole annihilation in the case of secondary creep. In single crystals creep is dependent on the climb of edge dislocations into pre-existent sub-boundaries and their subsequent rearrangement within these boundaries. In the β phase the creep of polycrystals is governed by the diffusional climb of edge dislocations. Between 450 and 630 deg. C small alloy additions of molybdenum modify the creep characteristics of uranium although the deformation mechanisms involved are analogous to those in the pure metal. (author) [fr

Nitrogen implantation into silicon at 700-1100 deg C

International Nuclear Information System (INIS)

Kachurin, G.A.; Tyschenko, I.E.; Popov, V.P.; Tijs, S.A.; Plotnikov, A.E.

1989-01-01

Nitrogen ions 130-140 kW potential accelerated were implanted in silicon heated up to Ti=700-1100 deg C. Densities of ion current were 1-5 mcA/cm 2 , doses did not exceed 5x10 17 cm -2 . Initial stages of nitride formation in buried layers are investigated by means of Rutherford backscattering, layer-by-layer Augerspctroscopy and electron microscopy. It is determind, that Ti growth from 700 up to 900 deg C is accompanied by essential reduction of defectiveness of silicon near-the-surface layer at nitrogen retention within the limits of the calculation profile of ion ranges. At Ti=900 deg C nitrogen is rather mobile and at ∼5x10 16 cm -2 dose it is drown to α-Si 3 N 4 crystalling extraction in R p range. Beginning from Ti ≅1000 deg C nitrogen is not retained in the furied layer and diffuses to the surface. No essenstial losses of nitrogen due to evaporation or inside diffusion are observed. It is noted, that critical Ti, when nitrogen is accumulated in the buried layer, correspond to critical temperatures, when light ions introduce essential structure distortions. Conclusion is made, that irradition-introduced distortions of structure represent centres of initiation and growth of nitride phase. At 1150 deg C additional annaling during 3 hs nitrogen, occurring outside the stable extraction, is redistributed between th surface and furied layers, sintering in narrow concentration peaks

Field-induced strain memory with non-180 .deg. domain-reorientation control

International Nuclear Information System (INIS)

Kadota, Yoichi; Hosaka, Hiroshi; Morita, Takeshi

2010-01-01

Using non-180 .deg. domain-reorientation control, we propose the strain memory effect in ferroelectric ceramics. Electric fields with asymmetric amplitudes were applied to soft-type lead zirconate titanate (PZT) ceramics, and the strain hysteresis and the polarization loop were measured. The butterfly curve became asymmetric under an electric field with a particular asymmetric amplitude. The asymmetric butterfly curve had two stable strain states at zero electric field. Thus, the strain memory effect was realized as the difference between the two stable strain states. An XRD analysis was carried out to verify the contribution of the non-180 .deg. domain reorientation to the strain memory effect. The non-180 .deg. domain reorientation was determined as the intensity ratio of the (002) to the (200) peak. The strain memory determined from macroscopic strain measurements had a linear relationship to the non-180 .deg. domain volume fraction. This result indicated the origin of the strain memory to be the non-180 .deg. domain reorientation.

Study of elementary mechanisms of creep in uranium as a function of temperature (150 deg. to 760 deg. C) by activation energy measurements; Etude des mecanismes elementaires de deformation par fluage de l'uranium en fonction de la temperature (de 150 deg. a 760 deg. C) par la mesure des energies d'activation

Energy Technology Data Exchange (ETDEWEB)

Grenier, P [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

1967-07-01

Creep tests were carried out on single crystals and polycrystalline specimens of uranium in both the {alpha} and {beta} phases over the temperature range 150 - 760 deg. C. The determination of the activation energy for creep and the study of its variation with temperature made it possible to distinguish various temperature ranges in which one or more elementary mechanisms govern deformation. Micrographic observations after creep and the study of the variation of creep-rate with load support the conclusions. The creep behavior of single crystals is identical with that of polycrystalline material below 325 deg. C. From 325 deg. C to one upper limiting temperature whose value depends on the purity and previous history of the metal, the creep deformation of uranium is controlled by cross-slip. From this limiting temperature up to 520 deg. C, the creep of uranium involves two independent mechanisms operating simultaneously, the movement of screw dislocation by cross-slip and the climbing of edge dislocations out of their slip plane. Between 520 deg. C and the {alpha} - {beta} transformation temperature creep in polycrystals is governed by the climb of edge dislocations out of their slip planes, by a pile up mechanism in the case of primary creep and by dipole annihilation in the case of secondary creep. In single crystals creep is dependent on the climb of edge dislocations into pre-existent sub-boundaries and their subsequent rearrangement within these boundaries. In the {beta} phase the creep of polycrystals is governed by the diffusional climb of edge dislocations. Between 450 and 630 deg. C small alloy additions of molybdenum modify the creep characteristics of uranium although the deformation mechanisms involved are analogous to those in the pure metal. (author) [French] Des essais de fluage a diverses temperatures comprises entre 150 et 760 deg. C ont ete effectues sur des polycristaux et des monocristaux d'uranium, en phase {alpha} et en phase {beta}. La

Precipitate evolution in underaged Al-Mg-Si alloy during thermal cycling between 25 deg. C and 65 deg. C

International Nuclear Information System (INIS)

Uan, J.-Y.; Cho, C.-Y.; Chen, Z.-M.; Lin, J.-K.

2006-01-01

The evolution of metastable precipitates and the aging response in underaged Al-Mg-Si alloy during environmental temperature cycling was investigated using transmission electron microscopy (TEM) and hardness tests. After the alloy underwent thermal cycling between 25 deg. C and 65 deg. C, the hardness tests revealed that hardness decreased slightly, rather than following a concave downward curve, with the cycle times. Needle-shaped G.P. zones transformed during the environmental thermal cycling. The fraction of the zones declined sharply from almost 100% to only approximately 10% after 90 cycles, accompanied by an increase in the fraction of lath-shaped precipitates and the formation of β'' precipitates in the matrix. The precipitate developed with the 25-65 deg. C cycling time as follows: needle-shaped G.P. zones → lath-shaped ppt + β'' ppt + needle-shaped G.P. zones → lath-shaped ppt + β'' ppt + rod-shaped ppt + needle-shaped G.P. zones. Therefore, three or four precipitates coexisted in the underaged alloy following prolonged cycling. The formation of a limited number of β'' precipitates and the presence of a rod-shaped phase in the alloy during environmental temperature cycling reduced the hardness as the cycle time increases

Acquirement of true stress-strain curve using true fracture strain obtained by tensile test and FE analysis

International Nuclear Information System (INIS)

Lee, Kyoung Yoon; Kim, Tae Hyung; Lee, Hyung Yil

2009-01-01

In this work, we predict a true fracture strain using load-displacement curves from tensile test and Finite Element Analysis (FEA), and suggest a method for acquiring true Stress-Strain (SS) curves by predicted fracture strain. We first derived the true SS curve up to necking point from load-displacement curve. As the beginning, the posterior necking part of true SS curve is linearly extrapolated with the slope at necking point. The whole SS curve is then adopted for FE simulation of tensile test. The Bridgman factor or suitable plate correction factors are applied to pre and post FEA. In the load-true strain curve from FEA, the true fracture strain is determined as the matching point to test fracture load. The determined true strain is validated by comparing with test fracture strain. Finally, we complete the true SS curve by combining the prior necking part and linear part, the latter of which connects necking and predicted fracture points.

Acquirement of true stress-strain curve using true fracture strain obtained by tensile test and FE analysis

Energy Technology Data Exchange (ETDEWEB)

Lee, Kyoung Yoon; Kim, Tae Hyung; Lee, Hyung Yil [Sogang University, Seoul (Korea, Republic of)

2009-07-01

In this work, we predict a true fracture strain using load-displacement curves from tensile test and Finite Element Analysis (FEA), and suggest a method for acquiring true Stress-Strain (SS) curves by predicted fracture strain. We first derived the true SS curve up to necking point from load-displacement curve. As the beginning, the posterior necking part of true SS curve is linearly extrapolated with the slope at necking point. The whole SS curve is then adopted for FE simulation of tensile test. The Bridgman factor or suitable plate correction factors are applied to pre and post FEA. In the load-true strain curve from FEA, the true fracture strain is determined as the matching point to test fracture load. The determined true strain is validated by comparing with test fracture strain. Finally, we complete the true SS curve by combining the prior necking part and linear part, the latter of which connects necking and predicted fracture points.

Acquirement of True Stress-strain Curve Using True Fracture Strain Obtained by Tensile Test and FE Analysis

Energy Technology Data Exchange (ETDEWEB)

Lee, Kyoung Yoon; Lee, Hyung Yil [Sogang University, Seoul (Korea, Republic of); Kim, Tae Hyung [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

2009-10-15

In this work, we predict a true fracture strain using load-displacement curves from tensile test and finite element analysis (FEA), and suggest a method for acquiring true stress-strain (SS) curves by predicted fracture strain. We first derived the true SS curve up to necking point from load-displacement curve. As the beginning, the posterior necking part of true SS curve is linearly extrapolated with the slope at necking point. The whole SS curve is then adopted for FE simulation of tensile test. The Bridgman factor or suitable plate correction factors are applied to pre and post FEA. In the load-true strain curve from FEA, the true fracture strain is determined as the matching point to test fracture load. The determined true strain is validated by comparing with test fracture strain. Finally, we complete the true SS curve by combining the prior necking part and linear part, the latter of which connects necking and predicted fracture points.

The hydrolysis of iron(III) and iron(ll) ions between 25 deg C and 375 deg C

Energy Technology Data Exchange (ETDEWEB)

Lewis, Derek

1971-11-15

Some data on the stabilities of the known iron (III) and iron (II) ions are presented, that have been obtained in a theoretical study of the iron-water system at temperatures up to the critical temperature. In this study, estimates of the stability constants of the various ions in dilute solution have been made by a method based on the equations of classical thermodynamics and empirical equations for the change with temperature of ionic heat capacity. The data indicate that hydrolysis increases so rapidly with temperature that the Fe+3 - ion is practically non-existent above about 150 deg C and, except in very acid solutions, the Fe+2 - ion is a relatively minor constituent above about 250 deg C. The most stable of the ions over a wide range of conditions are probably Fe(OH){sub 2}+ , Fe(OH)+ and HFeO{sub 2}-

Cold resistance and metabolic activity of lichens below 0 degC

Science.gov (United States)

Kappen, L.; Schroeter, B.; Scheidegger, C.; Sommerkorn, M.; Hestmark, G.

Laboratory measurements show that lichens are extremely tolerant of freezing stress and of low-temperature exposure. Metabolic activity recovered quickly after severe and extended cold treatment. Experimental results demonstrate also that CO_2 exchange is already active at around -20 degC. The psychrophilic character of polar lichen species is demonstrated by optimum temperatures for net photosynthesis between 0 and 15 degC. In situ measurements show that lichens begin photosynthesizing below 0 degC if the dry thalli receive fresh snow. The lowest temperature measured in active lichens was -17 degC at a continental Antarctic site. The fine structure and the hydration state of photobiont and mycobiont cells were studied by low-temperature scanning electron microscopy (LTSEM) of frozen hydrated specimens. Water potentials of the frozen system are in the range of or even higher than those allowing dry lichens to start photosynthesis by water vapor uptake at +10 degC. The great success of lichens in polar and high alpine regions gives evidence of their physiological adaptation to low temperatures. In general lichens are able to persist through glacial periods, but extended snow cover and glaciation are limiting factors.

Measurement of Doppler effect up to 2000degC at FCA. 1

International Nuclear Information System (INIS)

Oigawa, Hiroyuki; Okajima, Shigeaki; Mukaiyama, Takehiko; Satoh, Kunio; Hishida, Makoto; Hayano, Mutsuhiko; Kudogh, Fumio; Kasahara, Yoshiyuki.

1994-03-01

A new experimental device for the measurement of 238 U Doppler effect up to 2000degC was developed for the Fast Critical Assembly (FCA) of Japan Atomic Energy Research Institute with the intention to improve the Doppler effect analysis at high temperature in fast reactors. The measurement method consists of two different techniques; one is the reactivity worth measurement with using a small sample heated up to 1500degC, the other is the reaction rate measurement with using a foil heated up to 2000degC. In the present work, the development and measurement for the former technique is described. The technique itself had been used in critical assemblies around the world, including FCA, for the measurement up to 800degC. The present new device was developed by improving the old device throughouly to extend the sample temperature up to 1500degC which is hot enough for us to evaluate the Doppler effect in the MOX-fuel fast reactor. (author)

Proteolytic activity of recombinant DegP from Chromohalobacter salexigens BKL5

Directory of Open Access Journals (Sweden)

Dewi Fitriani

2017-09-01

Conclusions: Recombinant DegP from C. salexigens BKL5 showed proteolytic activity when β-casein was used as a substrate. In silico analysis indicated that recombinant DegP had characteristics similar to those of halophilic proteins depending on its amino acid composition.

Creep constitutive equations for a 0.5Cr 0.5 Mo 0.25V ferritic steel in the temperature range 565 deg. C-675 deg. C

International Nuclear Information System (INIS)

Mustata, R.; Hayhurst, D.R.

2005-01-01

A two damage state variable model is used to describe the softening mechanisms, damage initiation and growth for a low alloy ferritic steel 1/2Cr-1/2Mo-1/4V at 565 and 590 deg. C within the Continuum Damage Mechanics framework. The level of complexity of the constitutive equations and the degree of coupling through damage is high and it is difficult to calibrate values of the constitutive constants without recourse to optimisation techniques. A methodology for the analysis of uni-axial experimental data, coupled with a traditional gradient-based optimisation technique, is presented for the unique determination of the constitutive constants. Two sets of experimental data on parent material are used for inversion purposes: at 565 deg. C, c.f. Cane [Cane BJ. Collaborative programme on the corelation of test data for high temperature design of welded steam pipes. Presentation and analysis of the material data. Note No. RD/L/2101N81, March, CEGB Laboratory; 1981]; and, at 590 deg. C, c.f. Miller [Miller DA. Private communication: 'Creep rupture testing of Cr M V pipe steel. ERA Project 63-01-040320009'. Barnwood, Gloucs, UK: British Energy; 2000]. The variation of the constitutive parameters with temperature in the range 565-590 deg. C has been deduced by considering the values of constitutive parameters for the same alloy deduced by Perrin and Hayhurst [Perrin IJ, Hayhurst DR. Creep constitutive equations for a 0.5Cr-0.5Mo-0.25V ferritic steel in the temperature range 600-675 deg. C. J Strain Anal 1996;31:299-314] in the temperature range 620-675 deg. C

Book review. La forma degli animali. Adolf Portmann

Directory of Open Access Journals (Sweden)

Manuel Graziani

2013-09-01

Full Text Available Nel 1931 il biologo Adolf Portmann era già talmente noto a livello internazionale per le sue ricerche da guadagnarsi la cattedra in zoologia nell'università della sua città natale, Basilea, all'età di appena 34 anni. All'attività di docente universitario ha sempre affiancato un'originale riflessione sul significato delle scienze della vita, imponendosi come una delle figure chiave nel dibattito tra biologia teoretica, estetica e antropologia filosofica. La forma degli animali, la sua opera più celebre, si pone al confine tra varie discipline e conserva un grande interesse ancora oggi che il dialogo tra estetica e biologia si è fatto nuovamente intenso. Pubblicata nel 1948 e in forma ampliata nel 1960 (da cui deriva questa prima edizione italiana a cura di Pietro Conte l'opera rappresenta il frutto più maturo delle sue ricerche "interdisciplinari".Un saggio che nasce dall'insoddisfazione nei confronti dei paradigmi scientifici consolidati e che ripropone l'idea morfologica in biologia sulla scorta del pensiero di J. W. Goethe il quale affermava che "tutto ciò che è deve anche dar cenno di sé e mostrarsi". Adolf Portmann è un convinto sostenitore che dalla forma si possano dedurne le complessive caratteristiche interne ed esterne degli animali. Secondo questa prospettiva la peculiare fisionomia dell'organismo dipende dalla congiunzione delle sue parti e dalle loro reciproche funzioni. Tuttavia l'autore non vede nello studio della forma l'alternativa al funzionalismo quanto, piuttosto, il suo necessario bilanciamento come dichiara nell'introduzione: "… per giungere alla conoscenza della vita animale di strade ce ne sono molte, e tutte possono contribuire ad arricchire la nostra esperienza. Questo lavoro si occupa della forma degli animali e si propone di mettere in luce la peculiare natura dell'aspetto visibile. Ci sono persone che si dedicano allo studio degli animali, conoscono moltissime specie, hanno imparato centinaia di nomi e

True bursal pigmented villonodular synovitis

International Nuclear Information System (INIS)

Abdelwahab, Ibrahim Fikry; Kenan, Samuel; Steiner, German C.; Abdul-Quader, Mohammed

2002-01-01

We describe two cases of pigmented villonodular synovitis affecting true bursae. This study was also designed to discuss the term ''pigmented villonodular bursitis'', not confined to true synovial bursae, sometimes creating misunderstanding. (orig.)

Using Paraffin with -10 deg C to 10 deg C Melting Point for Payload Thermal Energy Storage in SpaceX Dragon Trunk

Science.gov (United States)

Choi, Michael K.

2013-01-01

A concept of using paraffin wax phase change material (PCM) with a melting point between -10 deg C and 10 deg C for payload thermal energy storage in a Space Exploration Technologies (SpaceX) Dragon trunk is presented. It overcomes the problem of limited heater power available to a payload with significant radiators when the Dragon is berthed to the International Space Station (ISS). It stores adequate thermal energy to keep a payload warm without power for 6 hours during the transfer from the Dragon to an ExPRESS logistics carrier (ELC) on the ISS.

Rotary balance data for a single-engine agricultural airplane configuration for an angle-of-attack range of 8 deg to 90 deg

Science.gov (United States)

Mulcay, W. J.; Chu, J.

1980-01-01

Aerodynamic characteristics obtained in a helical flow environment utilizing a rotary balance located in the Langley spin tunnel are presented in plotted form for a 1/10 scale single engine agricultural airplane model. The configurations tested include the basic airplane, various wing leading edge and wing tip devices, elevator, aileron, and rudder control settings, and other modifications. Data are presented without analysis for an angle of attack range of 8 deg to 90 deg, and clockwise and counter-clockwise rotations covering a spin coefficient range from 0 to .9.

Keeping warming within the 2 deg. C limit after Copenhagen

International Nuclear Information System (INIS)

Macintosh, Andrew

2010-01-01

The object of the United Nations Climate Change Conference in Copenhagen in December 2009 was to reach an agreement on a new international legal architecture for addressing anthropogenic climate change post-2012. It failed in this endeavour, producing a political agreement in the form of the Copenhagen Accord. The Accord sets an ambitious goal of holding the increase in the global average surface temperature to below 2 deg. C. This paper describes 45 CO 2 -only mitigation scenarios that provide an indication of what would need to be done to stay within the 2 deg. C limit if the international climate negotiations stay on their current path. The results suggest that if developed countries adopt a combined target for 2020 of ≤20% below 1990 levels, global CO 2 emissions would probably have to be reduced by ≥5%/yr, and possibly ≥10%/yr, post-2030 (after a decade transitional period) in order to keep warming to 2 deg. C. If aggressive abatement commitments for 2020 are not forthcoming from all the major emitting countries, the likelihood of warming being kept within the 2 deg. C limit is diminutive.

True bursal pigmented villonodular synovitis

Energy Technology Data Exchange (ETDEWEB)

Abdelwahab, Ibrahim Fikry [Department of Radiology, New York Methodist Hospital, Affiliated with New York Hospital-Cornell Medical Center, Brooklyn, NY (United States); Kenan, Samuel [Department of Orthopedics, New York University Medical Center, NY (United States); Steiner, German C. [Department of Pathology, Hospital for Joint Diseases/Orthopedic Institute, New York, NY (United States); Abdul-Quader, Mohammed [Department of Radiology, New York Presbyterian Hospital, Columbia University, New York, NY (United States)

2002-06-01

We describe two cases of pigmented villonodular synovitis affecting true bursae. This study was also designed to discuss the term ''pigmented villonodular bursitis'', not confined to true synovial bursae, sometimes creating misunderstanding. (orig.)

Material Properties Test to Determine Ultimate Strain and True Stress-True Strain Curves for High Yield Steels

Energy Technology Data Exchange (ETDEWEB)

K.R. Arpin; T.F. Trimble

2003-04-01

This testing was undertaken to develop material true stress-true strain curves for elastic-plastic material behavior for use in performing transient analysis. Based on the conclusions of this test, the true stress-true strain curves derived herein are valid for use in elastic-plastic finite element analysis for structures fabricated from these materials. In addition, for the materials tested herein, the ultimate strain values are greater than those values cited as the limits for the elastic-plastic strain acceptance criteria for transient analysis.

A DegU-P and DegQ-Dependent Regulatory Pathway for the K-state in Bacillus subtilis

Directory of Open Access Journals (Sweden)

Mathieu Miras

2016-11-01

Full Text Available The K-state in the model bacterium Bacillus subtilis is associated with transformability (competence as well as with growth arrest and tolerance for antibiotics. Entry into the K-state is determined by the stochastic activation of the transcription factor ComK and occurs in about ~15% of the population in domesticated strains. Although the upstream mechanisms that regulate the K-state have been intensively studied and are well understood, it has remained unexplained why undomesticated isolates of B. subtilis are poorly transformable compared to their domesticated counterparts. We show here that this is because fewer cells enter the K-state, suggesting that a regulatory pathway limiting entry to the K-state is missing in domesticated strains. We find that loss of this limitation is largely due to an inactivating point mutation in the promoter of degQ. The resulting low level of DegQ decreases the concentration of phosphorylated DegU, which leads to the de-repression of the srfA operon and ultimately to the stabilization of ComK. As a result, more cells reach the threshold concentration of ComK needed to activate the auto-regulatory loop at the comK promoter. In addition, we demonstrate that the activation of srfA transcription in undomesticated strains is transient, turning off abruptly as cells enter the stationary phase. Thus, the K-state and transformability are more transient and less frequently expressed in the undomesticated strains. This limitation is more extreme than appreciated from studies of domesticated strains. Selection has apparently limited both the frequency and the duration of the bistably expressed K-state in wild strains, likely because of the high cost of growth arrest associated with the K-state. Future modeling of K-state regulation and of the fitness advantages and costs of the K-state must take these features into account.

Characterization of Toxoplasma DegP, a rhoptry serine protease crucial for lethal infection in mice.

Directory of Open Access Journals (Sweden)

Gaelle Lentini

Full Text Available During the infection process, Apicomplexa discharge their secretory organelles called micronemes, rhoptries and dense granules to sustain host cell invasion, intracellular replication and to modulate host cell pathways and immune responses. Herein, we describe the Toxoplasma gondii Deg-like serine protein (TgDegP, a rhoptry protein homologous to High temperature requirement A (HtrA or Deg-like family of serine proteases. TgDegP undergoes processing in both types I and II strains as most of the rhoptries proteins. We show that genetic disruption of the degP gene does not impact the parasite lytic cycle in vitro but affects virulence in mice. While in a type I strain DegPI appears dispensable for the establishment of an infection, removal of DegPII in a type II strain dramatically impairs the virulence. Finally, we show that KO-DegPII parasites kill immunodeficient mice as efficiently as the wild-type strain indicating that the protease might be involved in the complex crosstalk that the parasite engaged with the host immune response. Thus, this study unravels a novel rhoptry protein in T. gondii important for the establishment of lethal infection.

Experimental formation of cronstedtite from Cox argillite-iron interaction at decreasing temperature in the 90 deg. C-40 deg. C range

International Nuclear Information System (INIS)

Pignatelli, Isabella; Mosser-Ruck, Regine; Rozsypal, Christophe; Truche, Laurent; Randi, Aurelien; Bartier, Daniele; Cathelineau, Michel; Ghanbaja, Jaafar; Mouton, Ludovic; Michau, Nicolas

2012-01-01

Document available in extended abstract form only. Cronstedtite crystals experimentally formed during a cooling experiment (90 deg.C-40 deg. C) simulating the time-temperature evolution of the iron-clay system around the steel overpacks in nuclear waste disposal, were characterized by XRD, SEM and TEM study. Cronstedtite is a T-O phyllosilicate with general formula (Fe 2+ 3-x Fe 3+ x )(Si 2-x Fe 3+ x )O 5 (OH) 4 , with 0 2 ), Callovo-Oxfordian argillite (COx) of the Paris Basin (with a solution/COx mass ratio of 10) and metal iron (powder and plates, with an iron powder/COx mass ratio of 0.5). This system was put in Teflon-line autoclaves heated at (90±2) deg. C for 6 months; then the temperature was decreased every month by step of 10 deg. C until 40 deg. C. The XRD results on run products clearly show that the T-O phyllosilicates crystallize and replace the predominant clay in the starting argillite, e.g. illite-smectite mixed-layer clays when the experimental temperature decreases. The reflections at 7.1 Angstrom, 4.76 Angstrom, 3.55 Angstrom and 2.73 Angstrom indicate that the T-O phyllosilicate formed is cronstedtite, but this technique is not efficient to determine its polytype. The SEM analyses confirm the presence of cronstedtite and show the morphological evolution of crystals with the temperature. At 90 deg. C three morphologies are recognized: trigonal pyramids and cones with hexagonal or rounded cross-section (Fig. 1), these crystals coexist with hairy berthierine-like minerals, as described by [10] and [12] The three cronstedtite shapes are observed until 70 deg. C and at lower temperatures the pyramidal morphology is dominant. From the energy dispersive X-ray analyses, structural formula of cronstedtite were calculated. The Fe II / Fe III ratio was adjusted to fix the octahedron to 3 in the calculation of the structural formula. Slight differences in the chemical compositions of cronstedtites are noticed: the pyramidal crystals have more Fe 2+ in the

'TrueCoinc' software utility for calculation of the true coincidence correction

International Nuclear Information System (INIS)

Sudar, S.

2002-01-01

The true coincidence correction plays an important role in the overall accuracy of the γ ray spectrometry especially in the case of present-day high volume detectors. The calculation of true coincidence corrections needs detailed nuclear structure information. Recently these data are available in computerized form from the Nuclear Data Centers through the Internet or on a CD-ROM of the Table of Isotopes. The aim has been to develop software for this calculation, using available databases for the levels data. The user has to supply only the parameters of the detector to be used. The new computer program runs under the Windows 95/98 operating system. In the framework of the project a new formula was prepared for calculating the summing out correction and calculation of the intensity of alias lines (sum peaks). The file converter for reading the ENDSF-2 type files was completed. Reading and converting the original ENDSF was added to the program. A computer accessible database of the X rays energies and intensities was created. The X ray emissions were taken in account in the 'summing out' calculation. Calculation of the true coincidence 'summing in' correction was done. The output was arranged to show independently two types of corrections and to calculate the final correction as multiplication of the two. A minimal intensity threshold can be set to show the final list only for the strongest lines. The calculation takes into account all the transitions, independently of the threshold. The program calculates the intensity of X rays (K, L lines). The true coincidence corrections for X rays were calculated. The intensities of the alias γ lines were calculated. (author)

The LCF behaviour of SS AISI 304 in the temperature range between 450 deg. C and 850 deg. C in connection with life time predictions

International Nuclear Information System (INIS)

Bocek, M.; Petersen, C.; Schmitt, R.

The lifetime in high amplitude strain cycling with tensional hold periods is analysed presuming that creep failure damage is life determining. The life fraction rule (LFR) is used to calculate the lifetime consumpted during the dwell period in strain controlled tests as well as during tensional hold time stress cycles. It follows from the present investigation that stress relaxation occurring during the strain hold periods has a dominant influence upon the lifetime. The damage in stress relaxation is calculated by means of the LFR and the results are compared to experiments conducted on Zircaloy-4 (T=600 deg. C) and the austenitic stainless steel Type AISI 304 (T=650 deg. C). From the very good agreement between both it is concluded that under the loading conditions considered, creep failure damage is the main life determining damage contribution. To investigate the contributions of creep and fatigue to failure damage stress controlled experiments were conducted on AISI 304 at 550 deg. C and 850 deg. C. Whereas at the lower temperature (T 0.6 Tsub(s)) the lifetime increased with decreasing R. Therefrom it is concluded that in the case considered for T>0.6 Tsub(s) fatigue damage is not lifetime determining. (author)

Value judgments and the true self.

Science.gov (United States)

Newman, George E; Bloom, Paul; Knobe, Joshua

2014-02-01

The belief that individuals have a "true self" plays an important role in many areas of psychology as well as everyday life. The present studies demonstrate that people have a general tendency to conclude that the true self is fundamentally good--that is, that deep inside every individual, there is something motivating him or her to behave in ways that are virtuous. Study 1 finds that observers are more likely to see a person's true self reflected in behaviors they deem to be morally good than in behaviors they deem to be bad. Study 2 replicates this effect and demonstrates observers' own moral values influence what they judge to be another person's true self. Finally, Study 3 finds that this normative view of the true self is independent of the particular type of mental state (beliefs vs. feelings) that is seen as responsible for an agent's behavior.

Thermal conductivity of fully dense unirradiated UO2: A new formulation from experimental results between 100 deg. C and 2500 deg. C, and associated fundamental properties

International Nuclear Information System (INIS)

Delette, G.; Charles, M.

1997-01-01

The various contributions to the thermal conductivity of UO 2 are first reviewed: contribution from phonons is preponderant up to 1600 deg. C; radiative contribution is negligible in the case of a polycrystalline sample, and is unable to account for the increase in conductivity observed above 1600 deg. C; electronic contribution, which seems patently to be responsible for this increase, is efficient from 1400 deg. C (electron-hole pairs treated as small polarons). Given the lack of decisive arguments on their actual efficiency, it was decided that, for temperatures above 2400 deg. C, neither a possible decrease in the electronic contribution due to vacancies, nor an additional possible contribution from Frenkel pairs would be described. We do not go therefore beyond the above-mentioned electronic contribution. In the light of these considerations, the law established by CEA for the thermal conductivity of unirradiated UO 2 , on the basis of a homogeneous set of measurements between 100 deg. C and 2500 deg. C, has been revised. A least-square method applied to the above measurements was used to derive simultaneously the four adjustable constants of the law which is henceforth proposed: λ = 1/A + BT+C/T 2 exp(-W/kT). The values of A, B, C, and W obtained, have the advantage of giving a better account of the high temperature results compared to the Martin recommendations (which has, by the way, the same physical form as above). Furthermore, this new law allows an extrapolation towards the melting point which is better founded than the earlier CEA law, while still respecting the value of the integrated thermal conductivity up to melting. Finally, various burnup effects (impurities, stoichiometry, etc.) can be formulated in physical terms. Moreover, the values of various fundamental properties connected with the derived constants have been determined: Debye temperature, Grueneisen parameter, Mott-Hubbard energy, electrical conductivity. These values are discussed and

Breast compression and radiation dose in two different mammographic oblique projections: 45 and 60 deg

International Nuclear Information System (INIS)

Brnic, Zoran; Hebrang, Andrija

2001-01-01

Introduction: Standard mammography includes two views, craniocaudal and medio-lateral oblique. Depending on patient's body constitution, central beam angle in mediolateral oblique projection may vary, with 45 deg. being suitable for the majority of patients in routine daily practice. With continuous improvement in X-ray technology and radiographers' training, the risk of radiation induced cancerogenesis is considerably reduced and acceptable when compared to benefit. However, the risk still exists, being cumulative and directly related to absorbed glandular dose. There is no minimal dose of radiation which is absolutely harmless, and every effort to reduce the dose is welcome. In this retrospective study two different angles (45 vs. 60 deg.) of mediolateral oblique view were compared according to radiation dose and efficacy of breast compression. Patients and methods: In 52 women, additional 60 deg. oblique films were done after craniocaudal and mediolateral oblique 45 deg.-films, with the same kVp and positioning technique. Breast thickness, time-current products (mA s) and absorbed doses were compared between 45 deg. - and 60 deg.-films. Subgroups of women with large, small, prominent and pendulous breasts were analyzed separately, following the same methodology as for the whole group. Results: mA s were 11.5% lower and compression 7% better with an angle of 60 deg. than with 45 deg. In the subgroup of women with small breasts, mA s values were 13% lower and compression 9% better with 60 deg. than with 45 deg., while in the subgroup with large breasts, mA s were 9% lower and compression 5% better. In the subgroup of patients with pendulous breasts, mA s values were 12% lower and compression 10% better with 60 deg. than with 45 deg., while in the subgroup with prominent breasts, mA s values were 4% lower and compression 3% better. Absorbed glandular dose was estimated to be approximately 20% lower when an oblique mammogram was done with 60 deg. instead of 45 deg

Ingegneria degli acquiferi

CERN Document Server

Molfetta, Antonio

2012-01-01

Il testo fornisce le conoscenze necessarie per affrontare, con un approccio quantitativo, i molteplici aspetti connessi al flusso delle risorse idriche sotterranee (acque di falda) e alla propagazione e bonifica di contaminanti nei sistemi acquiferi. Vengono illustrate le proprietà fondamentali che definiscono la capacità di immagazzinamento, trasporto e rilascio dell’acqua negli acquiferi, e successivamente, descritte le metodiche per la determinazione di tali parametri tramite l’esecuzione e l’interpretazione di prove di falda, di pozzo e di laboratorio. A partire dalla classificazione chimico fisica-tossicologica dei contaminanti vengono, quindi, analizzati i meccanismi di propagazione e illustrate le soluzioni analitiche dell’equazione del trasporto di massa nei mezzi porosi. L’ultima parte del testo è dedicata alla caratterizzazione e bonifica degli acquiferi contaminati. Il testo è rivolto sia agli studenti universitari, sia ai professionisti che debbano affrontare con un approccio quantit...

Testimonianze di vittime degli anni di piombo

DEFF Research Database (Denmark)

Cecchini, Leonardo

Testimonianze di vittime degli anni di piombo In un articolo pubblicato nel 2008 sulla webzine Nazione indiana Christian Raimo criticava quello che poi Giovanni De Luna qualche anno dopo nel suo libro La Repubblica del dolore (2011) ha chiamato “paradigma vittimario”; cioè la presenza predominante...

Creep properties of EB welded copper overpack at 125-175 deg C

International Nuclear Information System (INIS)

Holmstroem, S.; Salonen, J.; Kinnunen, T.

2012-01-01

Electron Beam welds (EBW) chosen as primary sealing method by Posiva welding the over-pack canister lids of oxygen-free phosphorus micro-alloyed copper (OFP) have been tested for material properties relevant to long term creep life prediction. Creep rupture results are presented for the ruptured 175 deg C tests and for the ongoing long term tests at 150 deg C and 125 deg C. The current status (test time, creep strain and strain rate) of the ongoing tests are reported. The initial (175 deg C) results indicate that the EB welds are weaker than the parent material and that both round bar and spark eroded square test specimens produce weld strengths of about 0.75 at tests durations of 5000 h. The downward trend is however expected to continue for the longer test durations. The creep ductility shows decrease for the longer tests. Life estimates for the EB weld have been calculated at 100 deg C for both 50 and 80 MPa with the so far lowest measured EB weld strength factor (WSF=0.77). The state-of-the-art model on the available data give estimated lives of 21000 and 3000 years correspondingly. However, simulated to the expected temperature profile of the repository service the life fraction reached after 10000 years of service is 1 % and 7 % for the same stress levels. It is though important to remembered that the 80 MPa assumption is very conservative in nature and that the predictions do not take into account relaxation of stresses, further decline of the WSF or anisotropy of the weld and are therefore still to be considered indicative only. It is also to be remembered that there is only limited data in the long term regime for the weldments and that the estimates are based on the few EB data available in the public domain added with the Posiva data of this project. Improvement of the models and predictions are expected from the ongoing 125 deg C and 150 deg C long term tests. (orig.)

Isothermal cross-sections of Hf-Sc-Ga(800 deg C) and Hf-Ti-Ga (750 deg C) phase diagrams

International Nuclear Information System (INIS)

Markiv, V.Ya.; Belyavina, N.N.

1981-01-01

Isothermal cross sections of Hf-Sc-Ga (800 deg C) and Hf-Ti-Ga (750 deg C) state diagrams are plotted. The existence of two ternary Hfsub(0.1-0.8)Scsub(0.9)-sub(0.2)Ga and Hfsub(0.8)Scsub(0.2)Gasub(3) phases is stated in the Hf-Sc-Ga system. The crystal structure of these compounds investigated by the powder method belongs to the structural α-MoB and ZrAl 3 types respectively. Continuous rows of (Hf, Sc 5 Ga 5 , (Hf, Ti)Ga 3 and (Hf, Ti)Ga 2 solid solutions are formed in the investigated systems. Essential quantity of the third component dissolve binary Sc 5 Ga 4 , Sc 2 Ga 3 (15 and 30 at % Hf respectively), Hf 5 Ga 4 , HfGa 2 (20, 10 at. % Sc), Hf 5 Ga 4 , HfGa, Hf 5 Ga 3 , Hf 2 Ga 3 (48, 30, 46, 20 at. % Ti) gallides [ru

Characterization of DegQVh, a serine protease and a protective immunogen from a pathogenic Vibrio harveyi strain.

Science.gov (United States)

Zhang, Wei-wei; Sun, Kun; Cheng, Shuang; Sun, Li

2008-10-01

Vibrio harveyi is an important marine pathogen that can infect a number of aquaculture species. V. harveyi degQ (degQ(Vh)), the gene encoding a DegQ homologue, was cloned from T4, a pathogenic V. harveyi strain isolated from diseased fish. DegQ(Vh) was closely related to the HtrA family members identified in other Vibrio species and could complement the temperature-sensitive phenotype of an Escherichia coli strain defective in degP. Expression of degQ(Vh) in T4 was modulated by temperature, possibly through the sigma(E)-like factor. Enzymatic analyses demonstrated that the recombinant DegQ(Vh) protein expressed in and purified from E. coli was an active serine protease whose activity required the integrity of the catalytic site and the PDZ domains. The optimal temperature and pH of the recombinant DegQ(Vh) protein were 50 degrees C and pH 8.0. A vaccination study indicated that the purified recombinant DegQ(Vh) was a protective immunogen that could confer protection upon fish against infection by V. harveyi. In order to improve the efficiency of DegQ(Vh) as a vaccine, a genetic construct in the form of the plasmid pAQ1 was built, in which the DNA encoding the processed DegQ(Vh) protein was fused with the DNA encoding the secretion region of AgaV, an extracellular beta-agarase. The E. coli strain harboring pAQ1 could express and secrete the chimeric DegQ(Vh) protein into the culture supernatant. Vaccination of fish with viable E. coli expressing chimeric degQ(Vh) significantly (P < 0.001) enhanced the survival of fish against V. harveyi challenge, which was possibly due to the relatively prolonged exposure of the immune system to the recombinant antigen produced constitutively, albeit at a gradually decreasing level, by the carrier strain.

Thermal conductivity of fully dense unirradiated UO{sub 2}: A new formulation from experimental results between 100 deg. C and 2500 deg. C, and associated fundamental properties

Energy Technology Data Exchange (ETDEWEB)

Delette, G; Charles, M [Commissariat a l` Energie Atomique, Grenoble (France)

1997-08-01

The various contributions to the thermal conductivity of UO{sub 2} are first reviewed: contribution from phonons is preponderant up to 1600 deg. C; radiative contribution is negligible in the case of a polycrystalline sample, and is unable to account for the increase in conductivity observed above 1600 deg. C; electronic contribution, which seems patently to be responsible for this increase, is efficient from 1400 deg. C (electron-hole pairs treated as small polarons). Given the lack of decisive arguments on their actual efficiency, it was decided that, for temperatures above 2400 deg. C, neither a possible decrease in the electronic contribution due to vacancies, nor an additional possible contribution from Frenkel pairs would be described. We do not go therefore beyond the above-mentioned electronic contribution. In the light of these considerations, the law established by CEA for the thermal conductivity of unirradiated UO{sub 2}, on the basis of a homogeneous set of measurements between 100 deg. C and 2500 deg. C, has been revised. A least-square method applied to the above measurements was used to derive simultaneously the four adjustable constants of the law which is henceforth proposed: {lambda} = 1/A + BT+C/T{sup 2}exp(-W/kT). The values of A, B, C, and W obtained, have the advantage of giving a better account of the high temperature results compared to the Martin recommendations (which has, by the way, the same physical form as above). Furthermore, this new law allows an extrapolation towards the melting point which is better founded than the earlier CEA law, while still respecting the value of the integrated thermal conductivity up to melting. Finally, various burnup effects (impurities, stoichiometry, etc.) can be formulated in physical terms. Moreover, the values of various fundamental properties connected with the derived constants have been determined: Debye temperature, Grueneisen parameter, Mott-Hubbard energy, electrical conductivity. These values

Phosphorylated DegU Manipulates Cell Fate Differentiation in the Bacillus subtilis Biofilm

Science.gov (United States)

Marlow, Victoria L.; Porter, Michael; Hobley, Laura; Kiley, Taryn B.; Swedlow, Jason R.; Davidson, Fordyce A.

2014-01-01

Cell differentiation is ubiquitous and facilitates division of labor and development. Bacteria are capable of multicellular behaviors that benefit the bacterial community as a whole. A striking example of bacterial differentiation occurs throughout the formation of a biofilm. During Bacillus subtilis biofilm formation, a subpopulation of cells differentiates into a specialized population that synthesizes the exopolysaccharide and the TasA amyloid components of the extracellular matrix. The differentiation process is indirectly controlled by the transcription factor Spo0A that facilitates transcription of the eps and tapA (tasA) operons. DegU is a transcription factor involved in regulating biofilm formation. Here, using a combination of genetics and live single-cell cytological techniques, we define the mechanism of biofilm inhibition at high levels of phosphorylated DegU (DegU∼P) by showing that transcription from the eps and tapA promoter regions is inhibited. Data demonstrating that this is not a direct regulatory event are presented. We demonstrate that DegU∼P controls the frequency with which cells activate transcription from the operons needed for matrix biosynthesis in favor of an off state. Subsequent experimental analysis led us to conclude that DegU∼P functions to increase the level of Spo0A∼P, driving cell fate differentiation toward the terminal developmental process of sporulation. PMID:24123822

Insight into DEG/ENaC channel gating from genetics and structure.

Science.gov (United States)

Eastwood, Amy L; Goodman, Miriam B

2012-10-01

The founding members of the superfamily of DEG/ENaC ion channel proteins are C. elegans proteins that form mechanosensitive channels in touch and pain receptors. For more than a decade, the research community has used mutagenesis to identify motifs that regulate gating. This review integrates insight derived from unbiased in vivo mutagenesis screens with recent crystal structures to develop new models for activation of mechanically gated DEGs.

Patologie sociali, resistenze e difese degli insegnanti nell’istituzione scolastica: Considerazioni cliniche e pedagogiche

Directory of Open Access Journals (Sweden)

Tommaso Fratini

2014-12-01

Full Text Available L’articolo prende in esame il tema di alcune resistenze e difese degli insegnanti all’interno dell’istituzione scolastica. Partendo dall’attuale condizione di emergenza della scuola italiana e rifacendosi al concetto di patologia sociale di Giuseppe Di Chiara, viene argomentato come tali resistenze coprano le angosce persecutorie degli insegnanti nel loro lavoro scolastico quotidiano nel rapporto con gli allievi. L’articolo, tra le varie forme di patologia istituzionale, affronta principalmente il tema di quelle che presiedono alle resistenze degli insegnanti al lavoro introspettivo con il proprio mondo interno, conseguenza e ulteriore cagione di sensi di colpa nel rapporto con gli allievi e di fenomeni di burnout lavorativo degli stessi insegnanti. Tali fenomeni vanno nella direzione del rinforzo sia di un atteggiamento di chiusura verso la collaborazione con professionisti esterni all’istituzione scolastica, sia di un atteggiamento di minore empatia e vicinanza emotiva con la realtà interna degli allievi.

Control of growth mode in SrTiO3 homoepitaxy under 500 deg. C

International Nuclear Information System (INIS)

Li Yanrong; Li Jinlong; Zhang Ying; Wei Xianhua; Deng Xinwu; Liu Xingzhao

2004-01-01

Homoepitaxial SrTiO 3 thin films were grown by laser molecular beam epitaxy. The growth mode was determined by in-situ reflective high energy electron diffraction, and the surface of the films was studied by ex-situ atomic force microscopy. At the deposition rate of 0.16A ring /sec and the laser energy density of 6J/cm 2 , layer-by-layer growth was observed above 460 deg. C substrate temperature, while the Stranski-Krastanov growth mode, that is layer-by-layer growth plus island growth mode, prevailed between 460 deg. C and 410 deg. C. On further decreasing the substrate temperature, the island growth was determined under 410 deg. C. With the optimization of deposition process in terms of laser energy density and deposition rate, the lowest crystallization temperatures of SrTiO 3 films grown in layer-by-layer growth mode were obtained as low as 280 deg. C. The effects of laser energy density on growth temperature were studied

Behavior of ferritic/martensitic steels after n-irradiation at 200 and 300 deg. C

International Nuclear Information System (INIS)

Matijasevic, M.; Lucon, E.; Almazouzi, A.

2008-01-01

High chromium ferritic/martensitic (F/M) steels are considered as the most promising structural materials for accelerator driven systems (ADS). One drawback that needs to be quantified is the significant hardening and embrittlement caused by neutron irradiation at low temperatures with production of spallation elements. In this paper irradiation effects on the mechanical properties of F/M steels have been studied and comparisons are provided between two ferritic/martensitic steels, namely T91 and EUROFER97. Both materials have been irradiated in the BR2 reactor of SCK-CEN/Mol at 300 deg. C up to doses ranging from 0.06 to 1.5 dpa. Tensile tests results obtained between -160 deg. C and 300 deg. C clearly show irradiation hardening (increase of yield and ultimate tensile strengths), as well as reduction of uniform and total elongation. Irradiation effects for EUROFER97 starting from 0.6 dpa are more pronounced compared to T91, showing a significant decrease in work hardening. The results are compared to our latest data that were obtained within a previous program (SPIRE), where T91 had also been irradiated in BR2 at 200 deg. C (up to 2.6 dpa), and tested between -170 deg. C and 300 deg. C. Irradiation effects at lower irradiation temperatures are more significant

Phase relationship in AL-Cu-Sc alloys at 450-500 deg C

International Nuclear Information System (INIS)

Kharakterova, M.L.

1991-01-01

Al-Cu-Sc alloys containing up to 40% Cu and up to 6% Sc at 450 deg C and 500 deg C are studied using light microscopy, X-ray-spectral microanalysis, X-ray diffraction analysis, scanning electron microscopy, measurement of microhardness and electric resistance. It is determined, that in equilibrium with aluminium solid solution under the given temperature ther are Al 3 Sc, CuAl 2 phases of the respective binary systems and W (ScCu 6.6-4 Al 5.4-8 ) ternary phase. Isothermal cross sections of Al-Cu-Sc system at 450 and 500 deg C are plotted. Microhardness of equilibrium phases is measured. Combined solubility of copper and scandium in aluminium is determined

Radiolysis of cesium iodide solutions at 35 and 85 deg C

International Nuclear Information System (INIS)

Lucas, M.

1981-09-01

An aqueous solution of cesium iodide was irradiated by the gamma rays from a cobalt 60 source with a dose rate of 0.4 Mrad/hr. At 35 deg C the iodide I - is oxidized in molecular iodine I 2 but at 85 deg C the iodate IO 3 - is obtained. The aim of this work is the study of aerosols behaviour released in accidental situation of a PWR in presence of steam [fr

Tirocinio e videomentoring: il punto di vista degli studenti

Directory of Open Access Journals (Sweden)

Carla Maltinti

2015-12-01

Full Text Available Il presente contributo analizza i commenti espressi dagli studenti del Corso di Studi in Scienze della Formazione Primaria dell’Università di Firenze dopo aver partecipato al primo anno di un nuovo percorso di tirocinio integrato da videomentoring.I feedback forniti dai tirocinanti sono stati esaminati con un duplice scopo: (i acquisire i giudizi, le percezioni, le emozioni degli studenti in rapporto all’esperienza effettuata; (ii ricavarne indicazioni per migliorare la proposta formativa.I dati raccolti, analizzati attraverso una content analysis, toccano aspetti fondamentali della formazione iniziale degli insegnanti, quali il modellamento, l’importanza del rapporto con il tutor, la riflessività, l’imbarazzo dei tirocinanti nel vedersi in azione.

submitter Technical Note: Using DEG-CPCs at upper tropospheric temperatures

CERN Document Server

Wimmer, D; Nieminen, T; Duplissy, J; Ehrhart, S; Almeida, J; Rondo, L; Franchin, A; Kreissl, F; Bianchi, F; Manninen, H E; Kulmala, M; Curtius, J; Petäjä, T

2015-01-01

Over the last few years, several condensation particle counters (CPCs) capable of measuring in the sub-3 nm size range have been developed. Here we study the performance of CPCs based on diethylene glycol (DEG) at different temperatures during Cosmics Leaving OUtdoor Droplets (CLOUD) measurements at CERN. The data shown here are the first set of verification measurements for sub-3 nm CPCs under upper tropospheric temperatures using atmospherically relevant aerosol particles. To put the results in perspective we calibrated the DEG-CPC at room temperature, resulting in a cut-off diameter of 1.4 nm. All diameters refer to mobility equivalent diameters in this paper. At upper tropospheric temperatures ranging from 246.15 K to 207.15 K, we found cut-off sizes relative to a particle size magnifier in the range of 2.5 to 2.8 nm. Due to low number concentration after size classification, the cut-off diameters have a high uncertainty (±0.3 nm) associated with them. Operating two laminar flow DEG-CPCs with different c...

La valutazione degli investimenti finanziati tramite equity crowdfunding

OpenAIRE

Zanetti, Laura

2015-01-01

Evoluzione e dimensione del crowdfunding, La valutazione e strutturazione dell’investimento tramite equity crowdfunding, Valutazioni implicite nelle raccolte fondi in equity crowdfunding, Peculiarità specifiche dell’equity crowdfunding, Un confronto con la bolla valutativa delle aziende internet degli anni 2000

Distance and total column density to the periodic radio star LSI + 61 deg 303

International Nuclear Information System (INIS)

Frail, D.A.; Hjellming, R.M.

1991-01-01

New observations toward the periodic radio star LSI + 61 deg 303 in the lines of H I at 21 cm and CO-18 at 2.7 mm are reported. Using the kinematic method, H I observations are interpreted in terms of the two-armed spiral shock model of Roberts (1972) to derive a distance to LSI + 61 deg 303 of 2.0 + or - 0.2 kpc. The results clearly show the presence of the Perseus arm shock and locate LSI + 61 deg 303 between this shock and the more distant postshock gas. In addition, by using the H I and CO-18 data, the total neutral and molecular gas column density is derived along the line of sight toward LSI + 61 deg 303. 32 refs

Wind-tunnel investigation of the flow correction for a model-mounted angle of attack sensor at angles of attack from -10 deg to 110 deg. [Langley 12-foot low speed wind tunnel test

Science.gov (United States)

Moul, T. M.

1979-01-01

A preliminary wind tunnel investigation was undertaken to determine the flow correction for a vane angle of attack sensor over an angle of attack range from -10 deg to 110 deg. The sensor was mounted ahead of the wing on a 1/5 scale model of a general aviation airplane. It was shown that the flow correction was substantial, reaching about 15 deg at an angle of attack of 90 deg. The flow correction was found to increase as the sensor was moved closer to the wing or closer to the fuselage. The experimentally determined slope of the flow correction versus the measured angle of attack below the stall angle of attack agreed closely with the slope of flight data from a similar full scale airplane.

Measurement of true density

International Nuclear Information System (INIS)

Carr-Brion, K.G.; Keen, E.F.

1982-01-01

System for determining the true density of a fluent mixture such as a liquid slurry, containing entrained gas, such as air comprises a restriction in pipe through which at least a part of the mixture is passed. Density measuring means such as gamma-ray detectors and source measure the apparent density of the mixture before and after its passage through the restriction. Solid-state pressure measuring devices are arranged to measure the pressure in the mixture before and after its passage through the restriction. Calculating means, such as a programmed microprocessor, determine the true density from these measurements using relationships given in the description. (author)

Pourbaix diagrams for the system copper-chlorine at 5-100 deg C

International Nuclear Information System (INIS)

Beverskog, B.; Puigdomenech, I.

1998-04-01

Pourbaix diagrams for the copper-chlorine system in the temperature interval 5-100 deg C have been revised. Predominance diagrams for dissolved copper containing species have also been calculated. Two different total concentrations of each dissolved element, 10 -4 and 10 -6 molal for copper and 0.2 and 1.5 molal for chlorine have been used in the calculations. Chloride is the predominating chlorine species in aqueous solutions. Presence of chloride increases the corrosion regions of copper at the expense of the immunity and passivity regions in the Pourbaix diagrams. CuCl 2 · 3Cu(OH) 2 is the only copper-chloride solid phase that forms at the concentrations of chlorine studied. However, its stability area decreases with increasing temperature. The ion CuCl 2 - predominates at all temperatures at [Cl(aq)] tot =0.2 molal and this reduces the immunity and passivity areas. A corrosion region exists between the immunity and passivity regions at 100 deg C at [Cu(aq)] tot =10 -6 and [Cl(aq)] tot =0.2 molal. At the chlorine concentration of 1.5 molal the corrosion region exists in the whole temperature range investigated. The ion CuCl 3 2- predominates at 5-25 and 100 deg C, while CuCl 2 - predominates at 50-80 deg C at [Cl(aq)] tot= 1-5 molal. A copper concentration of 10 -4 molal reduces the corrosion areas due to expansion of the immunity and passivity areas. However, a corrosion region still exists between the immunity and passivity regions at all investigated temperatures at pH Τ -6 molal and the chloride concentration of 0.2 molal. However, at 80-100 deg C the equilibrium potentials postulated for the Swedish nuclear repository are dangerously close to a corrosion situation. According to our calculations the copper canisters in the Swedish repository corrode at 80-100 deg C at the chloride concentration of 1.5 molal

Frictional property of glass-like carbon heat-treated at 1000-3000 deg. C

International Nuclear Information System (INIS)

Nakamura, Kazumasa; Sano, Takanori; Shindo, Hitoshi

2008-01-01

Frictional coefficient 'f' was measured in the air and in water at glass-like carbon (GLC) surfaces heat-treated between 1000 and 3000 deg. C. GLCs heat-treated at higher temperature had smoother and more hydrophobic faces, and lower f. The f was smaller than 0.10 for GLCs heat-treated at and above 2000 deg. C, which indicates their applicability as a solid lubricant or a self-lubricating material. The f = 0.06 observed for GLC heat-treated at 3000 deg. C was nearly the same as that of pyrolytic graphite (PG). Slightly lower f's were obtained in water than in the air

ETBP (Extended True Boiling Point) curve extension of extra heavy crudes; Extensao da curva PEV (Ponto de Ebulicao Verdadeiro) de petroleos extrapesados por destilacao molecular e ampliacao da caracterizacao

Energy Technology Data Exchange (ETDEWEB)

Rocha, Rodrigo S.; Batistella, Cesar B.; Maciel, Maria Regina W.; Maciel Filho, Rubens [Universidade Estadual de Campinas (UNICAMP), SP (Brazil). Faculdade de Engenharia Quimica; Medina, Lilian C. [PETROBRAS S.A., Rio de Janeiro, RJ (Brazil). Centro de Pesquisas (CENPES)

2008-07-01

For the determination of the TBP (True Boiling Point) Curve, which defines the yield of petroleum products, the ASTM D2892 method for petroleum distillation and ASTM D5236 method for vacuum distillation of heavy hydrocarbons were applied. Furthermore, from these distillations, cuts that are submitted to several analyses to determine its physical-chemical properties are obtained, and all this information generates the evaluation of petroleum. For heavy petroleum, these conventional methods have been limited, since the total distilled percentage determined for temperatures up to 565 deg C (maximum reached with ASTM D5236 method) is lower for these oils, reducing the points of the curve, limiting its information. To improve this data set for heavy oils, a methodology for the extension of TBP curve through molecular distillation was established. It was possible to reach values up to 700 deg C, representing a considerable progress for the extension of TBP curve. The objective of this work is to present the results of Extended TBP curve for a heavy petroleum and characterization carried out through the cuts and residues obtained in molecular distillation of the residue 'Zeta' 400 deg C+ (fancy name), made by ASTM D2892 method. (author)

DEG/ENaC ion channels involved in sensory transduction are modulated by cold temperature

Science.gov (United States)

Askwith, Candice C.; Benson, Christopher J.; Welsh, Michael J.; Snyder, Peter M.

2001-01-01

Several DEG/ENaC cation channel subunits are expressed in the tongue and in cutaneous sensory neurons, where they are postulated to function as receptors for salt and sour taste and for touch. Because these tissues are exposed to large temperature variations, we examined how temperature affects DEG/ENaC channel function. We found that cold temperature markedly increased the constitutively active Na+ currents generated by epithelial Na+ channels (ENaC). Half-maximal stimulation occurred at 25°C. Cold temperature did not induce current from other DEG/ENaC family members (BNC1, ASIC, and DRASIC). However, when these channels were activated by acid, cold temperature potentiated the currents by slowing the rate of desensitization. Potentiation was abolished by a “Deg” mutation that alters channel gating. Temperature changes in the physiologic range had prominent effects on current in cells heterologously expressing acid-gated DEG/ENaC channels, as well as in dorsal root ganglion sensory neurons. The finding that cold temperature modulates DEG/ENaC channel function may provide a molecular explanation for the widely recognized ability of temperature to modify taste sensation and mechanosensation. PMID:11353858

Deconstructing the mammal species richness pattern in Europe - towards and understanding of the relative importance of climate, biogeographic history, habitat heterogeneity and humans

DEFF Research Database (Denmark)

Fløjgaard, Camilla; Normand, Signe; Skov, Flemming

2011-01-01

partitioning to assess the importance of macroclimate and HHH variables. The HHH variables included two historical factors, estimated by novel methodologies: (1) ice-age-driven dynamics, represented by accessibility to recolonization from hindcasting-estimated glacial refugia, and (2) biogeographic peninsular...

Data of evolutionary structure change: 1ACLA-1LPOA [Confc[Archive

Lifescience Database Archive (English)

Full Text Available entryIDChain>1ACLA DEQFP-GFSGS > - HHH...O A 1LPOA PEGTYEENLPK ...> HHH> ATOM 474 CA PRO A 65 69.013 60.208 -6.968 1...Chain>A 1LPOA GSASD--KLACL re> --HHHHH...CLA NLNSDEELIHCL > HHHHHHHH

The air oxidation behavior of lanthanum ion implanted zirconium at 500 deg. C

CERN Document Server

Peng, D Q; Chen, X W; Zhou, Q G

2003-01-01

The beneficial effect of lanthanum ion implantation on the oxidation behavior of zirconium at 500 deg. C has been studied. Zirconium specimens were implanted by lanthanum ions using a MEVVA source at energy of 40 keV with a fluence range from 1x10 sup 1 sup 6 to 1x10 sup 1 sup 7 ions/cm sup 2 at maximum temperature of 130 deg. C, The weight gain curves were measured after being oxidized in air at 500 deg. C for 100 min, which showed that a significant improvement was achieved in the oxidation behavior of zirconium ion implanted with lanthanum compared with that of the as-received zirconium. The valence of the oxides in the scale was analyzed by X-ray photoemission spectroscopy; and then the depth distributions of the elements in the surface of the samples were obtained by Auger electron spectroscopy. Glancing angle X-ray diffraction at 0.3 deg. incident angles was employed to examine the modification of its phase transformation because of the lanthanum ion implantation in the oxide films. It was obviously fou...

The True Scholar.

Science.gov (United States)

Bellah, Robert N.

2000-01-01

This essay argues for ethical inquiry as the essence of true scholarship. Individual sections address: pure reason versus ethics, the current "age of money" in the university, rational choice theory, and the fatal flaw in rational choice theory that all human actions cannot be explained by it. (DB)

Environmental oil spill sensitivity atlas for the West Greenland (68 deg.-72 deg. N) coastal zone, 2nd revised edition

Energy Technology Data Exchange (ETDEWEB)

Clausen, D.; Johansen, Kasper L.; Mosbech, A.; Boertmann, D.; Wegeberg, S.

2012-12-15

This oil spill sensitivity atlas covers the shoreline and the offshore areas of West Greenland between 68 deg. N and 72 deg. N. The coastal zone is divided into 199 shoreline segments and the offshore zone into 8 areas. A sensitivity index value is calculated for each segment/area, and each segment/area is subsequently ranked according to four degrees of sensitivity. Besides this general ranking a number of smaller areas are especially selected as they are of particular significance, they are especially vulnerable to oil spills and they have a size making oil spill response possible. The shoreline sensitivity ranking are shown on 37 maps (in scale 1:250,000), which also show the different elements included and the selected areas. Coast types, logistics and proposed response methods along the coasts are shown on another 37 maps. The sensitivities of the offshore zones are depicted on 4 maps, one for each season. Based on all the information, appropriate oil spill response methods have been assessed for each area. (Author)

Your True Freedom

Directory of Open Access Journals (Sweden)

Jena Rausch

2015-02-01

Full Text Available Your True Freedom is about my journey teaching inmates the fundamental truths of self worth, self acceptance and self love--through writing, mindfulness meditation and emotional healing. It is a journey that continues to enlighten me and to heal and free the inmates with whom I work.

Systemic True False

African Journals Online (AJOL)

Preferred Customer

):. (a). (b). (c). (d). Answer: True systemics are (b & c); False Systemics (a & d). For more examples, see (10 and 11). Na2O2. NaCl. Na. HCl heat /excess. (O). 300°C electrolysis. (molten). NaOH. NaCl. Na. HCl. H2O electrolysis. (solution). NaCl.

Quantitative cine-left ventriculography - Superiority of 45 .deg. RAO view to straight AB view -

International Nuclear Information System (INIS)

Lim, Tae Hwan; Han, Man Chung

1981-01-01

The volumetry by cineangiocardiography is known to have the most diagnostic and prognostic value in the evaluation of various valvular heart diseases and ischemic heart diseases. Although many authors favor the area-length method for the volumetry of left ventricle, 45 .deg. RAO projection seems to be more simple, inexpensive and accurate technique, considering the positional relationship of cardiac valves and obliquity of the long axis of left ventricle within the chest cage. Authors present the anatomical, geometrical and radiological basis for the superiority of 45 .deg. RAO protection by analyzing 20 normal heart specimen and 115 cineangiocardiograms of valvular heart diseases, and the results as follows: 1. Blood flow and motility of the mitral and aortic valves can be more clearly demonstrated by 45 .deg. RAO projection than by AP view. 2. The long diameter of left ventricular silhouette made 45 .deg. RAO projection reflects 90% or more of real diameter. 3. In RAO 45 .deg. position, patient's left nipple is optimal and convenient level for the ruler offering accurate magnification coefficient of left ventricle. 4. Ejection fraction after the extrasystole is exaggerated regardless of the left ventricular function, so it is desirable to exclude the 2 or 3 beats after extrasystole

Physical properties of concrete under 3-years exposure to high temperatures up to 110degC

International Nuclear Information System (INIS)

Nishiuchi, T.; Kanazu, T.; Ishida, H.

1990-01-01

Concrete structural members in a storehouse of high level radioactive wastes are designed assuming that they may be subjected to elevated temperature for a long term. So, in this study, concrete properties under temperature conditions (between 65degC-temperature limitation specified in design and 110degC-vaporing temperature of gel water in concrete) and possibility of raising this temperature limitation has been investigated from the view point of long term concrete properties. In this experiment, many properties of concrete were examined, such as compressive strength, tensile strength. Young's modulus, weight loss, pore size distribution under combined conditions (temperature conditions, mix proportions of concrete, moisture conditions). Followings are the main conclusions obtained within the limit of the experiment. 1. Compressive strength of concrete becomes smaller according as temperature becomes high, but there is little difference between the compressive strength at 65degC and 85degC. 2. Young's modulus of concrete decreases linearly according as temperature becomes higher. 3. Weight loss of concrete increases according as temperature becomes higher. 4. Judging from the decreasing rate of physical properties of concrete, it seems possible to raise temperature limitation from 65degC to 85degC. (author)

Ce2O3-SO3-H2O system at 150 and 200 deg C

International Nuclear Information System (INIS)

Belokoskov, V.I.; Trofimov, G.V.; Govorukhina, O.A.

1978-01-01

The solubility, solid phase composition and crystal characteristics in the Ce 2 O 3 -SO 3 -H 2 O system have been studied in a broad range of sulfuric acid concentrations (25 to 80% SO 3 ) at temperatures from 150 to 200 deg C. It has been established that in the system the equilibrium had been reached after 15 to 20 days. At 150 deg C, Ce 2 (SO 4 ) 3 x2H 2 O, Ce 2 (SO 4 ) 3 xH 2 O sulfates and Ce 2 (SO 4 ) 3 x3H 2 SO 4 acid salt crystallize in the system. At 200 deg C, the same sulfates crystallize in the system, except that the bisaturation points of the system are shifted, with respect to 150 deg C, into the region of higher SO 3 concentration and correspond to solutions with a SO 3 concentration of 57.8 and 65%. The solubility of cerium(3) at 150 deg C is about 0.5% Ce 2 O 3 . An increase in temperature up to 200 deg C leads to a slightly higher solubility of cerium sulfates

Pourbaix diagrams for the system copper-chlorine at 5-100 deg C

Energy Technology Data Exchange (ETDEWEB)

Beverskog, B. [Studsvik Material AB, Nykoeping (Sweden); Puigdomenech, I. [Studsvik Eco and Safety AB, Nykoeping (Sweden)

1998-04-01

Pourbaix diagrams for the copper-chlorine system in the temperature interval 5-100 deg C have been revised. Predominance diagrams for dissolved copper containing species have also been calculated. Two different total concentrations of each dissolved element, 10{sup -4} and 10{sup -6} molal for copper and 0.2 and 1.5 molal for chlorine have been used in the calculations. Chloride is the predominating chlorine species in aqueous solutions. Presence of chloride increases the corrosion regions of copper at the expense of the immunity and passivity regions in the Pourbaix diagrams. CuCl{sub 2} {center_dot} 3Cu(OH){sub 2} is the only copper-chloride solid phase that forms at the concentrations of chlorine studied. However, its stability area decreases with increasing temperature. The ion CuCl{sub 2}{sup -} predominates at all temperatures at [Cl(aq)]{sub tot}=0.2 molal and this reduces the immunity and passivity areas. A corrosion region exists between the immunity and passivity regions at 100 deg C at [Cu(aq)]{sub tot}=10{sup -6} and [Cl(aq)]{sub tot}=0.2 molal. At the chlorine concentration of 1.5 molal the corrosion region exists in the whole temperature range investigated. The ion CuCl{sub 3}{sup 2-} predominates at 5-25 and 100 deg C, while CuCl{sub 2}{sup -} predominates at 50-80 deg C at [Cl(aq)]{sub tot=}1-5 molal. A copper concentration of 10{sup -4} molal reduces the corrosion areas due to expansion of the immunity and passivity areas. However, a corrosion region still exists between the immunity and passivity regions at all investigated temperatures at pH{sub {Tau}}<9.5 and 1.5 molal chloride concentration. According to our calculations the copper canisters in the deep nuclear waste repository should not corrode at the copper concentration of 10{sup -6} molal and the chloride concentration of 0.2 molal. However, at 80-100 deg C the equilibrium potentials postulated for the Swedish nuclear repository are dangerously close to a corrosion situation. According to

Tensile properties of Zr-2.5 Nb pressure tube alloy between 25 and 800 degC

International Nuclear Information System (INIS)

Singh, R.N.; Kishore, R.; Sinha, T.K.; Banerjee, S.

2000-10-01

Tensile properties of zirconium-2.5 wt. % niobium pressure tube material were evaluated by uniaxial tension tests at temperatures between 25 and 800 degC and under strain-rates varying from 3.3 x 10 -5 to 3.3 x 10 -3 /s. Tests were carried out on specimens fabricated from the sections of finished (autoclaved) tubes as well as on those machined from the sections of cold worked (2 nd pilgered) tubes. Moreover, specimens fabricated from finished tubes belonging to twenty different heats were tested at 300 degC to study the heat to heat variation in tensile properties of this alloy. In order to study the effect of the crystallographic texture on the tensile properties, specimens oriented in longitudinal as well as, in transverse directions of the tubes were also tested. Results showed that both yield and ultimate tensile strengths of this alloy decreased monotonically with increasing test temperatures, with a rapid fall in strengths above a temperature of 350 degC (623 K). The tensile ductility did not change appreciably up to 400 degC (673K) but increased rapidly above this temperature. The observed results on the temperature dependence of the strength and ductility indicated the possible occurrence of dynamic strain-ageing in this alloy in the temperature range of 200-300 degC (473 to 573 K). The transverse specimens showed higher strengths and lower ductility as compared to those of the longitudinal specimens up to a temperature of 350 degC (623 K). Above 350 degC, the difference in the strengths and the ductility of the two types of the specimens, became negligibly small indicating that the texture did not appreciably influence the tensile properties of this alloy at temperatures exceeding 350 degC. The alloy developed extensive superplasticity (ductility exceeding 100 %), when tested in the temperature range of 650-800 degC. Maximum ductility values of 650 % for longitudinal and 900 % for the transverse orientation with strain-rate sensitivity (m) exceeding 0

The tensile properties of alloys 800H and 617 in the range 20 to 950deg C

International Nuclear Information System (INIS)

Abd El-Azim, M.E.; Ennis, P.J.; Schuster, H.; Nickel, H.

1990-01-01

The tensile properties of Alloy 800H and Alloy 617 in the solution treated condition and after ageing or carburization have been determined for the temperature range 20 to 950deg C. It was found that ageing at 900deg C prior to testing led to an increase in strength and a decrease in ductility at test temperatures up to 700deg C. Above 700deg C, there was no significant difference between the tensile properties of solution treated and aged material. Carburization caused a severe loss of ductility in both alloys at temperatures of 20 to around 800deg C, but the ductility increased sharply at test temperatures above 800deg C, accompanied by a change in the fracture mode from fracture of the carbide particles themselves to void formation and separation at the carbide/matrix interface. The correlation between tensile properties and creep data was investigated in tests carried out at different strain rates. Reasonable agreement was found at 800 to 950deg C for Alloy 617 and at 800 to 900deg C for Alloy 800H. Strain ageing effects were observed in both alloys at some temperatures and strain rates; these effects were serrated flow, negative strain rate sensitivity, peaks in the normalized UTS-temperature curves and plateaus in the elongation-temperature curves. The experimental results were interpreted in the light of two current models for strain ageing, the dislocation-dislocation interaction model and the dislocation-solute interaction model. (orig.) [de

Dynamic Longitudinal and Directional Stability Derivatives for a 45 deg. Sweptback-Wing Airplane Model at Transonic Speeds

Science.gov (United States)

Bielat, Ralph P.; Wiley, Harleth G.

1959-01-01

An investigation was made at transonic speeds to determine some of the dynamic stability derivatives of a 45 deg. sweptback-wing airplane model. The model was sting mounted and was rigidly forced to perform a single-degree-of-freedom angular oscillation in pitch or yaw of +/- 2 deg. The investigation was made for angles of attack alpha, from -4 deg. to 14 deg. throughout most of the transonic speed range for values of reduced-frequency parameter from 0.015 to 0.040 based on wing mean aerodynamic chord and from 0.04 to 0.14 based on wing span. The results show that reduced frequency had only a small effect on the damping-in-pitch derivative and the oscillatory longitudinal stability derivative for all Mach numbers M and angles of attack with the exception of the values of damping coefficient near M = 1.03 and alpha = 8 deg. to 14 deg. In this region, the damping coefficient changed rapidly with reduced frequency and negative values of damping coefficient were measured at low values of reduced frequency. This abrupt variation of pitch damping with reduced frequency was a characteristic of the complete model or wing-body-vertical-tail combination. The damping-in-pitch derivative varied considerably with alpha and M for the horizontal-tail-on and horizontal-tail-off configurations, and the damping was relatively high at angles of attack corresponding to the onset of pitch-up for both configurations. The damping-in-yaw derivative was generally independent of reduced frequency and M at alpha = -4 deg. to 4 deg. At alpha = 8 deg. to 14 deg., the damping derivative increased with an increase in reduced frequency and alpha for the configurations having the wing, whereas the damping derivative was either independent of or decreased with increase in reduced frequency for the configuration without the wing. The oscillatory directional stability derivative for all configurations generally decreased with an increase in the reduced-frequency parameter, and, in some instances

Reclutamento e formazione dei poliziotti: il caso degli ufficiali della gendarmeria francese

Directory of Open Access Journals (Sweden)

François Dieu

2007-04-01

Full Text Available Partendo dal caso degli ufficiali della gendarmeria francese, questo articolo illustra il modo in cui il reclutamento e la formazione possono contribuire, informalmente, alla ripartizione del potere nelle organizzazioni di polizia. Tramite la diversità delle vie di reclutamento si costituisce, di fatto, un vero e proprio sistema di "caste", con una stratificazione degli ufficiali in tre livelli gerarchici, che produce, al di là dei principi meritocratici, delle ineguaglianze manifeste nella ripartizione del potere nell'organizzazione della gendarmeria.

Post-deposition thermal annealing studies of hydrogenated microcrystalline silicon deposited at 40 deg. C

International Nuclear Information System (INIS)

Bronsveld, P.C.P.; Wagt, H.J. van der; Rath, J.K.; Schropp, R.E.I.; Beyer, W.

2007-01-01

Post-deposition thermal annealing studies, including gas effusion measurements, measurements of infrared absorption versus annealing state, cross-sectional transmission electron microscopy (X-TEM) and atomic force microscopy (AFM), are used for structural characterization of hydrogenated amorphous and microcrystalline silicon films, prepared by very high frequency plasma enhanced chemical vapor deposition (VHF-PECVD) at low substrate temperature (T S ). Such films are of interest for application in thin semiconductor devices deposited on cheap plastics. For T S ∼ 40 deg. C, H-evolution shows rather complicated spectra for (near-) microcrystalline material, with hydrogen effusion maxima seen at ∼ 200-250 deg. C, 380 deg. C and ∼ 450-500 deg. C, while for the amorphous material typical spectra for good-quality dense material are found. Effusion experiments of implanted He demonstrate for the microcrystalline material the presence of a rather open (void-rich) structure. A similar tendency can be concluded from Ne effusion experiments. Fourier Transform infrared (FTIR) spectra of stepwise annealed samples show Si-H bond rupture already at annealing temperatures of 150 deg. C. Combined AFM/X-TEM studies reveal a columnar microstructure for all of these (near-) microcrystalline materials, of which the open structure is the most probable explanation of the shift of the H-effusion maximum in (near-) microcrystalline material to lower temperature

Rotary balance data for a typical single-engine general aviation design for an angle-of-attack range of 8 deg to 90 deg. 2: High-wing model C

Science.gov (United States)

Hultberg, R. S.; Chu, J.

1980-01-01

Aerodynamic characteristics obtained in a helical flow environment utilizing a rotary balance located in the Langley spin g tunnel are presented in plotted form for a 1/6 scale, single engine, high wing, general aviation model. The configurations tested included the basic airplane and control deflections, wing leading edge devices, tail designs, and airplane components. Data are presented without analysis for an angle of attack range of 8 deg to 90 deg and clockwise and counter clockwise rotations covering a spin coefficient range from 0 to 0.9.

Rotary balance data for a typical single-engine general aviation design for an angle-of-attack range of 8 deg to 90 deg. 2: Low-wing model B

Science.gov (United States)

Bihrle, W., Jr.; Hultberg, R. S.

1979-01-01

Aerodynamic characteristics obtained in a rotational flow environment utilizing a rotary balance located in the spin tunnel are presented in plotted form for a 1/6.5 scale, single engine, low wing, general aviation airplane model. The configurations tested included the basic airplane, various wing leading-edge devices, tail designs, and rudder control settings as well as airplane components. Data are presented without analysis for an angle-of-attack range of 8 deg to 90 deg and clockwise and counter-clockwise rotations covering an (omega)(b)/2V range from 0 to 0.85.

Rotary balance data for a typical single-engine general aviation design for an angle-of-attack range of 8 deg to 90 deg. 1: High-wing model B

Science.gov (United States)

Bihrle, W., Jr.; Hultberg, R. S.

1979-01-01

Aerodynamic characteristics obtained in a rotational flow environment utilizing a rotary balance located in a spin tunnel are presented in plotted form for a 1/6.5 scale, single engine, high wing, general aviation airplane model. The configurations tested included the basic airplane, various wing leading-edge devices, tail designs, and rudder control settings as well as airplane components. Data are presented without analysis for an angle of attack range of 8 deg to 90 deg and clockwise and counter-clockwise rotations covering an omega b/2V range from 0 to 0.85.

Vortex lift augmentation by suction on a 60 deg swept Gothic wing

Science.gov (United States)

Taylor, A. H.; Jackson, L. R.; Huffman, J. K.

1982-01-01

An experimental investigation was conducted in the Langley high-speed 7- by 10-foot wind tunnel to determine the aerodynamic performance of suction applied near the wing tips above the trailing edge of a 60 deg swept Gothic wing. Moveable suction inlets were symmetrically mounted in the proximity of the trailing edge, and the amount of suction was varied to maximize wing lift. Tests were conducted at Mach 0.15, 0.30, and 0.45, and the angle of attack was varied from -4 to 50 deg. The suction augmentation increases the lift coefficient over the entire range of angle of attack. The lift improvement exceeds the unaugmented wing lift by over 20%. Moreover, the augmented lift exceeds the lift predicted by vortex lattice theory to 30 deg angle of attack. Suction augmentation is postulated to strengthen the vortex system by increasing its velocity and making it more concentrated. This causes the vortex breakdown to be delayed to a higher angle of attack

Data of evolutionary structure change: 1A5CB-2QUUC [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 2QUU C 2QUUC ...in>C 2QUUC INKCPLLKPWAence> HHH...>2 2QUU C 2QUUC LKIGE--HTPSA...1A5CB-2QUUC 1A5C 2QUU B C ------LPADVAEELATTAQKLVQAGKGILAADESTQTI.../pdbChain> 1A5CB ence>LFGTK-GLGKFence> HHH -

True self-alienation positively predicts reports of mindwandering.

Science.gov (United States)

Vess, Matthew; Leal, Stephanie A; Hoeldtke, Russell T; Schlegel, Rebecca J; Hicks, Joshua A

2016-10-01

Two studies assessed the relationship between feelings of uncertainty about who one truly is (i.e., true self-alienation) and self-reported task-unrelated thoughts (i.e., mindwandering) during performance tasks. Because true self-alienation is conceptualized as the subjective disconnect between conscious awareness and actual experience, we hypothesized that greater feelings of true self-alienation would positively relate to subjective reports of mindwandering. Two convergent studies supported this hypothesis. Moreover, this relationship could not consistently be accounted for by the independent influence of other aspects of authenticity, negative mood, mindfulness, or broad personality dimensions. These findings suggest that individual differences in true self-alienation are reliably associated with subjective reports of mindwandering. The implications of these findings for the true self-alienation construct, the ways that personality relates to mindwandering, and future research directions focused on curtailing mindwandering and improving performance and achievement are discussed. Copyright © 2016 Elsevier Inc. All rights reserved.

Determination of the spiral Galaxy structure parameters based on neutral hydrogen radiowave radiation in 21 cm line. 2. Nonlinear theory. 30 deg <= |l| <= 60 deg

International Nuclear Information System (INIS)

Berman, V.G.; Mishurov, Yu.N.

1980-01-01

Gas flow and its density distribution in the Galaxy spiral arm gravitational potential is calculated by means of the nonlinear theory. Line profile of H I emission in 21 cm based on the Galaxy spiral structure models proposed by Lin and Marochnik are constructed for the galactic coordinates 30 deg < or approximately |l| < or approximately 60 deg. It is shown that the conclusion about the possibility of agreement of the Marochnik model with observations made by means of the linear theory is confirmed in the nonlinear theory. In the Marochnik model distributions with R H II regions, CO-clouds, γ-radiation, supernova remnants and so on may also be understood connecting them with variation of gas compression in galactic shock with H radius

Knowledge as Fact-Tracking True Belief

Directory of Open Access Journals (Sweden)

Fred Adams

Full Text Available ABSTRACT Drawing inspiration from Fred Dretske, L. S. Carrier, John A. Barker, and Robert Nozick, we develop a tracking analysis of knowing according to which a true belief constitutes knowledge if and only if it is based on reasons that are sensitive to the fact that makes it true, that is, reasons that wouldn’t obtain if the belief weren’t true. We show that our sensitivity analysis handles numerous Gettier-type cases and lottery problems, blocks pathways leading to skepticism, and validates the epistemic closure thesis that correct inferences from known premises yield knowledge of the conclusions. We discuss the plausible views of Ted Warfield and Branden Fitelson regarding cases of knowledge acquired via inference from false premises, and we show how our sensitivity analysis can account for such cases. We present arguments designed to discredit putative counterexamples to sensitivity analyses recently proffered by Tristan Haze, John Williams and Neil Sinhababu, which involve true statements made by untrustworthy informants and strange clocks that sometimes display the correct time while running backwards. Finally, we show that in virtue of employing the paradox-free subjunctive conditionals codified by Relevance Logic theorists instead of the paradox-laden subjunctive conditionals codified by Robert Stalnaker and David Lewis.

In search of true friendship

Directory of Open Access Journals (Sweden)

Luciana Karine de Souza

2008-01-01

Full Text Available The present text proposes a discussion on the concept of true friendship. The argument is grounded mostly on Aristotle's Nicomachean Ethics, Owen Flanagan's ethics as human ecology, and on contemporary authors' works about the Greek philosopher's concept of friendship. Given that human beings flourish through 1 exercising capacities, 2 being moral, and 3 having true friendships, difficulties to establish the level of trust required by true friendships turns the search itself (for them morally valid.O presente texto propõe uma discussão sobre o conceito de amizade verdadeira. A argumentação que fundamenta o trabalho baseia-se em grande parte na Ética a Nicômaco de Aristóteles, na ética como ecologia humana de Owen Flanagan, e em autores contemporâneos sobre o conceito de amizade do filósofo grego. Considerando-se que seres humanos encontram a felicidade mediante 1 o exercício de suas capacidades, 2 ser um ente moral, e 3 ter amizades verdadeiras, as dificuldades no estabelecimento do nível de amizade requerido nas amizades verdadeiras torna a busca (por elas, por si só, algo moralmente válido.

Apparent and partial molar volumes of long-chain alkyldimethylbenzylammonium chlorides and bromides in aqueous solutions at T=15 deg. C and T=25 deg. C

International Nuclear Information System (INIS)

Gonzalez-Perez, A.; Ruso, J.M.; Nimo, J.; Rodriguez, J.R.

2003-01-01

Density measurements of dodecyl- (C 12 DBACl), tetradecyl- (C 14 DBACl), hexadecyldimethylbenzylammonium chloride (C 16 DBACl) and of decyl- (C 10 DBABr) and dodecyldimethylbenzylammonium bromide (C 12 DBABr) in aqueous solutions at T=15 deg. C and T=25 deg. C have been carried out. From these results, apparent and partial molar volumes were calculated. Positive deviations from the Debye-Hueckel limiting law provide evidence for limited association at concentrations below the critical micelle concentration. The change of the apparent molar volume upon micellization was calculated. The relevant parameters have been presented in function of the alkyl chain length. Apparent molar volumes of the present compounds in the micellar phase, V phi m , and the change upon micellization, ΔV phi m , have been discussed in terms of temperature and type of counterion

Simulated cosmic microwave background maps at 0.5 deg resolution: Unresolved features

Science.gov (United States)

Kogut, A.; Hinshaw, G.; Bennett, C. L.

1995-01-01

High-contrast peaks in the cosmic microwave background (CMB) anisotropy can appear as unresolved sources to observers. We fit simluated CMB maps generated with a cold dark matter model to a set of unresolved features at instrumental resolution 0.5 deg-1.5 deg to derive the integral number density per steradian n (greater than absolute value of T) of features brighter than threshold temperature absolute value of T and compare the results to recent experiments. A typical medium-scale experiment observing 0.001 sr at 0.5 deg resolution would expect to observe one feature brighter than 85 micro-K after convolution with the beam profile, with less than 5% probability to observe a source brighter than 150 micro-K. Increasing the power-law index of primordial density perturbations n from 1 to 1.5 raises these temperature limits absolute value of T by a factor of 2. The MSAM features are in agreement with standard cold dark matter models and are not necessarily evidence for processes beyond the standard model.

Strain ageing of the 15Kh2MFA steel at 500 and 550 deg C

International Nuclear Information System (INIS)

Maksimovich, G.G.; Azbukin, V.G.; Krylova, R.P.; Tretyak, I.Yu.; Bardachevskaya, T.V.

1978-01-01

The effect of ageing at high temperatures and under high stresses on strength and plasticity of the 15Kh2MFA steel has been studied. The steel was kept at 500 and at 550 deg C for 100, 1000 and 2500 hours without stress and under stress of 0.5 and 0.9 of the long-term strength limit (sigmasub(ls)). Ageing at 500 deg C without stress and under 0.5 sigmasub(ls) changed neither strength nor plasticity of the steel; under 0.9 sigmasub(ls) the strength somewhat decreased. Ageing at 550 deg C for 1000 hours resulted in an appreciable stress drop

Comparison of true metabolisable energy and true amino acid availability between normal maize and quality protein maize (Shandan 17

Directory of Open Access Journals (Sweden)

Mei Li Zhang

2010-01-01

Full Text Available A precision-fed assay was conducted to determine true metabolisable energy and true amino acid digestibility in Chinese quality protein maize (QPM compared with normal maize (NM. Thirty adult roosters, kept in individual cages, were made to fast for 48h and then tub-fed 50g QPM or NM per bird and their excreta was colleted for the subsequent 48h. Additional fifteen roosters were made to fast in order to estimate endogenous losses of energy and amino acids (AA in excreta. Gross energy of the two types of maize were similar; the lysine content in NM and QPM were 0.27% and 0.41% (DM basis, respectively. True metabolisable energy (TME and true metabolisable energy nitrogen corrected (TMEn values of QPM and NM were not significantly different (P>0.05. Digestibility of some AA, including lysine and methionine, in QPM were higher than those in NM (P<0.05. The results of this study indicated that the nutritive value of QPM might be higher than that of NM.

Irradiation creep of the martensitic steel no. 1.4914 between 400 deg C and 600 deg C (Mol 5B)

International Nuclear Information System (INIS)

Herschbach, K.; Doser, W.

1983-01-01

The irradiation induced creep of the martensitic steel DIN No. 1.4914 was investigated in the temperature range from 400 to 600 deg C for stresses up to 200 Mpa using the Mol 5B irradiation rig. The results point to a behavior quite different from that observed in the austenitic steels as will be discussed in detail. The creep is thermally activated and non-linearly dependent upon the applied stress. (author)

Radionuclide therapy for true polycythemia

International Nuclear Information System (INIS)

Afanasieva, N.I.; Grushka, G.V.; Vasiliev, L.Ya.

2005-01-01

Full text: True polycythemia (Vaquez' disease) is the disease of the hemopoietic system of an unknown origin accompanied by increase of erythrocyte count in the peripheral blood with absolute and relative increase in the mass of circulating erythrocytes. True polycythemia is treated with bloodletting and myelosuppressing drugs. This treatment is not always effective. A special place among myelo-depressants is occupied by P-32. Its main therapeutic effect is mediated by the participation in the metabolic processes. Besides DNA damage with beta-radiation, P-32 incorporation by DNA followed by decay and transformation to a stable sulphur isotope (S-32) results in the damage of the structure of nucleic acids, which is main mechanism of cellular proliferation inhibition. Therefore, P-32 is considered a powerful myelosuppressive agent. The indication to P-32 administration is true polycythemia, which, in contrast to secondary polycythemia accompanying numerous diseases, requires special cytostatic treatment. The study involved 152 patients with true polycythemia (76 men and 76 women aged 48) treated with P-32. The treatment was administered in case when bloodletting proved to be ineffective and hematocrit level exceeded 75%. P-32 was administered orally in 100 ml of 10% glucose solution on an empty stomach at a dose of 37-111 MBq with a 4-10-day intervals (mean 6 days). The blood count was checked for 12 weeks. If the number of thrombocytes and leukocytes decreased less than by 25% and the level of hematocrit did not normalize, repeated P-32 treatments were performed. In 13 (8.6%) patients, haematocrit parameters became normal after a single P-32 administration, in 15 (9.9%) patients two treatments with P-32 were necessary to normalize the blood count. In 134 (88.1%) cases P-32 treatment was administered more then two times (maximum 10 treatments). Total P-32 activity ranged from 37 to 740 MBq. Of all the patients who were administered P- 32 treatment, hematological

True ternary fission in 310126X

International Nuclear Information System (INIS)

Banupriya, B.; Vijayaraghavan, K.R.; Balasubramaniam, M.

2015-01-01

All possible combinations are minimized by the two dimensional minimization process and minimized with respect to neutron numbers and proton numbers of the fragments. Potential energy is low and Q - value is high at true ternary fission region. It shows that true ternary mode is the dominant mode in the ternary fission of superheavy nuclei. Also, the results show that the fragments with neutron magic numbers are the dominant one in the ternary fission of superheavy nuclei whereas the fragments with proton magic numbers are the dominant one in the ternary fission of heavy nuclei

Models for Surface Roughness Scattering of Electrons in a 2DEG

International Nuclear Information System (INIS)

Yarar, Z.

2004-01-01

In this work surface roughness scattering of electrons in a two dimensional electron gas (2DEG) formed at heterojunction interfaces is investigated for different auto-correlation tions and potential forms. Gaussian, exponentiaI and lorentsian auto-correlation tions are used to represent surface roughness. Both an infinitely deep triangular potential model and the potential that is found from the numerical solution of Poisson Shrodinger equations self consistently are used as the potential that holds 2DEG at the hetero Interface. Using the wave functions appropriate for the potentials just mentioned and the auto-correlation functions indicated above, the scattering rates due to surface roughness are calculated. The calculations were repeated when the effect of screening is also included for the case of triangular potential

Retrieving SW fluxes from geostationary narrowband radiances for the NASA-CERES SYN1deg product

Science.gov (United States)

Wrenn, F. J., IV; Doelling, D. R.; Liang, L.

2017-12-01

The CERES mission was designed to measure the natural variability of the net TOA flux over long time scales relevant to climate monitoring. To achieve this goal, CERES provides the level-3 SSF1deg, SYN1deg, and EBAF monthly 1° by 1° regional TOA flux. The single satellite (Terra or Aqua) SSF1deg 24-hour shortwave flux is based on one daytime measurements and assumes constant meteorology to model the diurnal change in albedo. To accurately describe regions with a prominent diurnal signal, the SYN1deg Edition4 dataset employs hourly geostationary (GEO) measurements. This improves upon Edition3, which used 3-hourly GEO measurements and with temporal interpolation. The EBAF product combines the temporal stability of the SSF1deg product with the diurnal information from SYN1deg and removes the CERES instrument calibration bias by constraining the net flux balance to the ocean heat storage term. The SYN-1deg product retrieves hourly SW fluxes from GEO measurements. Over regions with large diurnal cycles, such as maritime stratus and land afternoon convective locations, the GEO derived SW fluxes will capture the diurnal flux not observed with Terra or Aqua sun-synchronous satellites. Obtaining fluxes from geostationary satellite radiance is a multistep process. First, most GEO visible imagers lack calibration and must be calibrated to MODIS and VIIRS. Second, the GEO imager visible channel radiances are converted to broadband radiances using empirical and theoretical models. The lack of coincident, collocated, and co-angled GEO and CERES measurements makes building an empirical model difficult. The narrowband to broadband models are a function of surface and cloud conditions, which are difficult to identify due to the inconsistent cloud retrievals between the 16 GEO imagers used in the CERES record. Third, the GEO derived broadband radiances are passed through the CERES angular distribution model (ADM) to convert the radiances to fluxes. Lastly, the GEO derived

A preliminary design and structural analysis on the central column for supporting the full 40 .deg. Sectors at tokamak in pit

International Nuclear Information System (INIS)

Nam, Kyoungo; Park, Hyun Ki; Kim, Dong Jin; Moon, Jaeh Wan; Kim, Byung Seok; Watson, Emma; Shaw, Robert

2012-01-01

The ITER Tokamak machine is composed of nine 40 .deg. sectors shaped of torus. Each 40.deg. sector is made up of one 40 .deg. vacuum vessel (VV), two 20 .deg. toroidal filed coils and associated vacuum vessel thermal shield (VVTS) segments which consist of one inboard and two outboard VVTS. The VV/TFC/VVTS 40 .deg. sectors are sub assembled at assembly building respectively at sector sub assembly tool and then nine sub assembled 40 .deg. sectors are finally assembled at in-pit of Tokamak building. ITER sector assembly tools are the purpose built assembly tools to assemble nine 40 .deg. sectors into the complete ITER Tokamak machine at Tokamak in pit. Based on the design description document, final report prepared by the ITER organization (IO) and tooling requirements, Korea has carried out the conceptual and preliminary design of these assembly tools. Especially, the central column is the main tool, which is composed of some hollow cylinders, to support full nine 40 .deg. sectors at Tokamak in pit. Configuration and structural analysis of the central column are presented

The isothermal section at 500 deg. C of the Gd-Tb-Ga ternary system

International Nuclear Information System (INIS)

Li, J.Q.; Jian, Y.X.; Ao, W.Q.; Zhuang, Y.H.; He, W.

2006-01-01

Phase equilibria in the Gd-Tb-Ga ternary system at 500 deg. C were investigated by X-ray powder diffraction and differential scanning calorimetry. The binary compounds, Gd 5 Ga 3 , Gd 3 Ga 2 , GdGa, GdGa 2 , Tb 5 Ga 3 , TbGa, TbGa 2 and TbGa 3 have been confirmed at 500 deg. C. No ternary compound was found in this system. The isothermal section of this system at 500 deg. C was constructed. It is composed of 7 single-phase regions, 8 two-phase regions and 2 three-phase regions. Four ternary continuous solid solutions (Gd, Tb), (Gd, Tb) 5 Ga 3 , (Gd, Tb)Ga, (Gd, Tb)Ga 2 were formed in this isothermal section. The maximum solid solubilities of Ga in (Gd, Tb) at 500 deg. C is 5.0 at.%. The homogeneity range of (Gd, Tb)Ga 2 is from 20 to 33.3 at.% Ga in Gd-Ga side but limited in Tb-Ga side. The solid solubilities of Ga in the other phases cannot be detected. The Curie temperatures of the Gd 0.6 Tb 0.4-x Ga x alloys increase from 270 to 298 K as x increases from 0 to 0.03

Ge films grown on Si substrates by molecular-beam epitaxy below 450 deg. C

International Nuclear Information System (INIS)

Liu, J.; Kim, H.J.; Hul'ko, O.; Xie, Y.H.; Sahni, S.; Bandaru, P.; Yablonovitch, E.

2004-01-01

Ge thin films are grown on Si(001) substrates by molecular-beam epitaxy at 370 deg. C. The low-temperature epitaxial growth is compatible with the back-end thermal budget of current generation complementary metal-oxide-semiconductor technology, which is restricted to less than 450 deg. C. Reflection high-energy electron diffraction shows that single-crystal Ge thin films with smooth surfaces could be achieved below 450 deg. C. Double-axis x-ray θ/2θ scans also show that the epitaxial Ge films are almost fully strain-relaxed. As expected, cross-sectional transmission electron microscopy shows a network of dislocations at the interface. Hydrogen and oxide desorption techniques are proved to be necessary for improving the quality of the Ge films, which is reflected in improved minority carrier diffusion lengths and exceptionally low leakage currents

Effect of temperatures up to 130 deg C on the responses of TLD 700

Energy Technology Data Exchange (ETDEWEB)

Douglas, J A; Binns, P J [UKAEA Atomic Energy Research Establishment, Harwell. Environmental and Medical Sciences Div.

1984-01-01

The need to measure doses at temperatures up to 130 deg C led to an investigation into the effect of exposure and storage at these temperatures on the response of TLD 700 before and after UV phototransfer. As a preliminary, the delays required during the UV re-estimation process were optimised. The effects of storage and exposure were compared. This was followed by a detailed examination of the effects of storage at temperatures up to 130 deg C. Glow curves were analysed to investigate the rates of growth and decay of the different peaks. The findings for peaks 6 and 7 are compatible with previously reported effects at lower temperatures on peaks 3, 4 and 5. Storage at temperatures of 130 deg C or below for periods up to 28 days does not affect the UV photo-transfer response.

The spread of true and false news online.

Science.gov (United States)

Vosoughi, Soroush; Roy, Deb; Aral, Sinan

2018-03-09

We investigated the differential diffusion of all of the verified true and false news stories distributed on Twitter from 2006 to 2017. The data comprise ~126,000 stories tweeted by ~3 million people more than 4.5 million times. We classified news as true or false using information from six independent fact-checking organizations that exhibited 95 to 98% agreement on the classifications. Falsehood diffused significantly farther, faster, deeper, and more broadly than the truth in all categories of information, and the effects were more pronounced for false political news than for false news about terrorism, natural disasters, science, urban legends, or financial information. We found that false news was more novel than true news, which suggests that people were more likely to share novel information. Whereas false stories inspired fear, disgust, and surprise in replies, true stories inspired anticipation, sadness, joy, and trust. Contrary to conventional wisdom, robots accelerated the spread of true and false news at the same rate, implying that false news spreads more than the truth because humans, not robots, are more likely to spread it. Copyright © 2018 The Authors, some rights reserved; exclusive licensee American Association for the Advancement of Science. No claim to original U.S. Government Works.

Degradation of PsbO by the Deg Protease HhoA Is Thioredoxin Dependent

OpenAIRE

Roberts, Irma N.; Lam, Xuan Tam; Miranda, Helder; Kieselbach, Thomas; Funk, Christiane

2012-01-01

The widely distributed members of the Deg/HtrA protease family play an important role in the proteolysis of misfolded and damaged proteins. Here we show that the Deg protease rHhoA is able to degrade PsbO, the extrinsic protein of the Photosystem II (PSII) oxygen-evolving complex in Synechocystis sp. PCC 6803 and in spinach. PsbO is known to be stable in its oxidized form, but after reduction by thioredoxin it became a substrate for recombinant HhoA (rHhoA). rHhoA cleaved reduced eukaryotic (...

Imaging diagnosis--positive contrast peritoneographic features of true diaphragmatic hernia.

Science.gov (United States)

Choi, Jihye; Kim, Hyunwook; Kim, Mieun; Yoon, Junghee

2009-01-01

A true diaphragmatic hernia is a congenital diaphragmatic malformation that can appear identical to a peritoneopericardial diaphragmatic hernia (PPDH). True diaphragmatic hernias are rare in dogs. Herein we describe the use of positive contrast peritoneography for diagnosis of a true diaphragmatic hernia in two dogs.

Hippocampal size is related to short-term true and false memory, and right fusiform size is related to long-term true and false memory.

Science.gov (United States)

Zhu, Bi; Chen, Chuansheng; Loftus, Elizabeth F; He, Qinghua; Lei, Xuemei; Dong, Qi; Lin, Chongde

2016-11-01

There is a keen interest in identifying specific brain regions that are related to individual differences in true and false memories. Previous functional neuroimaging studies showed that activities in the hippocampus, right fusiform gyrus, and parahippocampal gyrus were associated with true and false memories, but no study thus far has examined whether the structures of these brain regions are associated with short-term and long-term true and false memories. To address that question, the current study analyzed data from 205 healthy young adults, who had valid data from both structural brain imaging and a misinformation task. In the misinformation task, subjects saw the crime scenarios, received misinformation, and took memory tests about the crimes an hour later and again after 1.5 years. Results showed that bilateral hippocampal volume was associated with short-term true and false memories, whereas right fusiform gyrus volume and surface area were associated with long-term true and false memories. This study provides the first evidence for the structural neural bases of individual differences in short-term and long-term true and false memories.

Giovanni Degli Alessandri: i primi anni del direttorato agli Uffizi fra nuovi e vecchi ruoli

Directory of Open Access Journals (Sweden)

Chiara Pasquinelli

2011-11-01

Full Text Available La figura di Giovanni Degli Alessandri (1765-1830, presidente dell’Accademia di Belle Arti di Firenze e direttore degli Uffizi tra gli anni napoleonici e la Restaurazione di Ferdinando III d’Asburgo-Lorena, è quella di un personaggio chiave nella politica artistica fiorentina, e toscana più in generale. Nel saggio si esaminano i primi anni del suo direttorato alla Galleria, i rapporti con Antonio Canova, il suo ruolo all’interno dell’entourage di Elisa Baciocchi Bonaparte, oltre a considerare alcuni spunti legati al rinnovamento degli Uffizi, nonché la delicata vicenda del passaggio in città di Dominique-Vivant Denon, direttore del Louvre. L’obbiettivo è quello di introdurre elementi di approfondimento relativamente a una figura molto nota ma poco studiata.

True ternary fission of 252Cf

International Nuclear Information System (INIS)

Vijayaraghavan, K.R.; Balasubramaniam, M.; Oertzen, W. von

2014-01-01

Splitting of heavy radioactive nucleus into three fragments is known as ternary fission. If the size of the fragments are almost equal it is referred to as true ternary fission. Recently, Yu. V. Pyatkov et al observed/reported the experimental observation of true ternary fission in 252 Cf. In this work, the possibilities of different true ternary fission modes of 252 Cf through potential energy surface (PES) calculations based on three cluster model (TCM) are discussed. In TCM a condition on the mass numbers of the fission fragments is implied as A 1 ≥ A 2 ≥ A 3 in order to avoid repetition of combinations. Due to this condition, the values of Z 3 vary from 0 to 36 and Z 2 vary from 16 to 51. Of the different pairs having similar (Z 2 , Z 3 ) with different potential energy, a pair possessing minimum potential energy is chosen. Thus identified favourable combinations are plotted. For the PES calculations the arrangement of the fragments is considered in the order of A 1 +A 2 +A 3 . i.e. the heavy and the lightest fragments are kept at the ends. It is seen that the deepest minimum in the PES occurs for Z 3 =2 labelled as (Z 2 ; 2) indicating He accompanied breakup as the most favourable one. Of which, the breakup with Z 2 around 46 to 48 is the least (shown by dashed (Z 1 = 50) and dotted (Z 1 = 52) lines indicating a constant Z 1 value). The other notable minima in the PES are labelled and they correspond to the (Z 2 , Z 3 ) pairs viz., (20, 20), (28, 20), (28, 28) and (32, 32). Of these four minima, the first three are associated with the magic numbers 20 and 28. For Z 3 =20, there are two minimums at (20,20) and (28,20) among them (28,20) is the lowest minimum through which the minimum-path passes, and it is the ternary decay observed by Yu. V. Pyatkov et al. The fourth minima is the most interesting due to the fact that it corresponds to true ternary fission mode with Z 2 =32, Z 3 =32 and Z 1 =34. The minimum potential energy path also goes through this true

Rotary balance data for a typical single-engine general aviation design for an angle of attack range of 8 deg to 90 deg. 1: Low wing model C. [wind tunnel tests

Science.gov (United States)

Mulcay, W. J.; Rose, R. A.

1980-01-01

Aerodynamic characteristics obtained in a helical flow environment utilizing a rotary balance located in the Langley spin tunnel are presented in plotted form for a 1/6 scale, single engine, low wing, general aviation model (model C). The configurations tested included the basic airplane and control deflections, wing leading edge and fuselage modification devices, tail designs and airplane components. Data are presented without analysis for an angle of attack range of 8 deg to 90 deg and clockwise and counter clockwise rotations covering an omega b/2v range from 0 to .9.

MR-Venography Using High Resolution True-FISP

Energy Technology Data Exchange (ETDEWEB)

Spuentrup, E. [Technische Hochschule Aachen (Germany). Klinik fuer Radiologische Diagnostik; Beth Israel Deaconess Medical Center, Boston, MA (United States). Dept. of Medicine; Harvard Medical School, Boston, MA (United States); Buecker, A.; Guenther, R.W. [Technische Hochschule Aachen (Germany). Klinik fuer Radiologische Diagnostik; Stuber, M. [Beth Israel Deaconess Medical Center, Boston, MA (United States). Dept. of Medicine; Harvard Medical School, Boston, MA (United States); Philips Med. Syst., Best (Netherlands)

2001-08-01

A new fast MR-venography approach using a high resolution True-FISP imaging sequence was investigated in 20 patients suffering from 23 deep vein thromboses. Diagnosis was proven by X-ray venography, CT or ultrasound examination. The presented technique allowed for clear thrombus visualization with a high contrast to the surrounding blood pool even in calf veins. Acquisition time was less than 10 minutes for imaging the pelvis and the legs. No contrast media was needed. The presented high resolution True-FISP MR-veography is a promising non-invasive, fast MR-venography approach for detection of deep venous thrombosis. (orig.) [German] Eine neue schnelle, oertlich hochaufgeloeste MR-Phlebographietechnik mit einer axialen True-FISP Bildgebungssequenz wurde an 20 Patienten mit 23 nach-gewiesenen tiefen Beinvenenthrombosen untersucht. Die Befunde wurden mit einer konventionellen Roentgenphlebographie, einer CT oder einer Sonographie gesichert. Die vorgestellte Technik erlaubte in allen Faellen eine Thrombusdarstellung mit hohem Kontrast zum umgebenden venoesen Blut, wobei aufgrund der hohen Ortsaufloesung auch die Unterschenkelvenen beurteilt werden konnten. Die Datenaufnahmezeit zur Untersuchung des Beckens und der Beine betrug weniger als 10 Minuten. Kontrastmittel wurde nicht benoetigt. Die vorgestellte MR-Phlebographietechnik unter Verwendung einer oertlich hochauf-geloesten True-FISP Sequenz ist eine neue, vielversprechende, nicht-invasive Technik zur Diagnostik der tiefen Bein- und Beckenvenenthrombose. (orig.)

Restrained shrinkage experiments on coated particle fuel compacts in the temperature range 600-1200 deg C

International Nuclear Information System (INIS)

Blackstone, R.; Veringa, H.J.; Loelgen, R.

1976-05-01

Information on irradiation induced creep in reactor graphite and in fuel compact material is an essential ingredient in the design of any reactor core layout, because the creep plasticity of these materials diminishes the stresses which are built up in the fuel element during reactor operation. The restrained shrinkage method in which the shrinkage of a dumbbell shaped creep specimen is restrained by a graphite material which shows less irradiation shrinkage, offers a good possibility of performing a large series of tensile creep experiments in a limited irradiation volume. The irradiations, evaluations and the results of a series of restrained shrinkage experiments in which six different materials were tested, of which five were dummy coated particle compacts and one pure matrix material are described and discussed. These materials were irradiated in the High Flux Reactor of the Euratom Joint Research Centre in Petten/Netherlands. The irradiations were performed in three successive capsules at irradiation temperatures of 600 deg C, 900 deg C, 1050 deg C and 1200 deg C up to a neutron fluence of maximum 3x10 21 n.cm 2 (DNE). The post-irradiation examinations yielded plastic strains up to 2,3%, and values for the radiation creep coefficient were calculated, ranging from 4 to 8.10 -12 at 600 deg C and 8 to 30.10 -12 at 1200 deg C always given per dyn.cm -2 tensile stresses and per 10 20 n.cm -2 fluence units. Generally it was found that the creep behavior of these materials and the temperature dependence of the creep process could be compared with those for normal reactor graphites

An investigation of the aerodynamic characteristics of a 0.00548 scale model (model no. 486) of the space shuttle 146-inch diameter solid rocket booster at angels of attack from 113 deg to 180 deg in the AEDC PWT 4-foot transonic wind tunnel (SA16F)

Science.gov (United States)

Ramsey, P. E.

1976-01-01

An experimental investigation (SA16F) was conducted in the AEDC PWT 4T to determine the entry static stability of a 0.00548 scale space shuttle solid rocket booster (SRB). The primary objective was to improve the definition of the aerodynamic characteristics in the angle of attack range beyond 90 deg in the vicinity of the entry trim point. The SRB scale model consisted of the reentry configuration with all major protuberances. A simulated heat shield around the engine nozzle was also included. Data were obtained for a 60 deg side mounted sting and a straight nose mounted sting. The angle of attack range for the side mounted sting was 113 deg to 147 deg and for the nose mounted sting 152 deg to 187 deg. The Mach number range consisted of 0.4 to 1.2 at roll angles of 0 and 90 deg. The resulting 6-component aerodynamic force data was presented as the variation of coefficients with angle of attack for each Mach number and roll angle.

"True" posterior communicating aneurysms: Three cases, three strategies.

Science.gov (United States)

Nery, Breno; Araujo, Ricardo; Burjaili, Bruno; Smith, Timothy R; Rodrigues, Jose Carlos; Silva, Marcelo Nery

2016-01-01

The authors provide a review of true aneurysms of the posterior communicating artery (PCoA). Three cases admitted in our hospital are presented and discussed as follows. First patient is a 51-year-old female presenting with a Fisher II, Hunt-Hess III (headache and confusion) subarachnoid hemorrhage (SAH) from a ruptured true aneurysm of the right PCoA. She underwent a successful ipsilateral pterional craniotomy for aneurysm clipping and was discharged on postoperative day 4 without neurological deficit. Second patient is a 53-year-old female with a Fisher I, Hunt-Hess III (headache, mild hemiparesis) SAH and multiple aneurisms, one from left ophthalmic carotid artery and one (true) from right PCoA. These lesions were approached and successfully treated by a single pterional craniotomy on the left side. The patient was discharged 4 days after surgery, with complete recovery of muscle strength during follow-up. Third patient is a 69-year-old male with a Fisher III, Hunt-Hess III (headache and confusion) SAH, from a true PCoA on the right. He had a left subclavian artery occlusion with flow theft from the right vertebral artery to the left vertebral artery. The patient underwent endovascular treatment with angioplasty and stent placement on the left subclavian artery that resulted in aneurysm occlusion. In conclusion, despite their seldom occurrence, true PCoA aneurysms can be successfully treated with different strategies.

Responding to the Challenge of True Uncertainty

DEFF Research Database (Denmark)

Hallin, Carina Antonia; Andersen, Torben Juul

We construe a conceptual framework for responding effectively to true uncertainty in the business environment. We drill down to the essential micro-foundational capabilities - sensing and seizing of dynamic capabilities - and link them to classical strategic issue management theory with suggestions...... on how to operationalize these essential capabilities. By definition true uncertainty represents environmental conditions that are hard to foresee, which can catch the unprepared by surprise while presenting opportunities to the conscious organization. We demonstrate that organizations relying...

Solubility of ammonium metavanadate in ammonium carbonate and sodium bicarbonate solutions at 25 deg C

International Nuclear Information System (INIS)

Fedorov, P.I.; Andreev, V.K.; Slotvinskij-Sidak, N.P.

1978-01-01

Solubility at 25 deg C has been studied in the system ammonium metavanadate - sodium bicarbonate - water which is a stable section of the corresponding quaternary mutual system. In the eutonic point the content of ammonium metavanadate is 4.95% and of sodium bicarbonate 12.1%. The crystallization branch of ammonium metavanadate has been studied in the system ammonium metavanadate - ammonium carbonate - water at 25 deg C. Metavanadate solubility attains minimum (0.14%) at ammonium carbonate concentration 2.6%. Three sections have been studied of the quaternary system ammonium - metavanadate - ammonium carbonate - sodium bicarbonate-water at 25 deg C in the crystallization region of ammonium metavanadate at a ratio of sodium bicarbonate to ammonium carbonate 3:1, 1:1, and 1:3. A region of minimum solubility of ammonium metavanadate has been detected (0.1%)

Oxidation-induced embrittlement and structural changes of Zircaloy-4 tubing in steam at 700-1000 deg. C

Energy Technology Data Exchange (ETDEWEB)

Ali, A E; Huessein, A G; El-Sayed, A A; El Banna, O A [Atomic Energy Authority, Cairo (Egypt); El Raghy, S M [Cairo Univ. (Egypt). Faculty of Engineering

1997-02-01

The oxidation-induced embrittlement and structural changes of Zircaloy-4 (KWU-Type) tubing was investigated under light water reactors (LWR) Loss-of-Coolant. Accident conditions (LOCA) in temperature range 700-1000 deg. C. The effect of hydrogen addition to steam was also investigated in the temperature range 800-1000 deg. C. The oxidation-induced embrittlement was found to be a function of both temperature and time. Fractography investigation of oxidized tubing showed a typical brittle fracture in the stabilized-alpha zone. The microhardness measurements revealed that the alpha-Zr is harder than that near the mid-wall position. The oxidation-induced embrittlement at 900 deg. C was found to be higher than at 1000 deg. C. The results also indicated that the addition of 5% by volume hydrogen to steam resulted in an increase in the degree of embrittlement. (author). 22 refs, 9 figs, 3 tabs.

Surface protection of a chromia forming alloy at 1300deg C

International Nuclear Information System (INIS)

Lobb, R.C.; Bennett, M.J.

1990-01-01

Under postulated abnormal (fault) reactor conditions, a rapid temperature transient could occur such that for a short time ( 2 /1-2% CO/300 vpm H 2 O/300 vpm CH 4 , at 1.300deg C has been studied. (orig./MM)

True dreams: Encounter of the worlds in Islamic philosophy

Directory of Open Access Journals (Sweden)

Halilović Tehran

2014-01-01

Full Text Available True dreams that explicitly or symbolically reveal the events of the past and the future, in the ontological sense tell more than just about the content of a dream because they bespeak the supratemporal dimension of human beings and represent man's ability to connect to different worlds, and respectively multitudinous forms and levels of being. In this paper, without going into the psychological or physiological analysis of dreams, we try to clarify the ontological significance and position of true dreams in existing worlds. In Islamic philosophy, the underlying cognitive basis for the description of the ontological level of true dreams was established by the founder of Illuminative Philosophy, Shaykh al-Ishraq (1155-1191, and it was expanded by the founder of Transcendental Philosophy, Mulla Sadra Shirazi (1572-1640. Shaykh al-Ishraq explained in detail existential position of supramaterial beings that on the one hand are above the world of matter and in a direct active contact with it, and on the other hand, are under the dominant world of intellect. He called these creatures Midworld (Barzakh and, for the first time in Islamic philosophy, stated that it is a separate world of imagination that is different from the material and intelligible one. True dreams are one of the many indications that man has a supratemporal dimension that exposes supramaterial and temporally unlimited worlds to him. Apart from true dreams, most important signs of supramaterial worlds in human life are the prophetic revelation, as well as revelations and mystical-gnostic intuition. Unlike the last two examples, true dreams are known and accessible to all people, both from their immediate experience and from the stories of the ones close to them. For this reason, in this paper we explain how true dreams represent a blend of worlds in human life.

Turn down the heat: why a 4 deg. C warmer world must be avoided

International Nuclear Information System (INIS)

Schellnhuber, Hans Joachim; Hare, William; Serdeczny, Olivia; Adams, Sophie; Coumou, Dim; Frieler, Katja; Martin, Maria; Otto, Ilona M.; Perrette, Mahe; Robinson, Alexander; Rocha, Marcia; Schaeffer, Michiel; Schewe, Jacob; Wang, Xiaoxi; Warszawski, Lila; Durand, Francis

2012-11-01

This paper summarizes in French the content of a Report for the World Bank made by the Potsdam Institute for Climate Impact Research and Climate Analytics. This report provides a snapshot of recent scientific literature (about 190 papers) and new analyses of likely impacts and risks that would be associated with a 4 deg. Celsius warming within this century. It is a rigorous attempt to outline a range of risks, focusing on developing countries and especially the poor. A 4 deg. C world would be one of unprecedented heat waves, severe drought, and major floods in many regions, with serious impacts on ecosystems and associated services. But with action, a 4 deg. C world can be avoided and we can likely hold warming below 2 deg. C. This report is not a comprehensive scientific assessment, as will be forthcoming from the Intergovernmental Panel on Climate Change (IPCC) in 2013-14 in its fifth assessment report. It is focused on developing countries, while recognizing that developed countries are also vulnerable and at serious risk of major damages from climate change. A series of recent extreme events worldwide continue to highlight the vulnerability of not only the developing world but even wealthy industrialized countries. No nation will be immune to the impacts of climate change. However, the distribution of impacts is likely to be inherently unequal and tilted against many of the world's poorest regions, which have the least economic, institutional, scientific, and technical capacity to cope and adapt

Sexy DEG/ENaC channels involved in gustatory detection of fruit fly pheromones.

Science.gov (United States)

Pikielny, Claudio W

2012-11-06

Hydrocarbon pheromones on the cuticle of Drosophila melanogaster modulate the complex courtship behavior of males. Recently, three members of the degenerin/epithelial Na+ channel (DEG/ENaC) family of sodium channel subunits, Ppk25, Ppk23, and Ppk29 (also known as Nope), have been shown to function in gustatory perception of courtship-modulating contact pheromones. All three proteins are required for the activation of male courtship by female pheromones. Specific interactions between two of them have been demonstrated in cultured cells, suggesting that, in a subset of cells where they are coexpressed, these three subunits function within a common heterotrimeric DEG/ENaC channel. Such a DEG/ENaC channel may be gated by pheromones, either directly or indirectly, or alternatively may control the excitability of pheromone-sensing cells. In addition, these studies identify taste neurons that respond specifically to courtship-modulating pheromones and mediate their effects on male behavior. Two types of pheromone-sensing taste neurons, F and M cells, have been defined on the basis of their specific response to either female or male pheromones. These reports set the stage for the dissection of the molecular and cellular mechanisms that mediate gustatory detection of contact pheromones.

True Fibroma of Alveolar Mucosa

Directory of Open Access Journals (Sweden)

Shankargouda Patil

2014-01-01

Full Text Available Benign fibrous overgrowths are often found in the oral cavity, almost always being reactive/irritational in nature. However, benign mesenchymal neoplasms of the fibroblasts are extremely uncommon. Here we report a case of “True Fibroma of Alveolar Mucosa” for its rarity.

True vaginal prolapse in a bitch.

Science.gov (United States)

Alan, M; Cetin, Y; Sendag, S; Eski, F

2007-08-01

Frequently, vaginal fold prolapse is the protrusion of edematous vaginal tissue into and through the opening of the vulva occurring during proestrus and estrus stages of the sexual cycle. True vaginal prolapse may occur near parturition, as the concentration of serum progesterone declines and the concentration of serum oestrogen increases. In the bitch, this type of true vaginal prolapse is a very rare condition. This short communication describes a 5-year-old female, cross-breed dog in moderate condition, weighing 33 kg, with distocia and true vaginal prolapse. Abdominal palpation and transabdominal ultrasonography revealed live and dead foetuses in the uterine horns. One dead and four live fetuses were removed from uterus by cesarean section. The ovariohysterectomy was performed after repositioning the vaginal wall with a combination of traction from within the abdomen and external manipulation through the vulva. Re-occurrence of a vaginal prolapse was not observed and the bitch recovered completely after the surgical therapy. Compared to other vaginal disorders, vaginal prolapse is an uncommon condition in the bitch. In the present case, extreme tenesmus arising from distocia may have predisposed to the vaginal prolapse. The cause of dystocia was probably the disposition of the first foetus. We concluded that the vaginal prolapse was the result of dystocia in the present case.

Elucidating of the microstructure of ZrO2 ceramics with additions of 1200 deg. C heat treated ultrafine MgO powders: Aging at 1420 deg. C

International Nuclear Information System (INIS)

Brito-Chaparro, J.A.; Reyes-Rojas, A.; Bocanegra-Bernal, M.H.; Aguilar-Elguezabal, A.; Echeberria, J.

2007-01-01

The microstructure and phase transformations in the pressureless sintered composite ZrO 2 with additions of 3.11 wt% high purity and ultrafine MgO powder (9.25 mol% Mg-PSZ) heat treated at 1200 deg. C were investigated by using scanning electron microscopy (SEM), transmission electron microscopy (TEM) and X-ray diffraction, before and after of eutectoid aging treatment at 1420 deg. C during 4 h. The phases in the as-sintered ceramics were t, c, and m, and was not evident under the experimental conditions of this work, the formation of typical disk-like shape tetragonal precipitates aligned at right angles, meanwhile the microstructure resulting in aged samples was majority monoclinic stable phase showing a banded structure which appear to be twin related. When is used MgO previously heat treated as stabilizer of ZrO 2 , strong differences in SEM microstructures compared to the shown by other investigators in very similar compositions have been found

Mechanical properties of steel fiber reinforced reactive powder concrete following exposure to high temperature reaching 800 deg. C

Energy Technology Data Exchange (ETDEWEB)

Tai, Yuh-Shiou, E-mail: ystai@cc.cma.edu.tw [Department of Civil Engineering, ROC Military Academy, Kaohsiung, Taiwan (China); Pan, Huang-Hsing; Kung, Ying-Nien [Department of Civil Engineering, Kaohsiung University of Applied Sciences, Kaohsiung, Taiwan (China)

2011-07-15

Highlights: > The stress-strain relation of reactive powder concrete after exposure to high temperatures are tested by using displacement control. > Develops regression formulae to estimate the mechanical properties of RPC. > Valuable experimental data have been obtained about RPC with various fiber contents. These data include compressive strength, peak strain and modulus of elasticity. - Abstract: This study investigates the stress-strain relation of RPC in quasi-static loading after an elevated temperature. The cylinder specimens of RPC with {phi} 50 mm x 100 mm are examined at the room temperature and after 200-800 deg. C. Experimental results indicate that the residual compressive strength of RPC after heating from 200-300 deg. C increases more than that at room temperature, but, significantly decreases when the temperature exceeds 300 deg. C. The residual peak strains of RPC also initially increase up to 400-500 deg. C, then decrease gradually beyond 500 deg. C. Meanwhile, Young's modulus diminishes with an increasing temperature. Based on the regression analysis results, this study also develops regression formulae to estimate the mechanical properties of RPC after an elevated temperature, thus providing a valuable reference for industrial applications and design.

Visualization of swallowing using real-time TrueFISP MR fluoroscopy

Energy Technology Data Exchange (ETDEWEB)

Barkhausen, Joerg; Goyen, Mathias; Lauenstein, Thomas; Debatin, Joerg F. [Department of Diagnostic Radiology, University Hospital Essen (Germany); Winterfeld, F. von; Arweiler-Harbeck, Diana [Department of Otorhinolaryngology, University Hospital Essen (Germany)

2002-01-01

The aim of this study was to evaluate the ability of different real-time true fast imaging with steady precession (TrueFISP) sequences regarding their ability to depict the swallowing process and delineate oropharyngeal pathologies in patients with dysphagia. Real-time TrueFISP visualization of swallowing was performed in 8 volunteers and 6 patients with dysphagia using a 1.5 T scanner (Magnetom Sonata, Siemens, Erlangen Germany) equipped with high-performance gradients (amplitude 40 mT/m). Image quality of four different real-time TrueFISP sequences (TR 2.2-3.0 ms, TE 1.1-1.5 ms, matrix 63 x 128-135 x 256, field of view 250 mm{sup 2}, acquisition time per image 139-405 ms) was evaluated. Water, yoghurt, and semolina pudding were assessed as oral contrast agents. Functional exploration of the oropharyngeal apparatus was best possible using the fastest real-time TrueFISP sequence (TR 2.2 ms, TE 1.1 ms, matrix 63 x 128). Increased acquisition time resulted in blurring of anatomical structures. As the image contrast of TrueFISP sequences depends on T2/T1 properties, all tested foodstuff were well suited as oral contrast agents, but image quality was best using semolina pudding. Real-time visualization of swallowing is possible using real-time TrueFISP sequences in conjunction with oral contrast agents. For the functional exploration of swallowing high temporal resolution is more crucial than spatial resolution. (orig.)

Book review, Igiene e Tecnologie degli Alimenti di Origine Animale Giampaolo Colavita (a cura di

Directory of Open Access Journals (Sweden)

Manuel Graziani

2008-09-01

Full Text Available Igiene e Tecnologie degli Alimenti di Origine Animale si avvale del contributo di 33 autori, tutti soci dell’Associazione Italiana Veterinari Igienisti (AIVI, che garantiscono l’appropriata trattazione di una materia estremamente vasta e dinamica. Il manuale nasce da un’iniziativa finalizzata alla realizzazione di un testo che rifletta e possa soddisfare le esigenze didattiche degli insegnamenti di un’ampia serie di materie universitarie: Igiene e Tecnologie degli Alimenti di Origine Animale della Facoltà di Medicina Veterinaria, di Agraria, nei corsi di Scienze e Tecnologie Alimentari, di Scienze e Tecnologie delle Produzioni Animali, nel corso di laurea in Tecniche della Prevenzione nell’ambiente e nei Luoghi di Lavoro, nonché in altri corsi di studio dove si insegnano le discipline relative all’igiene e alla sicurezza degli alimenti.Sono stati trattati gran parte degli alimenti di origine animale, i prodotti a base di carne, il latte e i prodotti derivati, i prodotti della pesca freschi e trasformati, i prodotti dell’alveare, le uova e gli ovoprodotti. Di particolare interesse appare il capitolo riguardante la diagnostica analitica degli alimenti, considerato che le moderne metodologie analitiche risultano fondamentali per affrontare le tematiche legate all’igiene e alla sicurezza alimentare.Il volume ha una finalità prevalentemente didattica ma è comunque rivolto a tutti coloro che operano nel campo dell’Igiene e delle Tecnologie Alimentari. Infatti, visti gli argomenti trattati come le tossinfezioni e le intossicazioni alimentari, la conservazione, il confezionamento e l’etichettatura dei prodotti alimentari, anche i professionisti del settore possono trarre dal testo elementi utili per la loro attività. Per esempio argomenti quali l’analisi del rischio, le attività di audit ed i sistemi di accreditamento e di certificazione sono particolarmente utili per chi opera nelle Aziende Sanitarie Locali e negli Istituti

Simplified 2DEG carrier concentration model for composite barrier AlGaN/GaN HEMT

International Nuclear Information System (INIS)

Das, Palash; Biswas, Dhrubes

2014-01-01

The self consistent solution of Schrodinger and Poisson equations is used along with the total charge depletion model and applied with a novel approach of composite AlGaN barrier based HEMT heterostructure. The solution leaded to a completely new analytical model for Fermi energy level vs. 2DEG carrier concentration. This was eventually used to demonstrate a new analytical model for the temperature dependent 2DEG carrier concentration in AlGaN/GaN HEMT

Solubility of nickel ferrite (NiFe2O4) from 100 to 200 deg. C

International Nuclear Information System (INIS)

Bellefleur, Alexandre; Bachet, Martin; Benezeth, Pascale; Schott, Jacques

2012-09-01

The solubility of nickel ferrite was measured in a Hydrogen-Electrode Concentration Cell (HECC) at temperatures of 100 deg. C, 150 deg. C and 200 deg. C and pH between 4 and 5.25. The experimental solution was composed of HCl and NaCl (0.1 mol.L -1 ). Based on other studies ([1,2]), pure nickel ferrite was experimentally synthesized by calcination of a mixture of hematite Fe 2 O 3 and bunsenite NiO in molten salts at 1000 deg. C for 15 hours in air. The so obtained powder was fully characterized. The Hydrogen-Electrode Concentration cell has been described in [3]. It allowed us to run solubility experiments up to 250 deg. C with an in-situ pH measurement. To avoid reduction of the solid phase to metallic nickel, a hydrogen/argon mixture was used instead of pure hydrogen. Consequently, the equilibration time for the electrodes was longer than with pure hydrogen. Eight samples were taken on a 70 days period. After the experiments, the powder showed no significant XRD evidence of Ni (II) reduction. Nickel concentration was measured by atomic absorption spectroscopy and iron concentration was measured by UV spectroscopy. The protocol has been designed to be able to measure both dissolved Fe (II) and total iron. The nickel solubility of nickel ferrite was slightly lower than the solubility of nickel oxide in close experimental conditions [3]. Dissolved iron was mainly ferrous and the solution was under-saturated relative to both hematite and magnetite. The nickel/iron ratio indicated a non-stoichiometric dissolution. The solubility measurements were compared with equilibrium calculations using the MULTEQ database. [1] Hayashi et al (1980) J. Materials Sci. 15, 1491-1497. [2] Ziemniak et al (2007) J. Physics and Chem. of Solids. 68,10-21. [3] EPRI Report 1003155 (2002). (authors)

Reversal of the ΔdegP Phenotypes by a Novel rpoE Allele of Escherichia coli

Science.gov (United States)

Leiser, Owen P.; Charlson, Emily S.; Gerken, Henri; Misra, Rajeev

2012-01-01

RseA sequesters RpoE (σE) to the inner membrane of Escherichia coli when envelope stress is low. Elevated envelope stress triggers RseA cleavage by the sequential action of two membrane proteases, DegS and RseP, releasing σE to activate an envelope stress reducing pathway. Revertants of a ΔdegP ΔbamB strain, which fails to grow at 37°C due to high envelope stress, harbored mutations in the rseA and rpoE genes. Null and missense rseA mutations constitutively hyper-activated the σE regulon and significantly reduced the major outer membrane protein (OMP) levels. In contrast, a novel rpoE allele, rpoE3, resulting from the partial duplication of the rpoE gene, increased σE levels greater than that seen in the rseA mutant background but did not reduce OMP levels. A σE-dependent RybB::LacZ construct showed only a weak activation of the σE pathway by rpoE3. Despite this, rpoE3 fully reversed the growth and envelope vesiculation phenotypes of ΔdegP. Interestingly, rpoE3 also brought down the modestly activated Cpx envelope stress pathway in the ΔdegP strain to the wild type level, showing the complementary nature of the σE and Cpx pathways. Through employing a labile mutant periplasmic protein, AcrAL222Q, it was determined that the rpoE3 mutation overcomes the ΔdegP phenotypes, in part, by activating a σE-dependent proteolytic pathway. Our data suggest that a reduction in the OMP levels is not intrinsic to the σE-mediated mechanism of lowering envelope stress. They also suggest that under extreme envelope stress, a tight homeostasis loop between RseA and σE may partly be responsible for cell death, and this loop can be broken by mutations that either lower RseA activity or increase σE levels. PMID:22439016

Simulated cosmic microwave background maps at 0.5 deg resolution: Basic results

Science.gov (United States)

Hinshaw, G.; Bennett, C. L.; Kogut, A.

1995-01-01

We have simulated full-sky maps of the cosmic microwave background (CMB) anisotropy expected from cold dark matter (CDM) models at 0.5 deg and 1.0 deg angular resolution. Statistical properties of the maps are presented as a function of sky coverage, angular resolution, and instrument noise, and the implications of these results for observability of the Doppler peak are discussed. The rms fluctuations in a map are not a particularly robust probe of the existence of a Doppler peak; however, a full correlation analysis can provide reasonable sensitivity. We find that sensitivity to the Doppler peak depends primarily on the fraction of sky covered, and only secondarily on the angular resolution and noise level. Color plates of the simulated maps are presented to illustrate the anisotropies.

The dynamic interplay between perceived true self-knowledge and decision satisfaction.

Science.gov (United States)

Schlegel, Rebecca J; Hicks, Joshua A; Davis, William E; Hirsch, Kelly A; Smith, Christina M

2013-03-01

The present research used multiple methods to examine the hypothesis that perceived true self-knowledge and decision satisfaction are inextricably linked together by a widely held "true-self-as-guide" lay theory of decision making. Consistent with this proposition, Study 1 found that participants rated using the true self as a guide as more important for achieving personal satisfaction than a variety of other potential decision-making strategies. After establishing the prevalence of this lay theory, the remaining studies then focused on examining the proposed consequent relationship between perceived true self-knowledge and decision satisfaction. Consistent with hypotheses, 2 cross-sectional correlational studies (Studies 2 and 3) found a positive relationship between perceived true self-knowledge and decision satisfaction for different types of major decisions. Study 4 used daily diary methods to demonstrate that fluctuations in perceived true self-knowledge reliably covary with fluctuations in decision satisfaction. Finally, 2 studies directly examined the causal direction of this relationship through experimental manipulation and revealed that the relationship is truly bidirectional. More specifically, Study 5 showed that manipulating perceived knowledge of the true self (but not other self-concepts) directly affects decision satisfaction. Study 6 showed that this effect also works in reverse by manipulating feelings of decision satisfaction, which directly affected perceived knowledge of the true self (but not other self-concepts). Taken together, these studies suggest that people believe the true self should be used as a guide when making major life decisions and that this belief has observable consequences for the self and decision making. PsycINFO Database Record (c) 2013 APA, all rights reserved

Oxidation in air of two refractory alloys (Nicral D and Hastelloy X) at 900 and 1100 deg. C

International Nuclear Information System (INIS)

Sannier, J.; Dominget, R.; Darras, R.

1960-01-01

The oxidation in air of two refractory alloys (Nicral D and Hastelloy X) has been studied at 900 and 1100 deg. C, by means of recording thermo-balances and microscopic cross section examination. At 900 deg. C, the surface oxidation rates of the two alloys are quite similar, but at 1100 deg. C the alloy Nicral D oxidizes faster than the alloy Hastelloy X. On the other hand, after heating at 1100 deg. C for 150 hours, Nicral D shows both intergranular oxidation and a small amount of internal oxidation, whereas Hastelloy X is especially subject to internal oxidation. In addition, two descaling methods were compared: an electrolytic method, in a sodium hydroxide-sodium carbonate bath, and a chemical method using a sodium nitrate-sodium peroxide bath; the latter appears suitable only for Hastelloy X. Reprint of a paper published in Journal of nuclear materials, 3, p. 213-225, 1959 [fr

True random numbers from amplified quantum vacuum.

Science.gov (United States)

Jofre, M; Curty, M; Steinlechner, F; Anzolin, G; Torres, J P; Mitchell, M W; Pruneri, V

2011-10-10

Random numbers are essential for applications ranging from secure communications to numerical simulation and quantitative finance. Algorithms can rapidly produce pseudo-random outcomes, series of numbers that mimic most properties of true random numbers while quantum random number generators (QRNGs) exploit intrinsic quantum randomness to produce true random numbers. Single-photon QRNGs are conceptually simple but produce few random bits per detection. In contrast, vacuum fluctuations are a vast resource for QRNGs: they are broad-band and thus can encode many random bits per second. Direct recording of vacuum fluctuations is possible, but requires shot-noise-limited detectors, at the cost of bandwidth. We demonstrate efficient conversion of vacuum fluctuations to true random bits using optical amplification of vacuum and interferometry. Using commercially-available optical components we demonstrate a QRNG at a bit rate of 1.11 Gbps. The proposed scheme has the potential to be extended to 10 Gbps and even up to 100 Gbps by taking advantage of high speed modulation sources and detectors for optical fiber telecommunication devices.

Aging between 300 and 450 deg C of wrought martensitic 13-17 wt-%Cr stainless steels

International Nuclear Information System (INIS)

Yrieix, B.; Guttmann, M.

1993-06-01

Martensitic stainless steels containing 13-17 wt-% Cr, some also containing nickel and some having precipitation hardening additions, have been aged between 300 and 450 deg C for times up to 30 000 h. For all the steels examined, the aging response takes the form of an increase of strength and hardness, correlated with embrittlement. The rate and intensity of aging increase with increasing chromium and molybdenum concentrations. In addition, two steels exhibit some temper embrittlement on long term aging at 400 deg C; such embrittlement of these materials is not expected in service at temperatures up to 300 deg C. A general method of prediction of the mechanical properties of these steels as a function of aging conditions is proposed. (authors). 11 refs., 17 figs., 7 tabs

Comparison of the corrosion behavior of austenitic and ferritic/martensitic steels exposed to static liquid Pb-Bi at 450 and 550 deg. C

International Nuclear Information System (INIS)

Kurata, Y.; Futakawa, M.; Saito, S.

2005-01-01

Static corrosion tests of various steels were conducted in oxygen-saturated liquid Pb-Bi eutectic at 450 deg. C and 550 deg. C for 3000 h to study the effects of temperature and alloying elements on corrosion behavior in liquid Pb-Bi. Corrosion depth decreases at 450 deg. C with increasing Cr content in steels regardless of ferritic/martensitic steels or austenitic steels. Appreciable dissolution of Ni and Cr does not occur in the three austenitic steels at 450 deg. C. Corrosion depth of ferritic/martensitic steels also decreases at 550 deg. C with increasing Cr content in steels whereas corrosion depth of austenitic steels, JPCA and 316SS becomes larger due to ferritization caused by dissolution of Ni at 550 deg. C than that of ferritic/martensitic steels. An austenitic stainless steel containing about 5%Si exhibits fine corrosion resistance at 550 deg. C because the protective Si oxide film is formed and prevents dissolution of Ni and Cr

True navigation and magnetic maps in spiny lobsters.

Science.gov (United States)

Boles, Larry C; Lohmann, Kenneth J

2003-01-02

Animals are capable of true navigation if, after displacement to a location where they have never been, they can determine their position relative to a goal without relying on familiar surroundings, cues that emanate from the destination, or information collected during the outward journey. So far, only a few animals, all vertebrates, have been shown to possess true navigation. Those few invertebrates that have been carefully studied return to target areas using path integration, landmark recognition, compass orientation and other mechanisms that cannot compensate for displacements into unfamiliar territory. Here we report, however, that the spiny lobster Panulirus argus oriented reliably towards a capture site when displaced 12-37 km to unfamiliar locations, even when deprived of all known orientation cues en route. Little is known about how lobsters and other animals determine position during true navigation. To test the hypothesis that lobsters derive positional information from the Earth's magnetic field, lobsters were exposed to fields replicating those that exist at specific locations in their environment. Lobsters tested in a field north of the capture site oriented themselves southwards, whereas those tested in a field south of the capture site oriented themselves northwards. These results imply that true navigation in spiny lobsters, and perhaps in other animals, is based on a magnetic map sense.

Representations built from a true geographic database

DEFF Research Database (Denmark)

Bodum, Lars

2005-01-01

the whole world in 3d and with a spatial reference given by geographic coordinates. Built on top of this is a customised viewer, based on the Xith(Java) scenegraph. The viewer reads the objects directly from the database and solves the question about Level-Of-Detail on buildings, orientation in relation...... a representation based on geographic and geospatial principles. The system GRIFINOR, developed at 3DGI, Aalborg University, DK, is capable of creating this object-orientation and furthermore does this on top of a true Geographic database. A true Geographic database can be characterized as a database that can cover...

True and False Memories, Parietal Cortex, and Confidence Judgments

Science.gov (United States)

Urgolites, Zhisen J.; Smith, Christine N.; Squire, Larry R.

2015-01-01

Recent studies have asked whether activity in the medial temporal lobe (MTL) and the neocortex can distinguish true memory from false memory. A frequent complication has been that the confidence associated with correct memory judgments (true memory) is typically higher than the confidence associated with incorrect memory judgments (false memory).…

Comment on: "Current-voltage characteristics and zero-resistance state in 2DEG"

OpenAIRE

Cheremisin, M. V.

2003-01-01

We demonstrate that N(S)-shape current-voltage characteristics proposed to explain zero-resistance state in Corbino(Hall bar) geometry 2DEG (cond-mat/0302063, cond-mat/0303530) cannot account essential features of radiation-induced magnetoresistance oscillations experiments.

The cortical basis of true memory and false memory for motion.

Science.gov (United States)

Karanian, Jessica M; Slotnick, Scott D

2014-02-01

Behavioral evidence indicates that false memory, like true memory, can be rich in sensory detail. By contrast, there is fMRI evidence that true memory for visual information produces greater activity in earlier visual regions than false memory, which suggests true memory is associated with greater sensory detail. However, false memory in previous fMRI paradigms may have lacked sufficient sensory detail to recruit earlier visual processing regions. To investigate this possibility in the present fMRI study, we employed a paradigm that produced feature-specific false memory with a high degree of visual detail. During the encoding phase, moving or stationary abstract shapes were presented to the left or right of fixation. During the retrieval phase, shapes from encoding were presented at fixation and participants classified each item as previously "moving" or "stationary" within each visual field. Consistent with previous fMRI findings, true memory but not false memory for motion activated motion processing region MT+, while both true memory and false memory activated later cortical processing regions. In addition, false memory but not true memory for motion activated language processing regions. The present findings indicate that true memory activates earlier visual regions to a greater degree than false memory, even under conditions of detailed retrieval. Thus, the dissociation between previous behavioral findings and fMRI findings do not appear to be task dependent. Future work will be needed to assess whether the same pattern of true memory and false memory activity is observed for different sensory modalities. Copyright © 2013 Elsevier Ltd. All rights reserved.

Effect of caecectomy on true metabolizable energy and lysine ...

African Journals Online (AJOL)

True metabolizable energy, conected for nitrogen retention. cfMEx) and true rysine avilabiliry, was determined for maize and sunflower oilcake o,?, t*o ,u*ii"s of each, *O in-r*ples of fishmeal, soyabean oilcake -"ur -a sorghum meal using intact and caecectomized roosters. The roosters were allowed ad tibitum intake over a ...

True Umbilical Cord Knot Leading to Fetal Demise | Ikechebelu ...

African Journals Online (AJOL)

The incidence of true knot of the umbilical cord is not only very low but it is often undiagnosed antenatally when present despite the availability of prenatal ultrasonography. When the true knot remains tight, it may impede the circulation of the fetus and may result to fetal death in utero especially in labor. We report a very ...

Electrically tunable photonic true-time-delay line.

Science.gov (United States)

Barmenkov, Yuri O; Cruz, José Luis; Díez, Antonio; Andrés, Miguel V

2010-08-16

We present a new application of the acousto-optic superlattice modulation of a fiber Bragg grating based on the dynamic phase and group delay properties of this fiber-optic component. We demonstrate a tunable photonic true-time-delay line based on the group delay change of the light reflected from the grating sidebands. The delay is electrically tuned by adjusting the voltage applied to a piezoelectric transducer that generates the acoustic wave propagating along the grating. In our experiments, a true-time delay of 400 ps is continuously adjusted (300 ps within the 3 dB amplitude range of the first sideband), using a 12 cm long uniform grating.

Determination of true coincidence correction factors using Monte-Carlo simulation techniques

Directory of Open Access Journals (Sweden)

Chionis Dionysios A.

2014-01-01

Full Text Available Aim of this work is the numerical calculation of the true coincidence correction factors by means of Monte-Carlo simulation techniques. For this purpose, the Monte Carlo computer code PENELOPE was used and the main program PENMAIN was properly modified in order to include the effect of the true coincidence phenomenon. The modified main program that takes into consideration the true coincidence phenomenon was used for the full energy peak efficiency determination of an XtRa Ge detector with relative efficiency 104% and the results obtained for the 1173 keV and 1332 keV photons of 60Co were found consistent with respective experimental ones. The true coincidence correction factors were calculated as the ratio of the full energy peak efficiencies was determined from the original main program PENMAIN and the modified main program PENMAIN. The developed technique was applied for 57Co, 88Y, and 134Cs and for two source-to-detector geometries. The results obtained were compared with true coincidence correction factors calculated from the "TrueCoinc" program and the relative bias was found to be less than 2%, 4%, and 8% for 57Co, 88Y, and 134Cs, respectively.

Temperature dependence of the surface energy of mercury from 0 to 250 deg. C

CERN Document Server

Halas, S

2002-01-01

The surface energy (SE) for mercury was calculated on the basis of the free electron model in which the electron density parameter, r sub s , for bulk electrons was calculated from the density of mercury while the electron density parameter for surface electrons, r sub s sub s , was assumed to be higher by a factor that is linearly dependent on temperature. Ideal agreement of calculated SE values with experimental data was attained for the temperatures 0-250 deg. C assuming that r sub s sub s = r sub s x 1.0021 sup T sup / sup 1 sup 0 sup 0 deg. C. (letter to the editor)

The Use of Dexamethasone in Support of High-Altitude Ground Operations and Physical Performance: Review of the Literature

Science.gov (United States)

2014-12-01

rates vary dramatically, the physiological effect of hypobaric high-altitude hypoxia (HHH) is ubiquitous.1,2 Symptoms of less severe cases of HHH...staff member on a quarterly basis at the UHM Fellowship Program and Multiplace Hyperbaric Chamber Wilford Hall San Anto- nio MHS, Texas. Initially...oc- cupational, and undersea hyperbaric medicine. Lt Col (Ret) Wright, PhD, CAsP, is a full-time faculty member at the USAF School of Aerospace

Measurements of anisotropy in the cosmic microwave background radiation at 0.5 deg angular scales near the star gamma ursae minoris

Science.gov (United States)

Devlin, M. J.; Clapp, A. C.; Gundersen, J. O.; Hagmann, C. A.; Hristov, V. V.; Lange, A. E.; Lim, M. A.; Lubin, P. M.; Mauskopf, P. D.; Meinhold, P. R.

1994-01-01

We present results from a four-frequency observation of a 6 deg x 0.6 deg strip of the sky centered near the star Gamma Ursae Minoris (GUM) during the fourth flight of the Millimeter-wave Anistropy experiment(MAX). The observation was made with a 1.4 deg peak-to-peak sinusoidal chop in all bands. The FWHM beam sizes were 0.55 deg +/- 0.05 deg at 3.5 per cm and 0.75 deg +/- 0.05 deg at 6, 9, and 14 per cm. During this observation significant correlated structure was observed at 3.5, 6 and 9 per cm with amplitudes similar to those observed in the GUM region during the second and third fligts of MAX. The frequency spectrum is consistent with cosmic microwave background (CMB) and inconsistent with thermal emission from interstellar dust. The extrapolated amplitudes of synchrotron and free-free emission are too small to account for the amplitude of the observed structure, If all of the structure is attributed to CMB anisotropy with a Gaussian autocorrelation function and a coherence angle of 25 min, then the most probable values of delta T/T(sub CMB) in the 3.5, 6 and 9 per cm bads are (4.3 +2.7/-1.6) x 10(exp -5), 2.8 (+4.3/-1/1) x 10(exp -5), and 3.5 (+3.0/-1.6) x 10(exp -5) (95% confidence upper and lower limits), respectively.

Gas sensing with AlGaN/GaN 2DEG channels

NARCIS (Netherlands)

Offermans, P.; Vitushinsky, R.; Crego-Calama, M.; Brongersma, S.H.

2011-01-01

AlGaN/GaN shows great promise as a generic platform for (bio-)chemical sensing because of its robustness and intrinsic sensitivity to surface charge or dipoles. Here, we employ the two-dimensional electron gas (2DEG) formed at the interface of AlGaN/GaN layers grown on Si substrates for the

Crystallography of [0 1 1]/54.7 deg. lath boundary and cementite in tempered 0.2C steel

International Nuclear Information System (INIS)

Wei Fugao; Tsuzaki, Kaneaki

2005-01-01

The crystallographic structures of the [0 1 1]/54.7 deg. lath boundary and the intralath and interlath cementite precipitates in a 0.2C steel tempered at 400 deg C have been observed by high resolution transmission electron microscopy and discussed in terms of the O-lattice model. The [0 1 1]/54.7 deg lath boundary which is composed of one Kurdjumov-Sachs variant (α1) and one Nishiyama-Wasserman variant (α2) is likely to facet on the (0 12 7) α1 //(5 19 14) α2 irrational plane. The O-lattice analysis indicated that the facet coincides with a plane with a high density of O-points. Intralath cementite obeys the Isaichev orientation relationship (OR) with ferrite and has a habit plane of (1 0 1) θ //(1 2 1) α . Interlath cementite precipitating on the [0 1 1]/54.7 deg boundary maintains a strict Bagaryatskii OR with the ferrite on one side of the boundary and has a (1 0 0) θ habit plane

The True Self: A Psychological Concept Distinct From the Self.

Science.gov (United States)

Strohminger, Nina; Knobe, Joshua; Newman, George

2017-07-01

A long tradition of psychological research has explored the distinction between characteristics that are part of the self and those that lie outside of it. Recently, a surge of research has begun examining a further distinction. Even among characteristics that are internal to the self, people pick out a subset as belonging to the true self. These factors are judged as making people who they really are, deep down. In this paper, we introduce the concept of the true self and identify features that distinguish people's understanding of the true self from their understanding of the self more generally. In particular, we consider recent findings that the true self is perceived as positive and moral and that this tendency is actor-observer invariant and cross-culturally stable. We then explore possible explanations for these findings and discuss their implications for a variety of issues in psychology.

Interdiffusion between U-Mo alloys and Al or Al alloys at 340 deg. C. Irradiation plan

International Nuclear Information System (INIS)

Fortis, A.M.; Mirandou, M.; Ortiz, M.; Balart, S.; Denis, A.; Moglioni, A.; Cabot, P.

2005-01-01

Out of reactor interdiffusion experiments between U-Mo alloys and Al alloys made close to fuel operation temperature are needed to validate the results obtained above 500 deg. C. A study of interdiffusion between U-Mo and Al or Al alloys, out and in reactor, has been initiated. The objective is to characterize the interdiffusion layer around 250 deg. C and study the influence of neutron irradiation. Irradiation experiments will be performed in the Argentine RA3 reactor and chemical diffusion couples will be fabricated by Friction Stir Welding (FSW) technique. In this work out-of-pile diffusion experiments performed at 340 deg. C are presented. Friction Stir Welding (FSW) was used to fabricate some of the samples. One of the results is the presence of Si, in the interaction layer, coming from the Al alloy. This is promising in the sense that the absence of Al rich phases may also be expected at low temperature. (author)

Theoretical Studies of Aqueous Systems above 25 deg C. 2. The Iron - Water System

Energy Technology Data Exchange (ETDEWEB)

Lewis, Derek

1971-09-15

A theoretical study of the iron-water system at elevated temperatures is reported. Values for the equilibrium constants for the principle reactions in the system up to 374 deg C, obtained by a method described previously, are given and equilibrium diagrams are presented that illustrate the results for 50, 150, 250 and 350 deg C. The results indicate that, among other things, the most important metal-bearing ions in the iron-water system at elevated temperatures are Fe(OH){sub 2}+, Fe(OH)+ and HFeO{sub 2}- The conditions for the stability of solid iron oxides are also examined. Finally, some limitations of the thermodynamic approach to corrosion problems are discussed briefly

Design of UHECR telescope with 1 arcmin resolution and 50 deg. field of view

CERN Document Server

Sasaki, M; Asaoka, Y

2002-01-01

A new telescope design based on Baker-Nunn optics is proposed for observation of ultra-high-energy cosmic rays (UHECRs). The optical system has an image resolution better than 0.02 deg. within a wide field of view of 50 deg. angular diameter. When combined with a high-quality imaging device, the proposed design enables the directions of UHECRs and high-energy neutrinos to be determined with an accuracy better than 1 arcmin. The outstanding resolution of this telescope allows charge-separated cosmic-rays to be resolved and the source to be determined accurately. This marked improvement in angular resolution will allow the multi-wavelength and 'multi-particle' observations of astronomical objects through collaboration with established astronomical observations.

The true cost of electric power. Summary for policymakers

Energy Technology Data Exchange (ETDEWEB)

Burtraw, Dallas; Knupnick, Alan [Resources for the Future, Washington, DC (United States). Center for Energy Economics and Policy

2012-06-15

This report examines the various methods that have been used to measure 'true' costs of electricity generation technologies and looks at how such estimates can be used in company decision-making and public policy to ensure that investments are directed at the electricity generation methods with the lowest true costs to investors and society. In some geographic areas, adequate data and methods exist to make a solid estimate of the total social costs of energy production. In those places where the data or methods (or both) are less robust, it is possible to use a benefits transfer approach that still gives stakeholders important guidance about the scale of the true costs of their investments and to get started in formulating policies to incorporate those costs into the market price.

True and Fair View: Incentive or Inhibitor for Creative Accounting?

Directory of Open Access Journals (Sweden)

Ciocan Claudia-Cătălina

2017-01-01

Full Text Available The objective of accounting is to present information about the financial position, changes forthe financial position and performance of an economic entity and the financial statements mustpresent a true and fair view of the economic reality for the enterprise concerned. Creativeaccounting is a present issue, a phenomenon that increases users mistrust in financial statements,being considered a manipulation of figures in order to obtain a favorable image, far from beingtrue. In order to address this issue, we analyzed several definitions and forms of this concept, andfollowed how they relate to the objective of the true and fair view. The paper points out that theinteraction between creative accounting and true and fair view can be regarded in a double way:on one side, taking into account the influence of creative accounting on the objective of the trueand fair view, and, on the other side, considering the influence of the perception of the true and fairview on the choice of these techniques.

Investigation on structural integrity of graphite component during high temperature 950degC continuous operation of HTTR

International Nuclear Information System (INIS)

Sumita, Junya; Shimazaki, Yosuke; Shibata, Taiju

2014-01-01

Graphite material is used for internal structures in high temperature gas-cooled reactor. The core components and graphite core support structures are so designed as to maintain the structural integrity to keep core cooling capability. To confirm that the core components and graphite core support structures satisfy the design requirements, the temperatures of the reactor internals are measured during the reactor operation. Surveillance test of graphite specimens and in-service inspection using TV camera are planned in conjunction with the refueling. This paper describes the evaluation results of the integrity of the core components and graphite core support structures during the high temperature 950degC continuous operation, a high temperature continuous operation with reactor outlet temperature of 950degC for 50 days, in high temperature engineering test reactor. The design requirements of the core components and graphite core support structures were satisfied during the high temperature 950degC continuous operation. The dimensional change of graphite which directly influences the temperature of coolant was estimated considering the temperature profiles of fuel block. The magnitude of irradiation-induced dimensional change considering temperature profiles was about 1.2 times larger than that under constant irradiation temperature of 1000degC. In addition, the programs of surveillance test and ISI using TV camera were introduced. (author)

Forced Rolling Oscillation of a 65 deg-Delta Wing in Transonic Vortex-Breakdown Flow

Science.gov (United States)

Menzies, Margaret A.; Kandil, Osama A.; Kandil, Hamdy A.

1996-01-01

Unsteady, transonic, vortex dominated flow over a 65 deg. sharp-edged, cropped-delta wing of zero thickness undergoing forced rolling oscillations is investigated computationally. The wing angle of attack is 20 deg. and the free stream Mach number and Reynolds number are 0.85 and 3.23 x 10(exp 6), respectively. The initial condition of the flow is characterized by a transverse terminating shock which induces vortex breakdown of the leading edge vortex cores. The computational investigation uses the time accurate solution of the laminar, unsteady, compressible, full Navier-Stokes equations with the implicit, upwind, Roe flux difference splitting, finite-volume scheme. While the maximum roll amplitude is kept constant at 4.0 deg., both Reynolds number and roll frequency are varied covering three cases of forced sinusoidal rolling. First, the Reynolds number is held at 3.23 x 10(exp 6) and the wing is forced to oscillate in roll around the axis of geometric symmetry at a reduced frequency of 2(pi). Second, the Reynolds number is reduced to 0.5 x 10(exp 6) to observe the effects of added viscosity on the vortex breakdown. Third, with the Reynolds number held at 0.5 x 10(exp 6), the roll frequency is reduced to 1(pi) to complete the study.

Study of plastic deformation peculiarities in CdS single crystals within the temperature range of 25 to 300 deg C

International Nuclear Information System (INIS)

Bulatova, T.M.

1990-01-01

By the method of stress relaxation dependences of platic deformation rate on effective strain in CdS monocrystals for the temperatures of 25-300 deg C both in the darkness and in the light are obtained. In the range of the temperatures up to 150 deg C deformation activation energy is determined, which correlates with the value of point defect diffusion activation energy in the crystal. Anomalous temperature dependence of plastic deformation rate, i.e. its decrease with the temperature increase in the range of 150-300 deg C is detected

Rotary balance data for a typical single-engine general aviation design for an angle-of-attack range of 8 deg to 90 deg. 1: Influence of airplane components for model D. [Langley spin tunnel tests

Science.gov (United States)

Ralston, J.

1983-01-01

The influence of airplane components, as well as wing location and tail length, on the rotational flow aerodynamics is discussed for a 1/6 scale general aviation airplane model. The airplane was tested in a built-up fashion (i.e., body, body-wing, body-wing-vertical, etc.) in the presence of two wing locations and two body lengths. Data were measured, using a rotary balance, over an angle-of-attack range of 8 deg to 90 deg, and for clockwise and counter-clockwise rotations covering an omega b/2V range of 0 to 0.9.

Islam, rappresentanza degli interessi religiosi e diritto comune europeo *

Directory of Open Access Journals (Sweden)

Gianfranco Macrì

2011-03-01

Full Text Available Contributo destinato alla pubblicazione negli Atti del Convegno: Europa e Islam. Ridiscutere i fondamenti per la disciplina delle libertà religiose, svoltosi a Salerno il 3 dicembre 2007. SOMMARIO: Premessa - 1. La società «reticolare» europea: sistema di governance e valori unificanti - 2. Europa e fenomeno religioso - 3. La sostanza del Trattato di Lisbona e il ruolo delle organizzazioni religiose - 4. Il dibattito interno all’Islam europeo - 5. La Carta dei musulmani d’Europa - 6. La rappresentanza degli interessi religiosi dell’Islam in Europa - Conclusioni.

A Case of True Hermaphroditism Presenting as a Testicular Tumour

Directory of Open Access Journals (Sweden)

Michelle Ceci

2015-01-01

Full Text Available True hermaphroditism represents only 5% cases of all of disorders of sexual differentiation (DSD and usually present in early childhood with ambiguous genitalia. Occasionally, cases might present later on in adolescence with problems of sexual maturation. Our case report presents a true hermaphrodite with normal male phenotype that presented as a left testicular mass, two years after being diagnosed with Sertoli cell only syndrome in the contralateral testis. Histological examination of the left testis showed ovarian, fallopian tube, myometrial, endometrial, and epididymal tissue. This combination of findings is found in approximately one-third of true hermaphrodites, but it is very rare to present clinically as an inguinoscrotal mass.

Boric acid - trilon B (glycine, acetylurea) - water systems at 25 deg C

International Nuclear Information System (INIS)

Skvortsov, V.G.; Rodionov, N.S.; Molodkin, A.K.; Fedorov, Yu.A.; Tsekhanskij, R.S.

1985-01-01

Boric acid-trilon B (glycine, acetylurea)-water systems are studied at 25 deg C by the methods of isothermal solubility densi- and refractometry. It is ascertained that all of them are of a simple eutonic type with a small salting-out effect of organic components on boric acid

Boric acid - trilon B (glycine, acetylurea) - water systems at 25 deg C

Energy Technology Data Exchange (ETDEWEB)

Skvortsov, V G; Rodionov, N S; Molodkin, A K; Fedorov, Yu A; Tsekhanskij, R S

1985-07-01

Boric acid-trilon B (glycine, acetylurea)-water systems are studied at 25 deg C by the methods of isothermal solubility densi- and refractometry. It is ascertained that all of them are of a simple eutonic type with a small salting-out effect of organic components on boric acid.

Cosmic chirality both true and false.

Science.gov (United States)

Barron, Laurence D

2012-12-01

The discrete symmetries of parity P, time reversal T, and charge conjugation C may be used to characterize the properties of chiral systems. It is well known that parity violation infiltrates into ordinary matter via an interaction between the nucleons and electrons, mediated by the Z(0) particle, that lifts the degeneracy of the mirror-image enantiomers of a chiral molecule. Being odd under P but even under T, this P-violating interaction exhibits true chirality and so may induce absolute enantioselection under all circumstances. It has been suggested that CP violation may also infiltrate into ordinary matter via a P-odd, T-odd interaction mediated by the (as yet undetected) axion. This CP-violating interaction exhibits false chirality and so may induce absolute enantioselection in processes far from equilibrium. Both true and false cosmic chirality should be considered together as possible sources of homochirality in the molecules of life. Copyright © 2012 Wiley Periodicals, Inc.

Systems of amonium polyborates - monoammonium phosphate -water at 25 deg C

International Nuclear Information System (INIS)

Skvortsov, V.G.; Sadetdinov, Sh.V.; Polenov, A.D.; Mikhajlov, V.I.

1992-01-01

It is established by solubility and refractometry methods at 25 deg C that systems of ammonium tetraborate (pentaborate) monoammonium phosphate-water refer to sumple eutonic type. The ammonium borates and monoammoniumphosphate exert salting effect over each other. It is found that phosphate borate compositions on the basis of ammonium salts are characterized by lower inhibitor properties as compared to sodium salts

Sodium nitrate-cerium nitrate-water ternary system at 25 deg C

International Nuclear Information System (INIS)

Fedorenko, T.P.; Onishchenko, M.K.

1978-01-01

Solubility isotherm of sodium nitrate-cerium nitrate-water system at 25 deg C consists of three crystallization branches of initial salts and double compound of the composition 2NaNO 3 xCe(NO 3 ) 3 x2H 2 O. Sodium nitrate introduced in the solution strengthens complexing. Physico-chemical characteristics are in a good agreement with solubility curve

Endovascular treatment of ruptured true posterior communicating artery aneurysms.

Science.gov (United States)

Yang, Yonglin; Su, Wandong; Meng, Qinghai

2015-01-01

Although true posterior communicating artery (PCoA) aneurysms are rare, they are of vital importance. We reviewed 9 patients with this fatal disease, who were treated with endovascular embolization, and discussed the meaning of endovascular embolization for the treatment of true PCoA aneurysms. From September 2006 to May 2012, 9 patients with digital substraction angiography (DSA) confirmed true PCoA aneurysms were treated with endovascular embolization. Patients were followed-up with a minimal duration of 17 months and assessed by Glasgow Outcome Scale (GOS) score. All the patients presented with spontaneous subarachnoid hemorrhage from the ruptured aneurysms. The ratio of males to females was 1:2, and the average age of onset was 59.9 (ranging from 52 to 72) years. The preoperative Hunt-Hess grade scores were I to III. All patients had recovered satisfactorily. No permanent neurological deficits were left. Currently, endovascular embolization can be recommended as the top choice for the treatment of most true PCoA aneurysms, due to its advanced technique, especially the application of the stent-assisted coiling technique, combined with its advantage of mininal invasiveness and quick recovery. However, the choice of treatment methods should be based on the clinical and anatomical characteristics of the aneurysm and the skillfulness of the surgeon.

A Deg-protease family protein in marine Synechococcus is involved in outer membrane protein organization

Directory of Open Access Journals (Sweden)

Rhona Kayra Stuart

2014-06-01

Full Text Available Deg-family proteases are a periplasm-associated group of proteins that are known to be involved in envelope stress responses and are found in most microorganisms. Orthologous genes SYNW2176 (in strain WH8102 and sync_2523 (strain CC9311 are predicted members of the Deg-protease family and are among the few genes induced by copper stress in both open ocean and coastal marine Synechococcus strains. In contrast to the lack of a phenotype in a similar knockout in Synechocystis PCC6803, a SYNW2176 knockout mutant in strain WH8102 was much more resistant to copper than the wild-type. The mutant also exhibited a significantly altered outer membrane protein composition which may contribute to copper resistance, longer lag phase after transfer, low-level consistent alkaline phosphatase activity, and an inability to induce high alkaline phosphatase activity in response to phosphate stress. This phenotype suggests a protein-quality-control role for SYNW2176, the absence of which leads to a constitutively activated stress response. Deg-protease family proteins in this ecologically important cyanobacterial group thus help to determine outer membrane responses to both nutrients and toxins.

Charge transport in 2DEG/s-wave superconductor junction with Dresselhaus-type spin-orbit coupling

International Nuclear Information System (INIS)

Sawa, Y.; Yokoyama, T.; Tanaka, Y.

2007-01-01

We study spin-dependent charge transport in superconducting junctions. We consider ballistic two-dimensional electron gas (2DEG)/s-wave superconductor junctions with Dresselhaus-type spin-orbit coupling (DSOC). We calculate the conductance normalized by that in the normal state of superconductor in order to study the effect of DSOC in 2DEG on conductance, changing the height of insulating barrier. We find the DSOC suppresses the conductance for low insulating barrier, while it can slightly enhance the conductance for high insulating barrier. It has a reentrant dependence on DSOC for middle strength insulating barrier. The effect of DSOC is weaken as the insulating barrier becomes high

Solar process for cold production at low temperature (-28 deg) by solid-gas sorption; Procede solaire de production de froid basse temperature (-28 deg) par sorption solide-gaz

Energy Technology Data Exchange (ETDEWEB)

Le Pierres, N.

2005-09-15

The aim of this work is the design and experimentation of a thermochemical process for cold production purpose at -28 deg. C using low grade heat (70 deg. C) supplied by flat plate solar collectors. An exergetic analysis of the thermo-chemical dipole and of ideal thermodynamic cycles led to the definition of an original solar process. This process involves two cascaded cycles functioning in parallel. The cycle is discontinuous and presents a day phase of heating and regeneration and a night phase of cold production. A dynamic simulation allowed the study of its functioning depending on the weather conditions and on the dimensions of the process. A prototype covering the needs of a cold chamber loosing 40 W of cold continuously was built and tested in real conditions in Perpignan. It demonstrated the feasibility of this innovative concept and validated the hypothesis used to develop the model. A study of the process functioning was lead by simulation in different meteorological conditions and for different heat sources (solar, geothermal or industrial waste). It showed the potentialities of the concept. (author)

FIRST DETERMINATION OF THE TRUE MASS OF CORONAL MASS EJECTIONS: A NOVEL APPROACH TO USING THE TWO STEREO VIEWPOINTS

International Nuclear Information System (INIS)

Colaninno, Robin C.; Vourlidas, Angelos

2009-01-01

The twin Sun Earth Connection Coronal and Heliospheric Investigation (SECCHI) COR2 coronagraphs of the Solar Terrestrial Relations Observatory (STEREO) provide images of the solar corona from two viewpoints in the solar system. Since their launch in late 2006, the STEREO Ahead (A) and Behind (B) spacecraft have been slowly separating from Earth at a rate of 22. 0 5 per year. By the end of 2007, the two spacecraft were separated by more than 40 deg. from each other. At that time, we began to see large-scale differences in the morphology and total intensity between coronal mass ejections (CMEs) observed with SECCHI-COR2 on STEREO-A and B. Due to the effects of the Thomson scattering geometry, the intensity of an observed CME is dependent on the angle it makes with the observed plane of the sky. From the intensity images, we can calculate the integrated line-of-sight electron density and mass. We demonstrate that it is possible to simultaneously derive the direction and true total mass of the CME if we make the simple assumption that the same mass should be observed in COR2-A and B.

Behavior of steels in flowing liquid PbBi eutectic alloy at 420-600 deg. C after 4000-7200 h

International Nuclear Information System (INIS)

Mueller, G.; Heinzel, A.; Konys, J.; Schumacher, G.; Weisenburger, A.; Zimmermann, F.; Engelko, V.; Rusanov, A.; Markov, V.

2004-01-01

This paper presents the results of steel exposure up to 7200 h in flowing LBE at elevated temperatures and is a follow-up paper of that with results of an exposure of up to 2000 h. The examined AISI 316 L, 1.4970 austenitic and MANET 10Cr martensitic steels are suitable as a structural material in LBE (liquid eutectic Pb 45 Bi 55 ) up to 550 deg. C, if 10 -6 wt% of oxygen is dissolved in the LBE. The martensitic steel develops a thick magnetite and spinel layer while the austenites have thin spinel surface layers at 420 deg. C and thick oxide scales like the martensitic steel at 550 deg. C. The oxide scales protect the steels from dissolution attack by LBE during the whole test period of 7200 h. Oxide scales that spall off are replaced by new protective ones. At 600 deg. C severe attack occurs already after 2000 and 4000 h of exposure. Steels with 8-15 wt% Al alloyed into the surface suffer no corrosion attack at all experimental temperatures and exposure times

True Faith in Faith and Knowledge

NARCIS (Netherlands)

Jonkers, P.H.A.I.

2003-01-01

This article deals with the diverging conceptions of faith that Hegel discusses in his essay Faith and Knowledge (1802). In order to modify the usual, negative image of Hegel’s attitude towards faith, which stresses its reflective character, I analyze his idea of a ‘true faith’. My conclusion is

Frege on Truths, Truth and the True

Directory of Open Access Journals (Sweden)

Wolfgang Künne

2008-08-01

Full Text Available The founder of modern logic and grandfather of analytic philosophy was 70 years old when he published his paper 'Der Gedanke' (The Thought in 1918. This essay contains some of Gottlob Frege's deepest and most provocative reflections on the concept of truth, and it will play a prominent role in my lectures. The plan for my lectures is as follows. What is it that is (primarily true or false? 'Thoughts', is Frege's answer. In §1, I shall explain and defend this answer. In §2, I shall briefly consider his enthymematic argument for the conclusion that the word 'true' resists any attempt at defining it. In §3, I shall discuss his thesis that the thought that things are thus and so is identical with the thought that it is true that things are thus and so. The reasons we are offered for this thesis will be found wanting. In §4, I shall comment extensively on Frege's claim that, in a non-formal language like the one I am currently trying to speak, we can say whatever we want to say without ever using the word 'true' or any of its synonyms. I will reject the propositional-redundancy claim, endorse the assertive-redundancy claim and deny the connection Frege ascribes to them. In his classic 1892 paper 'Über Sinn und Bedeutung' (On Sense and Signification Frege argues that truth-values are objects. In §5, I shall scrutinize his argument. In §6, I will show that in Frege's ideography (Begriffsschrift truth, far from being redundant, is omnipresent. The final §7 is again on truth-bearers, this time as a topic in the theory of intentionality and in metaphysics. In the course of discussing Frege's views on the objecthood, the objectivity of thoughts and the timelessness of truth(s, I will plead for a somewhat mitigated Platonism.

On-line Learning of Unlearnable True Teacher through Mobile Ensemble Teachers

Science.gov (United States)

Hirama, Takeshi; Hukushima, Koji

2008-09-01

The on-line learning of a hierarchical learning model is studied by a method based on statistical mechanics. In our model, a student of a simple perceptron learns from not a true teacher directly, but ensemble teachers who learn from a true teacher with a perceptron learning rule. Since the true teacher and ensemble teachers are expressed as nonmonotonic and simple perceptrons, respectively, the ensemble teachers go around the unlearnable true teacher with the distance between them fixed in an asymptotic steady state. The generalization performance of the student is shown to exceed that of the ensemble teachers in a transient state, as was shown in similar ensemble-teachers models. Furthermore, it is found that moving the ensemble teachers even in the steady state, in contrast to the fixed ensemble teachers, is efficient for the performance of the student.

Neural Global Pattern Similarity Underlies True and False Memories.

Science.gov (United States)

Ye, Zhifang; Zhu, Bi; Zhuang, Liping; Lu, Zhonglin; Chen, Chuansheng; Xue, Gui

2016-06-22

The neural processes giving rise to human memory strength signals remain poorly understood. Inspired by formal computational models that posit a central role of global matching in memory strength, we tested a novel hypothesis that the strengths of both true and false memories arise from the global similarity of an item's neural activation pattern during retrieval to that of all the studied items during encoding (i.e., the encoding-retrieval neural global pattern similarity [ER-nGPS]). We revealed multiple ER-nGPS signals that carried distinct information and contributed differentially to true and false memories: Whereas the ER-nGPS in the parietal regions reflected semantic similarity and was scaled with the recognition strengths of both true and false memories, ER-nGPS in the visual cortex contributed solely to true memory. Moreover, ER-nGPS differences between the parietal and visual cortices were correlated with frontal monitoring processes. By combining computational and neuroimaging approaches, our results advance a mechanistic understanding of memory strength in recognition. What neural processes give rise to memory strength signals, and lead to our conscious feelings of familiarity? Using fMRI, we found that the memory strength of a given item depends not only on how it was encoded during learning, but also on the similarity of its neural representation with other studied items. The global neural matching signal, mainly in the parietal lobule, could account for the memory strengths of both studied and unstudied items. Interestingly, a different global matching signal, originated from the visual cortex, could distinguish true from false memories. The findings reveal multiple neural mechanisms underlying the memory strengths of events registered in the brain. Copyright © 2016 the authors 0270-6474/16/366792-11$15.00/0.

Apparent and true resistant hypertension: definition, prevalence and outcomes.

Science.gov (United States)

Judd, E; Calhoun, D A

2014-08-01

Resistant hypertension, defined as blood pressure (BP) remaining above goal despite the use of > or =3 antihypertensive medications at maximally tolerated doses (one ideally being a diuretic) or BP that requires > or =4 agents to achieve control, has received more attention with increased efforts to improve BP control rates and the emergence of device-based therapies for hypertension. This classically defined resistant group consists of patients with true resistant hypertension, controlled resistant hypertension and pseudo-resistant hypertension. In studies where pseudo-resistant hypertension cannot be excluded (for example, 24-h ambulatory BP not obtained), the term apparent resistant hypertension has been used to identify 'apparent' lack of control on > or =3 medications. Large, well-designed studies have recently reported the prevalence of resistant hypertension. Pooling prevalence data from these studies and others within North America and Europe with a combined sample size of >600,000 hypertensive participants, the prevalence of resistant hypertension is 14.8% of treated hypertensive patients and 12.5% of all hypertensives. However, the prevalence of true resistant hypertension, defined as uncontrolled both by office and 24-h ambulatory BP monitoring with confirmed medication adherence, may be more meaningful in terms of identifying risk and estimating benefit from newer therapies like renal denervation. Rates of cardiovascular events and mortality follow mean 24-h ambulatory BPs in patients with resistant hypertension, and true resistant hypertension represents the highest risk. The prevalence of true resistant hypertension has not been directly measured in large trials; however, combined data from smaller studies suggest that true resistant hypertension is present in half of the patients with resistant hypertension who are uncontrolled in the office. Our pooled analysis shows prevalence rates of 10.1% and 7.9% for uncontrolled resistant hypertension among

Performance of MHD coatings in flowing Li at 700 deg

International Nuclear Information System (INIS)

Pint, B.; Pawel, S.J.; Howell, M.; Moser, J.L.; Garner, G.W.; Santella, M.L.; Tortorelli, P.F.; Di Stefano, J.R.

2007-01-01

Full text of publication follows: A thermal convection loop was constructed from V-4Cr-4Ti tubing and operated in vacuum at a maximum Li temperature of 700 deg. C for ∼1000 h.. Due to slow Li flow (∼1 cm/s) in the loop, the temperature gradient was ∼340 deg. C. Specimens in the hot and cold legs of the loop included V-4Cr-4Ti spacers, tensile specimens (SS-3 type) and coupons coated by physical vapor deposition with yttria and over coated with unalloyed vanadium. Based on prior work, the multi-layer electrically-insulating coatings were developed to reduce the magneto hydrodynamic (MHD) force expected in the first wall of a lithium cooled blanket in a magnetic confinement fusion reactor. Characterization of the specimens after exposure will include: (1) mass change and chemistry change as a function of location in the temperature gradient, (2) the effect of Li exposure on the tensile properties of V-4Cr-4Ti and (3) characterization of the properties and microstructure of the coatings after exposure. Of particular interest will be the coating resistivity after exposure and any degradation of the thin (∼10 μm) vanadium overlayer. Chemistry of the Li before and after the experiment will be compared in order to assess any mass transfer effects. (authors)

Creep crack growth in a reactor pressure vessel steel at 360 deg C

Energy Technology Data Exchange (ETDEWEB)

Wu, Rui; Seitisleam, F; Sandstroem, R [Swedish Institute for Metals Research, Stockholm (Sweden)

1999-12-31

Plain creep (PC) and creep crack growth (CCG) tests at 360 deg C and post metallography were carried out on a low alloy reactor pressure vessel steel (ASTM A508 class 2) with different microstructures. Lives for the CCG tests were shorter than those for the PC tests and this is more pronounced for simulated heat affected zone microstructure than for the parent metal at longer lives. For the CCG tests, after initiation, the cracks grew constantly and intergranularly before they accelerated to approach rupture. The creep crack growth rate is well described by C*. The relations between reference stress, failure time and steady crack growth rate are presented for the CCG tests. It is demonstrated that the failure stress due to CCG is considerably lower than the yield stress at 360 deg C. Consequently, the CCG will control the static strength of a reactor vessel. (orig.) 17 refs.

Creep crack growth in a reactor pressure vessel steel at 360 deg C

Energy Technology Data Exchange (ETDEWEB)

Rui Wu; Seitisleam, F.; Sandstroem, R. [Swedish Institute for Metals Research, Stockholm (Sweden)

1998-12-31

Plain creep (PC) and creep crack growth (CCG) tests at 360 deg C and post metallography were carried out on a low alloy reactor pressure vessel steel (ASTM A508 class 2) with different microstructures. Lives for the CCG tests were shorter than those for the PC tests and this is more pronounced for simulated heat affected zone microstructure than for the parent metal at longer lives. For the CCG tests, after initiation, the cracks grew constantly and intergranularly before they accelerated to approach rupture. The creep crack growth rate is well described by C*. The relations between reference stress, failure time and steady crack growth rate are presented for the CCG tests. It is demonstrated that the failure stress due to CCG is considerably lower than the yield stress at 360 deg C. Consequently, the CCG will control the static strength of a reactor vessel. (orig.) 17 refs.

Differentiating true and false schematic memories in older adults.

Science.gov (United States)

Webb, Christina E; Dennis, Nancy A

2018-02-06

While schemas aid memory for schematically related information, the gist induced by the schema can also lead to high rates of false memories, especially in older adults. The neural mechanisms that support and differentiate true and false memories in aging are not well understood. The current study sought to clarify this, using a novel scene paradigm to investigate the role of schemas on true and false memories in older adults. Healthy older adults encoded schematic scenes (e.g., bathroom). At retrieval, participants were tested on their memory for both schematic and non-schematic targets and lures while fMRI data was collected. Results indicate that true memories were supported by the typical retrieval network, and activity in this network was greater for true than false memories. Schema specific retrieval was supported by mPFC, extending this common finding to aging. While no region differentiated false memories compared to correct rejections, results showed that individual differences in false memory rates were associated with variability in neural activity. The findings underscore the importance of elucidating the neural basis of cognition within older adults, as well as the specific contribution of individual differences to the neural basis of memory errors in aging. © The Author(s) 2018. Published by Oxford University Press on behalf of The Gerontological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

The Codice digitale degli archivi veronesi. A research instrument

Directory of Open Access Journals (Sweden)

Andrea Brugnoli

2014-04-01

Full Text Available The Codice digitale degli archivi veronesi (Verona’s archives digital code ‹http://cdavr.dtesis.univr.it› makes available online the digital reproductions of the documents produced by corporate bodies and family of Verona between the eighth and twelfth century. The framework of the site reflects the current organisation of the archives. A brief description of the circumstances around the creation of each archive, the corporate body or individual responsible for it and its structure is provided. Each archival unit is identified by its key elements: chronological date, name and qualification of the notary, original/copy, main editions.

Estimating true instead of apparent survival using spatial Cormack-Jolly-Seber models

Science.gov (United States)

Schaub, Michael; Royle, J. Andrew

2014-01-01

Survival is often estimated from capture–recapture data using Cormack–Jolly–Seber (CJS) models, where mortality and emigration cannot be distinguished, and the estimated apparent survival probability is the product of the probabilities of true survival and of study area fidelity. Consequently, apparent survival is lower than true survival unless study area fidelity equals one. Underestimation of true survival from capture–recapture data is a main limitation of the method.

Spectrophotometric study of holmium complexation in KOH solutions at 25 Deg C

International Nuclear Information System (INIS)

Stepanchikova, S.A.; Bitejkina, R.P.

2006-01-01

Complexation of Ho 3+ in solutions of HoCl 3 and KOH at 25 Deg C is studied by indicator spectrophotometric method. Within the range of pH 9.25-10.10 and μ≤4 x 10 -4 stability constants of Ho 3+ hydroxocomplexes are measured and are extrapolated on zero ion strength [ru

Increase of thermal conductivity of uranium dioxide nuclear fuel pellets with beryllium oxide addition; Condutividade termica de pastilhas de combustivel nuclear de UO{sub 2}-BeO nas temperaturas de 25 deg C e 100 deg C

Energy Technology Data Exchange (ETDEWEB)

Camarano, D.M.; Mansur, F.A.; Santos, A.M.M. dos; Ferraz, W.B., E-mail: dmc@cdtn.br [Centro de Desenvolvimento da Tecnologia Nuclear (CDTM/CNEN-MG), Belo Horizonte, MG (Brazil)

2016-07-01

The UO{sub 2} fuel is one of the most used nuclear fuel in thermal reactors and has many advantages such as high melting point, chemical compatibility with cladding, etc. However, its thermal conductivity is relatively low, which leads to a premature degradation of the fuel pellets due to a high radial temperature gradient during reactor operation. An alternative to avoid this problem is to increase the thermal conductivity of the fuel pellets, by adding beryllium oxide (BeO). Pellets of UO{sub 2} and UO{sub 2}-BeO were obtained from a homogenized mixture of powders of UO{sub 2} and BeO, containing 2% and 3% by weight of BeO and sintering at 1750 °C for 3 h under H{sub 2} atmosphere after uniaxial pressing at 400 MPa. The pellet densities were obtained by xylol penetration-immersion method and the thermal diffusivity, specific heat and thermal conductivity were determined according to ASTM E-1461 at room temperature (25 deg C) and 100 deg C. The thermal diffusivity measurements were carried out employing the laser flash method. The thermal conductivity obtained at 25 deg C showed an increase with the addition of 2% and 3% of BeO corresponding to 19% and 28%, respectively. As for the measurements carried out at 100 deg C, there was an increase in the thermal conductivity for the same BeO contents of 20% and 31%. These values as a percentage of increased conductivity were obtained in relation to the UO{sub 2} pellets. (author)

Filing false vice reports: Distinguishing true from false allegations of rape

NARCIS (Netherlands)

de Zutter, A.; Horselenberg, R.; van Koppen, P.J.

2017-01-01

False allegations constitute a problem since they may cause harm. To study the difference between true and false allegations we used a quasi-experimental approach. In the control condition likely true allegations were retrieved from criminal files. The victims, all female, were between the ages of

The Drosophila gene CheB42a is a novel modifier of Deg/ENaC channel function.

Directory of Open Access Journals (Sweden)

Yehuda Ben-Shahar

2010-02-01

Full Text Available Degenerin/epithelial Na(+ channels (DEG/ENaC represent a diverse family of voltage-insensitive cation channels whose functions include Na(+ transport across epithelia, mechanosensation, nociception, salt sensing, modification of neurotransmission, and detecting the neurotransmitter FMRFamide. We previously showed that the Drosophila melanogaster Deg/ENaC gene lounge lizard (llz is co-transcribed in an operon-like locus with another gene of unknown function, CheB42a. Because operons often encode proteins in the same biochemical or physiological pathway, we hypothesized that CHEB42A and LLZ might function together. Consistent with this hypothesis, we found both genes expressed in cells previously implicated in sensory functions during male courtship. Furthermore, when coexpressed, LLZ coprecipitated with CHEB42A, suggesting that the two proteins form a complex. Although LLZ expressed either alone or with CHEB42A did not generate ion channel currents, CHEB42A increased current amplitude of another DEG/ENaC protein whose ligand (protons is known, acid-sensing ion channel 1a (ASIC1a. We also found that CHEB42A was cleaved to generate a secreted protein, suggesting that CHEB42A may play an important role in the extracellular space. These data suggest that CHEB42A is a modulatory subunit for sensory-related Deg/ENaC signaling. These results are consistent with operon-like transcription of CheB42a and llz and explain the similar contributions of these genes to courtship behavior.

Release of fission products during and after oxidation of trace-irradiated uranium dioxide at 300-900 deg. C

Energy Technology Data Exchange (ETDEWEB)

Wood, P; Bannister, G H [Central Electricity Generating Board, Berkeley Nuclear Laboratories (United Kingdom)

1985-07-01

Should defected UO{sub 2} fuel pins come into contact with air then oxidation of the fuel may occur, the rate and consequences of which are dependent upon temperature and oxygen partial pressure. At CEGB-BNL an experimental programme is underway investigating the kinetics, and extent, of release of fission products during and after oxidation of trace-irradiated UO{sub 2} to U{sub 3}O{sub 8}, and reduction of U{sub 3}O{sub 8} to UO{sub 2}. This paper presents preliminary results and analysis of experiments performed at 300-900 deg. C. Dense sintered UO{sub 2} has been oxidised at 300-500 deg. C using a thermo balance with simultaneous counting of released {sup 85}Kr. The kinetics of the {sup 85}Kr release are shown to correlate with the kinetics of oxidation, and the extent of release has been determined as 3-8% of that in the UO{sub 2} converted to U{sub 3}O{sub 8}. The release of {sup 106}Ru and {sup 137}Cs during this oxidation has been estimated by {gamma}-counting of the fuel sample, before and after oxidation, and of glassware in the vicinity of the sample. This indicates slight release of ruthenium and caesium. Greater fission product release is caused by oxidation at higher temperatures or by heating of the oxidation product. U{sub 3}O{sub 8} produced at 400 deg. C has been heated at 800 and 900 deg. C in air for 20 hours. This results in near total release of {sup 85}Kr and {sup 106}Ru, but still only slight release of {sup 137}Cs. The kinetics of the {sup 85}Kr release have been analysed and found to follow the Booth diffusion equation at 900 deg. C, but not at 800 deg. C. The fuel burn-up level may also have an effect. Some results of fission product release during reduction of the oxidation product U{sub 3}O{sub 8} are presented, and the influence of chemical effects upon the release of individual fission products is discussed. The future programme is outlined. (author)

Inhibition between 350 and 500 deg. C of the corrosion of magnesium by damp air; Inhibition entre 350 et 500 deg. C de la corrosion du magnesium par l'air humide

Energy Technology Data Exchange (ETDEWEB)

Darras, Raymond; Caillat, Roger [Commissariat a l' energie atomique et aux energies alternatives - CEA (France)

1960-07-01

It has been demonstrated that the formation of a fluoride layer on the surface of magnesium by either dry or wet methods raises the temperature to which it resists corrosion in damp air from 350 to 490 deg. C. This protection effect could lead to a revision of the Pilling and Bedworth rule. Reprint of a paper published in 'Comptes Rendus des Seances de l'Academie des Sciences', tome 249, p. 1517-1519, sitting of 19 October 1959 [French] Il a ete montre que la formation d'une couche fluoree a la surface du magnesium, soit par voie seche, soit par voie humide, permet d'elever de 350 a 490 deg. C la temperature jusqu'a laquelle il resiste a la corrosion dans l'air humide. Cet effet protecteur pourrait conduire a revoir la regle de Pilling et Bedworth. Reproduction d'un article publie dans les 'Comptes Rendus des Seances de l'Academie des Sciences', tome 249, p. 1517-1519, seance du 19 octobre 1959.

Dishonest responding or true virtue?

DEFF Research Database (Denmark)

Zettler, Ingo; Hilbig, Benjamin E.; Moshagen, Morten

2015-01-01

but troubling proposition that high scores in impression management scales actually reflect honesty rather than dishonest responding. In line with findings indicating that respondents answer to personality questionnaires rather accurately in typical low demand situations, we herein suggest that high impression...... management scores indeed reflect true virtues rather than dishonesty under such conditions. We found support for this idea by replicating previous correlations between impression management scores and virtue-related basic personality traits (including honesty-humility), and additionally provided conclusive...

A constitutional investigation of the Mo-Pd-Rh ternary system at 1100deg C

International Nuclear Information System (INIS)

Guerler, R.; Pratt, J.N.

1991-01-01

Phase relations in the system Mo-Pd-Rh were studied at 1100deg C using conventionally melted and ultrarapidly solidified samples. Optical microscopy, X-ray diffraction, scanning electron microscopy and electron probe microanalysis were used for phase characterisation. The complete isothermal section at 1100deg C was established. The Mo bcc phase was found to have a very limited solid solution range whereas the ternary fcc solid solution originating on the Pd-Rh binary is the dominant phase in the system at this temperature. The centre of the isothermal is dominated by the ternary extension of the Mo-Rh hcp intermediate phase. The three phase (bcc+fcc+hcp) equilibrium region is located very near to the Mo-Pd binary system. No additional ternary intermediate phases were observed. The results are consistent with an isothermal section reported at higher temperatures. (orig.)

Molecular dynamics simulations of the interaction between 60 deg. dislocation and self-interstitial cluster in silicon

International Nuclear Information System (INIS)

Jing Yuhang; Meng Qingyuan; Zhao Wei

2009-01-01

Molecular dynamics simulations are performed to investigate the interaction between 60 deg. shuffle dislocation and tetrainterstitial (I 4 ) cluster in silicon, using Stillinger-Weber (SW) potential to calculate the interatomic forces. Based on Parrinello-Rahman method, shear stress is exerted on the model to move the dislocation. Simulation results show that the I 4 cluster can bend the dislocation line and delay the dislocation movement. During the course of intersection the dislocation line sections relatively far away from the I 4 cluster accelerate first, and then decelerate. The critical shear stress unpinning the 60 deg. dislocation from the I 4 cluster decreases as the temperature increases in the models.

Emotional content enhances true but not false memory for categorized stimuli.

Science.gov (United States)

Choi, Hae-Yoon; Kensinger, Elizabeth A; Rajaram, Suparna

2013-04-01

Past research has shown that emotion enhances true memory, but that emotion can either increase or decrease false memory. Two theoretical possibilities-the distinctiveness of emotional stimuli and the conceptual relatedness of emotional content-have been implicated as being responsible for influencing both true and false memory for emotional content. In the present study, we sought to identify the mechanisms that underlie these mixed findings by equating the thematic relatedness of the study materials across each type of valence used (negative, positive, or neutral). In three experiments, categorically bound stimuli (e.g., funeral, pets, and office items) were used for this purpose. When the encoding task required the processing of thematic relatedness, a significant true-memory enhancement for emotional content emerged in recognition memory, but no emotional boost to false memory (exp. 1). This pattern persisted for true memory with a longer retention interval between study and test (24 h), and false recognition was reduced for emotional items (exp. 2). Finally, better recognition memory for emotional items once again emerged when the encoding task (arousal ratings) required the processing of the emotional aspect of the study items, with no emotional boost to false recognition (EXP. 3). Together, these findings suggest that when emotional and neutral stimuli are equivalently high in thematic relatedness, emotion continues to improve true memory, but it does not override other types of grouping to increase false memory.

Deformation behaviour of type 316 steel at 400 deg. C

International Nuclear Information System (INIS)

Wood, D.S.; Williamson, K.

A variety of type 316 steel deformation tests at 400 deg. C involving a study of strain rate, stress increment, stress cycling and strain cycling effects are reported. It is concluded that very small ratchet strains may occur, but these are unlikely to be of engineering significance. It is also shown that in the absence of reversed plasticity the upper stress bound is represented by the monotonic stress-strain curve. Under reversed plasticity, significant cyclic hardening can occur and in this case the upper bound may be represented by the cyclic stress-strain curve

PLATONISTS AND GNOSTICS ON NEGATIVE THEOLOGY AND TRUE INNER SELF

Directory of Open Access Journals (Sweden)

VICTOR ALEXANDRU PRICOPI

2014-11-01

Full Text Available Late Antiquity is characterized by a strong search for human’s true nature. This is proper to almost all philosophical and religious movements in the first three Christian centuries. Christians, Gnostics, and philosophers of those days aim to find the true nature of man. In this study we will deal mainly with anthropology and gnoseology of Valentinian Gnostics and Platonists. In their case, knowledge of human nature is inextricably linked to knowledge of God's true nature. These thinkers say that the first Principle/the Father/the source of this universe is inherently unknowable, indescribable and unspeakable. However, God can be known, either through secret revelation (Gnostics or through a purely rational approach (Platonists. For these thinkers, the true knowledge of the Divine Principle and knowledge of the human being or the world we live in is carried out in a double sense. By knowing God is possible the knowledge of human nature, while knowing human nature unfolds the nature of the first Principle. This is due to the fact that although the creator is alien to this world, he is now here through man true nature. In other words, in man there is a spark of the divine that has fallen or was dropped in the sublunary world. These ideas are found in Plato’s Phaedrus, Meno or Phaedo and also in some Valentinian gnostic texts as Gospel of Truth, Tripartite Tractate, Gospel of Philip and Treatise on Resurrection. Therefore, in this paper we will analyze the Platonists conceptions about human nature in comparison to Gnostic conception of man, as it appears in Plato’s works and Coptic texts discovered in Egypt, at Nag Hammadi.

High-resolution 8-13 micron imaging of the planetary nebulae BD + 30 deg 3639 and NGC 6572

International Nuclear Information System (INIS)

Hora, J.L.; Hoffmann, W.F.; Deutsch, L.K.; Fazio, G.G.

1990-01-01

High-resolution midinfrared images of the planetary nebulae BD + 30 deg 3639 and NGC 6572 are presented at 8.3, 8.7, 9.8, 11.2, and 12.4 microns. Analysis of the maps of BD + 30 deg 3639 supports a model in which the infrared emission originates from two spatially distinct components, one which is responsible for the continuum radiation at 8-12 microns and the other which produces the emission-line features. The NGC 6572 images provides evidence for a previously undetected 11.2 micron UIR emission feature. Comparison with radio continuum maps indicates that the distribution of dust is similar to the distribution of ionized gas in each nebula. Various models of source morphology are also investigated. The planetary nebulae DB + 30 deg 3639 and NGC 6572 can be modeled by an optically thin cylinder or a prolate ellipsoid with enhanced equatorial emission. These models reproduce well the general features of the nebula, such as the bipolar lobes of emission and the ring structure. 67 refs

Chemical composition, true metabolisable energy content and ...

African Journals Online (AJOL)

The physical characteristics (thousand seed and hectolitre mass), chemical composition (dry matter, ash, crude protein (CP), ether extract, acid detergent fibre, neutral detergent fibre and mineral content), energy values (nitrogen corrected true metabolisable energy content (TMEn for roosters)) as well as the lysine and ...

Is It True That Smoking Causes Wrinkles?

Science.gov (United States)

Healthy Lifestyle Quit smoking Is it true that smoking causes wrinkles? Answers from J. Taylor Hays, M.D. Yes. So if you need another reason to motivate ... elastin, which are fibers that give your skin its strength and elasticity. As a result, skin begins ...

Higgs boson pair production at the photon linear collider in the two Higgs doublet model

International Nuclear Information System (INIS)

Asakawa, Eri; Harada, Daisuke; Okada, Yasuhiro; Kanemura, Shinya; Tsumura, Koji

2009-02-01

We calculate the cross section of the lightest Higgs boson pair production at the Photon Linear Collider in the two Higgs doublet model. We focus on the scenario in which the lightest Higgs boson has the standard model like couplings to gauge bosons. We take into account the one-loop correction to the hhh coupling as well as additional one-loop diagrams due to charged bosons to the γγ → hh helicity amplitudes. We discuss the impact of these corrections on the hhh coupling measurement at the Photon Linear Collider. (author)

Chemical composition, true nutrient digestibility, and true metabolizable energy of novel pet food protein sources using the precision-fed cecectomized rooster assay.

Science.gov (United States)

Deng, P; Utterback, P L; Parsons, C M; Hancock, L; Swanson, K S

2016-08-01

A wide variety of animal protein-based ingredients is commonly used in the pet food products. The raw ingredients and processing procedures used may greatly affect protein quality. Testing the quality of alternative protein sources is necessary and contributes to the sustainability of pet foods. The objective of this study was to test the chemical composition of 8 protein sources intended for use in dog and cat foods (calamari meal, pork peptone, alligator meal, lamb meal, venison meal, chicken meal, and 2 duck meals), and evaluate their true nutrient digestibility and nitrogen-corrected true ME (TMEn) using the precision-fed cecectomized rooster assay. Calamari meal and pork peptone had lower ash (4.4 and 3.6% of DM, respectively) but greater CP (88.1 and 80.5% of DM, respectively) and either greater or similar GE (5.6 and 5.3 kcal/g of DM, respectively) compared with alligator, lamb, venison, chicken, and duck meals (11.8 to 24.5% ash, 58.7 to 65.9% CP, and 4.6 to 5.3 kcal GE/g). Acid-hydrolyzed fat (AHF) was lower in calamari meal (8.7% of DM) compared with the other proteins tested (15.5-22.1% of DM). True nutrient digestibility was variable among the protein sources (52 to 79% of DM, 60 to 83% of OM, 78 to 92% of AHF, and 70 to 89% of GE) with pork peptone having the highest DM, AHF, and GE digestibility and calamari meal having the highest OM digestibility. True indispensable AA digestibility was highest for calamari meal, with all AA having a digestibility greater than 90%. Except for histidine, all indispensable AA had a digestibility over 85% for pork peptone. In contrast, true indispensable AA digestibility was lowest for lamb meal, with histidine having digestibility less than 70% and the other entire indispensable AA having digestibility between 72 and 88%. The TMEn of calamari meal (4.82 kcal/g DM and 86.9% of GE) was greater ( digestibility among protein sources intended for use in dog and cat foods and justifies further in vivo testing of novel

Studies on the true coincidence correction in measuring filter samples by gamma spectrometry

CERN Document Server

Lian Qi; Chang Yong Fu; Xia Bing

2002-01-01

The true coincidence correction in measuring filter samples has been studied by high efficiency HPGe gamma detectors. The true coincidence correction for a specific three excited levels de-excitation case has been analyzed, and the typical analytical expressions of true coincidence correction factors have been given. According to the measured relative efficiency on the detector surface with 8 'single' energy gamma emitters and efficiency of filter samples, the peak and total efficiency surfaces are fitted. The true coincidence correction factors of sup 6 sup 0 Co and sup 1 sup 5 sup 2 Eu calculated by the efficiency surfaces agree well with experimental results

Journalism as Justified True Belief

OpenAIRE

Lisboa, Sílvia; Benetti, Marcia

2015-01-01

If it is important to think of journalism as a form of knowledge, then how does it become knowledge? How does this process work? In order to answer this question, this article proposes a new understanding of journalism as a subject; presenting it as a justified true belief. We think of journalism being based on pillars of truth and justification, conditions necessary in order for Epistemology to grant it the status of knowledge. We address the concept of truth and show how journalistic report...

An evaluation of the +/-45 deg tensile test for the determination of the in-plane shear strength of composite materials

Science.gov (United States)

Kellas, S.; Morton, J.; Jackson, K. E.

1991-01-01

The applicability of the +/-45 deg tensile test for the determination of the in-plane shear strength of advanced composite laminates is studied. The assumptions used for the development of the shear strength formulas were examined, and factors such as the specimen geometry and stacking sequence were assessed experimentally. It was found that the strength of symmetric and balanced +/-45 deg laminates depends primarily upon the specimen thickness rather than the specimen width. These findings have important implications for the +/-45 deg tensile test which is recommended by several organizations for the determination of the in-plane shear stress/strain response and the shear strength of continuous fiber reinforced composites. Modifications to the recommended practices for specimen selection and shear strength determination are suggested.

A True Human Tail in a Neonate; Case report and literature review

Directory of Open Access Journals (Sweden)

Mahesh K. Pillai

2017-03-01

Full Text Available A true human tail is a benign vestigial caudal cutaneous structure composed of adipose, connective tissue, muscle, vessels, nerves and mechanoreceptors. A true human tail can be distinguished from a pseudotail as the latter is commonly associated with underlying spinal dysraphism, which requires specialised management. True human tails are very rare, with fewer than 40 cases reported to date. We report a healthy one-day-old male newborn who was referred to the Bharath Hospital, Kottayam, Kerala, India, in 2014 with a cutaneous appendage arising from the lumbosacral region. Magnetic resonance imaging of the spine ruled out spinal dysraphism. The appendage was removed by simple surgical excision. Clinicians should emphasise use of ‘true tail’ and ‘pseudotail’ as specific disparate terms as the clinical, radiological and histological findings of these conditions differ significantly, along with management strategies and outcomes.

Usefulness of true FISP cine MR imaging in patients with poor cardiac function

Energy Technology Data Exchange (ETDEWEB)

Sakuma, Toshiharu; Yamada, Naoaki; Motooka, Makoto; Enomoto, Naoyuki; Maeshima, Isamu; Matsuda, Kazuhide; Urayama, Shinichi; Ikeo, Miki [National Cardiovascular Center, Suita, Osaka (Japan)

2002-01-01

This study was done to assess the value of True FISP cine in patients with poor cardiac function. True FISP cine and FLASH cine imaging were performed on a 1.5 T machine. Both short axis and horizontal long axis imaging sections were used. The imaging sections used a Matrix (120 x 128), FOV (24 x 32 cm), and had a slice thickness of 8 mm. The imaging time for True FISP cine was 8 heart beats and 17 heart beats for FLASH cine. The contrast-to-noise ratio between the blood and myocardium (CNR) was measured at enddiastole and endsystole. The subjects in the study were 10 healty volunteers (average age 26.5{+-}3.2 years) and 12 patients with hypofunction (average age 53.9{+-}13.2 years). In the volunteers, the CNR of the short axis imaging was similar in both True FISP (24.6{+-}3.7) and FLASH (23.4{+-}5.9). In the patients with poor cardiac function however, the CNR of True FISP was larger than FLASH in both the short and long axis. In the short axis (22.7{+-}6.1 vs. 17.9{+-}5.3, P<0.01) and in the long axis (17.4{+-}4.3 vs. 9.3{+-}4.0, P<0.01). We conclude that True FISP cine has a higher contrast in a shorter imaging time than FLASH cine. True FISP cine is especially useful in patients with poor cardiac function. (author)

In-situ pH measurements and sample analyses in glass-iron-clay systems at 90 deg. C and 150 deg. C

International Nuclear Information System (INIS)

Rozsypal, Christophe; Mosser-Ruck, Regine; Truche, Laurent; Pignatelli, Isabella; Randi, Aurelien; Bartier, Daniele; Cathelineau, Michel; Michau, Nicolas

2012-01-01

Document available in extended abstract form only. The long term repository of long life and high activity radioactive waste consists in the burial of steel overpacks of vitrified waste in a clay-stone. As the natural interstitial fluid of the clay-stone is a potential corrosion enhancer for the containers, the viability of the repository requires previous data acquisition on the interactions between clays, water, metallic iron, and glass. A set of experiments have been performed in autoclaves at 90 deg. C (thermal peak of the site) in order to follow the pH evolution and to characterize fluids with time and solids at the end of the experiments. Another set of experiments at 150 deg. C have also been carried out in order to increase the rates of the involved chemical reactions and mineralogical transformations. The objectives of those two sets of experiments were to measure the in-situ pH, to study how it was influenced by various parameters, such as the presence of glass and/or iron, to estimate the increase of the CO 2 and H 2 pressures, and to analyze gas and liquids taken in the course or at the end of experiments and solids recovered at the end of the experiments. The initial aqueous solution simulating the natural interstitial fluid was made of 22 mM of sodium, 4 mM of calcium, 29.75 mM of chloride, and 0.25 mM of bromide as a tracer. The initial solution/clay mass ratio was 10 for all the experiments, the metallic iron/clay or glass/clay mass ratios were 0.1 or 0. The list of the experiments and their characteristics is given in Table (1). The first results concern the evolution of the in-situ pH during the A90pH experiment and are reported on Figure (1). The measurements started after a 48 hours stabilization time of the pH probe. The pH seemed to tend reaching a plateau after several weeks. (authors)

The "True and fair view" concept in Lithuanian accounting regulation

OpenAIRE

Rudžionienė, Kristina; Christauskas, Česlovas

2010-01-01

The "true and fair view" concept is very popular in the professional accountants’ language. After theoretical analysis of the "true and fair view" concept it was made research how understanding of this concept was created in Lithuanian accounting regulation. The stated purpose of financial statements is taken from the United Kingdom, and is different in the particular formulation. Additionally, it is not explained anywhere what it is and how to reach it. There are not specifically defined qua...

Influence of stress change on the fatigue behavior and fatigue life of aluminum oxide-dispersion-strengthening copper alloy at room temperature and 350degC

International Nuclear Information System (INIS)

Kawagoishi, Norio; Kondo, Eiji; Nisitani, Hironobu; Shimamoto, Atsunori; Tashiro, Rieko

2004-01-01

In order to investigate the influence of stress change on the fatigue behavior and fatigue life of an aluminum oxide-dispersion-strengthening copper alloy at elevated temperature, rotating bending fatigue tests were carried out under two-step loading at room temperature and 350degC. Both of static strength and fatigue strength decreased at 350degC. However, at the same relative stress σ a /σ B , fatigue life was longer at 350degC than at room temperature. Although the cumulative ratios Σ(N/N f ) were nearly unity for both the low to high and the high to low block loadings at room temperature, Miner's rule did not hold at 350degC. These results were related to the stress dependence on the log l-N/N f relation. That is, the crack length initiated at the same N/N f was larger in higher stress level at 350degC, whereas there was no stress dependence in the relation at room temperature. The stress dependence on the relation at 350degC was caused by the suppression of crack initiation due to the surface oxidation. (author)

Investigation of the thermal stability of 210 deg. C TL peak of quartz and dating the components of terrazzo from the monastery church of Tegernsee

International Nuclear Information System (INIS)

Goeksu, H.Y.; Schwenk, P.; Semiochkina, N.

2001-01-01

The lifetime of the thermoluminescence (TL) peak of quartz observed at 210 deg. C using 5 deg. C/s heating rate is assessed using well-dated thermally isolated bricks from a monastery and exposed bricks from warmer climatic zones by comparing the absorbed dose obtained using the 210 deg. C TL peak with those obtained from 310 deg. C TL peak. The lifetimes of the 210 deg. C TL peak calculated for samples collected from thermally isolated excavations and exposed buildings are found to be clustered around 8000-10000 and 600-800 years, respectively. The results proved that 210 deg. C TL peak could be used for dating of samples younger than 1000 years without thermal correction if the samples are thermally isolated from their environment. TL ages are obtained using quartz, polyminerals from brick pieces as well as flint splinters, and other quartz inclusions extracted from the mortar of the terrazzo floor of the monastery church. The measured TL ages and the consistency of the results are discussed. The fine grains in the mortar, which contained calcite/aragonite, could not be dated using thermoluminescence due to presence of a very strong non-radiation induced TL glow

Educazione linguistica e bisogni degli alunni (stranieri.

Directory of Open Access Journals (Sweden)

Marina Chini

2009-12-01

Full Text Available Normal 0 14 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Tabella normale"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin:0cm; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:10.0pt; font-family:"Times New Roman";} L’articolo focalizza l’attenzione sui bisogni linguistici e comunicativi specifici degli allievi nativi e immigrati, al fine di evidenziare alcuni suggerimenti che è possibile trarne sul piano dell’educazione linguistica, intesa nel senso dell’insegnamento rivolto allo sviluppo e al potenziamento delle abilità linguistico-comunicative, ma anche metalinguistiche, svolto trasversalmente dai docenti di discipline linguistiche e non.  Tenendo conto di principi e suggerimenti emersi dalla riflessione glottodidattica e linguistica degli ultimi decenni si forniscono criteri in base ai quali i docenti possono rilevare i bisogni linguistici dei loro allievi, bisogni che si correlano a valenze di carattere comunicativo, pragmatico, espressivo e culturale-matetico, ma che sono anche di natura sociale, relazionale e affettiva, identitaria e psicologica oltre che cognitiva.  Normal 0 14 MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Tabella normale"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin:0cm; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:10.0pt; font-family:"Times New Roman";} The article focuses on the specific linguistic and communicative needs of native and immigrant pupils, in order to draw attention to inspiration  that can be gained for general linguistic education, seen as teaching that aims to develop and strengthen linguistic-communicative abilities but also meta-linguistic ones – teaching that is carried

High levels of DegU-P activate an Esat-6-like secretion system in Bacillus subtilis.

Directory of Open Access Journals (Sweden)

Catarina Baptista

Full Text Available The recently discovered Type VII/Esat-6 secretion systems seem to be widespread among bacteria of the phyla Actinobacteria and Firmicutes. In some species they play an important role in pathogenic interactions with eukaryotic hosts. Several studies have predicted that the locus yukEDCByueBC of the non-pathogenic, Gram-positive bacterium Bacillus subtilis would encode an Esat-6-like secretion system (Ess. We provide here for the first time evidences for the functioning of this secretion pathway in an undomesticated B. subtilis strain. We show that YukE, a small protein with the typical features of the secretion substrates from the WXG100 superfamily is actively secreted to culture media. YukE secretion depends on intact yukDCByueBC genes, whose products share sequence or structural homology with known components of the S. aureus Ess. Biochemical characterization of YukE indicates that it exists as a dimer both in vitro and in vivo. We also show that the B. subtilis Ess essentially operates in late stationary growth phase in absolute dependence of phosphorylated DegU, the response regulator of the two-component system DegS-DegU. We present possible reasons that eventually have precluded the study of this secretion system in the B. subtilis laboratory strain 168.

Corrosion of stainless steels in lead-bismuth eutectic up to 600 deg. C

International Nuclear Information System (INIS)

Soler, L.; Martin, F.J.; Hernandez, F.; Gomez-Briceno, D.

2004-01-01

An experimental program has been carried out to understand the differences in the corrosion behaviour between different stainless steels: the austenitic steels 304L and 316L, the martensitic steels F82Hmod, T91 and EM10, and the low alloy steel P22. The influence of oxygen level in Pb-Bi, temperature and exposure time is studied. At 600 deg. C, the martensitic steels and the P22 steel exhibit thick oxide scales that grow with time, following a linear law for the wet environment and a parabolic law for the dry one. The austenitic stainless steels show a better corrosion behaviour, especially AISI 304L. Under reducing conditions, the steels exhibit dissolution, more severe for the austenitic stainless steels. At 450 deg. C, all the materials show an acceptable behaviour provided a sufficient oxygen level in the Pb-Bi. At reducing conditions, the martensitic steels and the P22 steel have a good corrosion resistance, while the austenitic steels exhibit already dissolution at the longer exposures

Effects of heat treatments and neutron irradiation on the physical and mechanical properties of copper alloys at 100 deg. C

International Nuclear Information System (INIS)

Singh, B.N.; Eldrup, M.; Toft, P.; Edwards, D.J.

1998-05-01

The final irradiation experiment in a series of screening experiments aimed at investigating the effects of bonding and bakeout thermal cycles on irradiated copper alloys is described herein. Tensile specimens of CuCrZr and CuNiBe alloys were given various heat treatments corresponding to solution anneal, prime-ageing and bonding thermal treatment. Additional specimens were reaged and given a reactor bakeout treatment at 350 deg. C for 100 h. GlidCop TM CuAl-15 (previously referred to as CuAl-25) was given a heat treatment corresponding to a bonding thermal cycle only. Specimens were neutron irradiated at 100 deg. C to a dose level of ∼0.3 dpa. Post-irradiation tensile tests at (100 deg. C), electrical resistivity measurements (at 23 deg. C), and microstructural examinations were performed. The post-irradiation tests at 100 deg. C revealed that the greatest loss of ductility occurred in the CuCrZr alloys irradiated at 100 deg. C, irrespective of the pre-irradiation heat treatment, with the uniform elongation dropping to levels of less than 1.5%. The yield and ultimate strengths for all of the individual heat treated samples increased substantially after irradiation. The same trend was observed for the CuNiBe alloys, which exhibited much higher uniform elongation and strength after irradiation than that observed in the case of CuCrZr alloys. In both alloys irradiation-induced precipitation lead to a large increase in the strength of the solution annealed specimens with a noticeable decrease in uniform elongation. The CuAl-25 alloy also experienced an increase in the overall strength of the alloy after irradiation, accompanied by approximately a 50% decrease in the uniform and total elongation. The additional bakeout treatments given to the CuCrZr and CuNiBe before irradiation served to increase the strength, but in terms of the ductility no improvement or degradation resulted from the additional thermal exposure

Diagnostic pitfalls associated with a large true posterior communicating artery aneurysm: a case report.

Science.gov (United States)

Nagatani, Kimihiro; Otani, Naoki; Seno, Soichiro; Takeuchi, Satoru; Wada, Kojiro; Mori, Kentaro

2013-10-01

True posterior communicating artery (PCoA) aneurysm is an aneurysm that originates from the PCoA, and large or giant true PCoA aneurysms are rare. We report a case of a large true PCoA aneurysm successfully clipped after anterior clinoidectomy and discuss the diagnostic pitfalls associated with this rare clinical entity.

Usefulness of true FISP cine MR imaging in patients with poor cardiac function

International Nuclear Information System (INIS)

Sakuma, Toshiharu; Yamada, Naoaki; Motooka, Makoto; Enomoto, Naoyuki; Maeshima, Isamu; Matsuda, Kazuhide; Urayama, Shinichi; Ikeo, Miki

2002-01-01

This study was done to assess the value of True FISP cine in patients with poor cardiac function. True FISP cine and FLASH cine imaging were performed on a 1.5 T machine. Both short axis and horizontal long axis imaging sections were used. The imaging sections used a Matrix (120 x 128), FOV (24 x 32 cm), and had a slice thickness of 8 mm. The imaging time for True FISP cine was 8 heart beats and 17 heart beats for FLASH cine. The contrast-to-noise ratio between the blood and myocardium (CNR) was measured at enddiastole and endsystole. The subjects in the study were 10 healty volunteers (average age 26.5±3.2 years) and 12 patients with hypofunction (average age 53.9±13.2 years). In the volunteers, the CNR of the short axis imaging was similar in both True FISP (24.6±3.7) and FLASH (23.4±5.9). In the patients with poor cardiac function however, the CNR of True FISP was larger than FLASH in both the short and long axis. In the short axis (22.7±6.1 vs. 17.9±5.3, P<0.01) and in the long axis (17.4±4.3 vs. 9.3±4.0, P<0.01). We conclude that True FISP cine has a higher contrast in a shorter imaging time than FLASH cine. True FISP cine is especially useful in patients with poor cardiac function. (author)

THE CONFLICT BETWEEN THE TRUE AND FAIR VIEW AND THE PRUDENCE IN ROMANIAN ACCOUNTING

Directory of Open Access Journals (Sweden)

Violeta Isai

2015-05-01

Full Text Available In the accounts of Romania, the principle of true and fair view and the prudence principle are in a relationship of mutual conditioning. True and fair view has its origins in Anglo-Saxon accounting, the British, and English translation of the expression is "true and fair view". In the context of Romania's national, a first reference to the concept of true and fair view a we identify in the root Accounting Law No 82/1991 which lays down that objective accounting- ensuring accurate image, clear, and complete heritage of the financial situation and the results. Prudence is to be found in sincerity (in the direction of the present in the financial statements facts which might influence the recipient information and should serve the concept of true and fair view.

Posttraumatic True Aneurysm of the Axillary Artery Following Blunt Trauma

Directory of Open Access Journals (Sweden)

Tugrul Goncu

2010-01-01

Full Text Available The majority of the axillary artery aneurysm cases arise as pseudoaneurysms secondary to blunt or iatrogenic trauma. Isolated traumatic true axillary artery aneurysm is a relatively unusual disorder and generally occurs with repetitive blunt trauma. A 22-year-old female patient with distal axillary artery true aneurysm due to simple blunt axillothoracic trauma is presented. The aneurysm was excised with subpectoral-axillary approach and saphenous vein graft interposition was applied. Long-term follow-up with the patient was uneventful.

SURVEY METHODS FOR EARTHQUAKE DAMAGES IN THE "CAMERA DEGLI SPOSI" OF MANTEGNA (MANTOVA

Directory of Open Access Journals (Sweden)

E. Fratus de Balestrini

2013-07-01

Full Text Available Cultural Heritage constitutes a fundamental resource for all Countries, even in economic terms, as it can be considered an extraordinary tourist attraction. This is particularly true for Italy, which is one of the Countries with the richest artistic heritage in the world. For this reason, restoration becomes an essential step towards the conservation and therefore valorisation of architecture. In this context, this paper focuses on one of the first stages that allow us to reach a complete knowledge of a building. Because of the earthquake of May 2012, the Castle of San Giorgio in Mantova (Italy presented a series of structural damages. On the occasion of its upcoming re-opening to the public, the Soprintendenza per i Beni Architettonici e Paesaggistici per le province di Brescia, Cremona e Mantova has requested an analysis and evaluation of the damages for the development of an intervention project. In particular, a special attention was given to the "Camera degli Sposi" ("Bridal Chamber", also known as the Camera picta ("painted chamber". It is a frescoed room, with illusionistic paintings by Andrea Mantegna, located in the northeast tower of the Castle. It was painted between 1465 and 1474 and commissioned by Ludovico Gonzaga, and it is well-known for the use of trompe l'oeil details and for the decoration of its ceiling. The seismic shakes damaged the wall decorated with the "Scena della Corte" ("Court Scene", above the chimney, re-opening an old crack that had to be analysed, in order to understand whether the damage was structural or just superficial. The diagnostic analyses constitute a fundamental prerequisite for the elaboration of any kind of intervention or restoration in any architectural, artistic or archaeological framework. To obtain a description of the conservation state of the Camera, non-invasive integrated survey techniques were applied. The purpose of the study presented here is the definition of a methodology able to support

The Dream Comes True in the Golden Hall

Institute of Scientific and Technical Information of China (English)

JianZhong; ChenJianguo

2004-01-01

Nanjing Traditional Music Ensemble has long dreamed of performing in Vienna's Golden Hall.Now the dream has come true.the whole troupe felt so exciting that they did not even sleep well during the flight.

AN XMM-NEWTON SURVEY OF THE SOFT X-RAY BACKGROUND. I. THE O VII AND O VIII LINES BETWEEN l = 120 DEG. AND l = 240 DEG

International Nuclear Information System (INIS)

Henley, David B.; Shelton, Robin L.

2010-01-01

We present measurements of the soft X-ray background (SXRB) O VII and O VIII intensity between l = 120 deg. and l = 240 deg., the first results of a survey of the SXRB using archival XMM-Newton observations. We do not restrict ourselves to blank-sky observations, but instead use as many observations as possible, removing bright or extended sources by hand if necessary. In an attempt to minimize contamination from near-Earth solar wind charge exchange (SWCX) emission, we remove times of high solar wind proton flux from the data. Without this filtering we are able to extract measurements from 586 XMM-Newton observations. With this filtering, ∼1/2 of the observations are rendered unusable, and we are able to extract measurements from 303 observations. The oxygen intensities are typically ∼0.5-10 photons cm -2 s -1 sr -1 (line units, L.U.) for O VII and ∼0-5 L.U. for O VIII. The proton flux filtering does not systematically reduce the oxygen intensities measured from a given observation. However, the filtering does preferentially remove the observations with higher oxygen intensities. Our data set includes 69 directions with multiple observations, whose oxygen intensity variations can be used to constrain SWCX models. One observation exhibits an O VII enhancement of ∼25 L.U. over two other observations of the same direction, although most SWCX enhancements are ∼ 6 K, in good agreement with previous studies.

Biological effects of diethylene glycol (DEG) and produced waters (PWs) released from offshore activities: A multi-biomarker approach with the sea bass Dicentrarchus labrax

Energy Technology Data Exchange (ETDEWEB)

Stefania, Gorbi; Maura, Benedetti [Dipartimento di Biochimica, Biologia e Genetica, Universita Politecnica delle Marche, Via Ranieri, Monte d' Ago, 60121 Ancona (Italy); Claudia, Virno Lamberti [Istituto Superiore per la Ricerca e la Protezione Ambientale (ISPRA), Via di Casalotti 300 Roma (Italy); Barbara, Pisanelli [Dipartimento di Biochimica, Biologia e Genetica, Universita Politecnica delle Marche, Via Ranieri, Monte d' Ago, 60121 Ancona (Italy); Ginevra, Moltedo [Istituto Superiore per la Ricerca e la Protezione Ambientale (ISPRA), Via di Casalotti 300 Roma (Italy); Francesco, Regoli, E-mail: f.regoli@univpm.i [Dipartimento di Biochimica, Biologia e Genetica, Universita Politecnica delle Marche, Via Ranieri, Monte d' Ago, 60121 Ancona (Italy)

2009-11-15

Diethylene glycol (DEG) is largely used during oil and gas exploitation by offshore platforms. The aim of this work was to investigate if this compound induces direct molecular/cellular effects in marine organisms, or indirectly modulate those of produced waters (PWs). Sea bass (Dicentrarchus labrax) were exposed to DEG dosed alone or in combination with PWs from an Adriatic platform. A wide array of analysed biomarkers included cytochrome P450-dependent enzymatic activity, bile metabolites, glutathione S-transferases, acetylcholinesterase, peroxisomal proliferation, antioxidant defences (catalase, glutathione reductase, glutathione peroxidases, glutathione), total oxyradical scavenging capacity, malondialdehyde and DNA integrity (single strand breaks and frequency of micronuclei). Results did not reveal marked effects of DEG, while PWs influenced the biotransformation system, the oxidative status and the onset of genotoxic damages. Co-exposures caused only limited differences of biomarker responses at some experimental conditions, overall suggesting a limited biological impact of DEG at levels normally deriving from offshore activities. - A biological risk for marine organisms can be excluded for DEG concentrations as those normally associated to produced waters discharged in the Adriatic Sea.

Biological effects of diethylene glycol (DEG) and produced waters (PWs) released from offshore activities: A multi-biomarker approach with the sea bass Dicentrarchus labrax

International Nuclear Information System (INIS)

Stefania, Gorbi; Maura, Benedetti; Claudia, Virno Lamberti; Barbara, Pisanelli; Ginevra, Moltedo; Francesco, Regoli

2009-01-01

Diethylene glycol (DEG) is largely used during oil and gas exploitation by offshore platforms. The aim of this work was to investigate if this compound induces direct molecular/cellular effects in marine organisms, or indirectly modulate those of produced waters (PWs). Sea bass (Dicentrarchus labrax) were exposed to DEG dosed alone or in combination with PWs from an Adriatic platform. A wide array of analysed biomarkers included cytochrome P450-dependent enzymatic activity, bile metabolites, glutathione S-transferases, acetylcholinesterase, peroxisomal proliferation, antioxidant defences (catalase, glutathione reductase, glutathione peroxidases, glutathione), total oxyradical scavenging capacity, malondialdehyde and DNA integrity (single strand breaks and frequency of micronuclei). Results did not reveal marked effects of DEG, while PWs influenced the biotransformation system, the oxidative status and the onset of genotoxic damages. Co-exposures caused only limited differences of biomarker responses at some experimental conditions, overall suggesting a limited biological impact of DEG at levels normally deriving from offshore activities. - A biological risk for marine organisms can be excluded for DEG concentrations as those normally associated to produced waters discharged in the Adriatic Sea.

Mood-congruent true and false memory: effects of depression.

Science.gov (United States)

Howe, Mark L; Malone, Catherine

2011-02-01

The Deese/Roediger-McDermott paradigm was used to investigate the effect of depression on true and false recognition. In this experiment true and false recognition was examined across positive, neutral, negative, and depression-relevant lists for individuals with and without a diagnosis of major depressive disorder. Results showed that participants with major depressive disorder falsely recognised significantly more depression-relevant words than non-depressed controls. These findings also parallel recent research using recall instead of recognition and show that there are clear mood congruence effects for depression on false memory performance. © 2011 Psychology Press, an imprint of the Taylor & Francis Group, an Informa business

Radiation fibrosis : differentiation from true hilar mass on plain chest film

International Nuclear Information System (INIS)

Baik, Jun Hyun; Ahn, Kook Jin; Park, Seog Hee; Shinn, Kyung Sub

1996-01-01

Radiation-induced fibrotic mass might masquerade as a true hilar tumor mass on a plain chest radiograph. We attempted to differentiate radiation fibrosis from a true hilar tumor using only a plain radiograph. Plain chest radiographs were obtained from seven patients who had developed radiation fibrosis simulating hilar mass after radiation therapy for lung cancer, and from 19 patients with lung cancer, a comparison group, who had not received radiation therapy. They were reviewed for the obliteration of the overlapped mediastinal and hilar anatomical silhouettes by the mass : pulmonary artery, heart or aorta border, and paraspinal line. All seven patients with radiation-induced fibrotic mass(bilateral lesion in two patients) showed obliteration of all three overlapped anatomical silhouettes of the mediastinum and hilum on chest radiographs. In the comparison group of 19 patients with a true hilar mass, there was, however, no case which demonstrated obliteration of all landmarks, Obliteration of all anatomical landmarks at the hilum and mediastinum may be a helpful clue in the differential diagnosis of radiation-induced fibrotic mass from true hilar mass on a plain radiograph, particularly when clinical information on previous radiation therapy is unavailable

“Intonazioni degli Ebrei” from Benedetto Marcello’s Estro poetico-armonico in Prague in 1729

Czech Academy of Sciences Publication Activity Database

Jonášová, Milada

2015-01-01

Roč. 52, č. 1 (2015), s. 5-54 ISSN 0018-7003 R&D Projects: GA ČR(CZ) GAP409/12/2563 Keywords : Benedetto Marcello * Intonazioni degli Ebrei * Prague Subject RIV: AL - Art, Architecture, Cultural Heritage

The impairment of true glomerular filtration rate in long-term cyclosporine-treated pediatric allograft recipients

International Nuclear Information System (INIS)

McDiarmid, S.V.; Ettenger, R.B.; Hawkins, R.A.; Senguttvan, P.; Busuttil, R.W.; Vargas, J.; Berquist, W.E.; Ament, M.E.

1990-01-01

We performed indium-111-DTPA plasma clearance studies in 61 pediatric kidney and liver recipients treated with cyclosporine to compare true glomerular filtration rate with calculated GFR (cGFR). The mean true GFR of 61.9 +/- 36.6 ml/min/1.73 m2 indicated renal impairment. The mean cGFR of 85.2 +/- 22.4 ml/min/1.73 m2 was significantly higher (P less than 0.001), and overestimated GFR by 38%. cGFR alone did not accurately reflect the degree of renal dysfunction. A group of 48 pediatric orthotopic liver transplant recipients was studied in more detail: 73% of these patients had a true GFR less than 70 ml/min/1.73 m2, while 85% had a true GFR below 90 ml/min/1.73 m2, the lower limit for normal GFR in children. The mean true GFR for patients treated more than 24 months with CsA was lower (P = 0.02) than patients treated with CsA for 12 to 24 months. OLT patients with normal true GFR (greater than 90 ml/min/1.73 m2) had significantly lower plasma CsA levels, and 50% of patients with a true GFR less than or equal to 50 ml/min/1.73 m2 had hypertension. There was no effect on true GFR of age, liver function, azathioprine use, or peritransplant treatment with other nephrotoxic drugs. We conclude that true GFR is significantly impaired in long-term CsA-treated allograft pediatric recipients. Calculations of GFR underestimate the degree of renal dysfunction. As patients treated greater than 24 months had the lowest true GFRs, the fall in GFR may be progressive

Thermocouple calibration facility for 2900 deg C high temperature and its applications

International Nuclear Information System (INIS)

Chen Daolong

1991-01-01

The construction and the performance characteristic of a 2900 deg C high temperature thermocouple calibration facility are described. The calibration error analysis is made. The test results of the calibration characteristics of high temperature thermocouples Mo/Nb, W-3Re/W-25Re, and W-1Mo/W-25Mo are given. The test result of temperature dependent resistivity of BeO made by this facility is given

Semantic processes leading to true and false memory formation in schizophrenia.

Science.gov (United States)

Paz-Alonso, Pedro M; Ghetti, Simona; Ramsay, Ian; Solomon, Marjorie; Yoon, Jong; Carter, Cameron S; Ragland, J Daniel

2013-07-01

Encoding semantic relationships between items on word lists (semantic processing) enhances true memories, but also increases memory distortions. Episodic memory impairments in schizophrenia (SZ) are strongly driven by failures to process semantic relations, but the exact nature of these relational semantic processing deficits is not well understood. Here, we used a false memory paradigm to investigate the impact of implicit and explicit semantic processing manipulations on episodic memory in SZ. Thirty SZ and 30 demographically matched healthy controls (HC) studied Deese/Roediger-McDermott (DRM) lists of semantically associated words. Half of the lists had strong implicit semantic associations and the remainder had low strength associations. Similarly, half of the lists were presented under "standard" instructions and the other half under explicit "relational processing" instructions. After study, participants performed recall and old/new recognition tests composed of targets, critical lures, and unrelated lures. HC exhibited higher true memories and better discriminability between true and false memory compared to SZ. High, versus low, associative strength increased false memory rates in both groups. However, explicit "relational processing" instructions positively improved true memory rates only in HC. Finally, true and false memory rates were associated with severity of disorganized and negative symptoms in SZ. These results suggest that reduced processing of semantic relationships during encoding in SZ may stem from an inability to implement explicit relational processing strategies rather than a fundamental deficit in the implicit activation and retrieval of word meanings from patients' semantic lexicon. Copyright © 2013 Elsevier B.V. All rights reserved.

Rehydration and microstructure of cement paste after heating at temperatures up to 300 deg. C

International Nuclear Information System (INIS)

Farage, M.C.R.; Sercombe, J.; Galle, C.

2003-01-01

This paper is concerned with the evolution of the microstructure of cementitious materials subjected to high temperatures and subsequent resaturation in the particular context of long-term storage of radioactive wastes, where diffusive and convective properties are of primary importance. Experimental results obtained by mercury intrusion porosimetry (MIP) are presented concerning the evolution of the pore network of ordinary portland cement (OPC) paste heated at temperatures varying between 80 and 300 deg. C. The consequences of heating on the macroscopic properties of cement paste are evaluated by measures of the residual gas permeabilities, elastic moduli and Poisson's ratio, obtained by nondestructive methods. Resaturation by direct water absorption and water vapour sorption are used to estimate the reversibility of dehydration. The results provide some evidence of the self-healing capacity of resaturated cement paste after heating at temperatures up to 300 deg. C

Oxidation kinetics of simulated metallic spent fuel in air at 200∼300 .deg. C

International Nuclear Information System (INIS)

Joo, J. S.; Yoo, K. S.; Jo, I. J.; Kook, D. H.; Lee, E. P.; Lee, J. C.; Bang, K. S.; Kim, H. D.

2003-01-01

In order to evaluate the long term storage safety study of the metallic spent fuel, U-5Zr, U-5Ti, U-5Ni, U-5Nb, and U-5Hf simulated metallic uranium alloys, known as corrosion resistant alloys, were fabricated and oxidized in oxygen gas at 200 .deg. C ∼ 300 .deg. C. All simulated metallic uranium alloys were more corrosion resistant than pure uranium metal, and corrosion resistance increases Nb, Ni, Ti, Zr, Hf in that order. The oxidation rates of uranium alloys determined and activation energy was calculated for each alloy. The matrix microstructure of the test specimens were analyzed using OM, SEM, and EPMA. It was concluded that Nb was the best acceptable alloying elements for reducing corrosion of uranium metal, and Ni, Ti were also considered to suitable as candidate

Spin-orbit coupling in InGaSb/InAlSb and InGaAs/InP 2DEGs

International Nuclear Information System (INIS)

Guzenko, Vitaliy A.; Schaepers, Thomas; Estevez, Sergio; Hardtdegen, Hilde; Akabori, Masashi; Sato, Taku; Suzuki, Toshi-kazu; Yamada, Syoji

2008-01-01

Spin-orbit interaction in high-mobility two-dimensional electron gases (2DEGs) formed in high indium content InGaAs-based and InGaSb-based quantum wells was studied. Magnetotransort measurements were performed at low temperatures in a wide range of magnetic field. Characteristic beating pattern in the Shubnikov-de Haas oscillations as well as the enhancement of magnetoconductance at B=0 T due to weak antilocalization (WAL) effect were observed. A comparison of the values of the Rashba spin-orbit coupling parameters estimated from analysis of the beatings with the ones obtained from the fit of the WAL curves showed a good agreement. A control over the strength of the Rashba coupling parameter in the InGaAs 2DEG was achieved by applying a gate voltage. We found that in particular range of the negative gate voltages no beatings can be observed anymore, whereas the weak antilocalization becomes more pronounced. Under such conditions analysis of the WAL is a reliable method to determine the strength of the spin-orbit interaction in 2DEGs

Changes in the microflora of Vienna sausages after irradiation with gamma-rays and storage at 10 deg C

International Nuclear Information System (INIS)

Ito, Hitoshi; Sato, Tomotaro

1973-01-01

The species of microorganisms which can grow on commercial viennas on the storage at 10 deg C were Lactobacillus, Streptococcus and yeasts. When the viennas specially made which did not contain preservatives in it were used for this investigation, growth of microorganisms such as Lactobacillus, Streptococcus, Micrococcus, Bacillus and yeasts were predominant on the storage at 10 deg C, and Pseudomonas and molds some time propagated. When smoked-viennas specially made for the National Project were used for preservation, growth of microorganisms consisted mainly of the species of Lactobacillus, Micrococcus, Acinetobacter, Flavobacterium, Streptococcus, Serratia, Corynebacterium and yeasts. Irradiation of viennas at 300 and 500 krad reduced the aforementioned flora to the Lactobacillus, Streptococcus, Acinetobacter and yeasts. The number of microorganisms on the viennas packed with nitrogen gas was not increased for 3 to 7 days by means of 300 krad irradiation, and extended the storage-life 2 to 3 times. When irradiated with a dose of 500 krad, the number of microorganisms was not increased for 9 to 14 days on the storage at 10 deg C. (author)

A study of non-ideal focus properties of 30deg parallel plate energy analyzers

International Nuclear Information System (INIS)

Fujisawa, A.; Iguchi, H.; Hamada, Y.

1993-12-01

A succinct model is proposed to describe non-ideal characteristics owing to electric field penetration into the drift region in actual parallel plate energy analyzers. A good agreement has been obtained between the theoretically expected and experimentally observed focus properties of the 30deg parallel plate analyzer. (author)

Phase equilibria in Dy-Cu-Al system at 500 deg C

International Nuclear Information System (INIS)

Kuz'ma, Yu.B.; Milyan, V.V.

1989-01-01

Using the methods of X-ray diffraction analysis a diagram of phase equilibria in Dy-Cu-Al system at 500 deg C is plotted. Boundaries of solid solutions on the basis of DyCu 2 , DyCu and DyAl 2 compounds are determined and homogeneity regions of ternary compounds Dy 2 (Cu, Al) 7 and Dy(CuAl) 5 are ascertained. Compounds DyCuAl 3 , Dy 4 Cu 4 Al 11 and Dy 5 Cu 6 Al 9 have been detected for the first time

Characteristics study of 2DEG transport properties of AlGaN/GaN and AlGaAs/GaAs-based HEMT

International Nuclear Information System (INIS)

Lenka, T. R.; Panda, A. K.

2011-01-01

Growth of wide bandgap material over narrow bandgap material, results into a two dimensional electron gas (2DEG) at the heterointerface due to the conduction band discontinuity. In this paper the 2DEG transport properties of AlGaN/GaN-based high electron mobility transistor (HEMT) is discussed and its effect on various characteristics such as 2DEG density, C-V characteristics and Sheet resistances for different mole fractions are presented. The obtained results are also compared with AlGaAs/GaAs-based HEMT for the same structural parameter as like AlGaN/GaN-based HEMT. The calculated results of electron sheet concentration as a function of the Al mole fraction are in excellent agreement with some experimental data available in the literature.

Chemical composition, true metabolisable energy content and ...

African Journals Online (AJOL)

aneldavh

116. Chemical composition, true metabolisable energy content and amino acid availability of grain legumes for poultry. T.S. Brand. 1, 2,3#. , D.A. Brandt. 1, 2,4 and C.W. ... alternatives (Wiseman, 1987; Brand et al., 1995). ..... The Ca, P and trace element concentrations for lupins, faba beans and peas recorded in the present.

Chernobyl, the true, the false and the uncertain

International Nuclear Information System (INIS)

1996-04-01

This work makes the part between the true and the false information in France about the Chernobyl accident that have been read in different newspapers during the last years. This document is divide in three parts: what is true, what is false, what is uncertain. In each part are noticed extracts from newspapers face to the synthesis of thoughts about them. It is the fourth edition, the first one was in April 1990, the second one was in 1992 after a report from IAEA on the radiological consequences, the third edition was born in 1994 with the emergence of thyroid cancers especially among children, this fourth edition of 1996 takes into account the sanitary report given by the World Health Organisation experts in 1995. It confirms the progression of thyroid cancers and the absence of any other cancer as well leukemia. (N.C.)

MODEL PENSKORAN PARTIAL CREDIT PADA BUTIR MULTIPLE TRUE-FALSE BIDANG FISIKA

OpenAIRE

Wasis Wasis

2013-01-01

Tujuan penelitian ini menghasilkan model penskoran politomus untuk respons butir multiple true-false, sehingga dapat mengestimasi secara lebih akurat kemampuan di bidang fisika. Pengembangan penskoran menggunakan Four-D model dan diuji akurasinya melalui penelitian empiris dan simulasi. Penelitian empiris menggunakan 15 butir multiple true-false yang diambil dari soal UMPTN tahun 1996-2006 dan dikenakan pada 410 mahasiswa baru FMIPA Universitas Negeri Surabaya angkatan tahun 2007. Respons pes...

Fluctuations in the cosmic microwave background on a 2.3 deg angular scale

International Nuclear Information System (INIS)

Calzolari, P.; Cortiglioni, S.; Mandolesi, N.

1982-01-01

The study of fluctuations in the temperature of the cosmic microwave background may provide important information on the origin of the large scale structures in the Universe. An experiment is in operation at Medicina (Bologna) for studying such temperature fluctuations on a 2 deg 3 angular scale at lambda=2.8 cm. Preliminary results seem to indicate ΔT/T -4

Estimating True Short-Term Consistency in Vocational Interests: A Longitudinal SEM Approach

Science.gov (United States)

Gaudron, Jean-Philippe; Vautier, Stephane

2007-01-01

This study aimed at estimating the correlation between true scores (true consistency) of vocational interest over a short time span in a sample of 1089 adults. Participants were administered 54 items assessing vocational, family, and leisure interests twice over a 1-month period. Responses were analyzed with a multitrait (MT) model, which supposes…

Effects of 42 deg. C hyperthermia on intracellular pH in ovarian carcinoma cells during acute or chronic exposure to low extracellular pH

International Nuclear Information System (INIS)

Wahl, Miriam L.; Bobyock, Suzanne B.; Leeper, Dennis B.; Owen, Charles S.

1997-01-01

Purpose: To determine whether intracellular pH (pH i ) is affected during hyperthermia in substrate-attached cells and whether acute extracellular acidification potentiates the cytotoxicity of hyperthermia via an effect on pH i . Methods and Materials: The pH i was determined in cells attached to extracellular matrix proteins loaded with the fluorescent indicator dye BCECF at 37 deg. C and during 42 deg. C hyperthermia at an extracellular pH (pH e ) of 6.7 or 7.3 in cells. Effects on pH i during hyperthermia are compared to effects on clonogenic survival after hyperthermia at pH e 7.3 and 6.7 of cells grown at pH e 7.3, or of cells grown and monitored at pH e 6.7. Results: The results show that pH i values are affected by substrate attachments. Cells attached to extracellular matrix proteins had better signal stability, low dye leakage and evidence of homeostatic regulation of pH i during heating. The net decrease in pH i in cells grown and assayed at pH e = 7.3 during 42 deg. C hyperthermia was 0.28 units and the decrease in low pH adapted cells heated at pH e = 6.7 was 0.14 units. Acute acidification from pH e = 7.3 to pH e = 6.7 at 37 deg. C caused an initial reduction of 0.5-0.8 unit in pH i , but a partial recovery followed during the next 60-90 min. Concurrent 42 deg. C hyperthermia caused the same initial reduction in pH i in acutely acidified cells, but inhibited the partial recovery that occurred during the next 60-90 min at 37 deg. C. After 4 h at 37 deg. C, the net change in pH i in acutely acidified cells was 0.30 pH unit, but at 42 deg. C is 0.63 pH units. The net change in pH i correlated inversely with clonogenic survival. Conclusions: Hyperthermia causes a pH i reduction in cells which was smaller in magnitude by 50% in low pH adapted cells. Hyperthermia inhibited the partial recovery from acute acidification that was observed at 37 deg. C in substrate attached cells, in parallel with a lower subsequent clonogenic survival

Wafer-level MOCVD growth of AlGaN/GaN-on-Si HEMT structures with ultra-high room temperature 2DEG mobility

Directory of Open Access Journals (Sweden)

Xiaoqing Xu

2016-11-01

Full Text Available In this work, we investigate the influence of growth temperature, impurity concentration, and metal contact structure on the uniformity and two-dimensional electron gas (2DEG properties of AlGaN/GaN high electron mobility transistor (HEMT structure grown by metal-organic chemical vapor deposition (MOCVD on 4-inch Si substrate. High uniformity of 2DEG mobility (standard deviation down to 0.72% across the radius of the 4-inch wafer has been achieved, and 2DEG mobility up to 1740.3 cm2/V⋅s at room temperature has been realized at low C and O impurity concentrations due to reduced ionized impurity scattering. The 2DEG mobility is further enhanced to 2161.4 cm2/V⋅s which is comparable to the highest value reported to date when the contact structure is switched from a square to a cross pattern due to reduced piezoelectric scattering at lower residual strain. This work provides constructive insights and promising results to the field of wafer-scale fabrication of AlGaN/GaN HEMT on Si.

Analyses of 2-DEG characteristics in GaN HEMT with AlN/GaN super-lattice as barrier layer grown by MOCVD.

Science.gov (United States)

Xu, Peiqiang; Jiang, Yang; Chen, Yao; Ma, Ziguang; Wang, Xiaoli; Deng, Zhen; Li, Yan; Jia, Haiqiang; Wang, Wenxin; Chen, Hong

2012-02-20

GaN-based high-electron mobility transistors (HEMTs) with AlN/GaN super-lattices (SLs) (4 to 10 periods) as barriers were prepared on (0001) sapphire substrates. An innovative method of calculating the concentration of two-dimensional electron gas (2-DEG) was brought up when AlN/GaN SLs were used as barriers. With this method, the energy band structure of AlN/GaN SLs was analyzed, and it was found that the concentration of 2-DEG is related to the thickness of AlN barrier and the thickness of the period; however, it is independent of the total thickness of the AlN/GaN SLs. In addition, we consider that the sheet carrier concentration in every SL period is equivalent and the 2-DEG concentration measured by Hall effect is the average value in one SL period. The calculation result fitted well with the experimental data. So, we proposed that our method can be conveniently applied to calculate the 2-DEG concentration of HEMT with the AlN/GaN SL barrier.

A True Open-Loop Synchronization Technique

DEFF Research Database (Denmark)

Golestan, Saeed; Vidal, Ana; Yepes, Alejandro G.

2016-01-01

Synchronization techniques can be broadly classified into two major categories: Closed-loop and open-loop methods. The open-loop synchronization (OLS) techniques, contrary to the closed-loop ones, are unconditionally stable and benefit from a fast dynamic response. Their performance, however, tends...... is to develop a true OLS (and therefore, unconditionally stable) technique without any need for the calculation of sine and cosine functions. The effectiveness of the proposed synchronization technique is confirmed through the simulation and experimental results....

Micro distillation of crude oil to obtain TBP (True Boiling Points) curve; Micro destilacao de petroleo para obtencao da curva PEV (Ponto de Ebulicao Verdadeiro)

Energy Technology Data Exchange (ETDEWEB)

Marques, Maria de Lourdes S.P.; Mendes, Luana de Jesus [Fundacao Gorceix, Ouro Preto, MG (Brazil); Medina, Lilian Carmen [PETROBRAS S.A., Rio de Janeiro, RJ (Brazil)

2008-07-01

PETROBRAS and others petroleum companies adopt the ASTM norms as reference method for oil distillation, ASTM D2892 (2005) that uses columns with 14 to 18 theoretical plates and the ASTM D 5236 (2003) , that distills mixture of heavy hydrocarbons with boiling point over 150 deg C. The result of these two distillations is the TBP (True Boiling Point) curve that is the main tool to define the yield of oil derivatives, the 'royalties' payment, the oil price for commercialization and the logistic support of oil location or in new plants projects of distillation and optimization studies. This procedure has some limitations as the volume sample, at least 1L, and the time of distillation, 2 to 4 days. The objective of this work is to propose a new alternative to attain de PEV curve, developing a new methodology using micro scale distillation that uses a more efficient column than the conventional method. Graphics of both methods were created and the results between the conventional and the micro distillation received statistical treatment to prove the equivalence between them. (author)

True Orthophoto Generation from Aerial Frame Images and LiDAR Data: An Update

Directory of Open Access Journals (Sweden)

Hamid Gharibi

2018-04-01

Full Text Available Image spectral and Light Detection and Ranging (LiDAR positional information can be related through the orthophoto generation process. Orthophotos have a uniform scale and represent all objects in their correct planimetric locations. However, orthophotos generated using conventional methods suffer from an artifact known as the double-mapping effect that occurs in areas occluded by tall objects. The double-mapping problem can be resolved through the commonly known true orthophoto generation procedure, in which an occlusion detection process is incorporated. This paper presents a review of occlusion detection methods, from which three techniques are compared and analyzed using experimental results. The paper also describes a framework for true orthophoto production based on an angle-based occlusion detection method. To improve the performance of the angle-based technique, two modifications to this method are introduced. These modifications, which aim at resolving false visibilities reported within the angle-based occlusion detection process, are referred to as occlusion extension and radial section overlap. A weighted averaging approach is also proposed to mitigate the seamline effect and spectral dissimilarity that may appear in true orthophoto mosaics. Moreover, true orthophotos generated from high-resolution aerial images and high-density LiDAR data using the updated version of angle-based methodology are illustrated for two urban study areas. To investigate the potential of image matching techniques in producing true orthophotos and point clouds, a comparison between the LiDAR-based and image-matching-based true orthophotos and digital surface models (DSMs for an urban study area is also presented in this paper. Among the investigated occlusion detection methods, the angle-based technique demonstrated a better performance in terms of output and running time. The LiDAR-based true orthophotos and DSMs showed higher qualities compared to their

Dose dependence of true stress parameters in irradiated bcc, fcc, and hcp metals

Science.gov (United States)

Byun, T. S.

2007-04-01

The dose dependence of true stress parameters has been investigated for nuclear structural materials: A533B pressure vessel steels, modified 9Cr-1Mo and 9Cr-2WVTa ferritic martensitic steels, 316 and 316LN stainless steels, and Zircaloy-4. After irradiation to significant doses, these alloys show radiation-induced strengthening and often experience prompt necking at yield followed by large necking deformation. In the present work, the critical true stresses for deformation and fracture events, such as yield stress (YS), plastic instability stress (PIS), and true fracture stress (FS), were obtained from uniaxial tensile tests or calculated using a linear strain-hardening model for necking deformation. At low dose levels where no significant embrittlement was detected, the true fracture stress was nearly independent of dose. The plastic instability stress was also independent of dose before the critical dose-to-prompt-necking at yield was reached. A few bcc alloys such as ferritic martensitic steels experienced significant embrittlement at doses above ∼1 dpa; and the true fracture stress decreased with dose. The materials fractured before yield at or above 10 dpa.

A baseline for upper crustal velocity variations along the East Pacific Rise at 13 deg N

Science.gov (United States)

Kappus, Mary E.; Harding, Alistair J.; Orcutt, John A.

1995-04-01

A wide aperture profile of the East Pacific Rise at 13 deg N provides data necessary to make a high-resolution seismic velocity profile of the uppermost crust along a 52-km segment of ridge crest. Automated and objective processing steps, including r-p analysis and waveform inversion, allow the construction of models in a consistent way so that comparisons are meaningful. A continuous profile is synthesized from 70 independent one-dimensional models spaced at 750-km intervals along the ridge. The resulting seismic velocity structure of the top 500 m of crust is remarkable in its lack of variability. The main features are a thin low-velocity layer 2A at the top with a steep gradient to layer 2B. The seafloor velocity is nearly constant at 2.45 km/s +/- 3% along the entire ridge. The velocity at the top of layer 2B is 5.0 km/s +/- 10%. The depth to the 4 km/s isovelocity contour within layer 2A is 130 +/- 20 m from 13 deg to 13 deg 20 min N, north of which it increases to 180 m. The increase in thickness is coincident with a deviation from axial linearity (DEVAL) noted by both a slight change in axis depth and orientation and in geochemistry. The waveform inversion, providing more details plus velocity gradient information, shows a layer 2A with about 80 m of constant-velocity material underlain by 150 m of high velocity gradient material, putting the base of layer 2A at approximately 230 m depth south of 13 deg 20 min N and about 50 m thicker north of the DEVAL. The overall lack of variability, combined with other recent measurements of layer 2A thickness along and near the axis, indicates that the thickness of volcanic extrusives is controlled not by levels of volcanic productivity, but the dynamics of emplacement. The homogeneity along axis also provides a baseline of inherent variability in crustal structure of about 10% against which other observed variations in similar regimes can be compared.

Measuring true localization accuracy in super resolution microscopy with DNA-origami nanostructures

International Nuclear Information System (INIS)

Reuss, Matthias; Blom, Hans; Brismar, Hjalmar; Fördős, Ferenc; Högberg, Björn; Öktem, Ozan

2017-01-01

A common method to assess the performance of (super resolution) microscopes is to use the localization precision of emitters as an estimate for the achieved resolution. Naturally, this is widely used in super resolution methods based on single molecule stochastic switching. This concept suffers from the fact that it is hard to calibrate measures against a real sample (a phantom), because true absolute positions of emitters are almost always unknown. For this reason, resolution estimates are potentially biased in an image since one is blind to true position accuracy, i.e. deviation in position measurement from true positions. We have solved this issue by imaging nanorods fabricated with DNA-origami. The nanorods used are designed to have emitters attached at each end in a well-defined and highly conserved distance. These structures are widely used to gauge localization precision. Here, we additionally determined the true achievable localization accuracy and compared this figure of merit to localization precision values for two common super resolution microscope methods STED and STORM. (paper)

An Explanation of True Dreams: Aristotle and Jung

Directory of Open Access Journals (Sweden)

Ali Sanai

2016-12-01

Full Text Available The naturalistic explanation of realized dream (or dreams that come true means that this phenomen will be explained regardless of supernatural agents. Aristotle in Parva naturalia and Jung in his works explained dream visionary. In this article by scrutiny on these thinkers’ theory, we will indicate the naturalistic approach to dream that is far- fetched for followers of metaphysics. In spite of this fact that Aristotle and Jung both belongs to different historical contexts, they have common aspects in terms of naturalistic method; in the universal or broad sense of word, but in terms of content both explain the true dream by the term “coincidence” or accidental conformity between objective events and psychological affairs. It also seems that the notion of Neutral monism in Jung is adaptive to Hylomorphism in Aristotle psychology, and this, provides a path for naturalistic approach to dream as one forms of consciousness.

Commercialized VCSEL components fabricated at TrueLight Corporation

Science.gov (United States)

Pan, Jin-Shan; Lin, Yung-Sen; Li, Chao-Fang A.; Chang, C. H.; Wu, Jack; Lee, Bor-Lin; Chuang, Y. H.; Tu, S. L.; Wu, Calvin; Huang, Kai-Feng

2001-05-01

TrueLight Corporation was found in 1997 and it is the pioneer of VCSEL components supplier in Taiwan. We specialize in the production and distribution of VCSEL (Vertical Cavity Surface Emitting Laser) and other high-speed PIN-detector devices and components. Our core technology is developed to meet blooming demand of fiber optic transmission. Our intention is to diverse the device application into data communication, telecommunication and industrial markets. One mission is to provide the high performance, highly reliable and low-cost VCSEL components for data communication and sensing applications. For the past three years, TrueLight Corporation has entered successfully into the Gigabit Ethernet and the Fiber Channel data communication area. In this paper, we will focus on the fabrication of VCSEL components. We will present you the evolution of implanted and oxide-confined VCSEL process, device characterization, also performance in Gigabit data communication and the most important reliability issue

Superconducting transition and low-field magnetoresistance of a niobium single crystal at 4.2 deg. K; Transition supraconductrice et magnetoresistance en champ faible d'un echantillon monocristallin de niobium a 4.2 deg. K

Energy Technology Data Exchange (ETDEWEB)

Perriot, G [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires. Service de physique du solide et de resonnance magnetique

1967-01-01

We report the study of the electrical resistance of a niobium single crystal, at 4.2 deg. K, from the beginning of the superconductive transition to 80 kilo oersteds. Critical fieldsH{sub c2} and H{sub c3} have been determined. Influences on superconductive transition of current density, field-current angle, crystal orientation and magnetoresistance have been studied. Variation laws of low-field transverse and longitudinal magneto-resistances have been determined. (author) [French] La variation de la resistance electrique d'un monocristal cylindrique de niobium a ete etudiee, a 4,2 deg. K, depuis le debut de la transition supraconductrice jusqu'a 80 kilooersteds. Les champs critiques H{sub c2} et H{sub c3} ont ete determines. On a etudie l'influence de la densite de courant, de l'angle champ-courant, de l'anisotropie cristalline et de la magnetoresistance sur la transition supraconductrice. Les lois de variation des magnetoresistances transversale et longitudinale ont ete determinees dans le domaine des champs faibles. (auteur)

3.55 GeV/c Kp elastic scattering near 180 deg; Diffusion elastique des K de 3.55 GeV/C par les protons, au voisinage de 180 deg

Energy Technology Data Exchange (ETDEWEB)

Duflo, J [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

1969-07-01

Backward elastic K{sup +}p and K{sup -}p scattering has been measured in the angular interval 168 deg. < {theta}.c.m. < 177 deg. The experimental apparatus included optical spark chambers to measure the three prongs of the event scattering, a set of scintillation counters and Cerenkov counters to select events ant trigger chambers, and a magnet to determine the moment of the recoil proton. 106000 photographs was taken. Of these, 22 satisfied all requirements as elastic K{sup +}p scattering events. No event was found satisfy the kinematical criteria for K{sup -}p elastic scattering. The correspondent values of differential cross sections are: (d{sigma}/d{omega})K{sup +}p {yields} pK{sup +} = 17 {+-} 4 {mu}b/ster. (d{sigma}/d{omega})K{sup -}p {yields} pK{sup -} {<=} 0.6 {mu}b/ster. Contaminations by {pi}p backward scattering, and inelastic scattering were estimated. Elastic scattering K{sup +}p exhibits a backward peak. A reasonably satisfactory interpretation of our results is obtained by exchange models. There is, in fact, no definitely established particles which could intermediate the Kp{sup -} {yields} pK{sup -} process in exchange cannel. That is in good agreement with our small value of K{sup -}p backward elastic scattering cross section. Our results lend support to the conclusions of the interference model developed by Barger and Cline for the {pi}p backward scattering, and to qualitative previsions of the Quark models. (author) [French] La diffusion elastique en arriere des K{sup +} et K{sup -} par les protons a ete mesuree dans l'intervalle angulaire 168 deg. < {theta}cm < 177 deg. Le dispositif experimental comprenait des chambres a etincelles 'optiques' pour mesurer les trois trajectoires de l'evenement diffuse, un ensemble de compteurs a scintillations et de compteurs Cerenkov pour selectionner les evenements et declencher les chambres, et un aimant pour determiner le moment du proton de recul. 106000 photographies ont ete prises, dont 22 ont satisfait a

3.55 GeV/c Kp elastic scattering near 180 deg; Diffusion elastique des K de 3.55 GeV/C par les protons, au voisinage de 180 deg

Energy Technology Data Exchange (ETDEWEB)

Duflo, J. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

1969-07-01

Backward elastic K{sup +}p and K{sup -}p scattering has been measured in the angular interval 168 deg. < {theta}.c.m. < 177 deg. The experimental apparatus included optical spark chambers to measure the three prongs of the event scattering, a set of scintillation counters and Cerenkov counters to select events ant trigger chambers, and a magnet to determine the moment of the recoil proton. 106000 photographs was taken. Of these, 22 satisfied all requirements as elastic K{sup +}p scattering events. No event was found satisfy the kinematical criteria for K{sup -}p elastic scattering. The correspondent values of differential cross sections are: (d{sigma}/d{omega})K{sup +}p {yields} pK{sup +} = 17 {+-} 4 {mu}b/ster. (d{sigma}/d{omega})K{sup -}p {yields} pK{sup -} {<=} 0.6 {mu}b/ster. Contaminations by {pi}p backward scattering, and inelastic scattering were estimated. Elastic scattering K{sup +}p exhibits a backward peak. A reasonably satisfactory interpretation of our results is obtained by exchange models. There is, in fact, no definitely established particles which could intermediate the Kp{sup -} {yields} pK{sup -} process in exchange cannel. That is in good agreement with our small value of K{sup -}p backward elastic scattering cross section. Our results lend support to the conclusions of the interference model developed by Barger and Cline for the {pi}p backward scattering, and to qualitative previsions of the Quark models. (author) [French] La diffusion elastique en arriere des K{sup +} et K{sup -} par les protons a ete mesuree dans l'intervalle angulaire 168 deg. < {theta}cm < 177 deg. Le dispositif experimental comprenait des chambres a etincelles 'optiques' pour mesurer les trois trajectoires de l'evenement diffuse, un ensemble de compteurs a scintillations et de compteurs Cerenkov pour selectionner les evenements et declencher les chambres, et un aimant pour determiner le moment du proton de recul. 106000 photographies ont ete prises

A True-False Test on Methods of Typewriting Instruction.

Science.gov (United States)

West, Leonard J.

1984-01-01

Presents a true-false test on typewriting instruction to illustrate the effects of educational lag, publishing practices, and deficiencies in preservice and inservice teacher education upon teaching methods. (SK)

Brucella Antibodies in Alaskan True Seals and Eared Seals—Two Different Stories

Directory of Open Access Journals (Sweden)

Ingebjørg H. Nymo

2018-01-01

Full Text Available Brucella pinnipedialis was first isolated from true seals in 1994 and from eared seals in 2008. Although few pathological findings have been associated with infection in true seals, reproductive pathology including abortions, and the isolation of the zoonotic strain type 27 have been documented in eared seals. In this study, a Brucella enzyme-linked immunosorbent assay (ELISA and the Rose Bengal test (RBT were initially compared for 206 serum samples and a discrepancy between the tests was found. Following removal of lipids from the serum samples, ELISA results were unaltered while the agreement between the tests was improved, indicating that serum lipids affected the initial RBT outcome. For the remaining screening, we used ELISA to investigate the presence of Brucella antibodies in sera of 231 eared and 1,412 true seals from Alaskan waters sampled between 1975 and 2011. In eared seals, Brucella antibodies were found in two Steller sea lions (Eumetopias jubatus (2% and none of the 107 Northern fur seals (Callorhinus ursinus. The low seroprevalence in eared seals indicate a low level of exposure or lack of susceptibility to infection. Alternatively, mortality due to the Brucella infection may remove seropositive animals from the population. Brucella antibodies were detected in all true seal species investigated; harbor seals (Phoca vitulina (25%, spotted seals (Phoca largha (19%, ribbon seals (Histriophoca fasciata (16%, and ringed seals (Pusa hispida hispida (14%. There was a low seroprevalence among pups, a higher seroprevalence among juveniles, and a subsequent decreasing probability of seropositivity with age in harbor seals. Similar patterns were present for the other true seal species; however, solid conclusions could not be made due to sample size. This pattern is in accordance with previous reports on B. pinnipedialis infections in true seals and may suggest environmental exposure to B. pinnipedialis at the juvenile stage, with a

OMI/Aura Surface Reflectance Climatology Level 3 Global 0.5deg Lat/Lon Grid V003

Data.gov (United States)

National Aeronautics and Space Administration — The OMI Earth Surface Reflectance Climatology product, OMLER (Global 0.5deg Lat/Lon grid) which is based on Version 003 Level-1B top of atmosphere upwelling radiance...

MODEL PENSKORAN PARTIAL CREDIT PADA BUTIR MULTIPLE TRUE-FALSE BIDANG FISIKA

Directory of Open Access Journals (Sweden)

Wasis Wasis

2013-01-01

Full Text Available Tujuan penelitian ini menghasilkan model penskoran politomus untuk respons butir multiple true-false, sehingga dapat mengestimasi secara lebih akurat kemampuan di bidang fisika. Pengembangan penskoran menggunakan Four-D model dan diuji akurasinya melalui penelitian empiris dan simulasi. Penelitian empiris menggunakan 15 butir multiple true-false yang diambil dari soal UMPTN tahun 1996-2006 dan dikenakan pada 410 mahasiswa baru FMIPA Universitas Negeri Surabaya angkatan tahun 2007. Respons peserta tes diskor dengan tiga model partial credit (PCM I; II; dan III dan secara dikotomus. Hasil penskoran dianalisis dengan program Quest untuk mendapat-kan estimasi tingkat kesukaran butir (δ dan estimasi ke-mampuan peserta (θ untuk menentukan nilai fungsi informasi tes dan kesalahan baku estimasi. Penelitian simulasi mengguna-kan data bangkitan berdasarkan parameter empiris (δ dan θ memakai program statistik SAS dan akurasi estimasinya di-analisis dengan metode root mean squared error (RMSE. Hasil penelitian ini menunjukkan: (i Penskoran PCM dengan pem-bobotan mampu mengestimasi kemampuan lebih akurat di-bandingkan tanpa pembobotan maupun secara dikotomus; (ii Semakin banyak jumlah kategori dalam penskoran partial credit, semakin akurat. Kata kunci: model penskoran partial credit, butir multiple true-false ____________________________________________________________ THE PARTIAL CREDIT SCORING MODEL FOR THE MULTIPLE TRUE-FALSE BUTIRS IN PHYSICS Abstract This study is an attempt to overcome the weaknesses. This study aims to produce a polytomous scoring model for responses to multiple true-false butirs in order to get a more accurate estimation of abilities in physics. It adopts the Four-D model and its accuracy is assessed through empirical and simulation studies. The empirical study employed 15 multiple true-false butirs taken from the New Students Entrance Test of State University the year of 1996–2006. It administered to 410 new students enrolled

L’esperienza MoULe dell’Università degli Studi di Milano-Bicocca

Directory of Open Access Journals (Sweden)

Michelle Pieri

2013-03-01

Full Text Available Questo contributo si focalizza sull’esperienza di mobile learning, con l’ambiente per l’apprendimento cooperativo MoULe, realizzata dall’Università degli studi di Milano- Bicocca in collaborazione con il Consiglio Nazionale delle Ricerche di Palermo. Un questionario1 sulle tecnologie e l’uso delle tecnologie è stato somministrato ai partecipanti prima dell’inizio dell’esperienza e alla fine dell’esperienza è stato realizzato un focus group con i partecipanti per valutare l’esperienza.

TRUE Block Scale Continuation Project. Final Report

Energy Technology Data Exchange (ETDEWEB)

Andersson, Peter; Byegaard, Johan [Geosigma AB (Sweden); Billaux, Daniel [Itasca Consultants SA (France); Cvetkovic, Vladimir [Royal Inst. of Technology, Stockholm (Sweden); Dershowitz, William; Doe, Thomas [Golder Associates Inc. (United States); Hermanson, Jan [Golder Associates AB (Sweden); Poteri, Antti [VTT (Finland); Tullborg, Eva-Lena [Terralogica AB (Sweden); Winberg, Anders [Conterra AB (SE)] (ed.)

2007-03-15

The TRUE Block Scale project was carried out during 1996-2002. This project focused on site characterisation and building of hydrostructural and microstructural models, sorbing tracer experiments in single structures and networks of structures over distances ranging between 1 and 100 m and also involved a unified application of various model approaches for modelling the in situ experiments. In 2002, ANDRA, Posiva, JNC and SKB decided to pursue some remaining issues in the so-called TRUE Block Scale Continuation project (TRUE BS2). The specific objectives of BS2 can be summarised as: 'Improve understanding of transport pathways at the block scale, including assessment of effects of geology and geometry, macrostructure and microstructure'. In order to cater to addressing the stated objective a series of hypotheses were formulated which explored the importance of geological information for predicting transport and retention and the possible differences between transport and retention between transport paths dominated by faults and those dominated by non-fault fractures (background fractures). In the process, prospects for carrying out experiments in fracture networks over longer distances (c 20-100 m) were explored. It was identified that experiments with sorbing tracers over these distances were prohibitive because of the time frames involved and the projected low mass recoveries. Instead the experimental locus was shifted to a geological structure previously not investigated by tracer tests in the TRUE Block Scale experiments. The lower immobile zone retention material properties assigned to background fractures compared to those assigned to the fault-type Structure 19 have been verified by means of back-calculations. The evaluated Type 1 flow path (Structure 19, Flow path I) retention material properties, as expressed by {kappa} parameter, are one order of magnitude higher than for the background fracture flow path. This finding is consistent with the

The system HoCl3-YCl3-H2O (25 deg C)

International Nuclear Information System (INIS)

Sorokina, A.A.; Yudina, N.G.

1981-01-01

By solubility method the system HoCl 3 -YCl 3 -H 2 O at 25 deg C has been studied. It is shown that in this system the continuous serie of solid solutions is formed. The liquid solutions of this system have been investigated by the isopiestic method. The values of activity coefficients, activity, free energy formation and excess free energy of solid solutions are calculated [ru

First Ground-Based Infrared Solar Absorption Measurements of Free Tropospheric Methanol (CH3OH): Multidecade Infrared Time Series from Kitt Peak (31.9 deg N 111.6 deg W): Trend, Seasonal Cycle, and Comparison with Previous Measurements

Science.gov (United States)

Rinsland, Curtis P.; Mahieu, Emmanuel; Chiou, Linda; Herbin, Herve

2009-01-01

Atmospheric CH3OH (methanol) free tropospheric (2.09-14-km altitude) time series spanning 22 years has been analyzed on the basis of high-spectral resolution infrared solar absorption spectra of the strong vs band recorded from the U.S. National Solar Observatory on Kitt Peak (latitude 31.9degN, 111.6degW, 2.09-km altitude) with a 1-m Fourier transform spectrometer (FTS). The measurements span October 1981 to December 2003 and are the first long time series of CH3OH measurements obtained from the ground. The results were analyzed with SFIT2 version 3.93 and show a factor of three variations with season, a maximum at the beginning of July, a winter minimum, and no statistically significant long-term trend over the measurement time span.

True fir spacing trials: 10-year results.

Science.gov (United States)

Robert O. Curtis

2008-01-01

Eighteen precommercial thinning trials were established in true fir-hemlock stands in the Olympic Mountains and the west side of the Cascade Range during the period 1987 through 1994. This paper updates a previous report, with results for the first 10 years after establishment. Results are given for (1) all trees, (2) the largest 80 per acre of any species, and (3)...

Complete dipole response in 208Pb from high-resolution polarized proton scattering at 0 deg

International Nuclear Information System (INIS)

Neumann-Cosel, P. von; Kalmykov, Y.; Poltoratska, I.; Ponomarev, V. Yu.; Richter, A.; Wambach, J.; Adachi, T.; Fujita, Y.; Matsubara, H.; Sakemi, Y.; Shimizu, Y.; Tameshige, Y.; Yosoi, M.; Bertulani, C. A.; Carter, J.; Fujita, H.; Dozono, M.; Fujita, K.; Hashimoto, H.; Hatanaka, K.

2009-01-01

The structure of electric and magnetic dipole modes in 208 Pb is investigated in a high-resolution measurement of the (p-vector,p-vector') reaction under 0 deg. First results on the E1 strength in the region of the pygmy dipole resonance are reported.

'Candidatus Phytoplasma sudamericanum' a novel taxon from diseased passion fruit (Passiflora edulis f. flavicarpa Deg.)

Science.gov (United States)

Symptoms of abnormal proliferation of shoots resulting in formation of witches’ broom growths were observed in diseased plants of passion fruit (Passiflora edulis f. flavicarpa Deg.) in Brazil. RFLP analysis of 16S rRNA gene sequences amplified in polymerase chain reactions containing template DNAs...

Relation between chemical properties in molten acetamide and water at 98 deg. C

International Nuclear Information System (INIS)

Petit, Nicole

1972-01-01

An attempt was made to establish the relation between the chemical properties of various cations in water and in molten acetamide at 98 deg. C. A solvent always possesses properties which have some effect on the reactivity of the solute. Various types of interactions (polar, electrostatic, Van der Waals forces, and hydrogen bonds) bind the solvent molecules to the dissolved molecules and ions. Interactions between the solute species and the solvent species are designated: solvation phenomena. In addition to solvation phenomena, another but less direct type of interaction occurs: the solvated ions find themselves in a sensibly continuous medium having a dielectric constant ε which can vary considerably. As the value of the dielectric constant decreases, the electrostatic interactions between the ions increase. The variation is such that these ions can only be considered free for values of ε > 40. This is the case for acetamide and water at 98 deg. C. The solvation of a chemical species belonging to an oxido-reducing system can only be effected by comparing the behavior of such a system with a reference system relatively insensitive to changes in the solvent. The reference system used was a ferrocene-ion/ferricinium couple. The solvation of a chemical species is characterized by a variable designated: the solvation activity coefficient. The chemical and electrochemical properties of various elements (alkali elements, alkaline earths, Cu, Zn, Cd, Hg, Pb, U, Al, Ce, and Eu) in neutral or acid media in acetamide were studied using various electrochemical techniques (principally polarography). These studies led to the establishment of a table of oxido-reducing potentials for molten acetamide. Comparisons with water at 98 deg. C indicate that the metallic cations are more solvated in acetamide than in water. The evaluation of solvation activity coefficients from polarographic measurements (E 1/2 , D M ) led to an approximate estimation of the differences in behavior

Temperature dependence of dynamic behavior of commercially pure titanium by the compression test

International Nuclear Information System (INIS)

Lee, Su Min; Seo, Song Won; Park, Kyoung Joon; Min, Oak Key

2003-01-01

The mechanical behavior of a Commercially Pure Titanium (CP-Ti) is investigated at high temperature Split Hopkinson Pressure Bar (SHPB) compression test with high strain-rate. Tests are performed over a temperature range from room temperature to 1000 .deg. C with interval of 200 deg. C and a strain-rate range of 1900∼2000/sec. The true flow stress-true strain relations depending on temperature are achieved in these tests. For construction of constitutive equation from the true flow stress-true strain relation, parameters for the Johnson-Cook constitutive equation is determined. And the modified Johnson-Cook equation is used for investigation of behavior of flow stress in vicinity of recrystallization temperature. The modified Johnson-Cook constitutive equation is more suitable in expressing the dynamic behavior of a CP-Ti at high temperature, i.e. about recrystallization temperature

Per un'etica degli scambi economici. La funzione civile del mercato in Eiximenis e nella pedagogia politica francescana (1273-1493

Directory of Open Access Journals (Sweden)

Paolo Evangelisti

2014-03-01

dell’esercizio del potere, degli scambi nel mercato. Quest’ultimo identificato qual estruttura comunitaria, ovvero una vera e propria agorà civica all’interno della quale la dinamica delle negoziazioni non riguarda solo le merci ma implica anche una riflessione sui pre-requisiti che legittimano l’esistenza del mercato. I francescani, e segnatamente i testi eiximeniani, rivelano una spiccata capacità di interrogarsi sulle ragioni fondative del mercato e del denaro, sulle funzioni civili degli scambi economici e del credito.

From gender identity disorder to gender identity creativity: true gender self child therapy.

Science.gov (United States)

Ehrensaft, Diane

2012-01-01

True gender self child therapy is based on the premise of gender as a web that weaves together nature, nurture, and culture and allows for a myriad of healthy gender outcomes. This article presents concepts of true gender self, false gender self, and gender creativity as they operationalize in clinical work with children who need therapeutic supports to establish an authentic gender self while developing strategies for negotiating an environment resistant to that self. Categories of gender nonconforming children are outlined and excerpts of a treatment of a young transgender child are presented to illustrate true gender self child therapy.

Benign cementoblastoma (true cementoma in a cat

Directory of Open Access Journals (Sweden)

Lenin A Villamizar-Martinez

2016-01-01

Full Text Available Case summary A 10-year-old castrated male domestic shorthair cat was presented for assessment of a gingival mass surrounding the left maxillary third and fourth premolar teeth. The mass was surgically removed by means of a marginal rim excision, and the tissue was submitted for histological assessment. It was identified as a benign cementoblastoma (true cementoma. There was proliferation of mineralized eosinophilic material with multiple irregularly placed lacunae and reversal lines, reminiscent of cementum. The cat recovered uneventfully from the anesthesia, and there was no evidence of tumor recurrence 6 months after surgery. Relevance and novel information Cementoblastomas (true cementomas in domestic animals are rare, with just a few reports in ruminants, monogastric herbivores and rodents. Cementoblastoma is considered a benign tumor that arises from the tooth root. The slow, expansive and constant growth that characterizes these masses may be accompanied by signs of oral discomfort and dysphagia. This case report is intended to increase knowledge regarding this tumor in cats and also highlights the importance of complete excision of the neoplasm. To our knowledge, there are no previous reports in the literature of cementoblastoma in the cat.

Molecular characterization of true morels (Morchella) in Turkey

Science.gov (United States)

A collection of 247 true morels (Morchella spp.) was made from 10 different provinces of Turkey during the 2007-2008 growing season. This collection was analyzed for species diversity using phylogenetic analyses of partial Ribonucleic acid (RNA) polymerase I (RPB1) and nuclear ribosomal large subuni...

Criteri di indagine degli spazi voltati nell’ambito dell’architettura storica e in archeologia

Directory of Open Access Journals (Sweden)

Luca Cipriani

2014-07-01

Full Text Available ItLo studio degli spazi voltati nell’ambito dell’architettura storica è un tema di grande interesse, che da sempre vede impegnati vari studiosi afferenti ad ambiti disciplinari diversi, dall’archeologia, alla storia dell’arte, alla conservazione. In tale contesto interdisciplinare molto spesso il ruolo di ingegneri ed architetti, che si occupano di indagare le matrici geometriche alla base della progettazione di tali spazi, viene relegato ad un ruolo accessorio rispetto a quello dei conservatori, che materialmente si occupano delle pratiche di manutenzione e di restauro. Con l’avanzare delle tecnologie di rilevamento, che spaziano con sempre maggiore affidabilità dalla documentazione dei caratteri morfologici superficiali a quelli più intrinseci alla base dei manufatti, quale può essere il ruolo attuale di chi si occupa di comprendere il progetto che generò tali ambienti? In altri termini, quel vasto patrimonio immateriale che sta alla base della concezione progettuale di un manufatto, specialmente se scaturito da una raffinata conoscenza matematica e geometrica, ha oggi un ruolo riconoscibile e sufficientemente autorevole rispetto all’ammontare di conoscenze tecniche che permettono alle “macchine” di funzionare?Con questo contributo si intende mostrare come l’integrazione di vari know-how legati sia alla modellazione reality-based che alla conoscenza dei criteri e degli strumenti di progettazione del passato, possa fornire un input sostanziale per l’intervento e per la conoscenza di manufatti caratterizzati da una evidente complessità geometrica e costruttiva. Per ricaduta si intende poi mostrare come la documentazione fine a se stessa, per quanto accurata, certificata e garantita attraverso le più avanzate tecnologie e metodologie integrate, non si configuri come base di scambio e di dialogo interdisciplinare. En The study of vaulted spaces in the context of the historic architecture is a topic of great interest

Acetanilide interaction with hydriodic acid in aqueous solutions at 20 and 40 deg C

International Nuclear Information System (INIS)

Erkasov, R.Sh.; Nurakhmetov, N.I.

1990-01-01

Isothermal method was used to study acetanilide solubility in aqueous solutions of hydriodic acid at 20 and 40 deg C. formation of two new anhydrous compounds of 2:1 and 1:1 compositions (anilide: acid molar ratio) was established. Temperature and concentration boundaries of solid phase formation were established for these compounds. Their IR spectroscopic investigation was conducted

Environmental Fatigue Behaviors of CF8M Stainless Steel in 310 .deg. C Deoxygenated Water - Effects of Hydrogen and Microstructure

Energy Technology Data Exchange (ETDEWEB)

Jang, Hun; Cho, Pyungyeon; Jang, Changheui [KAIST, Daejeon (Korea, Republic of); Kim, Tae Soon [Korea Hydro and Nuclear Power Corporation, Seoul (Korea, Republic of)

2014-01-15

The effects of environment and microstructure on low cycle fatigue (LCF) behaviors of CF8M stainless steels containing 11% of ferrites were investigated in a 310 .deg. C deoxygenated water environment. The reduction of LCF life of CF8M in a 310 .deg. C deoxygenated water was smaller than 316LN stainless steels. Based on the microstructure and fatigue surface analyses, it was confirmed that the hydrogen induced cracking contributed to the reduction in LCF life for CF8M as well as for 316LN. However, many secondary cracks were found on the boundaries of ferrite phases in CF8M, which effectively reduced the stress concentration at the crack tip. Because of the reduced stress concentration, the accelerated fatigue crack growth by hydrogen induced cracking was less significant, which resulted in the smaller environmental effects for CF8M than 316LN in a 310 .deg. C deoxygenated water.

MODIS/Terra Aerosol Cloud Water Vapor Ozone Monthly L3 Global 1Deg CMG V006

Data.gov (United States)

National Aeronautics and Space Administration — MODIS/Terra Aerosol Cloud Water Vapor Ozone Monthly L3 Global 1Deg CMG (MOD08_M3). MODIS was launched aboard the Terra satellite on December 18, 1999 (10:30 am...

On a true value of risk

DEFF Research Database (Denmark)

Kozin, Igor

2018-01-01

The paper suggests looking on probabilistic risk quantities and concepts through the prism of accepting one of the views: whether a true value of risk exists or not. It is argued that discussions until now have been primarily focused on closely related topics that are different from the topic...... intervals, the use of Byes rule, models of complete ignorance, hierarchical models of uncertainty, assignment of probabilities over possibility space and interpretation of derived probabilistic measures. Behavioural implications of favouring the either view are also briefly described....

Three-dimensional true FISP for high-resolution imaging of the whole brain

International Nuclear Information System (INIS)

Schmitz, B.; Hagen, T.; Reith, W.

2003-01-01

While high-resolution T1-weighted sequences, such as three-dimensional magnetization-prepared rapid gradient-echo imaging, are widely available, there is a lack of an equivalent fast high-resolution sequence providing T2 contrast. Using fast high-performance gradient systems we show the feasibility of three-dimensional true fast imaging with steady-state precession (FISP) to fill this gap. We applied a three-dimensional true-FISP protocol with voxel sizes down to 0.5 x 0.5 x 0.5 mm and acquisition times of approximately 8 min on a 1.5-T Sonata (Siemens, Erlangen, Germany) magnetic resonance scanner. The sequence was included into routine brain imaging protocols for patients with cerebrospinal-fluid-related intracranial pathology. Images from 20 patients and 20 healthy volunteers were evaluated by two neuroradiologists with respect to diagnostic image quality and artifacts. All true-FISP scans showed excellent imaging quality free of artifacts in patients and volunteers. They were valuable for the assessment of anatomical and pathologic aspects of the included patients. High-resolution true-FISP imaging is a valuable adjunct for the exploration and neuronavigation of intracranial pathologies especially if cerebrospinal fluid is involved. (orig.)

Critical opalescence and the true dielectric state in a Coulomb system

Science.gov (United States)

Bobrov, V. B.; Trigger, S. A.

2015-04-01

To study the critical opalescence effect in a two-component Coulomb system consisting of single-type electrons and nuclei, we consider the limit relations for static structure factors and analyze the singularities of the dielectric permittivity. We show that the critical opalescence effect can be observed not only at the critical point corresponding to the gas-liquid phase transition but also near the true dielectric state with zero static conductivity. With the available experimental data taken into account, we assume that the true dielectric state is the limit state of the liquid-liquid phase transition accompanied by sharp variations in the electrical conduction of the substances. We find that if the thermodynamic parameters correspond to the true dielectric state, then the critical opalescence effect can arise in the case where the squared fluctuation in the total number of electrons and nuclei in a two-component Coulomb system becomes infinite, as this occurs at the critical point corresponding to the gas-liquid phase transition.

MODIS/Terra Aerosol Cloud Water Vapor Ozone Daily L3 Global 1Deg CMG V006

Data.gov (United States)

National Aeronautics and Space Administration — MODIS/Terra Aerosol Cloud Water Vapor Ozone Daily L3 Global 1Deg CMG (MOD08_D3). MODIS was launched aboard the Terra satellite on December 18, 1999 (10:30 am equator...

MODIS/Aqua Aerosol Cloud Water Vapor Ozone Daily L3 Global 1Deg CMG V006

Data.gov (United States)

National Aeronautics and Space Administration — MODIS/Aqua Aerosol Cloud Water Vapor Ozone Daily L3 Global 1Deg CMG (MYD08_D3). MODIS was launched aboard the Aqua satellite on May 04, 2002 (1:30 pm equator...

Biological effects of diethylene glycol (DEG) and produced waters (PWs) released from offshore activities: a multi-biomarker approach with the sea bass Dicentrarchus labrax.

Science.gov (United States)

Stefania, Gorbi; Maura, Benedetti; Claudia, Virno Lamberti; Barbara, Pisanelli; Ginevra, Moltedo; Francesco, Regoli

2009-11-01

Diethylene glycol (DEG) is largely used during oil and gas exploitation by offshore platforms. The aim of this work was to investigate if this compound induces direct molecular/cellular effects in marine organisms, or indirectly modulate those of produced waters (PWs). Sea bass (Dicentrarchus labrax) were exposed to DEG dosed alone or in combination with PWs from an Adriatic platform. A wide array of analysed biomarkers included cytochrome P450-dependent enzymatic activity, bile metabolites, glutathione S-transferases, acetylcholinesterase, peroxisomal proliferation, antioxidant defences (catalase, glutathione reductase, glutathione peroxidases, glutathione), total oxyradical scavenging capacity, malondialdehyde and DNA integrity (single strand breaks and frequency of micronuclei). Results did not reveal marked effects of DEG, while PWs influenced the biotransformation system, the oxidative status and the onset of genotoxic damages. Co-exposures caused only limited differences of biomarker responses at some experimental conditions, overall suggesting a limited biological impact of DEG at levels normally deriving from offshore activities.

A Byzantine chant collection from Sicily: a collaboration between Copenhagen and Piana degli Albanesi (Palermo)

DEFF Research Database (Denmark)

Sanfratello, Giuseppe

2016-01-01

The aim of this paper is to give an account of the collaboration between a collector of the Byzantine chant tradition of Piana degli Albanesi (Palermo) in Sicily, namely fr. Bartolomeo Di Salvo, and the editorial board of the Monumenta Musicae Byzantinae, i.e. an institution under the aegis...

PUFKEY: A High-Security and High-Throughput Hardware True Random Number Generator for Sensor Networks

Directory of Open Access Journals (Sweden)

Dongfang Li

2015-10-01

Full Text Available Random number generators (RNG play an important role in many sensor network systems and applications, such as those requiring secure and robust communications. In this paper, we develop a high-security and high-throughput hardware true random number generator, called PUFKEY, which consists of two kinds of physical unclonable function (PUF elements. Combined with a conditioning algorithm, true random seeds are extracted from the noise on the start-up pattern of SRAM memories. These true random seeds contain full entropy. Then, the true random seeds are used as the input for a non-deterministic hardware RNG to generate a stream of true random bits with a throughput as high as 803 Mbps. The experimental results show that the bitstream generated by the proposed PUFKEY can pass all standard national institute of standards and technology (NIST randomness tests and is resilient to a wide range of security attacks.

PUFKEY: a high-security and high-throughput hardware true random number generator for sensor networks.

Science.gov (United States)

Li, Dongfang; Lu, Zhaojun; Zou, Xuecheng; Liu, Zhenglin

2015-10-16

Random number generators (RNG) play an important role in many sensor network systems and applications, such as those requiring secure and robust communications. In this paper, we develop a high-security and high-throughput hardware true random number generator, called PUFKEY, which consists of two kinds of physical unclonable function (PUF) elements. Combined with a conditioning algorithm, true random seeds are extracted from the noise on the start-up pattern of SRAM memories. These true random seeds contain full entropy. Then, the true random seeds are used as the input for a non-deterministic hardware RNG to generate a stream of true random bits with a throughput as high as 803 Mbps. The experimental results show that the bitstream generated by the proposed PUFKEY can pass all standard national institute of standards and technology (NIST) randomness tests and is resilient to a wide range of security attacks.

Identification of ultra-fine Ti-rich precipitates in V-Cr-Ti alloys irradiated below 300 deg. C by using positron CDB technique

International Nuclear Information System (INIS)

Fukumoto, Ken-ichi; Matsui, Hideki; Ohkubo, Hideaki; Tang, Zheng; Nagai, Yasuyoshi; Hasegawa, Masayuki

2008-01-01

Irradiation-induced Ti-rich precipitates in V-Ti and V-4Cr-4Ti alloys are studied by TEM and positron annihilation methods (positron lifetime, and coincidence Doppler broadening (CDB)). The characteristics of small defect clusters formed in V alloys containing Ti at irradiation temperatures below 300 deg. C have not been identified by TEM techniques. Strong interaction between vacancy and Ti solute atoms for irradiated V alloys containing Ti at irradiation temperatures from 220 to 350 deg. C are observed by positron lifetime measurement. The vacancy-multi Ti solute complexes in V-alloys containing Ti are definitely identified by using CDB measurement. It is suggested that ultra-fine Ti-rich precipitates or Ti segregation at periphery of dislocation loops are formed in V alloys containing Ti at irradiation temperatures below 300 deg. C

True Umbilical Cord Knot Leading to Fetal Demise

African Journals Online (AJOL)

weight was 140 kg, height 1.69 m, blood pressure 120 mmHg. The booking ... The fetal heart tones were monitored using Doppler sonicaid. They remained normal throughout .... true knot, seemingly because the umbilical cord vessels can be compressed ... Therefore, the Wharton's jelly surrounding the fetal vessels has the ...

Low cycle fatigue behaviour of neutron irradiated copper alloys at 250 and 350 deg. C

DEFF Research Database (Denmark)

Singh, B.N.; Stubbins, J.F.; Toft, P.

2000-01-01

V) to influence levels of 1.0 - 1.5 x 1024 n/m2 (E> 1 MeV) at 250 and 350 deg. C. These irradiations were carried out in temperature controlled rigs where the irradiation temperature was monitored and controlledcontinuously throughout the whole irradiation experiment. Both unirradiated and irradiated speciments...

Disinhibition of negative true self for identity reconstructions in cyberspace: Advancing self-discrepancy theory for virtual setting.

Directory of Open Access Journals (Sweden)

Chuan Hu

Full Text Available In face-to-face communications, to avoid sanctions and disapproval from others, people are more likely to hide negative aspects of their true self (such as socially undesirable personalities, minds, beliefs and consciousness to avoid conflict with social norms and laws. The anonymity of cyberspace provides people a unique environment to behave more freely and openly with less restraint from the real word. Existing research related to online true self expression has mainly explored true self as an independent aspect of self. Regarding true self as a two-dimensional concept, this study investigates true self from the perspective of individuals' self-guide and identity reconstruction in both online and offline world. Using qualitative research methods, the current study investigates 57 participants through interviews and questionnaires. Content analysis reveals four factors that motivate people to express more true self (especially negative true self when reconstructing their online identity and involve true self as a part of their self-guide in anonymous environment. By incorporating true self as an important part of individuals' self-guide and identity online, the current study advances self-discrepancy theory, making it more comprehensive for cyberspace. The results are also interpreted based on self-determination theory. The theoretical contributions of this study are discussed and practical implications are also presented.

Experimental transonic flutter characteristics of two 72 deg-sweep delta-wing models

Science.gov (United States)

Doggett, Robert V., Jr.; Soistmann, David L.; Spain, Charles V.; Parker, Ellen C.; Silva, Walter A.

1989-01-01

Transonic flutter boundaries are presented for two simple, 72 deg. sweep, low-aspect-ratio wing models. One model was an aspect-ratio 0.65 delta wing; the other model was an aspect-ratio 0.54 clipped-delta wing. Flutter boundaries for the delta wing are presented for the Mach number range of 0.56 to 1.22. Flutter boundaries for the clipped-delta wing are presented for the Mach number range of 0.72 to 0.95. Selected vibration characteristics of the models are also presented.

Irradiations under magnetic field. Measurement of resistivity sample irradiations between 100 and 500 deg C in a swimming-pool reactor

International Nuclear Information System (INIS)

Pauleve, J.; Marchand, A.; Blaise, A.

1964-01-01

An oven is described which enables the irradiation of small samples in the maximum neutron flux of a swimming-pool reactor of 15 MW (Siloe), at temperatures of between 100 and 500 deg.C defined to ± 0,5 deg.C, The oven is very simple from the technological point of view, and has a diameter of only 27 mm, This permits resistivity measurements to be carried out under irradiation in the reactor, or as another example, it enables irradiations in a magnetic field of 5000 oersteds, created by an immersed solenoid. (authors) [fr

Registration of global cardiac function with real-time trueFISP in one respiratory cycle

International Nuclear Information System (INIS)

Wintersperger, B.J.; Nikolaou, K.; Huber, A.; Dietrich, O.; Reiser, M.F.; Schoenberg, S.O.; Muehling, O.; Nittka, M.; Kiefer, B.

2004-01-01

Real-time multislice cine techniques lead to inaccurate results in ventricular volumes based on limited temporal resolution. The purpose of the study is to evaluate a real-time cine technique with parallel imaging algorithms in comparison to standard segmented techniques. Twelve patients underwent cardiac cine MRI using real-time multislice cine trueFISP. Temporal resolution was improved using parallel acquisition techniques (iPAT) and data acquisition was performed in a single breath-hold along the patients' short axis. Evaluation of EDV, ESV, EF and myocardial mass was performed and results compared to a standard segmented single-slice cine trueFISP. Combination of real-time cine trueFISP and iPAT provided a temporal resolution of 48 ms. Results of the multislice approach showed an excellent correlation to standard single-slice trueFISP for EDV (0.94, p [de

Research into zirconium alloys resistant to carbon dioxide under pressure at temperatures of up to 600 deg C (1963); Recherche d'alliages de zirconium compatibles avec le gaz carbonique sous pression jusqu'a 500 ou 600 deg C (1063)

Energy Technology Data Exchange (ETDEWEB)

Baque, P; Dominget, R; Bossard, J [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

1963-07-01

Zirconium is a metal having a relatively low neutron capture cross-section and a high melting point; it is thus possible to consider its use in particular as a canning material for fuel elements in CO{sub 2}-cooled nuclear reactors. A preliminary study of several types of zirconium showed that the metal is already strongly oxidised in this gas at 500 deg C. The 'breakaway' phenomenon is generalised; the oxidation rate is then linear and depends on the carbon dioxide pressure. An attempt was therefore made to find binary and tertiary alloys in order to improve the metal behaviour. Several interesting compositions were found: 1, 1.6 and 2.5 per cent of copper, 2 per cent of vanadium, and 0.05 and 0.5 per cent of calcium. Tertiary copper-molybdenum and copper-phosphorus alloys are also less liable to oxidation and in particular do not exhibit the 'breakaway' phenomenon even after a prolonged treatment at 600 deg C. (authors) [French] Le zirconium se trouve parmi les metaux a section de capture neutronique relativement faible et possede une temperature de fusion elevee; aussi peut on songer a l'employer notamment comme materiau de gainage d'elements combustibles pour reacteurs nucleaires refroidis au gaz carbonique. Une etude prealable de plusieurs qualites de zirconium a montre que le metal est deja assez fortement oxyde dans ce gaz des 500 deg C. En effet, le phenomene de ''breakaway'' est general; la vitesse d'oxydation devient alors lineaire et depend de la pression du gaz carbonique. La recherche d'alliages binaires et ternaires a donc ete entreprise afin de tenter d'ameliorer le comportement du metal. Elle a permis d'aboutir a quelques compositions interessantes: cuivre 1, 1,6 et 2,5 pour cent, vanadium 2 pour cent, et calcium 0,05 et 0,5 pour cent. Des alliages ternaires au cuivre-molybdene et cuivre-phosphore sont egalement moins oxydables, et en particulier ne presentent pas le phenomene de ''breakaway'', meme apres une longue exposition a 600 deg C. (auteurs)

Endovascular treatment of a true posterior communicating artery aneurysm.

Science.gov (United States)

Munarriz, Pablo M; Castaño-Leon, Ana M; Cepeda, Santiago; Campollo, Jorge; Alén, Jose F; Lagares, Alfonso

2014-01-01

Posterior communicating artery (PCoA) aneurysms are most commonly located at the junction of the internal carotid artery and the PCoA. "True" PCoA aneurysms, which originate from the PCoA itself, are rarely encountered. Most previously reported cases were treated surgically mainly before the endovascular option became available. A 53-year-old male presented with sudden onset of right hemiparesis and aphasia. Left middle cerebral artery stroke was diagnosed. Further studies revealed a 3 mm left PCoA aneurysm arising from the PCoA itself, attached to neither the internal carotid artery nor the posterior cerebral artery. Endovascular treatment was performed and the aneurysm was coiled completely. Technical advances in endovascular interventional technology have permitted an additional approach to these lesions. The possible endovascular significance of the treatment of true PCoA aneurysms is discussed.

Median Hetero-Associative Memories Applied to the Categorization of True-Color Patterns

Science.gov (United States)

Vázquez, Roberto A.; Sossa, Humberto

Median associative memories (MED-AMs) are a special type of associative memory based on the median operator. This type of associative model has been applied to the restoration of gray scale images and provides better performance than other models, such as morphological associative memories, when the patterns are altered with mixed noise. Despite of his power, MED-AMs have not been applied in problems involving true-color patterns. In this paper we describe how a median hetero-associative memory (MED-HAM) could be applied in problems that involve true-color patterns. A complete study of the behavior of this associative model in the restoration of true-color images is performed using a benchmark of 14400 images altered by different type of noises. Furthermore, we describe how this model can be applied to an image categorization problem.

Parent artery occlusion for ruptured "true" posterior communicating artery aneurysm.

Science.gov (United States)

Mitsuhashi, Takashi; Takeda, Nobuaki; Oishi, Hidenori; Arai, Hajime

2015-04-01

A case of a patient with a ruptured true posterior communicating artery (PCoA) aneurysm is reported, who had been managed by early endovascular parent artery occlusion with coils. The small blister aneurysm was located at the proximal PCoA itself and directed superiorly. Postoperative course was uneventful. During 1-month follow-up, the patient recovered well and could care for herself. Aneurysms of the PCoA itself are very rare. As reported to date, surgical procedures would favor microsurgical clipping over endovascular coil embolization. Endovascular treatment may be a good alternative to surgical trapping for true PCoA blister aneurysm. © The Author(s) 2015 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.

Selecting Eco-Friendly Thermal Systems for the “Vittoriale Degli Italiani” Historic Museum Building

Directory of Open Access Journals (Sweden)

Davide Astiaso Garcia

2015-09-01

Full Text Available Thermal systems installed in museums should guarantee the maintenance of the optimal hygrothermal parameters ranges for the conservation of their collection materials. Considering the preservation of historic buildings, according to their historical and landscaping constraints, not all the thermal system typologies could be installed in these buildings’ typologies. Therefore, the main aim of this paper is to present some indications for the choice of the best thermal system solutions for a considered historic museum building, called Vittoriale degli Italiani, in the north of Italy, taking into account their installation feasibility and their related environmental impacts. The methodology includes a monitoring of the current hygrothermal parameters as well as the assessment of design heat and cooling loads related to the maintenance of the optimal hygrothermal parameters ranges for the conservation of collection materials. In addition, a Life Cycle Assessment (LCA of each selected system typology is considered for highlighting the most eco-friendly solution among the suitable ones. The obtained results highlights the feasible thermal system solutions able to maintain the hygrothermal parameters between the optimal ranges with a lower environmental impact in the Vittoriale degli Italiani historic museum building.

Giant magnetic quadrupole resonance studied with 180 deg. electron scattering

CERN Document Server

Neumann-Cosel, P V

1999-01-01

The nuclei sup 4 sup 8 Ca and sup 9 sup 0 Zr were investigated in 180 deg. high-resolution inelastic electron scattering for momentum transfers q approx =0.35-0.8 fm sup - sup 1. Complete M2 strength distributions could be extracted in both nuclei up to excitation energies of about 15 MeV utilizing a fluctuation analysis technique. Second-RPA calculations successfully describe the experimentally observed strong fragmentation of the M2 mode. The quenching of the spin part is found to be comparable to the M1 case, contrary to previous claims suggesting a stronger reduction. A quantitative reproduction of the data requires the presence of appreciable orbital strength which can be interpreted as a torsional elastic vibration (the so-called twist mode).

Optical resonators for true-time-delay beam steering

Science.gov (United States)

Gesell, Leslie H.; Evanko, Stephen M.

1996-06-01

Conventional true time delay beamforming and steering devices rely on switching between various lengths of delay line. Therefore only discrete delays are possible. Proposed is a new photonics concept for true time delay beamforming which provides a finely controlled continuum of delays with switching speeds on the order of 10's of nanoseconds or faster. The architecture uses an array of waveguide cavities with different resonate frequencies to channelize the signal. Each spectral component of the signal is phase shifted by an amount proportional to the frequency of that component and the desired time delay. These phase shifted spectral components are then summed to obtain the delayed signal. This paper provides an overview of the results of a Phase I SBIR contract where this concept has been refined and analyzed. The parameters for an operational system are determined and indication of the feasibility of this approach is given. Among the issues addressed are the requirements of the resonators and the methods necessary to implement fiber optic Bragg gratings as these resonators.

Investigation of effect of air flow rate on Zircaloy-4 oxidation kinetics and breakaway phenomenon in air at 850 .deg. C

International Nuclear Information System (INIS)

Maeng, Yunhwan; Lee, Jaeyoung; Park, Sanggil

2016-01-01

This paper analyzed an effect of flow rate on oxidation kinetics of Zircaloy-4 in air at 850 .deg. C. In case of the oxidation of Zircaloy-4 in air at 850 .deg. C, acceleration of oxidation kinetics from parabolic to linear (breakaway phenomenon) occurs. Oxidation and breakaway kinetics of the Zircaloy-4 in air was experimentally studied by changing a flow rate of argon/air mixture. Tests were conducted at 850 .deg. C under constant ratio of argon and air. The effects of flow rate on the oxidation and breakaway kinetics was observed. This paper is based on a revised and considerably extended presentation given at the 21 st International Quench Workshop. The effects of flow conditions on the oxidation kinetics of Zircaloy-4 samples were explained with residence time and percent flow efficiency. In addition, several issues were observed from this study, interdiffusion at breakaway and deformation of oxide structure by breakaway phenomenon

BD-22deg3467, a DAO-type Star Exciting the Nebula Abell 35

Science.gov (United States)

Ziegler, M.; Rauch, T.; Werner, K.; Koppen, J.; Kruk, J. W.

2013-01-01

Spectral analyses of hot, compact stars with non-local thermodynamical equilibrium (NLTE) model-atmosphere techniques allow the precise determination of photospheric parameters such as the effective temperature (T(sub eff)), the surface gravity (log g), and the chemical composition. The derived photospheric metal abundances are crucial constraints for stellar evolutionary theory. Aims. Previous spectral analyses of the exciting star of the nebula A35, BD-22deg3467, were based on He+C+N+O+Si+Fe models only. For our analysis, we use state-of-the-art fully metal-line blanketed NLTE model atmospheres that consider opacities of 23 elements from hydrogen to nickel. We aim to identify all observed lines in the ultraviolet (UV) spectrum of BD-22deg3467 and to determine the abundances of the respective species precisely. Methods. For the analysis of high-resolution and high signal-to-noise ratio (S/N) far-ultraviolet (FUSE) and UV (HST/STIS) observations, we combined stellar-atmosphere models and interstellar line-absorption models to fully reproduce the entire observed UV spectrum. Results. The best agreement with the UV observation of BD-22deg3467 is achieved at T(sub eff) = 80 +/- 10 kK and log g = 7.2 +/- 0.3. While T(sub eff) of previous analyses is verified, log g is significantly lower. We re-analyzed lines of silicon and iron (1/100 and about solar abundances, respectively) and for the first time in this star identified argon, chromium, manganese, cobalt, and nickel and determined abundances of 12, 70, 35, 150, and 5 times solar, respectively. Our results partially agree with predictions of diffusion models for DA-type white dwarfs. A combination of photospheric and interstellar line-absorption models reproduces more than 90% of the observed absorption features. The stellar mass is M approx. 0.48 Solar Mass. Conclusions. BD.22.3467 may not have been massive enough to ascend the asymptotic giant branch and may have evolved directly from the extended horizontal branch

Exploring a possible origin of a 14 deg y-normal spin tilt at RHIC polarimeter

Energy Technology Data Exchange (ETDEWEB)

Meot, F. [Brookhaven National Lab. (BNL), Upton, NY (United States); Huang, H. [Brookhaven National Lab. (BNL), Upton, NY (United States)

2015-06-15

A possible origin of a 14 deg y-normal spin n^→₀ tilt at the polarimeter is in snake angle defects. This possible cause is investigated by scanning the snake axis angle µ, and the spin rotation angle at the snake, φ, in the vicinity of their nominal values.

The Solar Neighborhood. XXV. Discovery of New Proper Motion Stars with 0.40 sec/yr > mu > or = 0.18 sec/yr Between Declinations -47 deg and 00 deg

Science.gov (United States)

Boyd, Mark R.; Winters, Jennifer G.; Henry, Todd J.; Jao, Wei-Chun; Finch, Charlie T.; Subasavage, John P.; Hambly, Nigel C.

2011-01-01

We present 2817 new southern proper motion systems with 0.40 sec/yr > mu > or = 0.18 sec/yr and declination between 47 deg and 00 deg. This is a continuation of the SuperCOSMOS-RECONS (SCR) proper motion searches of the southern sky. We use the same photometric relations as previous searches to provide distance estimates based on the assumption that the objects are single main-sequence stars. We find 79 new red dwarf systems predicted to be within 25 pc, including a few new components of previously known systems. Two systems--SCR 1731-2452 at 9.5 pc and SCR 1746-3214 at 9.9 pc--are anticipated to be within 10 pc. We also find 23 new white dwarf (WD) candidates with distance estimates of 15-66 pc, as well as 360 new red subdwarf candidates. With this search, we complete the SCR sweep of the southern sky for stars with mu > or = 0.18 sec/yr and R(sub 59F) < or = 16.5, resulting in a total of 5042 objects in 4724 previously unreported proper motion systems. Here we provide selected comprehensive lists from our SCR proper motion search to date, including 152 red dwarf systems estimated to be within 25 pc (9 within 10 pc), 46 WDs (10 within 25 pc), and 598 subdwarf candidates. The results of this search suggest that there are more nearby systems to be found at fainter magnitudes and lower proper motion limits than those probed so far.

Detecting the True Nature of Allegations of Rape

NARCIS (Netherlands)

De Zutter, André; Horselenberg, Robert; van Koppen, Peter J.

2017-01-01

A study was conducted to test whether it is possible to build a model to distinguish true and false allegations of rape based on the theory of fabricated rape. The theory is based on the principle that a false complainant of rape has not been raped and has to fabricate a story while the story of a

True Crime: Forbrydelse, fortælling og dom

DEFF Research Database (Denmark)

Lundtofte, Thomas Enemark

2016-01-01

De seneste år har budt på en række opsigtsvækkende dokumentarkrimiserier, der har udfordret det amerikanske retssystem. Serierne inviterer os til at tage stilling til skyldsspørgsmål og blande os i debatten om retfærdighed. Angiveligt som følge af true crime-serien Making a Murderer (2015) bliver...

Characterizing concentrations of diethylene glycol and suspected metabolites in human serum, urine, and cerebrospinal fluid samples from the Panama DEG mass poisoning.

Science.gov (United States)

Schier, J G; Hunt, D R; Perala, A; McMartin, K E; Bartels, M J; Lewis, L S; McGeehin, M A; Flanders, W D

2013-12-01

Diethylene glycol (DEG) mass poisoning is a persistent public health problem. Unfortunately, there are no human biological data on DEG and its suspected metabolites in poisoning. If present and associated with poisoning, the evidence for use of traditional therapies such as fomepizole and/or hemodialysis would be much stronger. To characterize DEG and its metabolites in stored serum, urine, and cerebrospinal fluid (CSF) specimens obtained from human DEG poisoning victims enrolled in a 2006 case-control study. In the 2006 study, biological samples from persons enrolled in a case-control study (42 cases with new-onset, unexplained AKI and 140 age-, sex-, and admission date-matched controls without AKI) were collected and shipped to the Centers for Disease Control and Prevention (CDC) in Atlanta for various analyses and were then frozen in storage. For this study, when sufficient volume of the original specimen remained, the following analytes were quantitatively measured in serum, urine, and CSF: DEG, 2-hydroxyethoxyacetic acid (HEAA), diglycolic acid, ethylene glycol, glycolic acid, and oxalic acid. Analytes were measured using low resolution GC/MS, descriptive statistics calculated and case results compared with controls when appropriate. Specimens were de-identified so previously collected demographic, exposure, and health data were not available. The Wilcoxon Rank Sum test (with exact p-values) and bivariable exact logistic regression were used in SAS v9.2 for data analysis. The following samples were analyzed: serum, 20 case, and 20 controls; urine, 11 case and 22 controls; and CSF, 11 samples from 10 cases and no controls. Diglycolic acid was detected in all case serum samples (median, 40.7 mcg/mL; range, 22.6-75.2) and no controls, and in all case urine samples (median, 28.7 mcg/mL; range, 14-118.4) and only five (23%) controls (median, urine diglycolic acid (both OR > 999; exact p sample results were excluded and two from the same case were averaged, yielding

Il movimento degli scioperi nel XX secolo

Directory of Open Access Journals (Sweden)

Maria Theresa Schorer Petrone

1983-06-01

Full Text Available Cella, Gian Primo (organizador. Il movimento degli scioperi nel XX secolo. Bologna, Società Editrice Mulino, 1979. (primeiro parágrado do texto "O movimento das greves no século XX" constitui o resultado de laboriosa pesquisa realizada por um grupo de sociólogos— Guido 13oglioni, Lorenzo Bordogna, Gian Primo Cella, Pietro Kemeny, Giancarlo Provasi, Guido Romagnoli e Gian Enrico Rusconi — ligados às universidades de Turim, Parma, Trento e Cagliari.  Analisando com técnicas de quantificação, os mais variados aspectos das greves ocorridas desde o início deste século até 1970 na Grã Bretanha, Alemanha, Itália, França e nos Estados Unidos, e considerando esses niovimentos' os indicadores mais significativos da ação operária enquanto Manifestação sindical e reinvindicativa, acreditavam que poderiam de-teCtar as relações entre ação operária e as 'mudanças sociais.  O livro em questão é o resultado da primeira fase desta pesquisa em que se procurou reconstruir os movimentos grevistas e suas formas, chegando-se a construir modelos explicativos .

Why should correction values be better known than the measurand true value?

International Nuclear Information System (INIS)

Pavese, Franco

2013-01-01

Since the beginning of the history of modern measurement science, the experimenters faced the problem of dealing with systematic effects, as distinct from, and opposed to, random effects. Two main schools of thinking stemmed from the empirical and theoretical exploration of the problem, one dictating that the two species should be kept and reported separately, the other indicating ways to combine the two species into a single numerical value for the total uncertainty (often indicated as 'error'). The second way of thinking was adopted by the GUM, and, generally, adopts the method of assuming that their expected value is null by requiring, for all systematic effects taken into account in the model, that corresponding 'corrections' are applied to the measured values before the uncertainty analysis is performed. On the other hand, about the value of the measurand intended to be the object of measurement, classical statistics calls it 'true value', admitting that a value should exist objectively (e.g. the value of a fundamental constant), and that any experimental operation aims at obtaining an ideally exact measure of it. However, due to the uncertainty affecting every measurement process, this goal can be attained only approximately, in the sense that nobody can ever know exactly how much any measured value differs from the true value. The paper discusses the credibility of the numerical value attributed to an estimated correction, compared with the credibility of the estimate of the location of the true value, concluding that the true value of a correction should be considered as imprecisely evaluable as the true value of any 'input quantity', and of the measurand itself. From this conclusion, one should derive that the distinction between 'input quantities' and 'corrections' is not justified and not useful

SU-F-E-19: A Novel Method for TrueBeam Jaw Calibration

Energy Technology Data Exchange (ETDEWEB)

Corns, R; Zhao, Y; Huang, V [Fraser Valley Cancer Centre - BC Cancer Agency, Surrey, BC (United Kingdom)

2016-06-15

Purpose: A simple jaw calibration method is proposed for Varian TrueBeam using an EPID-Encoder combination that gives accurate fields sizes and a homogeneous junction dose. This benefits clinical applications such as mono-isocentric half-beam block breast cancer or head and neck cancer treatment with junction/field matching. Methods: We use EPID imager with pixel size 0.392 mm × 0.392 mm to determine the radiation jaw position as measured from radio-opaque markers aligned with the crosshair. We acquire two images with different symmetric field sizes and record each individual jaw encoder values. A linear relationship between each jaw’s position and its encoder value is established, from which we predict the encoder values that produce the jaw positions required by TrueBeam’s calibration procedure. During TrueBeam’s jaw calibration procedure, we move the jaw with the pendant to set the jaw into position using the predicted encoder value. The overall accuracy is under 0.1 mm. Results: Our in-house software analyses images and provides sub-pixel accuracy to determine field centre and radiation edges (50% dose of the profile). We verified the TrueBeam encoder provides a reliable linear relationship for each individual jaw position (R{sup 2}>0.9999) from which the encoder values necessary to set jaw calibration points (1 cm and 19 cm) are predicted. Junction matching dose inhomogeneities were improved from >±20% to <±6% using this new calibration protocol. However, one technical challenge exists for junction matching, if the collimator walkout is large. Conclusion: Our new TrueBeam jaw calibration method can systematically calibrate the jaws to crosshair within sub-pixel accuracy and provides both good junction doses and field sizes. This method does not compensate for a larger collimator walkout, but can be used as the underlying foundation for addressing the walkout issue.

Superconducting transition and low-field magnetoresistance of a niobium single crystal at 4.2 deg. K; Transition supraconductrice et magnetoresistance en champ faible d'un echantillon monocristallin de niobium a 4.2 deg. K

Energy Technology Data Exchange (ETDEWEB)

Perriot, G. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires. Service de physique du solide et de resonnance magnetique

1967-01-01

We report the study of the electrical resistance of a niobium single crystal, at 4.2 deg. K, from the beginning of the superconductive transition to 80 kilo oersteds. Critical fieldsH{sub c2} and H{sub c3} have been determined. Influences on superconductive transition of current density, field-current angle, crystal orientation and magnetoresistance have been studied. Variation laws of low-field transverse and longitudinal magneto-resistances have been determined. (author) [French] La variation de la resistance electrique d'un monocristal cylindrique de niobium a ete etudiee, a 4,2 deg. K, depuis le debut de la transition supraconductrice jusqu'a 80 kilooersteds. Les champs critiques H{sub c2} et H{sub c3} ont ete determines. On a etudie l'influence de la densite de courant, de l'angle champ-courant, de l'anisotropie cristalline et de la magnetoresistance sur la transition supraconductrice. Les lois de variation des magnetoresistances transversale et longitudinale ont ete determinees dans le domaine des champs faibles. (auteur)

Myocardial imaging with thallium-201: an experimental model for analysis of the true myocardial and background image components

International Nuclear Information System (INIS)

Narahara, K.A.; Hamilton, G.W.; Williams, D.L.; Gould, K.L.

1977-01-01

The true myocardial and background components of a resting thallium-201 myocardial image were determined in an experimental dog model. True background was determined by imaging after the heart had been removed and replaced with a water-filled balloon of equal size and shape. In all studies, the background estimated from the region surrounding the heart exceeded true background activity. Furthermore, the relationship between true myocardial background and that estimated from the pericardiac region was inconsistent. Background estimates based on the activity surrounding the heart were not accurate predictors of true background activity

Accurate decisions in an uncertain world: collective cognition increases true positives while decreasing false positives.

Science.gov (United States)

Wolf, Max; Kurvers, Ralf H J M; Ward, Ashley J W; Krause, Stefan; Krause, Jens

2013-04-07

In a wide range of contexts, including predator avoidance, medical decision-making and security screening, decision accuracy is fundamentally constrained by the trade-off between true and false positives. Increased true positives are possible only at the cost of increased false positives; conversely, decreased false positives are associated with decreased true positives. We use an integrated theoretical and experimental approach to show that a group of decision-makers can overcome this basic limitation. Using a mathematical model, we show that a simple quorum decision rule enables individuals in groups to simultaneously increase true positives and decrease false positives. The results from a predator-detection experiment that we performed with humans are in line with these predictions: (i) after observing the choices of the other group members, individuals both increase true positives and decrease false positives, (ii) this effect gets stronger as group size increases, (iii) individuals use a quorum threshold set between the average true- and false-positive rates of the other group members, and (iv) individuals adjust their quorum adaptively to the performance of the group. Our results have broad implications for our understanding of the ecology and evolution of group-living animals and lend themselves for applications in the human domain such as the design of improved screening methods in medical, forensic, security and business applications.

Breaking the Barriers to True Augmented Reality

OpenAIRE

Sandor, Christian; Fuchs, Martin; Cassinelli, Alvaro; Li, Hao; Newcombe, Richard; Yamamoto, Goshiro; Feiner, Steven

2015-01-01

In recent years, Augmented Reality (AR) and Virtual Reality (VR) have gained considerable commercial traction, with Facebook acquiring Oculus VR for \\$2 billion, Magic Leap attracting more than \\$500 million of funding, and Microsoft announcing their HoloLens head-worn computer. Where is humanity headed: a brave new dystopia-or a paradise come true? In this article, we present discussions, which started at the symposium "Making Augmented Reality Real", held at Nara Institute of Science and Te...

Measuring True Sales and Underreporting with Matched Firm-Level Survey and Tax-Office Data

NARCIS (Netherlands)

Zhou, F.; Oostendorp, R.H.

2014-01-01

This paper uses firm-level survey data matched with official tax records to estimate the unobserved true sales of formal firms in Mongolia. Taking into account firm-level incentives to comply with taxes and a production function technology linking unobserved true sales with observable firm-level

Two Cases of True Uterine Artery Aneurysms Diagnosed during Pregnancy

DEFF Research Database (Denmark)

Schlütter, Jacob Mørup; Johansen, Gry; Helmig, Rikke Bek

2016-01-01

We report 2 cases of true uterine artery aneurysms diagnosed during pregnancy. Both cases presented with nonspecific symptoms such as urethral obstruction, minimal vaginal bleeding and lower abdominal pain in the 2nd trimester. Both aneurysms were diagnosed by color Doppler ultrasound. In the fir...... masses, vague bladder symptoms or radiating pelvic pain. The diagnosis is readily made by color Doppler imaging. Elective Caesarean section should be the preferred mode of delivery to avoid rupture of the aneurysm during labor.......We report 2 cases of true uterine artery aneurysms diagnosed during pregnancy. Both cases presented with nonspecific symptoms such as urethral obstruction, minimal vaginal bleeding and lower abdominal pain in the 2nd trimester. Both aneurysms were diagnosed by color Doppler ultrasound. In the first...

Isothermal section of the Y-Co-V ternary system at 500 deg. C

International Nuclear Information System (INIS)

Wei, X.X.; Yan, J.L.; Du, H.W.; Wu, C.L.; Zhou, K.W.; Zhuang, Y.H.; Li, J.Q.

2011-01-01

Research highlights: → The isothermal section of the Y-Co-V system at 500 deg. C has been established. → Only one ternary compound YV x Co 12-x was found in this system and it exhibits a linear homogeneity range for 1.30 ≤ x ≤ 3.64. → The maximum solid solubilities of V in the compounds Y 2 Co 17 , Y 2 Co 7 , YCo 3 , YCo 2 and Y 3 Co are about 10, 1.0, 3.0, 4.0 and 4.0 at.%, respectively. - Abstract: The isothermal section of the Y-Co-V system at 500 deg. C has been investigated by X-ray diffraction, scanning electron microscopy and energy dispersive X-ray spectroscopy. Only one ternary compound YV x Co 12-x with a homogeneity range of 1.30 ≤ x ≤3.64 was found in this system. The maximum solid solubilities of V in Y 2 Co 17 , Y 2 Co 7 , YCo 3 , YCo 2 and Y 3 Co are about 10.0, 1.0, 3.0, 4.0 and 4.0 at.% V, respectively. The compounds VCo and VCo 3 have a homogeneity range of 46-66 at.% V and 22-30 at.% V, respectively. The maximum solid solubility of Y in VCo is about 2.0 at.% Y.

LA FORMAZIONE DEGLI INSEGNANTI PER UNA EDUCAZIONE PLURILINGUE E INTERCULTURALE

Directory of Open Access Journals (Sweden)

Edoardo Lugarini

2012-07-01

Full Text Available Dalla la Guida per lo sviluppo e l’attuazione di curricoli per una educazione plurilingue e interculturale del Consiglio d’Europa è possibile trarre una serie di indicazioni per disegnare un profilo professionale e, di conseguenza, una serie di indicazioni per la formazione iniziale e in servizio dell’insegnate di lingua (L1, L2, LS. In questo intervento si suggeriscono, senza alcuna pretesa di esaustività, degli indicatori relativi alle competenze professionali che l’insegnante dovrebbe possedere per poter svolgere la sua attività nella scuola italiana di oggi in considerazione dei bisogni linguistici delle nuove generazioni e degli obiettivi linguistici proposti dal Consiglio d’Europa nell’ambito delle politiche educative orientate a favorire la mobilità, una più efficace comunicazione internazionale, il rispetto dell’identità e della diversità delle culture, a sviluppare l’educazione alla cittadinanza democratica ed europea. Dalle riflessioni condotte emerge la necessità di una formazione disciplinare e didattica articolata e complessa che renda l’insegnante “professionista riflessivo” e “ricercatore sperimentale”TRAINING TEACHERS FOR MULTILINGUISTIC, INTERCULTURAL EDUCATIONFrom the Council of Europe’s Guide for the development and implementation of curricula for multilingual and intercultural education, it is possible to draw a series of explicit or implicit characteristics for teachers, and consequently, a series of indications for initial and in-service language (L1, L2, FL teacher training. This paper offers a brief view of the professional competences teachers should possess in order to carry out their roles in Italian schools considering the linguistic needs of the young generations and the language objectives set out by the Council of Europe regarding education policies that promote mobility, more effective International communication and respect for cultural identity and diversity, in an effort to

Feeling like you know who you are: perceived true self-knowledge and meaning in life.

Science.gov (United States)

Schlegel, Rebecca J; Hicks, Joshua A; King, Laura A; Arndt, Jamie

2011-06-01

The essence of who a person really is has been labeled the "true self," and an emerging area of research suggests that this self-concept plays an important role in the creation of a fulfilling existence. Three studies investigate the role of the subjective feeling that one possesses knowledge of one's true self in meaning in life judgments. Consistently, the perception of availability of true self-knowledge (operationalized as the metacognitive experience of ease in describing one's true self) predicted meaning in life judgments over and above other potentially related constructs such as mood and self-esteem. Conversely, the subjective availability of knowledge of how one actually behaves (i.e., one's actual self) was unrelated to meaning in life judgments. Implications and directions for future research are discussed.

Effect of bonding and bakeout thermal cycles on the properties of copper alloys irradiated at 350 deg. C

International Nuclear Information System (INIS)

Singh, B.N.; Eldrup, M.; Toft, P.; Edwards, D.J.

1997-02-01

Screening experiments were carried out to investigate the effect of bonding and bakeout thermal cycles on microstructure, mechanical properties and electrical resistivity of the oxide dispersion strengthened (GlidCop, CuAl-25) and the precipitation hardened (CuCrZr, CuNiBe) cooper alloys. Tensile specimens of CuCrZr and CuNiBe alloys were given various heat treatments corresponding to solution anneal, prime-ageing, and bonding thermal treatment followed by re-ageing and the reactor bakeout treatment at 350 deg. C for 100 h. Tensile specimens of CuAl-25 were given the heat treatment corresponding to the bonding thermal cycle. A number of heat treated specimens were neutron irradiated at 350 deg. C to a dose level of ∼ 0.3 dpa in the DR-3 reactor at Risoe. Both unirradiated and irradiated specimens with various heat treatments were tensile tested at 350 deg. C. The microstructure and electrical resistivity of these specimens were determined in the unirradiated as well as irradiated conditions. The post-deformation microstructure of the irradiated specimens was also investigated. The fracture surfaces of both unirradiated and irradiated specimens were examined. Results of these investigations are reported in the present report. The results are briefly discussed in terms of thermal and irradiation stability of precipitates and particles and irradiation-induced segregation, precipitation and recovery of dislocation microstructure. (au) 6 tabs., 24 ills., 9 refs

MODIS/Aqua Aerosol Cloud Water Vapor Ozone 8-Day L3 Global 1Deg CMG V006

Data.gov (United States)

National Aeronautics and Space Administration — MODIS/Aqua Aerosol Cloud Water Vapor Ozone 8-Day L3 Global 1Deg CMG (MYD08_E3). MODIS was launched aboard the Aqua satellite on May 04, 2002 (1:30 pm equator...

True photographs and false memories.

Science.gov (United States)

Lindsay, D Stephen; Hagen, Lisa; Read, J Don; Wade, Kimberley A; Garry, Maryanne

2004-03-01

Some trauma-memory-oriented psychotherapists advise clients to review old family photo albums to cue suspected "repressed" memories of childhood sexual abuse. Old photos might cue long-forgotten memories, but when combined with other suggestive influences they might also contribute to false memories. We asked 45 undergraduates to work at remembering three school-related childhood events (two true events provided by parents and one pseudoevent). By random assignment, 23 subjects were also given their school classes' group photos from the years of the to-be-recalled events as memory cues. As predicted, the rate of false-memory reports was dramatically higher in the photo condition than in the no-photo condition. Indeed, the rate of false-memory reports in the photo condition was substantially higher than the rate in any previously published study.

Comportment of various magnesium alloys in carbon dioxide under pressure, between 400 and 600 deg; Compatibilite de divers alliages de magnesium avec le gaz carbonique sous pression entre 400 et 600 deg

Energy Technology Data Exchange (ETDEWEB)

Darras, R; Baque, P; Chevilliard, C [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires

1960-07-01

The following materials were studied: nuclear magnesium, two Mg-Zr alloys, a 'Magnox' type alloy, a Mg-Mn alloy and a 'sintered magnesium oxide'. The samples, taken from drawn metals, are suitably polished and given two reproducible surface conditions for purposes of comparison. The tests were carried out in purified carbon dioxide, at pressures of 25 to 60 atmospheres and temperatures from 400 to 600, using special, externally heated stainless steel autoclaves. The duration of the tests is generally more than 1000 hours. The equations of the weight increase curves obtained are of the type: ({delta}p){sup n} = k.t (({delta}p in mg/cm{sup 2} and t in hours), the index n being around 2, at least up to 500 deg. C. Referring to results obtained previously in the case of certain of these materials exposed to carbon dioxide at atmospheric pressure and at 15 atmospheres, it appears that: 1) for given material: - at a given pressure, oxidation increases with temperature, - at a given temperature oxidation increases with pressure, - under the same temperature and pressure conditions, the results vary little according to the two surface states studied; 2) Mg-Zr alloys show better oxidation resistance than non-alloyed magnesium; 3) The alloy magnox shows up much less favourably in carbon dioxide than in air, compared with the other alloys. Generally speaking, the oxidation curves tending towards a threshold after a certain exposure time, all the alloys considered appear to show a satisfactory compatibility with carbon dioxide up to a temperature around 500 deg. C, under the working conditions defined here; above 500, under differences appear between various alloys, but the sublimation phenomena interfere with those of oxidation, with the result that a classification of the various materials can only be based on their resultant. (author) [French] Les materiaux etudies comprennent: le magnesium nucleaire, deux alliages Mg-Zr, un alliage du type 'Magnox', un alliage Mg-Mn et un

Pre- and post-irradiation properties of copper alloys at 250 deg. C following bonding and bakeout thermal cycles

International Nuclear Information System (INIS)

Singh, B.N.; Edwards, D.J.; Eldrup, M.; Toft, P.

1997-01-01

Screening experiments were carried out to investigate the effect of bonding and bakeout thermal cycles on microstructure, mechanical properties and electrical resistivity of the oxide dispersion strengthened (GlidCop, CuAl-25) and the precipitation hardened (CuCrZr, CuNiBe) copper alloys. Tensile specimens of CuCrZr and CuNiBe alloys were given various heat treatments corresponding to solution anneal, prime-ageing, and bonding thermal treatment followed by re-ageing and the reactor bakeout treatment at 350 deg. C for 100 h. Tensile specimens of CuAl-25 were given the heat treatment corresponding to the bonding thermal cycle. A number of heat treated specimens were neuron irradiated at 250 deg. C to a dose level of ∼ 0.3 dpa in the DR-3 reactor at Risoe. Both unirradiated and irradiated specimens with various heat treatments were tensile tested at 250 deg. C. The microstructure and electrical resistivity of these specimens were determined in the unirradiated as well as irradiated conditions. The post-deformation microstructure of the irradiated specimens was also investigated. The fracture surfaces of both unirradiated and irradiated specimens were examined. Results of these investigations are reported in the present report. The main effect of the bonding thermal cycle heat treatment was a slight decrease in strength of CuCrZr and CuNiBe alloys. The strength of CuAl-25, on the other hand, remained almost unaltered. The post irradiation tests at 250 deg. C showed a severe loss of ductility in the case of CuNiBe alloy. The irradiated CuAl-25 and CuCrZr specimens, on the other hand, exhibited a reasonable amount of uniform elongation. The results are briefly discussed in terms of thermal and irradiation stability of precipitates and particles and irradiation-induced segregation, precipitation and recovery of dislocation microstructure. (au) 7 tabs., 28 ills., 15 refs

The system Ba(H2PO4)2-Sr(H2PO4)2-H3PO4(30%)-H2O at 25, 40 and 60 deg C

International Nuclear Information System (INIS)

Taranenko, N.P.; Serebrennikova, G.M.; Stepin, B.D.; Oboznenko, Yu.V.

1982-01-01

The system Ba(H 2 PO 4 ) 2 -Sr(H 2 PO 4 ) 2 -H 3 PO 4 (30%)-H 2 O (25 deg C) belongs to eutonic type systems. Solubility isotherms of salt components at 40 and 60 deg C are calculated. Polytherms (25-60 deg C) of solubility of monosubstituted barium and strontium phosphates in 30-60% H 3 PO 4 are obtained. The value of cocrystallization coefficient of Sr 2 + and Ba(H 2 PO 4 ) 2 Dsub(Sr)=0.042+-0.005 remains stable in the temperature range of 25-60 deg C and concentrations 30-60% phosphoric acid at initial content [Sr 2 + ]=1x10 - 2 mass%

True bilateral nasopharyngeal angiofibroma: report and review.

Science.gov (United States)

Mishra, Anupam; Mishra, Subhash Chandra

2016-10-01

This report describes the third case of a true bilateral Juvenile nasopharyngeal angiofibroma (JNA), i.e. two separate JNA arising from both sides simultaneously. The associated multiple recurrences in such a case have not yet been reported. A 21-year-man underwent transpalatal excision and recurred twice. The last 'neo-occurrence' encountered after 2 years was at a different site and was subsequently managed by post-embolization endoscopic resection. A complete report of its clinico-radiological features and management outcome is discussed.

Excimer laser recrystallization of nanocrystalline-Si films deposited by inductively coupled plasma chemical vapour deposition at 150 deg. C

International Nuclear Information System (INIS)

Park, Joong-Hyun; Han, Sang-Myeon; Park, Sang-Geun; Han, Min-Koo; Shin, Moon-Young

2006-01-01

Polycrystalline silicon thin film transistors (poly-Si TFTs) fabricated at low temperature (under 200 deg. C) have been widely investigated for flexible substrate applications such as a transparent plastic substrate. Unlike the conventional TFT process using glass substrate, the maximum process temperature should be kept less than 200 deg. C in order to avoid thermal damage on flexible substrates. We report the characteristics of nanocrystalline silicon (nc-Si) irradiated by an excimer laser. Nc-Si precursors were deposited on various buffer layers by inductively coupled plasma chemical vapour deposition (ICP-CVD) at 150 deg. C. We employed various buffer layers, such as silicon nitride (SiN X ) and silicon dioxide (SiO 2 ), in order to report recrystallization characteristics in connection with a buffer layer of a different thermal conductivity. The dehydrogenation and recrystallization was performed by step-by-step excimer laser annealing (ELA) (XeCl,λ=308 nm) in order to prevent the explosive release of hydrogen atoms. The grain size of the poly-Si film, which was recrystallized on the various buffer layers, was measured by scanning electron microscopy (SEM) at each laser energy density. The process margin of step-by-step ELA employing the SiN X buffer layer is wider than SiO 2 and the maximum grain size slightly increased

Scaling rates of true polar wander in convecting planets and moons

Science.gov (United States)

Rose, Ian; Buffett, Bruce

2017-12-01

Mass redistribution in the convecting mantle of a planet causes perturbations in its moment of inertia tensor. Conservation of angular momentum dictates that these perturbations change the direction of the rotation vector of the planet, a process known as true polar wander (TPW). Although the existence of TPW on Earth is firmly established, its rate and magnitude over geologic time scales remain controversial. Here we present scaling analyses and numerical simulations of TPW due to mantle convection over a range of parameter space relevant to planetary interiors. For simple rotating convection, we identify a set of dimensionless parameters that fully characterize true polar wander. We use these parameters to define timescales for the growth of moment of inertia perturbations due to convection and for their relaxation due to true polar wander. These timescales, as well as the relative sizes of convective anomalies, control the rate and magnitude of TPW. This analysis also clarifies the nature of so called "inertial interchange" TPW events, and relates them to a broader class of events that enable large and often rapid TPW. We expect these events to have been more frequent in Earth's past.

Neuromorphic Kalman filter implementation in IBM’s TrueNorth

Science.gov (United States)

Carney, R.; Bouchard, K.; Calafiura, P.; Clark, D.; Donofrio, D.; Garcia-Sciveres, M.; Livezey, J.

2017-10-01

Following the advent of a post-Moore’s law field of computation, novel architectures continue to emerge. With composite, multi-million connection neuromorphic chips like IBM’s TrueNorth, neural engineering has now become a feasible technology in this novel computing paradigm. High Energy Physics experiments are continuously exploring new methods of computation and data handling, including neuromorphic, to support the growing challenges of the field and be prepared for future commodity computing trends. This work details the first instance of a Kalman filter implementation in IBM’s neuromorphic architecture, TrueNorth, for both parallel and serial spike trains. The implementation is tested on multiple simulated systems and its performance is evaluated with respect to an equivalent non-spiking Kalman filter. The limits of the implementation are explored whilst varying the size of weight and threshold registers, the number of spikes used to encode a state, size of neuron block for spatial encoding, and neuron potential reset schemes.

ID-Check: Online Concealed Information Test Reveals True Identity.

Science.gov (United States)

Verschuere, Bruno; Kleinberg, Bennett

2016-01-01

The Internet has already changed people's lives considerably and is likely to drastically change forensic research. We developed a web-based test to reveal concealed autobiographical information. Initial studies identified a number of conditions that affect diagnostic efficiency. By combining these moderators, this study investigated the full potential of the online ID-check. Participants (n = 101) tried to hide their identity and claimed a false identity in a reaction time-based Concealed Information Test. Half of the participants were presented with personal details (e.g., first name, last name, birthday), whereas the others only saw irrelevant details. Results showed that participants' true identity could be detected with high accuracy (AUC = 0.98; overall accuracy: 86-94%). Online memory detection can reliably and validly detect whether someone is hiding their true identity. This suggests that online memory detection might become a valuable tool for forensic applications. © 2015 American Academy of Forensic Sciences.

Phase equilibrium in the AgI-RbI-H2O system at 25 deg C

International Nuclear Information System (INIS)

Stepin, B.D.; Serebrennikova, G.M.; Sazikova, L.A.; Starikova, Z.A.

1977-01-01

The triple system of AgI-RbI-H 2 O at 25 deg C was studied by the isothermal method. The formation of the Rb 2 AgI 3 complex compound, which dissolves in water with decomposition, was established. A powder pattern of Rb 2 AgI 3 was indexed

Investigation of flow condition on the oxidation of Zircaloy-4 in air at 850 and 1100 .deg. C

Energy Technology Data Exchange (ETDEWEB)

Maeng, Yun Hwan; Lee, Jae Young [Hangdong Global University, Pohang (Korea, Republic of); Park, Sang Gil [ACT Co. Ltd, Daejeon (Korea, Republic of)

2016-05-15

An oxidation behavior of the Zircaloy-4 was experimentally studied by varying a flow rate and partial pressure of air. Tests were conducted at two distinct temperatures in which a kinetic transition was occurred, or not: 850 .deg. C and 1100 .deg. C. The effects of flow rate and partial pressure of air was studied by a measurement of mass gain using thermogravimetric analyzer (TGA). After experiments, samples were observed with macrophotography and metallography using optical microscopy. The effect of flow rate and partial pressure of air were qualitatively analyzed with those methods. The effects of flow conditions on the oxidation kinetics of Zircaloy-4 samples were qualitatively studied. The flow rate and the partial pressure of air were changed and their effects was different when the temperature was changed.

New true-triaxial rock strength criteria considering intrinsic material characteristics

Science.gov (United States)

Zhang, Qiang; Li, Cheng; Quan, Xiaowei; Wang, Yanning; Yu, Liyuan; Jiang, Binsong

2018-02-01

A reasonable strength criterion should reflect the hydrostatic pressure effect, minimum principal stress effect, and intermediate principal stress effect. The former two effects can be described by the meridian curves, and the last one mainly depends on the Lode angle dependence function. Among three conventional strength criteria, i.e. Mohr-Coulomb (MC), Hoek-Brown (HB), and Exponent (EP) criteria, the difference between generalized compression and extension strength of EP criterion experience a firstly increase then decrease process, and tends to be zero when hydrostatic pressure is big enough. This is in accordance with intrinsic rock strength characterization. Moreover, the critical hydrostatic pressure I_c corresponding to the maximum difference of between generalized compression and extension strength can be easily adjusted by minimum principal stress influence parameter K. So, the exponent function is a more reasonable meridian curves, which well reflects the hydrostatic pressure effect and is employed to describe the generalized compression and extension strength. Meanwhile, three Lode angle dependence functions of L_{{MN}}, L_{{WW}}, and L_{{YMH}}, which unconditionally satisfy the convexity and differential requirements, are employed to represent the intermediate principal stress effect. Realizing the actual strength surface should be located between the generalized compression and extension surface, new true-triaxial criteria are proposed by combining the two states of EP criterion by Lode angle dependence function with a same lode angle. The proposed new true-triaxial criteria have the same strength parameters as EP criterion. Finally, 14 groups of triaxial test data are employed to validate the proposed criteria. The results show that the three new true-triaxial exponent criteria, especially the Exponent Willam-Warnke criterion (EPWW) criterion, give much lower misfits, which illustrates that the EP criterion and L_{{WW}} have more reasonable meridian

Investigation of phase transformations of U2.5Zr7.5Nb and U3Zr9Nb alloys aging at 600 deg C

International Nuclear Information System (INIS)

Cantagalli, Natalia Mattar; Tanure, Leandro Paulo de Almeida Reis; Braga, Daniel Martins; Santos, Ana Maria Matildes dos; Ferraz, Wilmar Barbosa

2009-01-01

Investigation has been made of the effects of high-temperature aging (600 deg C) on the phase transformations in the U2.5Zr7.5Nb and U3Zr9Nb alloys. These alloys have been produced with vacuum induction melting (VIM) furnace in cast ingots. The ingots were homogenized at 1000 deg C for 24 hours in vacuum of -4 torr, and cooled to room temperature at a rate of 3 deg C/min. Specimens from these homogeneous materials, cut in 3 mm high and 10 mm diameter, were reheated to γ phase at 850 deg C, for 1 hour, and aging at 600 deg C at different times from 0.5 to 24 hours. The phases decomposition were characterized by X-ray diffraction (XRD), metallographic, micro-probe analyze by energy dispersive spectrometry (EDS) and microhardness methods. It was verified that the decomposition of the δ phase proceeds in two steps. The first is a discontinuous precipitation of a lamellar two-phase aggregate composed of alpha solid solution and a metastable gamma phase. The metastable gamma phase has a constant composition at given temperature. After longer annealing, it decomposes eutectoidally into the equilibrium (α + δ 2 ) phases mixture. During this process a modification of the original lamellar microstructure takes place. The obtained metastable phases of these alloys of different compositions were analyzed in relation to their constitution, heat treatability and micrographic features and the results confronted with available distinct uranium alloys data from literature. (author)

BMI may underestimate the socioeconomic gradient in true obesity

NARCIS (Netherlands)

van den Berg, G.; van Eijsden, M.; Vrijkotte, T. G. M.; Gemke, R. J. B. J.

2013-01-01

Body mass index (BMI) does not make a distinction between fat mass and lean mass. In children, high fat mass appears to be associated with low maternal education, as well as low lean mass because maternal education is associated with physical activity. Therefore, BMI might underestimate true obesity

Fatigue limit of Zircaloy-2 under variable one-directional tension and temperature 300 deg C; Granica zamora zircaloy-2, pri cisto jednosmerno promenljivom opterecenju (A=1) na zatezanje i temperaturi 300 deg C

Energy Technology Data Exchange (ETDEWEB)

Spasic, Z; Simic, G [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)

1968-11-15

A vacuum chamber wad designed and constructed. It was suitable for study of materials at higher temperatures in vacuum or controlled atmospheres. Zircaloy-2 fatigue at 300 deg C in argon atmosphere was measured. Character of strain is variable one directional (A=1) tension. Obtained results are presented in tables and in the form of Veler's curve. The obtained fatigue limit was {sigma} - 15 kp/mm{sup 2}. The Locati method was allied as well and fatigue limit value obtained was 15,75 kp/mm{sup 2}. Error calculated in reference to the previous value obtained by classical methods was 5%. Konstruisana je i izvedena vakuum-komora koja se pokazala prikladna za izucavanje osobina materijala na povisenim temperaturama u vakuumu ili kontrolisanim atmosferama. Izvrseno je ispitivanje zamaranja Zircaloy-2 na temperaturi 300 deg C u atmosferi preciscenog argona. Karakter opterecenja je bio cisto jednosmerno promenljivo opterecenje (A=1) na zatezanje. Dobiveni rezultati su dati tabelarno i u obliku Velerove krive. Dobijena je granica zamora {sigma} = 15 kp/mm{sup 2}. Primenjen je i metod Locati-a za priblizno odredjivanje granice zamora i dobijena je vrednost 15,75 kp/mm{sup 2}. Greska u odnosu na prethodnu granicu zamora dobijenu klasicnim metodom iznosi 5% (author)

The True Ultracool Binary Fraction Using Spectral Binaries

Science.gov (United States)

Bardalez Gagliuffi, Daniella; Burgasser, Adam J.; Schmidt, Sarah J.; Gagné, Jonathan; Faherty, Jacqueline K.; Cruz, Kelle; Gelino, Chris

2018-01-01

Brown dwarfs bridge the gap between stars and giant planets. While the essential mechanisms governing their formation are not well constrained, binary statistics are a direct outcome of the formation process, and thus provide a means to test formation theories. Observational constraints on the brown dwarf binary fraction place it at 10 ‑ 20%, dominated by imaging studies (85% of systems) with the most common separation at 4 AU. This coincides with the resolution limit of state-of-the-art imaging techniques, suggesting that the binary fraction is underestimated. We have developed a separation-independent method to identify and characterize tightly-separated (dwarfs as spectral binaries by identifying traces of methane in the spectra of late-M and early-L dwarfs. Imaging follow-up of 17 spectral binaries yielded 3 (18%) resolved systems, corroborating the observed binary fraction, but 5 (29%) known binaries were missed, reinforcing the hypothesis that the short-separation systems are undercounted. In order to find the true binary fraction of brown dwarfs, we have compiled a volume-limited, spectroscopic sample of M7-L5 dwarfs and searched for T dwarf companions. In the 25 pc volume, 4 candidates were found, three of which are already confirmed, leading to a spectral binary fraction of 0.95 ± 0.50%, albeit for a specific combination of spectral types. To extract the true binary fraction and determine the biases of the spectral binary method, we have produced a binary population simulation based on different assumptions of the mass function, age distribution, evolutionary models and mass ratio distribution. Applying the correction fraction resulting from this method to the observed spectral binary fraction yields a true binary fraction of 27 ± 4%, which is roughly within 1σ of the binary fraction obtained from high resolution imaging studies, radial velocity and astrometric monitoring. This method can be extended to identify giant planet companions to young brown

Studies of Redox Equilibria at Elevated Temperatures I. The Estimation of Equilibrium Constants and Standard Potentials for Aqueous Systems up to 374 deg C

Energy Technology Data Exchange (ETDEWEB)

Lewis, Derek

1969-07-01

A method is described for the estimation of equilibrium constants for aqueous systems at temperatures up to 374 deg C from entropy and free energy data for 25 deg C and data on the variation of heat capacity with temperature. Partial molal heat capacities of aqueous ions are estimated on the basis of the principle that, with suitably chosen standard states, the partial molal entropies of ions of a particular class at any given temperature are linearly related to the corresponding entropies at some reference temperature. The method suggested is compared with other methods, based on the Van't Hoff isobar and on an extension of the conventional scale of ionic free energy at 25 deg C, and the general dependence of aqueous equilibria on ionic heat capacity is considered.

Arm-associated measurements as estimates of true height in black ...

African Journals Online (AJOL)

arm-associated measurements to true height included that of the World Health ... Conclusion: Findings indicate the need for gender and race-specific height estimation ..... New. York, NY: Springer; 2012. 12. Golshan M, Amra B, Hoghoghi MA.

Endovascular treatment of splenic artery aneurysms; Trattamento endovascolare degli aneurismi dell'arteria splenica

Energy Technology Data Exchange (ETDEWEB)

Lagana, Domenico; Carrafiello, Gianpaolo; Mangini, Monica; Fontana, Federico; Dizonno, Massimiliano; Fugazzola, Carlo [Insubria Univ., Varese (Italy). Cattedra di radiologia; Castelli, Patrizio [Insubria Univ., Varese (Italy). Chirurgia vascolare

2005-07-15

Purpose. To assess the feasibility and effectiveness of endovascular treatment of splenic artery aneurysm (SAAs). Materials and methods. Between May 2000 and June 2003 we treated 11 true SAAs in 9 patients (7 females and 2 males; mean age 58 years), 8 saccular and 3 fusiform, 4 located at the middle tract of the splenic artery, 5 at the distal tract and 2 intra-parenchymal. The diagnosis was performed with colour-Doppler ultrasound and/or CT-angiography; 7 patients were symptomless, 1 had left hypochondriac pain, and 1 had acute abdomen caused by a ruptured SAA. Four SAAs were treated by micro coil embolisation of the aneurysmal sac with preservation of splenic artery patency; in 2 cases this was associated with transcatheter injection of N-butyl-2-cyanoacrylate. Four cases were treated by endovascular ligature, with sectoral spleen ischaemia. One ruptured SAA received emergency treatment with splenic artery cyanoacrylate embolisation. Two intra-parenchymal SAAs were excluded, one by cyanoacrylate embolisation of the afferent artery and the other by transcatheter thrombin injection in the aneurysmal sac. Results. Technical success was observed in all cases (in 10/11 at the end of the procedure; in 1/11 at CT performed 3 days after the procedure). The follow-up (mean 18 months; range 6-36) was performed by colour-Doppler ultrasound and/or CT-angiography 3, 6 and 12 months after the procedure and subsequently once a year; the complete exclusion of the aneurysms was confirmed in 11/11 cases. The complications were: 4 cases of mild pleuritis; fever and left hypochondriac pain 1 day after the procedure (in the same 4 patients and in one other case); 5 cases of sectorial spleen ischaemia and 1 case of diffuse spleen infarction with partial revascularization by collateral vessels. No alteration of the levels of pancreatic enzymes was found; a transitory increase in platelet count occurred only in the patient with diffuse spleen infarction. Conclusions. Using different

Accurate decisions in an uncertain world: collective cognition increases true positives while decreasing false positives

NARCIS (Netherlands)

Wolf, M.; Kurvers, R.H.J.M.; Ward, A.J.W.; Krause, S.; Krause, J.

2013-01-01

In a wide range of contexts, including predator avoidance, medical decision-making and security screening, decision accuracy is fundamentally constrained by the trade-off between true and false positives. Increased true positives are possible only at the cost of increased false positives;

Creep curve formularization at 950degC for Hastelloy XR

International Nuclear Information System (INIS)

Kaji, Yoshiyuki; Muto, Yasushi

1991-03-01

Creep tests under constant stress were conducted on a nickel-base heat-resistant alloy, Hastelloy XR, in air at 950degC. Minimum creep strain rate, time to the onset of tertiary creep and time to rupture were obtained as a function of applied stress. Then, a creep constitutive equation was made based on the Garofalo formula for primary and secondary creep and based on the Kachanov-Rabotnov formula for tertiary creep, which could represent fairly well the experimental creep deformation curves under the constant stress conditions. The creep deformation under the constant load condition corresponding to the stress increment was analysed using the creep constitutive equation and strain hardening law. Then the calculated creep strain showed slightly higher value than the experimental creep strain, and the calculated life was shorter than the experimental one. (author)

True HIV seroprevalence in Indian blood donors.

Science.gov (United States)

Choudhury, N; Ayagiri, A; Ray, V L

2000-03-01

The National AIDS Control Organization (NACO), the apex body for controlling AIDS in India, projected that HIV seroprevalence would increase from 7/1000 in 1995 to 21.2/1000 in 1997. A high incidence (8.2%) of HIV was observed in blood donors. This study was carried out to find out the true HIV positivity in Indian blood donors. Blood donors from our centre were followed for more than 5 years to determine the true HIV seroprevalence and our result was compared with similar studies from India. Voluntary and relative blood donors who visited the SGPGIMS, Lucknow, since 1993 to June 1998 were included. They were screened for HIV 1/2 by ELISA kits (WHO approved). First-time HIV-positive samples were preserved frozen for further study (stage-I). They were repeated in duplicate and retested with other kits. If found positive, the sample was labelled as ELISA positive (stage-II). ELISA-positive samples were confirmed by Western Blot (WB) at stage-III. A total of 65 288 donors were included and 834 (12.8/1000) were reactive at stage-I. But 1.1/1000 donors were found to be ELISA positive at stage-II, and 0.28/1000 donors were positive by WB at stage-III. The 'seropositivity' rate from the NACO was significantly (P commercial blood banks. The HIV prevalence of blood donors (and national prevalence) is to be reassessed.

The accelerated oxidation of zircaloy-4 at 700∼900 .deg. C in high pressure steam

International Nuclear Information System (INIS)

Kim, K. P.; Park, K. H.

1999-01-01

To find the effect of pressure on the high temperature oxidation of zircaloy-4, an autoclave capable of measuring the degree of oxidation at high temperatures and high pressure was manufactured. The specimens used in experiments are commercially available Zircaloy-4 used in Kori nuclear power plants. All the measurements were done at 700∼900 .deg. C in steam. Pressure effects were noticed. The oxide thickness was much thicker in high pressure steam, comparing to that in the 1 atm steam. And, the higher is the steam pressure, the thicker becomes the oxide. The enhancement of oxide growth rate at 700∼900 .deg. C in high pressure steam is approximately propotion to the power of 1.0∼1.6 of the ratio of experimental steam pressure to critical steam pressure. There is a critical steam pressure above that the oxidation rate enhances. The critical steam pressure was measured as 30∼40 bar. The enhanced oxidation seems from the oxide cracking due to the tetragonal to monoclinic phase transformation at high pressure steam

Corrosion of titanium alloys in concentrated chloride solutions at temperature up to 160 deg C

International Nuclear Information System (INIS)

Ruskol, Yu.S.; Viter, L.I.; Balakin, A.I.; Fokin, M.N.

1982-01-01

Resistance of VT1-0 titanium and 4200, 4207 titanium alloys to pitting and total corrosion in chlorides of cadmium, potassium, nickel, ammonium, barium, calcium, lithium, magnesium in respect to pH value and temperature (120,140,160 deg C) is determined. The results obtained are presented as nomograms of stability. Possible reasons for corrosion behaviour of titanium in each of the chlorides are discussed

True ownership of traditional medicines in South Africa

OpenAIRE

Gabriel Louw; André Duvenhage

2017-01-01

Background Literature postulates that traditional medicines form an important part of modern-day South African healthcare. The belief is that the traditional healer and traditional medicine is a close-knit unit, with the traditional healer as the true owner and manufacturer of traditional medicines. Various studies also postulate that the growth and development of South African traditional medicines are restricted by the pharmaceutical industries and other role players...

Methods for obtaining true particle size distributions from cross section measurements

Energy Technology Data Exchange (ETDEWEB)

Lord, Kristina Alyse [Iowa State Univ., Ames, IA (United States)

2013-01-01

Sectioning methods are frequently used to measure grain sizes in materials. These methods do not provide accurate grain sizes for two reasons. First, the sizes of features observed on random sections are always smaller than the true sizes of solid spherical shaped objects, as noted by Wicksell [1]. This is the case because the section very rarely passes through the center of solid spherical shaped objects randomly dispersed throughout a material. The sizes of features observed on random sections are inversely related to the distance of the center of the solid object from the section [1]. Second, on a plane section through the solid material, larger sized features are more frequently observed than smaller ones due to the larger probability for a section to come into contact with the larger sized portion of the spheres than the smaller sized portion. As a result, it is necessary to find a method that takes into account these reasons for inaccurate particle size measurements, while providing a correction factor for accurately determining true particle size measurements. I present a method for deducing true grain size distributions from those determined from specimen cross sections, either by measurement of equivalent grain diameters or linear intercepts.

Crystal structure of Na3Sc2(PO4)3 at 60 deg C

International Nuclear Information System (INIS)

Lazoryak, B.I.; Kalinin, V.B.; Stefanovich, S.Yu.; Efremov, V.A.

1980-01-01

The structure of the ferroelectric phase of Na 3 Sc 2 (PO 4 ) 3 compound was studied. Na 3 Sc 2 (PO 4 ) 3 monocrystal heated by a jet of warm N 2 was investigated at 60 deg C. The rhombohedron modification was determined: a=8.927(3), c=22.34(4) A, Z=6, space group R anti 3c. Interatomic distances and inner angles of polyhedrons in Na 3 Sc 2 (PO 4 ) 3 structure were determined

Evaluation of the portal veins, hepatic veins and bile ducts using fat-suppressed segmented True FISP

International Nuclear Information System (INIS)

Ueda, Takashi; Uchikoshi, Masato; Imaoka, Izumi; Iwaya, Kazuo; Matsuo, Michimasa; Wada, Akihiko

2005-01-01

True FISP (fast imaging with steady-state free precession) is a fast imaging technique that provides high SNR (signal to noise ratio) and excellent delineation of parenchymal organs. The contrast of True FISP depends on the mixture of T 2 /T 1 . Vessels with slow flow are usually displayed as high signal intensity on True FISP images. The purpose of this study was to optimize fat-suppressed (FS) segmented True FISP imaging for portal veins, hepatic veins, and bile ducts. FS segmented True FISP images were applied to the phantoms of liver parenchyma, saline, and oil with various flip angles (every 10 degrees from 5-65 degrees) and k-space segmentations (3, 15, 25, 51, 75, 99). Five healthy volunteers were also examined to get optimized flip angle and k-space segmentation. The largest flip angle, 65 degrees, showed the best contrast between the liver parenchyma phantom, saline, and oil. The largest segmentations, 99, provided the best contrast between a liver parenchyma phantom and saline. However, the signal of the oil phantom exceeded that of the liver parenchyma phantom with 99 segmentations. As a result, the flip angle of 65 degrees and 75 segments is recommended to get the best contrast between the liver parenchyma phantom and saline, while suppressing the signal of oil. The volunteer studies also support the phantom studies and showed excellent anatomical delineation of portal veins, hepatic veins, and bile ducts when using these parameters. We conclude that True FISP is potentially suitable for the imaging of portal veins, hepatic veins, and bile ducts. The flip angle of 65 degrees with 75 segments is recommended to optimize FS segmented True FISP images. (author)

True or False Customer Engagement Behaviour

DEFF Research Database (Denmark)

Haurum, Helle; Beckmann, Suzanne C.

2014-01-01

Customers’ engagement behaviours are considered an important source of value to the company. So far, the discussion has mainly been conceptual and focused on the company’s perspective. By adopting the customer’s perspective we investigated how customers perceive their service relationship...... encounters with a company, using in-depth interviews. We found the following key factors driving and explaining customers’ engagement behaviours: (1) transactions matter and inconsistent engagement behaviours are a reality, (2) mundane products and services are still highly relevant for customers, and (3......) different degrees of customer experience alignment with services and products exist. Moreover, the distinction between true and false engagement behaviours we suggest indeed is relevant and we could establish their mediating capabilities....

Studies on the occurrence of true spiders as natural enemies in many Egyptian fields

Directory of Open Access Journals (Sweden)

Amira A. Ibrahim

2012-01-01

Full Text Available True spiders represent one of the most important natural predatory species in Egyptian fields. In this work, common true spiders were surveyed in wheat, cotton and maize fields, and were counted weekly by using the direct method. For evaluating the feeding consumption of true spiders, five feeding cases were tested (as preys. These cases were: eggs of Ephestia kuehniella, eggs of Phthorimaea operculella, one day eggs and larvae of E. kuehniella, larvae of E. kuehniella and P. operculella and larvae of E. kuehniella only. Results obtained revealed that, the highest average daily consumption for each spider was recorded in case of feeding on eggs of P. operculella. While, the longest survival period was recorded in case of feeding on larvae of E. kuehniella.

Anelastic deformation of Pb(Zr,Ti)O3 thin films by non-180 deg. ferroelectric domain wall movements during nanoindentation

International Nuclear Information System (INIS)

Alguero, M.; Bushby, A.J.; Reece, M.J.; Seifert, A.

2002-01-01

Lead zirconate titanate Pb(Zr,Ti)O 3 ferroelectric thin films show significant anelastic deformation when indented with spherical tipped indenters. Experiments on films with different Zr/Ti ratio and a mixed , preferred crystallographic orientation have shown that there is a good agreement between the anelastic deformation and the maximum strain achievable by non-180 deg. domain wall movement. An expected increase of the indentation stiffness of the films also accompanies the anelastic deformation because of the single crystal elastic anisotropy. All these observations seem to indicate that non-180 deg. ferroelectric domain wall movements occur under indentation stresses and cause anelasticity. Stresses for maximum anelastic deformation are compared with those for recently reported stress-induced depolarization

Hydrogen permeability, diffusivity, and solubility of SUS 316L stainless steel in the temperature range 400 to 800 .deg. C for fusion reactor applications

International Nuclear Information System (INIS)

Lee, S. K.; Kim, H. S.; Noh, S. J.; Han, J. H.

2011-01-01

Tritium permeation is one of the critical issues for the economy and safety of fusion power plants. As an initial step in tritium permeation research for fusion reactor applications, experiments were initiated by using hydrogen as a tritium substitute. An experimental system for hydrogen permeation and related behaviors in solid materials was designed and constructed. A continuous flow method was adopted with a capacity for high temperatures up to ∼1,000 .deg. C under ultra-high vacuums of ∼10 -7 Pa. The hydrogen permeation behavior in SUS 316L stainless steel was investigated in the temperature range from 400 .deg. C to 800 .deg. C. As a result, the permeability, diffusivity and solubility of hydrogen were determined. The results were compared with the previously existing reference data. Changes in the sample's surface morphology after the hydrogen permeation experiment are also addressed.

Impact Vaporization as a Possible Source of Mercury's Calcium Exosphere

Science.gov (United States)

Killen, Rosemary M.; Hahn, Joseph M.

2015-01-01

Mercury's calcium exosphere varies in a periodic way with that planet's true anomaly. We show that this pattern can be explained by impact vaporization from interplanetary dust with variations being due to Mercury's radial and vertical excursions through an interplanetary dust disk having an inclination within 5 degrees of the plane of Mercury's orbit. Both a highly inclined dust disk and a two-disk model (where the two disks have a mutual inclination) fail to reproduce the observed variation in calcium exospheric abundance with Mercury true anomaly angle. However, an additional source of impacting dust beyond the nominal dust disk is required near Mercury's true anomaly (?) 25deg +/-5deg. This is close to but not coincident with Mercury's true anomaly (?=45deg) when it crosses comet 2P/Encke's present day orbital plane. Interestingly, the Taurid meteor storms at Earth, which are also due to Comet Encke, are observed to occur when Earth's true anomaly is +/-20 or so degrees before and after the position where Earth and Encke orbital planes cross. The lack of exact correspondence with the present day orbit of Encke may indicate the width of the potential stream along Mercury's orbit or a previous cometary orbit. The extreme energy of the escaping calcium, estimated to have a temperature greater than 50000 K if the source is thermal, cannot be due to the impact process itself but must be imparted by an additional mechanism such as dissociation of a calcium-bearing molecule or ionization followed by recombination.

Magnetic Resonance Imaging Study Using True versus Sham Acupuncture

Directory of Open Access Journals (Sweden)

Chunxiao Wu

2014-01-01

Full Text Available Functional magnetic resonance imaging (fMRI has been shown to detect the specificity of acupuncture points, as proved by numerous studies. In this study, resting-state fMRI was used to observe brain areas activated by acupuncture at the Taichong (LR3 acupoint. A total of 15 healthy subjects received brain resting-state fMRI before acupuncture and after sham and true acupuncture, respectively, at LR3. Image data processing was performed using Data Processing Assistant for Resting-State fMRI and REST software. The combination of amplitude of low-frequency fluctuation (ALFF and regional homogeneity (ReHo was used to analyze the changes in brain function during sham and true acupuncture. Acupuncture at LR3 can specifically activate or deactivate brain areas related to vision, movement, sensation, emotion, and analgesia. The specific alterations in the anterior cingulate gyrus, thalamus, and cerebellar posterior lobe have a crucial effect and provide a valuable reference. Sham acupuncture has a certain effect on psychological processes and does not affect brain areas related to function.

Deformation and Fracture Properties in Neutron Irradiated Pure Mo and Mo Alloys

International Nuclear Information System (INIS)

Byun, T.S.; Snead, L.; Li, M.; Cockeram, B.V.

2007-01-01

Full text of publication follows: The evolution in microstructural and mechanical properties was investigated for molybdenum and molybdenum alloys after high temperature neutron irradiation. Test materials include oxide dispersion-strengthened (ODS) molybdenum alloy, molybdenum- 0.5% titanium-0.1% zirconium (TZM) alloy, and low carbon arc-cast (LCAC) molybdenum. Tensile specimens were irradiated in high flux isotope reactor (HFIR) at temperatures in the range ∼300 - 1000 deg. C to neutron fluences of 2.28 - 24.7 x 10 25 n/m 2 (E>0.1 MeV) or 1.2-13.1 dpa. Tensile tests were performed at temperatures ranging from -150 deg. C to 1000 deg. C. To evaluate irradiation effects, true stress parameters (yield stress, plastic instability stress, and true fracture stress) and ductility parameters (uniform strain, fracture strain, and reduction area) were compared for both irradiated and non-irradiated materials. Fracture toughness was also evaluated from the fracture stress and fracture strain data using a fracture strain model. The fracture strain was used to determine the ductile-to-brittle transition temperature (DBTT). Results indicate that irradiation in the temperature range of 600 - 800 deg. C hardened the materials by up to 70%, while the irradiation hardening outside this temperature range was much lower (<40%). The plastic instability stress was strongly dependent on test temperature; however, it was nearly independent of irradiation dose and temperature. It was also found that the true fracture stress was dependent on test temperature. The true fracture stress was not significantly influenced by irradiation at elevated and high test temperatures; however, it was decreased significantly at sub-zero temperatures after irradiation due to material embrittlement. The DBTT for 600 deg. C irradiated ODS molybdenum alloy was found to be about room temperature or lower, and among the test materials the ODS alloy showed the highest resistance to irradiation embrittlement

Positive Predictive Value of True Bacteremia according to the Number of Positive Culture Sets in Adult Patients.

Science.gov (United States)

Kitaura, Tsuyoshi; Chikumi, Hiroki; Fujiwara, Hiromitsu; Okada, Kensaku; Hayabuchi, Tatsuya; Nakamoto, Masaki; Takata, Miyako; Yamasaki, Akira; Igishi, Tadashi; Burioka, Naoto; Shimizu, Eiji

2014-12-01

Performing multiple blood culture sets simultaneously is a standard blood culture methodology, although it is often difficult to distinguish true bacteremia from contamination when only one of several blood culture sets is positive. This study clarified the relationship between the number of positive blood culture sets and clinical significance in patients with positive blood culture. Patients aged 18 years and over with at least 1 positive blood culture were enrolled. Positive blood culture episodes were categorized from clinical records as true bacteremia, contamination, or unknown clinical significance. The associations among episodes of true bacteremia, isolated bacteria, the number of positive blood culture sets from among the performed sets, and the clinical background of patients were analyzed. Among a total of 407 episodes, 262, 67 and 78 were true bacteremia, contamination and unknown clinical significance, respectively. The positive predictive values (PPVs) of 1 out of 1, 1 out of 2 and 2 out of 2 positive sets in cases of Staphylococcus aureus, were 81.3%, 50% and 100% respectively; those in cases of coagulase-negative Staphylococci were 20.5%, 10.8% and 63.5%, respectively. Almost all cases of Escherichia coli, Pseudomonas aeruginosa, Klebsiella species and Candida species were true bacteremia. The probability of true bacteremia was strongly associated with recent surgery in multivariate analysis (P sets from among the performed sets varies by microorganism. Therefore, PPVs calculated using this method may help physicians distinguish true bacteremia from contamination.

Reduction of CSF flow artifact in fast fluid attenuated inversion recovery MR imaging. Study of excitation width in 180deg inversion pulse

International Nuclear Information System (INIS)

Tsuchihashi, Toshio; Yoshizawa, Satoshi; Maki, Toshio; Kitagawa, Matsuo; Suzuki, Ken; Fujita, Isao

1998-01-01

A technique that increases slice thickness so that it becomes wider than the excitation width of the 180deg inversion pulse and in which TR is partitioned twice has been investigated with regard to fast FLAIR. This is a technique that reduces the flow artifact of CSF. It is thought that, with this technique, the flow artifact is reduced because the CSF that flows onto the slice reaches the null point. The cross talk effect of the 180deg inversion pulse appears as a high CSF signal. As a result, the number of slices needs to be partitioned two or three times before imaging. Thus the imaging time is doubled or tripled. Considering the cross talk effect of the 180deg inversion pulse and the imaging time needed for this technique, the optimal imaging technique would be one that uses an inversion pulse that is four times slice thickness plus slice space and for which the number of slices is partitioned twice. Furthermore, the null point of CSF was dependent on dividing TR in half. (author)

True and common balsams

Directory of Open Access Journals (Sweden)

Dayana L. Custódio

2012-08-01

Full Text Available Balsams have been used since ancient times, due to their therapeutic and healing properties; in the perfume industry, they are used as fixatives, and in the cosmetics industry and in cookery, they are used as preservatives and aromatizers. They are generally defined as vegetable material with highly aromatic properties that supposedly have the ability to heal diseases, not only of the body, but also of the soul. When viewed according to this concept, many substances can be considered balsams. A more modern concept is based on its chemical composition and origin: a secretion or exudate of plants that contain cinnamic and benzoic acids, and their derivatives, in their composition. The most common naturally-occurring balsams (i.e. true balsams are the Benzoins, Liquid Storaque and the Balsams of Tolu and Peru. Many other aromatic exudates, such as Copaiba Oil and Canada Balsam, are wrongly called balsam. These usually belong to other classes of natural products, such as essential oils, resins and oleoresins. Despite the understanding of some plants, many plants are still called balsams. This article presents a chemical and pharmacological review of the most common balsams.

Activation of Imaginal Information on True and False Memories

Science.gov (United States)

Chang, Sau Hou; Pierce, Benton H.

2009-01-01

The present study examined the activation of imaginal information on true and false memories. Participants studied a series of concrete objects in pictures or words. The imagery group (n = 96) was instructed to form images and the control group (n = 96) was not instructed to do so. Both groups were then given a standard recognition memory test and…

True fir-hemlock spacing trials: design and first results.

Science.gov (United States)

Robert O. Curtis; Gary W. Clendenen; Jan A. Henderson

2000-01-01

A series of 18 precommercial thinning trials was established in true fir-hemlock stands in the Olympic Mountains and along the west side of the Cascade Range in Washington and Oregon from 1987 through 1994. This paper documents establishment of these installations and presents some preliminary observations and results. Substantial differences in growth rates in height...

False memory for context and true memory for context similarly activate the parahippocampal cortex.

Science.gov (United States)

Karanian, Jessica M; Slotnick, Scott D

2017-06-01

The role of the parahippocampal cortex is currently a topic of debate. One view posits that the parahippocampal cortex specifically processes spatial layouts and sensory details (i.e., the visual-spatial processing view). In contrast, the other view posits that the parahippocampal cortex more generally processes spatial and non-spatial contexts (i.e., the general contextual processing view). A large number of studies have found that true memories activate the parahippocampal cortex to a greater degree than false memories, which would appear to support the visual-spatial processing view as true memories are typically associated with greater visual-spatial detail than false memories. However, in previous studies, contextual details were also greater for true memories than false memories. Thus, such differential activity in the parahippocampal cortex may have reflected differences in contextual processing, which would challenge the visual-spatial processing view. In the present functional magnetic resonance imaging (fMRI) study, we employed a source memory paradigm to investigate the functional role of the parahippocampal cortex during true memory and false memory for contextual information to distinguish between the visual-spatial processing view and the general contextual processing view. During encoding, abstract shapes were presented to the left or right of fixation. During retrieval, old shapes were presented at fixation and participants indicated whether each shape was previously on the "left" or "right" followed by an "unsure", "sure", or "very sure" confidence rating. The conjunction of confident true memories for context and confident false memories for context produced activity in the parahippocampal cortex, which indicates that this region is associated with contextual processing. Furthermore, the direct contrast of true memory and false memory produced activity in the visual cortex but did not produce activity in the parahippocampal cortex. The present

Rotary balance data for a typical single-engine general aviation design for an angle-of-attack range of 8 deg to 90 deg. 2: Influence of horizontal tail location for Model D

Science.gov (United States)

Barnhart, B.

1982-01-01

The influence of horizontal tail location on the rotational flow aerodynamics is discussed for a 1/6-scale general aviation airplane model. The model was tested using various horizontal tail positions, with both a high and a low-wing location and for each of two body lengths. Data were measured, using a rotary balance, over an angle-of-attack range of 8 to 90 deg, and for clockwise and counter-clockwise rotations covering an Omega b/2V range of 0 to 0.9.

Current technology and advances in true re-use of effluents

International Nuclear Information System (INIS)

Cillie, G.G.

1975-01-01

Increasing exploitation of natural water resources has necessitated true re-use of effluents. Such planned re-use is preferable to the indirect or incidental re-use which has hitherto been practised, sometimes indiscriminately. Modern technology provides the means for renovating effluents to any desired quality standard, including human consumption. The major obstacles still confronting widespread application of true re-use are the removal of nitrogen compounds and trace organic residues, including insecticides, herbicides and carcinogens. The need to guarantee hygienic quality by removal or destruction of all pathogens, including viruses and parasites, constitutes a major cost item. Radiation techniques may well be applied for sterilization and for destruction of organic radicals. A combination of various unit processes, for which design criteria and hardware are readily available, can be used to produce potable water at a cost of some 10 cents/m 3 for a 45 Ml/d plant. (author)

Content Adaptive True Motion Estimator for H.264 Video Compression

Directory of Open Access Journals (Sweden)

P. Kulla

2007-12-01

Full Text Available Content adaptive true motion estimator for H.264 video coding is a fast block-based matching estimator with implemented multi-stage approach to estimate motion fields between two image frames. It considers the theory of 3D scene objects projection into 2D image plane for selection of motion vector candidates from the higher stages. The stages of the algorithm and its hierarchy are defined upon motion estimation reliability measurement (image blocks including two different directions of spatial gradient, blocks with one dominant spatial gradient and blocks including minimal spatial gradient. Parameters of the image classification into stages are set adaptively upon image structure. Due to search strategy are the estimated motion fields more corresponding to a true motion in an image sequence as in the case of conventional motion estimation algorithms that use fixed sets of motion vector candidates from tight neighborhood.

System for evaluation of the true average input-pulse rate

International Nuclear Information System (INIS)

Eichenlaub, D.P.; Garrett, P.

1977-01-01

The description is given of a digital radiation monitoring system making use of current digital circuit and microprocessor for rapidly processing the pulse data coming from remote radiation controllers. This system analyses the pulse rates in order to determine if a new datum is statistically the same as that previously received. Hence it determines the best possible average time for itself. So long as the true average pulse rate stays constant, the time required to establish an average can increase until the statistical error is under the desired level, i.e. 1%. When the digital processing of the pulse data indicates a change in the true average pulse rate, the time required to establish an average can be reduced so as to improve the response time of the system at the statistical error. This concept includes a fixed compromise between the statistical error and the response time [fr

Acquired Bilateral Longitudinal True Leukonychia in a 35-year-old Woman

Science.gov (United States)

Mokhtari, Fatemeh; Mozafarpoor, Samaneh; Nouraei, Saeid; Nilforoushzadeh, Mohammad Ali

2016-01-01

Acquired bilateral longitudinal true leukonychia is a rare disorder. We present a case of a 35-year-old healthy woman presented with this unusual and rare manifestation. She mentioned a history of unprotected exposure to detergents and bleaching chemical agents. Considering her low zinc level, she was prescribed with zinc capsules and recommended to avoid chemical substances for 6 months. During bimonthly follow-up, her zinc level turned normal, and leukonychia subsequently disappeared. Bilateral longitudinal true leukonychia in the nails due to zinc deficiency and exposure to chemical substances has not been reported previously. Direct and indirect effects of chemical substances on matrix and the effect of zinc deficiency on healing process should be considered in these cases. PMID:27857831

Fattori di crescita e recettori tirosin chinasici nelle neoplasie e displasie degli animali domestici

OpenAIRE

Muscatello, Luisa Vera

2016-01-01

La perdita della comunicazione cellulare può portare ad una crescita deregolata e dunque alla trasformazione neoplastica. Gli scopi dello studio di dottorato sono stati di individuare il rapporto funzionale di alcuni fattori di crescita (FC) e dei loro recettori (RTC) in tipi di neoplasie e displasie degli animali domestici, quali: 1. Amplificazione del proto-oncogene ERBB2 e sovra-espressione del RTC erb-b2. in tumori mammari della gatta. 2. Espressione di erb-b2, di recettori ormonal...

Gross and true ileal digestible amino acid contents of several animal body proteins and their hydrolysates.

Science.gov (United States)

Cui, J; Chong, B; Rutherfurd, S M; Wilkinson, B; Singh, H; Moughan, P J

2013-07-01

Amino acid compositions of ovine muscle, ovine myofibrillar protein, ovine spleen, ovine liver, bovine blood plasma, bovine blood globulins and bovine serum albumin and the amino acid compositions and in vivo (laboratory rat) true ileal amino acid digestibilities of hydrolysates (sequential hydrolysis with Neutrase, Alcalase and Flavourzyme) of these protein sources were determined. True ileal amino acid digestibility differed (Pprotein hydrolysates. The ovine myofibrillar protein and liver hydrolysates were the most digestible, with a mean true ileal digestibility across all amino acids of 99%. The least digestible protein hydrolysate was bovine serum albumin with a comparable mean true ileal digestibility of 93%. When the digestible amino acid contents were expressed as proportions relative to lysine, considerable differences, across the diverse protein sources, were found in the pattern of predicted absorbed amino acids. Copyright © 2013 Elsevier Ltd. All rights reserved.

Correction of the post -- necking true stress -- strain data using instrumented nanoindentation

Science.gov (United States)

Romero Fonseca, Ivan Dario

The study of large plastic deformations has been the focus of numerous studies particularly in the metal forming processes and fracture mechanics fields. A good understanding of the plastic flow properties of metallic alloys and the true stresses and true strains induced during plastic deformation is crucial to optimize the aforementioned processes, and to predict ductile failure in fracture mechanics analyzes. Knowledge of stresses and strains is extracted from the true stress-strain curve of the material from the uniaxial tensile test. In addition, stress triaxiality is manifested by the neck developed during the last stage of a tensile test performed on a ductile material. This necking phenomenon is the factor responsible for deviating from uniaxial state into a triaxial one, then, providing an inaccurate description of the material's behavior after the onset of necking. The research of this dissertation is aimed at the development of a correction method for the nonuniform plastic deformation (post-necking) portion of the true stress-strain curve. The correction proposed is based on the well-known relationship between hardness and flow (yield) stress, except that instrumented nanoindentation hardness is utilized rather than conventional macro or micro hardness. Three metals with different combinations of strain hardening behavior and crystal structure were subjected to quasi-static tensile tests: power-law strain hardening low carbon G10180 steel (BCC) and electrolytic tough pitch copper C11000 (FCC), and linear strain hardening austenitic stainless steel S30400 (FCC). Nanoindentation hardness values, measured on the broken tensile specimen, were converted into flow stress values by means of the constraint factor C from Tabor's, the representative plastic strainepsilonr and the post-test true plastic strains measured. Micro Vickers hardness testing was carried out on the sample as well. The constraint factors were 5.5, 4.5 and 4.5 and the representative plastic

True stress control asymmetric cyclic plastic behavior in SA333 C-Mn steel

International Nuclear Information System (INIS)

Paul, Surajit Kumar; Sivaprasad, S.; Dhar, S.; Tarafder, S.

2010-01-01

Asymmetric cyclic loading in the plastic region can leads to progressive accumulation of permanent strain. True stress controlled uniaxial asymmetric cycling on SA333 steel is conducted at various combinations of mean stress and stress amplitude in laboratory environment. It is investigated that fatigue life increases in the presence of mean stress. Plastic strain amplitude and hysteresis loop area are found to decrease with increasing mean stress. A huge difference of life and ratcheting strain accumulation is found in engineering and true stress controlled tests.

Hadronic vacuum polarization in true muonium

Science.gov (United States)

Lamm, Henry

2017-01-01

In order to reduce the theoretical uncertainty in the prediction, the leading-order hadronic vacuum polarization contribution to the hyperfine splitting of true muonium is reevaluated in two ways. A more complex pionic form factor and better estimates of the perturbative QCD contributions are used to study the model dependence of the previous calculation. The second, more accurate method directly integrates the Drell ratio R (s ) to obtain C1 ,HVP=-0.04874 (9 ) . This corresponds to an energy shift in the hyperfine splitting (HFS) of Δ EHFS,HVP μ=-8202 (16 ) MHz and represents a factor-of-50 reduction in the theoretical uncertainty from hadronic sources. We also compute the contribution in positronium, which is too small at present to detect.

How Fuzzy-Trace Theory Predicts True and False Memories for Words, Sentences, and Narratives

OpenAIRE

Reyna, Valerie F.; Corbin, Jonathan C.; Weldon, Rebecca B.; Brainerd, Charles J.

2016-01-01

Fuzzy-trace theory posits independent verbatim and gist memory processes, a distinction that has implications for such applied topics as eyewitness testimony. This distinction between precise, literal verbatim memory and meaning-based, intuitive gist accounts for memory paradoxes including dissociations between true and false memory, false memories outlasting true memories, and developmental increases in false memory. We provide an overview of fuzzy-trace theory, and, using mathematical model...

New approach to calculate the true-coincidence effect of HpGe detector

Energy Technology Data Exchange (ETDEWEB)

Alnour, I. A., E-mail: aaibrahim3@live.utm.my, E-mail: ibrahim.elnour@yahoo.com [Department of Physics, Faculty of Pure and Applied Science, International University of Africa, 12223 Khartoum (Sudan); Wagiran, H. [Department of Physics, Faculty of Science, Universiti Teknologi Malaysia, 81310 UTM Skudai,Johor (Malaysia); Ibrahim, N. [Faculty of Defence Science and Technology, National Defence University of Malaysia, Kem Sungai Besi, 57000 Kuala Lumpur (Malaysia); Hamzah, S.; Elias, M. S. [Malaysia Nuclear Agency (MNA), Bangi, 43000 Kajang, Selangor D.E. (Malaysia); Siong, W. B. [Chemistry Department, Faculty of Resource Science & Technology, Universiti Malaysia Sarawak, 94300 Kota Samarahan, Sarawak (Malaysia)

2016-01-22

The corrections for true-coincidence effects in HpGe detector are important, especially at low source-to-detector distances. This work established an approach to calculate the true-coincidence effects experimentally for HpGe detectors of type Canberra GC3018 and Ortec GEM25-76-XLB-C, which are in operation at neutron activation analysis lab in Malaysian Nuclear Agency (NM). The correction for true-coincidence effects was performed close to detector at distances 2 and 5 cm using {sup 57}Co, {sup 60}Co, {sup 133}Ba and {sup 137}Cs as standard point sources. The correction factors were ranged between 0.93-1.10 at 2 cm and 0.97-1.00 at 5 cm for Canberra HpGe detector; whereas for Ortec HpGe detector ranged between 0.92-1.13 and 0.95-100 at 2 and 5 cm respectively. The change in efficiency calibration curve of the detector at 2 and 5 cm after correction was found to be less than 1%. Moreover, the polynomial parameters functions were simulated through a computer program, MATLAB in order to find an accurate fit to the experimental data points.

Psychotherapy of the child with true brain damage.

Science.gov (United States)

Christ, Adolph E

1978-07-01

Psychotherapy of the child with true brain damage presents special problems and requires special approaches. Those who are cognitively primitive--at the sensorimotor or preoperational stage of development--require a crisis approach; those at the concrete or formal operational stage can be treated with a modified insight-oriented approach. Development of a therapeutic alliance, establishment of workable defense mechanisms, identification and clarification of unalterable cognitive defects and issues of termination unique to this special population are discussed.

Easy and Informative: Using Confidence-Weighted True-False Items for Knowledge Tests in Psychology Courses

Science.gov (United States)

Dutke, Stephan; Barenberg, Jonathan

2015-01-01

We introduce a specific type of item for knowledge tests, confidence-weighted true-false (CTF) items, and review experiences of its application in psychology courses. A CTF item is a statement about the learning content to which students respond whether the statement is true or false, and they rate their confidence level. Previous studies using…

Developmentally Invariant Dissociations in Children's True and False Memories: Not All Relatedness Is Created Equal

Science.gov (United States)

Howe, Mark L.

2006-01-01

The role of categorical versus associative relations in 5-, 7-, and 11-year-old children's true and false memories was examined using the Deese--Roediger--McDermott (DRM) paradigm and categorized lists of pictures or words with or without category labels as primes. For true items, recall increased with age and categorized lists were better…

Journalism as Justified True Belief

Directory of Open Access Journals (Sweden)

Sílvia Lisboa

2015-12-01

Full Text Available If it is important to think of journalism as a form of knowledge, then how does it become knowledge? How does this process work? In order to answer this question, this article proposes a new understanding of journalism as a subject; presenting it as a justified true belief. We think of journalism being based on pillars of truth and justification, conditions necessary in order for Epistemology to grant it the status of knowledge. We address the concept of truth and show how journalistic reports are justified to the public as well as consider the central role of credibility in this process. We add to the epistemic conception by using concepts of discourse that help to understand how journalism provides evidence through its intentions, its authority and its ability. This evidence acts like a guide for the reader towards forming opinions on journalistic reports and recognizing journalism as a form of knowledge.

Structures of glide-set 90 deg. partial dislocation cores in diamond cubic semiconductors

International Nuclear Information System (INIS)

Beckman, S.P.; Chrzan, D.C.

2003-01-01

Two core reconstructions of the 90 deg. partial dislocations in diamond cubic semiconductors, the so-called single- and double-period structures, are often found to be nearly degenerate in energy. This near degeneracy suggests the possibility that both core reconstructions may be present simultaneously along the same dislocation core, with the domain sizes of the competing reconstructions dependent on temperature and the local stress state. To explore this dependence, a simple statistical mechanics-based model of the dislocation core reconstructions is developed and analyzed. Predictions for the temperature-dependent structure of the dislocation core are presented

Dicty_cDB: AFH258 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 6. 2 Translated Amino Acid sequence gllxskinikqi*k*kcqvvemvvii*kilaiilkkllfnhqkkqlql*ynkilmilk...vrqfqs*wvlinckl*iqsmvgfhqrcnkqimilkscllvf ywvplmhl*fgkvqerpq*fvdslkihfgvnkiisssirhqaqvmnisplsil*nlvipm vqyws...*nkkkl* Frame B: gllxskinikqi*k*kcqvvemvvii*kilaiilkkllfnhqkkqlql*ynkilmilkq* hhh*SQNPLVAVLVKINHHHHHHVVVVVIK

Blue and red thermoluminescence of natural quartz in the temperature region from -196 to 400deg. C

International Nuclear Information System (INIS)

Hashimoto, Tetsuo; Yanagawa, Yuji; Yawata, Takashi

2007-01-01

Quartz samples of three different origins were γ-irradiated with 20kGy at room temperature or at the temperature of liquid nitrogen (-196 deg. C), and analyzed by on-line TL-emission spectrometry over two temperature ranges: above 200deg. C (high-temperature region) and -196 to 200deg. C (low-temperature region). The emission spectra in the high-temperature region could be separated into intense blue TL (BTL) or red TL (RTL) properties. All quartz samples displayed more or less both properties of BTL and RTL in the low temperature region, shifting the BTL-emission spectra towards violet. Particularly, volcanically originated quartz (RTL, Medeshima) showed highly complex BTL and RTL peaks in the low-temperature region, and a stronger simple RTL peak in the high temperature. These complex glow-curve peaks are considered to reflect the presence of many crystal defects and much content of impurities in the volcanically formed quartz. In the glow-curve measurements, Brazilian quartz (quartz-vein origin) gave weak RTL and intense BTL in the low-temperature range, followed by faint emission of BTL in the high-temperature side. On the other hand, the radiation-induced colored (CC) part of a Madagascan crystal rock slice (hydrothermal origin) showed intense BTL together with slight RTL in the low temperatures, followed by strong BTL and appreciable strength of RTL in the high temperatures. The BTL-emission pattern (TL-color image) of a Madagascan slice showed a complementary relationship between irradiations at liquid-nitrogen temperature and at room temperature. To explain these radiation-induced phenomena from quartz, hydrogen radicals and Li + ions, derived from radiolysis products of OH-related impurities, could operate to eliminate the BTL centers by recombination below the room temperature

True amplitude wave equation migration arising from true amplitude one-way wave equations

Science.gov (United States)

Zhang, Yu; Zhang, Guanquan; Bleistein, Norman

2003-10-01

One-way wave operators are powerful tools for use in forward modelling and inversion. Their implementation, however, involves introduction of the square root of an operator as a pseudo-differential operator. Furthermore, a simple factoring of the wave operator produces one-way wave equations that yield the same travel times as the full wave equation, but do not yield accurate amplitudes except for homogeneous media and for almost all points in heterogeneous media. Here, we present augmented one-way wave equations. We show that these equations yield solutions for which the leading order asymptotic amplitude as well as the travel time satisfy the same differential equations as the corresponding functions for the full wave equation. Exact representations of the square-root operator appearing in these differential equations are elusive, except in cases in which the heterogeneity of the medium is independent of the transverse spatial variables. Here, we address the fully heterogeneous case. Singling out depth as the preferred direction of propagation, we introduce a representation of the square-root operator as an integral in which a rational function of the transverse Laplacian appears in the integrand. This allows us to carry out explicit asymptotic analysis of the resulting one-way wave equations. To do this, we introduce an auxiliary function that satisfies a lower dimensional wave equation in transverse spatial variables only. We prove that ray theory for these one-way wave equations leads to one-way eikonal equations and the correct leading order transport equation for the full wave equation. We then introduce appropriate boundary conditions at z = 0 to generate waves at depth whose quotient leads to a reflector map and an estimate of the ray theoretical reflection coefficient on the reflector. Thus, these true amplitude one-way wave equations lead to a 'true amplitude wave equation migration' (WEM) method. In fact, we prove that applying the WEM imaging condition

TOMS/Earth Probe UV Reflectivity Daily L3 Global 1x1.25 deg Lat/Lon Grid V008

Data.gov (United States)

National Aeronautics and Space Administration — This data product contains TOMS/Earth Probe UV Reflectivity Daily L3 Global 1x1.25 deg Lat/Lon Grid Version 8 data in ASCII format. (The shortname for this Level-3...

Etch pit and γ' precipitate evolution in controlled Waspaloy microstructures aged at 725, 800 and 875 deg. C

International Nuclear Information System (INIS)

Kelekanjeri, V. Siva Kumar G.; Gerhardt, Rosario A.

2009-01-01

In this paper, controlled microstructures of Waspaloy were produced with the objective of studying the kinetic mechanisms that drive microstructural evolution during short-term aging. Three individual sets of controlled microstructures were produced by an initial solution-treatment at 1145 deg. C followed by aging-treatments at 725, 800 and 875 deg. C for times up to 263.5 h. The resulting microstructures varied markedly from one aging set to the next. The three sets of aged specimens were systematically characterized via microscopy (SEM and AFM), DC four-point probe resistivity and X-ray diffraction techniques. The occurrence of perfect polygonal etch-pit shapes in the solution-treated microstructures, which transformed upon aging first into corner-rounded shapes, followed by irregular shapes and eventual dissolution, was evidenced here. This phenomenon of transformation of etch-pit shapes appears to occur concurrently with gamma prime nucleation and growth. The formation mechanism of the etch-pits and subsequent microstructural evolution upon aging are discussed herein

Measurement of 0.8 and 1.5 GeV proton induced neutron production cross sections at 0deg

International Nuclear Information System (INIS)

Shigyo, Nobuhiro; Kunieda, Satoshi; Watanabe, Takehito; Ishibashi, Kenji; Satoh, Daiki; Meigo, Shin-ichiro

2004-01-01

Neutron-production double-differential cross sections at 0deg were measured for proton-induced reactions on Fe and Pb targets at 0.8 and 1.5 GeV. The experiment was performed at the π2 beam line of the 12 GeV proton synchrotron in High Energy Accelerator Research Organization (KEK). Neutrons were measured by time-of-flight technique with two different flight path lengths, i.e. 3.5 and 5.0 m at 0.8 and 1.5 GeV, respectively. NE213 liquid organic scintillators 12.7 cm in diameter and 12.7 cm in thickness were set at 0deg as neutron detector. For the improvement of the energy resolution, the scintillator was connected with three Hamamatsu H2431 photomultipliers 5.1 cm in diameter. The neutron detection efficiencies were obtained by the SCINFUL-QMD code. The experimental data were compared with the calculation results of the intranuclear-cascade-evaporation (INC/E) and the quantum-molecular-dynamics (QMD) models. (author)

[Intel random number generator-based true random number generator].

Science.gov (United States)

Huang, Feng; Shen, Hong

2004-09-01

To establish a true random number generator on the basis of certain Intel chips. The random numbers were acquired by programming using Microsoft Visual C++ 6.0 via register reading from the random number generator (RNG) unit of an Intel 815 chipset-based computer with Intel Security Driver (ISD). We tested the generator with 500 random numbers in NIST FIPS 140-1 and X(2) R-Squared test, and the result showed that the random number it generated satisfied the demand of independence and uniform distribution. We also compared the random numbers generated by Intel RNG-based true random number generator and those from the random number table statistically, by using the same amount of 7500 random numbers in the same value domain, which showed that the SD, SE and CV of Intel RNG-based random number generator were less than those of the random number table. The result of u test of two CVs revealed no significant difference between the two methods. Intel RNG-based random number generator can produce high-quality random numbers with good independence and uniform distribution, and solves some problems with random number table in acquisition of the random numbers.

Case Report: A true median facial cleft (crano-facial dysraphia ...

African Journals Online (AJOL)

Case Report: A true median facial cleft (crano-facial dysraphia, atessier type O) in Bingham University Teaching Hospital, Jos. ... Patient had a multidisciplinary care by the obstetrician, Neonatologist, anesthesiologist and the plastic surgery team who scheduled a soft tissue repair of the upper lip defect, columella and ...

Antonio Scarpa y su obra Saggio di osservazioni e d’esperienze sulle principali malattie degli occhi

Directory of Open Access Journals (Sweden)

Rolando Neri-Vela

2015-04-01

Full Text Available Antonio Scarpa fue un gran anatomista y cirujano del siglo xviii y principios del xix. Llamado «padre de la oftalmología italiana», escribió el Saggio di osservazioni e d’esperienze sulle principali malattie degli occhi, libro de gran valor científico y artístico.Scarpa describió varias partes del cuerpo humano, que tienen su nombre.

True many-particle scattering theory in oscillator representation

International Nuclear Information System (INIS)

Smirnov, Yu.F.; Shirokov, A.M.

1988-01-01

The scattering theory in oscillator representation in case of true multiparticle scattering (TMS) is generalized. All necessary expressions to construct a wave function of several particles system in a discrete or continuous spectra at TMS approximation are obtained. Essential advantage of the method suggested lies in the fact that the most difficult part: construction and diagonolization of the Hamiltonian cutted matrix is to be carried out only once, and then the wave function can be calculated at any designed energy. 23 refs

Data of evolutionary structure change: 1EP8B-1FAAA [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1EP8B-1FAAA 1EP8 1FAA B A -------------GGSVIVIDSKAAWDAQLAKGKEEHKP...IVVAFTATWCGPCKMIAPLFETLSNDYAGKVIFLKVDVD-AVAAVAEAAGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAAA LELALGT.../pdbChain> 1FAAA KLDCNQENKTL EEE HHH 1 1FAA A 1FAAA

Measurements of Pu239:U235 fission ratio using foils at temperatures up to 400 deg. C

Energy Technology Data Exchange (ETDEWEB)

Carter, D H; Puckett, B J; Richards, A E [General Reactor Physics Division, Atomic Energy Establishment, Winfrith, Dorchester, Dorset (United Kingdom)

1964-05-15

The paper describes the use of activation foils for the measurement of Pu239:U235 fission ratios in subcritical lattices at temperatures up to 390 deg C. Counting techniques and the method of analysis of the results are described in detail and the results are compared with fission chamber measurements. (author) 4 refs., 6 figs., 7 tabs.

SU-E-T-327: The Update of a XML Composing Tool for TrueBeam Developer Mode

International Nuclear Information System (INIS)

Yan, Y; Mao, W; Jiang, S

2014-01-01

Purpose: To introduce a major upgrade of a novel XML beam composing tool to scientists and engineers who strive to translate certain capabilities of TrueBeam Developer Mode to future clinical benefits of radiation therapy. Methods: TrueBeam Developer Mode provides the users with a test bed for unconventional plans utilizing certain unique features not accessible at the clinical mode. To access the full set of capabilities, a XML beam definition file accommodating all parameters including kV/MV imaging triggers in the plan can be locally loaded at this mode, however it is difficult and laborious to compose one in a text editor. In this study, a stand-along interactive XML beam composing application, TrueBeam TeachMod, was developed on Windows platforms to assist users in making their unique plans in a WYSWYG manner. A conventional plan can be imported in a DICOM RT object as the start of the beam editing process in which trajectories of all axes of a TrueBeam machine can be modified to the intended values at any control point. TeachMod also includes libraries of predefined imaging and treatment procedures to further expedite the process. Results: The TeachMod application is a major of the TeachMod module within DICOManTX. It fully supports TrueBeam 2.0. Trajectories of all axes including all MLC leaves can be graphically rendered and edited as needed. The time for XML beam composing has been reduced to a negligible amount regardless the complexity of the plan. A good understanding of XML language and TrueBeam schema is not required though preferred. Conclusion: Creating XML beams manually in a text editor will be a lengthy error-prone process for sophisticated plans. A XML beam composing tool is highly desirable for R and D activities. It will bridge the gap between scopes of TrueBeam capabilities and their clinical application potentials

Confidence Intervals for True Scores Using the Skew-Normal Distribution

Science.gov (United States)

Garcia-Perez, Miguel A.

2010-01-01

A recent comparative analysis of alternative interval estimation approaches and procedures has shown that confidence intervals (CIs) for true raw scores determined with the Score method--which uses the normal approximation to the binomial distribution--have actual coverage probabilities that are closest to their nominal level. It has also recently…

Automated fuel fabrication- a vision comes true

International Nuclear Information System (INIS)

Hemantha Rao, G.V.S.; Prakash, M.S.; Setty, C.R.P.; Gupta, U.C.

1997-01-01

When New Uranium Fuel Assembly Project at Nuclear Fuel Complex (NFC) begins production, its operator will have equipment provided with intramachine handling systems working automatically by pressing a single button. Additionally simple low cost inter machine handling systems will further help in critical areas. All these inter and intra machine handling systems will result in improved reliability, productivity and quality. The fault diagnostics, mimics and real time data acquisition systems make the plant more operator friendly. The paper deals with the experience starting from layout, selection of product carriers, different handling systems, the latest technology and the integration of which made the vision on automation in fuel fabrication come true. (author)

Coarsening and pattern formation during true morphological phase separation in unstable thin films under gravity

Science.gov (United States)

Kumar, Avanish; Narayanam, Chaitanya; Khanna, Rajesh; Puri, Sanjay

2017-12-01

We address in detail the problem of true morphological phase separation (MPS) in three-dimensional or (2 +1 )-dimensional unstable thin liquid films (>100 nm) under the influence of gravity. The free-energy functionals of these films are asymmetric and show two points of common tangency, which facilitates the formation of two equilibrium phases. Three distinct patterns formed by relative preponderance of these phases are clearly identified in "true MPS". Asymmetricity induces two different pathways of pattern formation, viz., defect and direct pathway for true MPS. The pattern formation and phase-ordering dynamics have been studied using statistical measures such as structure factor, correlation function, and growth laws. In the late stage of coarsening, the system reaches into a scaling regime for both pathways, and the characteristic domain size follows the Lifshitz-Slyozov growth law [L (t ) ˜t1 /3] . However, for the defect pathway, there is a crossover of domain growth behavior from L (t ) ˜t1 /4→t1 /3 in the dynamical scaling regime. We also underline the analogies and differences behind the mechanisms of MPS and true MPS in thin liquid films and generic spinodal phase separation in binary mixtures.

An X-ray CCD signal generator with true random arrival time

International Nuclear Information System (INIS)

Huo Jia; Xu Yuming; Chen Yong; Cui Weiwei; Li Wei; Zhang Ziliang; Han Dawei; Wang Yusan; Wang Juan

2011-01-01

An FPGA-based true random signal generator with adjustable amplitude and exponential distribution of time interval is presented. Since traditional true random number generators (TRNG) are resource costly and difficult to transplant, we employed a method of random number generation based on jitter and phase noise in ring oscillators formed by gates in an FPGA. In order to improve the random characteristics, a combination of two different pseudo-random processing circuits is used for post processing. The effects of the design parameters, such as sample frequency are discussed. Statistical tests indicate that the generator can well simulate the timing behavior of random signals with Poisson distribution. The X-ray CCD signal generator will be used in debugging the CCD readout system of the Low Energy X-ray Instrument onboard the Hard X-ray Modulation Telescope (HXMT). (authors)

The young Marx on constituent power and “true democracy.”

DEFF Research Database (Denmark)

Flohr, Mikkel

Marx and Marxism is commonly charged with having neglected politics and the development of a theory of politics. However, this presumption ignores Marx’s unfinished and unpublished 1843 Critique of Hegel’s Doctrine of State, where he engaged political theory at length – an engagement, which...... propelled him towards his subsequent critique of political economy. It is the aim of the proposed paper to reconstruct and reinterpret his argument focusing in particular on his conceptualization of constituent power and “true democracy.” In the 1843 Critique Marx argues that democracy is the foundation...... the conflicts of civil society. Marx therefore concludes that all these political forms are democracies in contradiction with themselves. Marx proceeds to suggest that it is possible to overcome these contradictions and develop an adequate political form of democracy, which he describes as “true democracy...

Annealing studies of Zircaloy-2 cladding at 580-850 deg C

International Nuclear Information System (INIS)

Hindle, E.D.

1983-01-01

For fuel rod cladding it is important to determine if prior metallurgical condition combined with irradiation damage can influence high temperature deformation, because studies of such deformation are required to produce data for the cladding ballooning models which are used in analysing loss-of-coolant (LOCA). If the behaviour of all cladding conditions during a LOCA can be represented by, say, the annealed condition, then a great deal of experimental work on a multiplicity of cladding conditions can be avoided. By examining the metallographic structure and hardness, the present study determines the time required in the range 580 to 850 deg C for returning Zircaloy cladding to the annealed condition, so that for any transient a point can be specified where the material should have annealed. An equation has been derived to give this information. (author)

The true invariant of an arbitrage free portfolio

Science.gov (United States)

Schmidt, Anatoly B.

2003-03-01

It is shown that the arbitrage free portfolio paradigm being applied to a portfolio with an arbitrary number of shares N allows for the extended solution in which the option price F depends on N. However the resulting stock hedging expense Q= MF (where M is the number of options in the portfolio) does not depend on whether N is treated as an independent variable or as a parameter. Therefore the stock hedging expense is the true invariant of the arbitrage free portfolio paradigm.

Operational implications of accepting and denying whether a true value of risk exists

DEFF Research Database (Denmark)

Kozin, Igor

It is suggested to look on probabilistic risk quantities and concepts through the prism of accepting one of the views: whether a true value of risk exists or not. It will be argued that discussions until now have been primarily focused on closely related topics that are different from the suggested...... one. In general, the values of risks are not known precisely and the analyst has the option to consider that convergence to a precise value of risk is possible in the limit. That is, the true value exists but due to limited time, resources or other limitations in assessing probabilities...

Delayed detached-eddy simulation of vortex breakdown over a 70 .deg. delta wing

International Nuclear Information System (INIS)

Son, Mi So; Sa, Jeong Hwan; Park, Soo Hyung; Byun, Yung Hwan; Cho, Kum Won

2015-01-01

To investigate the vortex breakdown over the ONERA70 delta wing at an angle-of-attack of 27 .deg., unsteady simulations were performed using Reynolds-averaged Navier-Stokes and Spalart-Allmaras delayed detached-eddy simulations. A low-diffusive preconditioned Roe scheme with third-order MUSCL interpolation scheme was applied, along with second-order dual-time stepping combined with diagonalized alternating direction implicit method for unsteady simulation. Vortex breakdown was investigated through an examination of total pressure loss, axial velocity, and axial vorticity around the primary vortex. Delayed dtached-eddy simulation provided good agreement with experimental data and predicted all physical phenomena related to vortex breakdown well.

Nucleation at the phase transition near 40 deg. C in MnAs nanodisks

International Nuclear Information System (INIS)

Jenichen, B.; Takagaki, Y.; Ploog, K. H.; Darowski, N.; Feyerherm, R.; Zizak, I.

2006-01-01

The phase transition near 40 deg. C of both as-grown thin epitaxial MnAs films prepared by molecular beam epitaxy on GaAs(001) and nanometer-scale disks fabricated from the same films is studied. The disks are found to exhibit a pronounced hysteresis in the temperature curve of the phase composition. In contrast, supercooling and overheating take place far less in the samples of continuous layers. These phenomena are explained in terms of the necessary formation of nuclei of the other phase in each of the disks independent from each other. The influence of the elastic strains in the disks is reduced considerably

Experimental study of the iron - smectite system in the presence of a solution at 80 at 300 deg

International Nuclear Information System (INIS)

Guillaume, D.

2002-04-01

One of the concepts proposed for the storage of nuclear wastes consists in the use of several confining barriers placed between the waste and the biosphere. Vitrified wastes are placed in steel containers surrounded by compacted smectite (engineered barrier). The whole is placed in the geological deep site (geological barrier, granite or argilite). The prediction of the evolution of the performances of the engineered barrier (low permeability, high swelling and sorption capacities) necessitates the study of the long-term stability of its mineral constituents under the conditions of the repository. The aim is to determine the nature and the chemistry of potential newly-formed phases resulting from the temperature increase due to disintegration reactions of the wastes, the presence of fluids coming from the geological barrier, and from the liberation of iron due to the degradation of the containers. Natural systems (in particular geothermal systems and sedimentary basins) give information concerning the possible evolutions of clay minerals. However, the potential availability of metallic iron makes a particular case of the nuclear waste storage. The aim of this experimental study is to put to evidence the chemical and mineralogical transformations of the iron-clay system at 80 deg C and 300 deg C, in the presence of a solution, so as to predict the possible transformations of a bentonite placed in the deep storage conditions of radioactive wastes. Several sets of experiments were carried out to study the reactivity of the MX80 bentonite in the presence of a solution ([CI]=3.10 -2 molal, Na/Ca=5,5 and liquid/rock ratio of 10) in absence or in presence of iron (magnetite + hematite or iron + magnetite) at 80 deg C or 300 deg C, and over periods ranging from 1 day to 9 months. Run products were submitted to multi-technique and multi-scale characterisation: X-ray diffraction, scanning electron microscopy, transmission electron microscopy (HR imaging, EDS and EELS

Final report of the TRUE Block Scale project. 1. Characterisation and model development

Energy Technology Data Exchange (ETDEWEB)

Andersson, Peter; Byegaard, Johan [Geosigma AB, Uppsala (Sweden); Dershowitz, Bill; Doe, Thomas [Golder Associates Inc., Redmond, WA (United States); Hermanson, Jan [Golder Associates AB (Sweden); Meier, Peter [ANDRA, Chatenay-Malabry (France); Tullborg, Eva-Lena [Terralogica AB (Sweden); Winberg, Anders (ed.) [Conterra AB, Partille (Sweden)

2002-04-01

The general objectives of the TRUE Block Scale Project were to 1) increase understanding of tracer transport in a fracture network and to improve predictive capabilities, 2) assess the importance of tracer retention mechanisms (diffusion and sorption) in a fracture network, and 3) assess the link between flow and transport data as a means for predicting transport phenomena. During the period mid 1996 through mid 1999 a 200x250x100 m rock volume was characterised with the purpose of furnishing the basis for successful tracer experiments in a network of conductive structures in the block scale (10-100 m). In total five cored boreholes were drilled as part of the project in an iterative mode with a period of analysis following completion of characterisation, and with a strong component of inter activity with numerical modelling and experimental design, particularly towards the end of the characterisation. The combined use of pressure responses due to drilling and drilling records provided important early information/confirmation of the existence and location of a given structure. Verification of conductors identified from pressure responses was achieved through the use of various flow logging techniques. The usage of the Posiva difference flow log towards the end of the characterisation work enabled identification of discrete conductive fractures with a high resolution. Pressure responses collected during drilling were used to obtain a first assessment of connectivity between boreholes. The transient behaviour of the responses collected during cross-hole interference tests in packed-off boreholes were used to identify families of responses, which correlated well with the identified principal families of structures/fracture networks. The conductive geometry of the investigated rock block is made up of steeply dipping deterministic NW structures and NNW structures. High inflows in the boreholes were for the most part associated with geologically/geometrically identified

Final report of the TRUE Block Scale project. 1. Characterisation and model development

International Nuclear Information System (INIS)

Andersson, Peter; Byegaard, Johan; Dershowitz, Bill; Doe, Thomas; Hermanson, Jan; Meier, Peter; Tullborg, Eva-Lena; Winberg, Anders

2002-04-01

The general objectives of the TRUE Block Scale Project were to 1) increase understanding of tracer transport in a fracture network and to improve predictive capabilities, 2) assess the importance of tracer retention mechanisms (diffusion and sorption) in a fracture network, and 3) assess the link between flow and transport data as a means for predicting transport phenomena. During the period mid 1996 through mid 1999 a 200x250x100 m rock volume was characterised with the purpose of furnishing the basis for successful tracer experiments in a network of conductive structures in the block scale (10-100 m). In total five cored boreholes were drilled as part of the project in an iterative mode with a period of analysis following completion of characterisation, and with a strong component of inter activity with numerical modelling and experimental design, particularly towards the end of the characterisation. The combined use of pressure responses due to drilling and drilling records provided important early information/confirmation of the existence and location of a given structure. Verification of conductors identified from pressure responses was achieved through the use of various flow logging techniques. The usage of the Posiva difference flow log towards the end of the characterisation work enabled identification of discrete conductive fractures with a high resolution. Pressure responses collected during drilling were used to obtain a first assessment of connectivity between boreholes. The transient behaviour of the responses collected during cross-hole interference tests in packed-off boreholes were used to identify families of responses, which correlated well with the identified principal families of structures/fracture networks. The conductive geometry of the investigated rock block is made up of steeply dipping deterministic NW structures and NNW structures. High inflows in the boreholes were for the most part associated with geologically/geometrically identified

How Fuzzy-Trace Theory Predicts True and False Memories for Words, Sentences, and Narratives

Science.gov (United States)

Reyna, Valerie F.; Corbin, Jonathan C.; Weldon, Rebecca B.; Brainerd, Charles J.

2016-01-01

Fuzzy-trace theory posits independent verbatim and gist memory processes, a distinction that has implications for such applied topics as eyewitness testimony. This distinction between precise, literal verbatim memory and meaning-based, intuitive gist accounts for memory paradoxes including dissociations between true and false memory, false memories outlasting true memories, and developmental increases in false memory. We provide an overview of fuzzy-trace theory, and, using mathematical modeling, also present results demonstrating verbatim and gist memory in true and false recognition of narrative sentences and inferences. Results supported fuzzy-trace theory's dual-process view of memory: verbatim memory was relied on to reject meaning-consistent, but unpresented, sentences (via recollection rejection). However, verbatim memory was often not retrieved, and gist memory supported acceptance of these sentences (via similarity judgment and phantom recollection). Thus, mathematical models of words can be extended to explain memory for complex stimuli, such as narratives, the kind of memory interrogated in law. PMID:27042402

OMI/Aura Surface UVB Irradiance and Erythemal Dose Daily L2 Global 0.25 deg Lat/Lon Grid V003

Data.gov (United States)

National Aeronautics and Space Administration — The Version 003 of Aura-OMI Spectral Surface UVB Irradiance and Erythemal Dose Level-2G data product (Daily level-2 data binned into global 0.25 deg Lat/Lon grids)...

Inhibition between 350 and 500 deg. C of the corrosion of magnesium by damp air

International Nuclear Information System (INIS)

Darras, Raymond; Caillat, Roger

1960-01-01

It has been demonstrated that the formation of a fluoride layer on the surface of magnesium by either dry or wet methods raises the temperature to which it resists corrosion in damp air from 350 to 490 deg. C. This protection effect could lead to a revision of the Pilling and Bedworth rule. Reprint of a paper published in 'Comptes Rendus des Seances de l'Academie des Sciences', tome 249, p. 1517-1519, sitting of 19 October 1959 [fr

Using Story Contexts to Bias Children's True and False Memories

Science.gov (United States)

Howe, Mark L.; Wilkinson, Samantha

2011-01-01

The effects of embedding standard Deese/Roediger-McDermott (DRM) lists into stories whose context biased interpretation either toward or away from the overall themes of the DRM lists on both true and false recognition were investigated with 7- and 11-year-olds. These biased story contexts were compared with the same children's susceptibility to…

A Case Study of True and Fair View Override in Financial Reporting

Directory of Open Access Journals (Sweden)

Ho Horace

2016-12-01

Full Text Available This paper documents a case study of true and fair view override in financial reporting by a multinational firm subject to International Financial Reporting Standards (IFRSs. The 2009 Interim Report of HSBC Holdings plc states that HSBC departed from the requirements of IAS 32 Financial Instruments: Presentation (IAS 32. Notwithstanding its noncompliance with the IFRSs, HSBC (2009 concluded that “the interim consolidated financial statements prepared on this basis presented fairly, and gave a true and fair view of the Group’s financial position, financial performance and cash flows” (p. 2. The purpose of this paper is to evaluate critically the accounting treatment in light of the relevant requirements of the IFRSs and the implications for professional accounting standards arising from this departure.

True versus spurious state dependence in firm performance

DEFF Research Database (Denmark)

Kaiser, Ulrich; Kongsted, Hans Christian

2008-01-01

This paper analyzes the persistence of firms' exporting behavior in a panel of German manufacturing firms using dynamic binary choice models. We distinguish between true and spurious state dependence in exports and apply fixed effects methods that allow us to verify the robustness of our results ...... determinants. Our results, which are consistent with the findings of previous studies on firms in developing countries and in the United States, show the presence of important sunk costs in export market entry and a depreciation of knowledge and experience in export markets....

True Versus Spurious State Dependence in Firm Performance

DEFF Research Database (Denmark)

Kaiser, Ulrich; Kongsted, Hans Christian

This paper analyzes the persistence of firms' exporting behavior in a panel of German manufacturing firms using dynamic binary choice models. We distinguish between true and spurious state dependence in exports and apply fixed effects methods that allow us to verify the robustness of our results ...... determinants. Our results, which are consistent with the findings of previous studies on firms in developing countries and in the United States, show the presence of important sunk costs in export market entry and a depreciation of knowledge and experience in export markets...

On the formation of the L-centre in silicon during heat treatment in the temperature range 205-285 deg. C

International Nuclear Information System (INIS)

Mikelsen, M; Monakhov, E V; Avset, B S; Svensson, B G

2006-01-01

Annealing kinetics of electron-irradiation induced defects in n-type diffusion oxygenated float-zone silicon has been studied in the temperature-range 205-285 deg. C. Previous deep level transient spectroscopy (DLTS) reports have established that an observed shift in the positions of two peaks related to the divacancy (V 2 ), is due to the annealing of the divacancy and the formation of the divacancy-oxygen complex (V 2 O). In parallel to this transformation from V 2 to V 2 O, a new defect of unknown identity, the so-called L-centre, forms with a level located at 0.36 eV below the conduction band edge. The L-level has a first order formation-kinetics in the temperature region studied; at 245-285 deg. C the formation rate is very similar to the annealing rate of V 2 , while at lower temperatures the formation rate becomes lower with a relative difference by a factor two at 205 deg. C. The Arrhenius plot for the L-level formation rate is not a straight line, indicating that the formation is controlled by at least two different processes. Kinetic modelling shows that the experimental data can be reproduced by a sequence of defect dissociation and migration, where the former limits at low temperatures (activation energy ∼1.75 eV) and the latter at high temperatures (E a ∼1.0 eV). Based on these results and other findings, the identity of the L-centre is discussed

An in situ synchrotron energy-dispersive diffraction study of the hydration of oilwell cement systems under high temperature/autoclave conditions up to 130 deg. C

International Nuclear Information System (INIS)

Colston, Sally L.; Barnes, Paul; Jupe, Andrew C.; Jacques, Simon D.M.; Hall, Christopher; Livesey, Paul; Dransfield, John; Meller, Nicola; Maitland, Geoffrey C.

2005-01-01

The technique of synchrotron energy dispersive diffraction has been developed for in situ studies of cement hydration under autoclave conditions. This has been applied to oilwell cements hydrating at typical oilwell temperatures up to 130 deg. C. The results show clearly the detailed interplay between 11 detectable phases, from which a phase transformation scheme has been derived; this illustrates the progression of hydration up to 130 deg. C for two extreme cases, with and without conservation of water content and autoclave pressure. The monosulphate hydrate phases are found to exhibit different stability bounds, with a surprising sequence of the 14-water, 10-water then 12-water monosulphate as temperature/time increases; the latter form is particularly associated with conditions of water/pressure loss. The effect of retarders on C 3 S dissolution and CH formation is negligible above 70 deg. C, whereas the effect on the calcium sulphoaluminate hydrates is more complex, and possible reasons for this are discussed

Calcium aluminates hydration in presence of amorphous SiO2 at temperatures below 90 deg. C

International Nuclear Information System (INIS)

Rivas Mercury, J.M.; Turrillas, X.; Aza, A.H. de; Pena, P.

2006-01-01

The hydration behaviour of Ca 3 Al 2 O 6 , Ca 12 Al 14 O 33 and CaAl 2 O 4 with added amorphous silica at 40, 65 and 90 deg. C has been studied for periods ranging from 1 to 31 days. In hydrated samples crystalline phases like katoite (Ca 3 Al 2 (SiO 4 ) 3- x (OH) 4 x ) and gibbsite, Al(OH) 3 , were identified, likewise amorphous phases like Al(OH) x , calcium silicate hydrates, C-S-H, and calcium aluminosilicate hydrates, C-S-A-H, were identified. The stoichiometry of Ca 3 Al 2 (SiO 4 ) 3- x (OH) 4 x (0≤3-x≤0.334), which was the main crystalline product, was established by Rietveld refinement of X-ray and neutron diffraction data and by transmission electron microscopy. - Graphical abstract: Katoite, Ca 3 Al 2 (SiO 4 ) 3- x (OH) 4 x (0≤3-x≤0.334), was identified besides gibbsite, Al(OH) 3 , as a crystalline stable hydration products in Ca 3 Al 2 O 6 , Ca 12 Al 14 O 33 and CaAl 2 O 4 hydrated with added amorphous silica between 40 and 90 deg. C

TOMS/Earth Probe UV Aerosol Index Monthly L3 Global 1x1.25 deg Lat/Lon Grid V008

Data.gov (United States)

National Aeronautics and Space Administration — This data product contains TOMS/Earth Probe UV Aerosol Index Monthly L3 Global 1x1.25 deg Lat/Lon Grid Version 8 data in ASCII format. (The shortname for this...

TOMS/Nimbus-7 UV Aerosol Index Monthly L3 Global 1x1.25 deg Lat/Lon Grid V008

Data.gov (United States)

National Aeronautics and Space Administration — This data product contains TOMS/Nimbus-7 UV Aerosol Index Monthly L3 Global 1x1.25 deg Lat/Lon Grid Version 8 data in ASCII format. The Total Ozone Mapping...

TOMS/Earth Probe Total Column Ozone Daily L3 Global 1x1.25 deg Lat/Lon Grid V008

Data.gov (United States)

National Aeronautics and Space Administration — This data product contains TOMS/Earth Probe Total Column Ozone Daily L3 Global 1x1.25 deg Lat/Lon Grid Version 8 data in ASCII format. (The shortname for this...

TOMS/Nimbus-7 Total Column Ozone Monthly L3 Global 1x1.25 deg Lat/Lon Grid V008

Data.gov (United States)

National Aeronautics and Space Administration — This data product contains TOMS/Nimbus-7 Total Column Ozone Monthly L3 Global 1x1.25 deg Lat/Lon Grid Version 8 data in ASCII format. The Total Ozone Mapping...

TOMS/Nimbus-7 UV Aerosol Index Daily L3 Global 1x1.25 deg Lat/Lon Grid V008

Data.gov (United States)

National Aeronautics and Space Administration — This data product contains TOMS/Nimbus-7 UV Aerosol Index Daily L3 Global 1x1.25 deg Lat/Lon Grid Version 8 data in ASCII format. The Total Ozone Mapping...

TOMS/Nimbus-7 Total Column Ozone Daily L3 Global 1x1.25 deg Lat/Lon Grid V008

Data.gov (United States)

National Aeronautics and Space Administration — This data product contains TOMS/Nimbus-7 Total Column Ozone Daily L3 Global 1x1.25 deg Lat/Lon Grid Version 8 data in ASCII format. The Total Ozone Mapping...

True Triaxial Strength and Failure Modes of Cubic Rock Specimens with Unloading the Minor Principal Stress

Science.gov (United States)

Li, Xibing; Du, Kun; Li, Diyuan

2015-11-01

True triaxial tests have been carried out on granite, sandstone and cement mortar using cubic specimens with the process of unloading the minor principal stress. The strengths and failure modes of the three rock materials are studied in the processes of unloading σ 3 and loading σ 1 by the newly developed true triaxial test system under different σ 2, aiming to study the mechanical responses of the rock in underground excavation at depth. It shows that the rock strength increases with the raising of the intermediate principal stress σ 2 when σ 3 is unloaded to zero. The true triaxial strength criterion by the power-law relationship can be used to fit the testing data. The "best-fitting" material parameters A and n ( A > 1.4 and n plastic deformation. The maximum extension strain criterion Stacey (Int J Rock Mech Min Sci Geomech Abstr 651 18(6):469-474, 1981) can be used to explain the change of failure mode from shear to slabbing for strong and hard rocks under true triaxial unloading test condition.

Perfusion MR imaging of the heart with TrueFISP

International Nuclear Information System (INIS)

Schreiber, W.G.; Schmitt, M.; Kalden, P.; Mohrs, O.; Kreitner, K.F.; Thelen, M.; Horstick, G.; Gumbrich, T.; Petersen, S.; Voigtlaender, T.

2001-01-01

Objective: Development and test of a saturation-recovery TrueFISP (SR-Trufi) pulse sequence for myocardial perfusion MR imaging (MRI) using improved gradient hardware. Material and methods: Measurements were performed on a 1.5 T scanner with prototype gradients (50 mT/m, minimum rise time 300 μs). T 1 -weighted first-pass MRI of Gd-DTPA (0.025 μmol/kg) kinetics in the myocardium was performed using an SR-Trufi pulse sequence (T R /T E /α=2.6 ms/1.4 ms/55 ) with a saturation preparation of TD-30 ms before the TrueFISP readout. Measurements were performed in volunteers (n=4) and in a pig model of chronic ischemia (n=1). Results: In phantoms, the signal intensity was linear with contrast concentration up to 0.9 mmol/kg Gd-DTPA. MR images obtained with SR-Trufi had a good image quality and high spatial resolution of 2.1 mmx2.1 mm. Differences of the contrast agent's kinetics between a subendocardial perfusion deficit and neighboring myocardium were well visible on both MR images and signal-time curves derived from the region-of-interest analysis. Conclusion: SR-Trufi appears to be an interesting new technique for the assessment of myocardial microcirculation using dedicated cardiovascular MR systems. (orig.) [de

True polar wander on convecting planets

Science.gov (United States)

Rose, Ian Robert

Rotating planets are most stable when spinning around their maximum moment of inertia, and will tend to reorient themselves to achieve this configuration. Geological activity redistributes mass in the planet, making the moment of inertia a function of time. As the moment of inertia of the planet changes, the spin axis shifts with respect to a mantle reference frame in order to maintain rotational stability. This process is known as true polar wander (TPW). Of the processes that contribute to a planet's moment of inertia, convection in the mantle generates the largest and longest-period fluctuations, with corresponding shifts in the spin axis. True polar wander has been hypothesized to explain several physiographic features on planets and moons in our solar system. On Earth, TPW events have been invoked in some interpretations of paleomagnetic data. Large swings in the spin axis could have enormous ramifications for paleogeography, paleoclimate, and the history of life. Although the existence of TPW is well-verified, it is not known whether its rate and magnitude have been large enough for it to be an important process in Earth history. If true polar wander has been sluggish compared to plate tectonic speeds, then it would be difficult to detect and its consequences would be minor. I investigate rates of true polar wander on convecting planets using scaling, numerics, and inverse problems. I perform a scaling analysis of TPW on a convecting planet, identifying a minimal set of nondimensional parameters which describe the problem. The primary nondimensional numbers that control the rate of TPW are the ratio of centrifugal to gravitational forces m and the Rayleigh number Ra. The parameter m sets the size of a planet's rotational bulge, which determines the amount of work that needs to be done to move the spin axis. The Rayleigh number controls the size, distribution, and rate of change of moment of inertia anomalies, all of which affect the rate of TPW. I find that

A material-sparing method for simultaneous determination of true density and powder compaction properties--aspartame as an example.

Science.gov (United States)

Sun, Changquan Calvin

2006-12-01

True density results for a batch of commercial aspartame are highly variable when helium pycnometry is used. Alternatively, the true density of the problematic aspartame lot was obtained by fitting tablet density versus pressure data. The fitted true density was in excellent agreement with that predicted from single crystal structure. Tablet porosity was calculated from the true density and tablet apparent density. After making the necessary measurements for calculating tablet apparent density, the breaking force of each intact tablet was measured and tensile strength was calculated. With the knowledge of compaction pressure, tablet porosity and tensile strength, powder compaction properties were characterized using tabletability (tensile strength versus pressure), compactibility (tensile strength versus porosity), compressibility (porosity versus pressure) and Heckel analysis. Thus, a wealth of additional information on the compaction properties of the powder was obtained through little added work. A total of approximately 4 g of powder was used in this study. Depending on the size of tablet tooling, tablet thickness and true density, 2-10 g of powder would be sufficient for characterizing most pharmaceutical powders.

Fluctuating confidence: the dynamic consequences of true/false affirmatives and denials on how a listener appraises their personal past.

Science.gov (United States)

Davis, Jolee; Bayantemur, Sharon Y; Seecharan, Sasha; Unger, Leslie D; Hellgren, Johanna; Stone, Charles B

2018-08-01

The present study examined the mnemonic consequences of true/false denials and affirmatives on how a listener appraises their personal past. To this end, participants (listeners) rated the extent to which they were confident certain events occurred during their childhood. They rated these events both before and after a confederate (speaker) denied or affirmed the occurrence of four different childhood events each, for a total of eight "rehearsed" events. For each set (denials and affirmatives) of events, half were true and half were false. In turn, this created four types of events (two each): true denials, true affirmatives, false denials, and false affirmatives. Additionally, half of the participants were told that the speaker was provided independent information about the veracity of the event's occurrence ("expert" condition). Overall, listeners were less confident in the occurrence of false denial events, but more so when they believed the speaker to be more knowledgeable of the listeners memories, more confident in false affirmative events and, counter intuitively, more confident in the occurrence of true denial events. These results underscore the importance of a nuanced approach to the mnemonic consequences of true and false denials and affirmations in the course of social interactions.

Endovascular treatment of a true posterior communicating artery aneurysm

OpenAIRE

Munarriz, Pablo M.; Castaño-Leon, Ana M.; Cepeda, Santiago; Campollo, Jorge; Alén, Jose F.; Lagares, Alfonso

2014-01-01

Background: Posterior communicating artery (PCoA) aneurysms are most commonly located at the junction of the internal carotid artery and the PCoA. "True" PCoA aneurysms, which originate from the PCoA itself, are rarely encountered. Most previously reported cases were treated surgically mainly before the endovascular option became available. Case Description: A 53-year-old male presented with sudden onset of right hemiparesis and aphasia. Left middle cerebral artery stroke was diagnosed. F...

Apparent and true resistant hypertension: definition, prevalence and outcomes

OpenAIRE

Judd, E; Calhoun, DA

2014-01-01

Resistant hypertension, defined as blood pressure (BP) remaining above goal despite the use of ≥3 antihypertensive medications at maximally tolerated doses (one ideally being a diuretic) or BP that requires ≥4 agents to achieve control, has received more attention with increased efforts to improve BP control rates and the emergence of device-based therapies for hypertension. This classically defined resistant group consists of patients with true resistant hypertension, controlled resistant hy...

A thermodynamic data base for Tc to calculate equilibrium solubilities at temperatures up to 300 deg C

Energy Technology Data Exchange (ETDEWEB)

Puigdomenech, I [Studsvik AB, Nykoeping (Sweden); Bruno, J [Intera Information Technologies SL, Cerdanyola (Spain)

1995-04-01

Thermodynamic data has been selected for solids and aqueous species of technetium. Equilibrium constants have been calculated in the temperature range 0 to 300 deg C at a pressure of 1 bar for T<100 deg C and at the steam saturated pressure at higher temperatures. For aqueous species, the revised Helgeson-Kirkham-Flowers model is used for temperature extrapolations. The data base contains a large amount of estimated data, and the methods used for these estimations are described in detail. A new equation is presented that allows the estimation of {Delta}{sub r}Cdeg{sub pm} values for mononuclear hydrolysis reactions. The formation constants for chloro complexes of Tc(V) and Tc(IV), whose existence is well established, have been estimated. The majority of entropy and heat capacity values in the data base have also been estimated, and therefore temperature extrapolations are largely based on estimations. The uncertainties derived from these calculations are described. Using the data base developed in this work, technetium solubilities have been calculated as a function of temperature for different chemical conditions. The implications for the mobility of Tc under nuclear repository conditions are discussed. 70 refs.

The 90deg excitation function for elastic 12C+12C scattering. The importance of Airy elephants

International Nuclear Information System (INIS)

McVoy, K.W.; Brandan, M.E.

1992-01-01

The 90deg excitation function for elastic 12 C+ 12 C scattering, at laboratory energies between the Coulomb barrier and 130 MeV, exhibits a complex structure of peaks and valleys whose nature has remained an unsolved mystery for more than 20 years. The problem has primarily been caused by the difficulty of choosing from a plethora of discretely ambiguous optical potentials. However, data accumulated above 150 MeV over the last decade have determined unique potentials at these higher energies, and the requirement of continuity downward in energy has recently permitted the determination of a unique set of potentials for angular distributions at energies below 130 MeV, where the excitation-function data exist. These new potentials are used to provide a mean-field (i.e., nonresonant) interpretation of the structure in the 12 C+ 12 C 90deg excitation function between 70 and 130 MeV. Its most prominent minima are found to be Airy minima from nuclear rainbows, with the remaining structure arising primarily from more elementary optical phenomena related to Fraunhofer diffraction. These same potentials are also successful in explaining the details of excitation functions measured very recently at other angles by Morsad. (orig.)

Superconducting transition and low-field magnetoresistance of a niobium single crystal at 4.2 deg. K

International Nuclear Information System (INIS)

Perriot, G.

1967-01-01

We report the study of the electrical resistance of a niobium single crystal, at 4.2 deg. K, from the beginning of the superconductive transition to 80 kilo oersteds. Critical fieldsH c2 and H c3 have been determined. Influences on superconductive transition of current density, field-current angle, crystal orientation and magnetoresistance have been studied. Variation laws of low-field transverse and longitudinal magneto-resistances have been determined. (author) [fr

The effect of high curing temperature on the reaction kinetics in MK/lime and MK-blended cement matrices at 60 deg. C

International Nuclear Information System (INIS)

Rojas, Moises Frias; Sanchez de Rojas, M.I.

2003-01-01

It is well known that the pozzolanic reaction between metakaolin (MK) and calcium hydroxide produces CSH, C 2 ASH 8 (stratlingite), C 4 AH 13 and C 3 ASH 6 (hydrogarnet). However, the presence or absence of these hydrated phases depends on different parameters, such as curing temperature, matrix used, etc. This paper shows the results of a study in order to know the effect of high curing temperature (60 deg. C) on the kinetics of the pozzolanic reaction in different matrices. MK/lime (calcium hydroxide) and MK-blended cement matrices were studied in samples stored and cured at 60 deg. C and up to 123 days of hydration. The nature, sequence and crystallinity of the hydrated phases were analysed using differential thermal analysis (DTA) and X-ray diffraction (XRD) techniques. Results showed that the sequence and formation of the hydrated phases was different in both matrices cured at 60 deg. C. In an MK/lime matrix, C 2 ASH 8 , C 4 AH 13 and C 3 ASH 6 were the main hydrated phases; while in an MK-blended cement, stratlingite was the sole hydrated phase issued from pozzolanic reaction. The DTA and XRD data also reveal an important fact: there is no evidence of the presence of hydrogarnet in blended cements

Research into zirconium alloys resistant to carbon dioxide under pressure at temperatures of up to 600 deg C (1963)

International Nuclear Information System (INIS)

Baque, P.; Dominget, R.; Bossard, J.

1963-01-01

Zirconium is a metal having a relatively low neutron capture cross-section and a high melting point; it is thus possible to consider its use in particular as a canning material for fuel elements in CO 2 -cooled nuclear reactors. A preliminary study of several types of zirconium showed that the metal is already strongly oxidised in this gas at 500 deg C. The 'breakaway' phenomenon is generalised; the oxidation rate is then linear and depends on the carbon dioxide pressure. An attempt was therefore made to find binary and tertiary alloys in order to improve the metal behaviour. Several interesting compositions were found: 1, 1.6 and 2.5 per cent of copper, 2 per cent of vanadium, and 0.05 and 0.5 per cent of calcium. Tertiary copper-molybdenum and copper-phosphorus alloys are also less liable to oxidation and in particular do not exhibit the 'breakaway' phenomenon even after a prolonged treatment at 600 deg C. (authors) [fr

δ-hydride habit plane determination in α-zirconium by strain energy minimization technique at 25 and 300 deg C

International Nuclear Information System (INIS)

Singh, R.N.; Stahle, P.; Sairam, K.; Ristmana, Matti; Banerjee, S.

2008-01-01

The objective of the present investigation is to predict the habit plane of δ-hydride precipitating in α-Zr at 25 and 300 deg C using strain energy minimization technique. The δ-hydride phase is modeled to undergo isotropic elastic and plastic deformation. The α-Zr phase was modeled to undergo transverse isotropic elastic deformation. Both isotropic plastic and transverse isotropic plastic deformations of α-Zr were considered. Further, both perfect and linear work-hardening plastic behaviors of zirconium and its hydride were considered. Accommodation strain energy of δ-hydrides forming in α-Zr crystal was computed using initial strain method as a function of hydride nuclei orientation. Hydride was modeled as disk with circular edge. The simulation was carried out using materials properties reported at 25 and 300 deg C. Contrary to several habit planes reported in literature for δ-hydrides precipitating in α-Zr crystal the total accommodation energy minima suggests only basal plane i.e. (0001) as the habit plane. (author)

Standardization of the TRUE Test imidazolidinyl urea and diazolidinyl urea patches

DEFF Research Database (Denmark)

Agner, T; Andersen, Klaus Ejner; Björkner, B

2001-01-01

The preservatives imidazolidinyl urea (IMID, Germall 115) and diazolidinyl urea (DU, Germall II) are commonly used in cosmetic products and are well-known sensitizers. The aim of the present study was to establish the optimal patch test concentration in hydrophilic dried-in vehicle (TRUE Test...

A new method to determine the 2DEG density distribution for passivated AlGaN/AlN/GaN heterostructure field-effect transistors

Science.gov (United States)

Fu, Chen; Lin, Zhaojun; Cui, Peng; Lv, Yuanjie; Zhou, Yang; Dai, Gang; Luan, Chongbiao; Liu, Huan; Cheng, Aijie

2018-01-01

A new method to determine the two-dimensional electron gas (2DEG) density distribution of the AlGaN/AlN/GaN heterostructure field-effect transistors (HFETs) after the Si3N4 passivation process has been presented. Detailed device characteristics were investigated and better transport properties have been observed for the passivated devices. The strain variation and the influence of the surface trapping states were analyzed. By using the polarization Coulomb field (PCF) scattering theory, the 2DEG density after passivation was both quantitively and qualitatively determined, which has been increased by 45% under the access regions and decreased by 2% under the gate region.

Passing the Remote: Community and Television Viewing in Woobinda and La guerra degli Antò

OpenAIRE

Seger, Monica

2011-01-01

This paper explores television-modeled narratives in Silvia Ballestra’s La guerra degli Antò, of 1992, and Aldo Nove’s Woobinda, of 1996. In so doing, it considers both the role of a text's author and the majority/minority reception practices that lead to its social imprint. For a definition of reception practices it turns to the work of media and reception scholars such as Henry Jenkins and Ien Ang. Employing a soap-operatic narrative and respecting the viewing practices of a mi...

Cs2SeO4-UO2SeO4-H2O system at 25 deg C

International Nuclear Information System (INIS)

Serezhkina, L.B.; Serezhkin, V.N.

1987-01-01

Using the method of isothermal solubility at 25 deg C the interaction of cesium and uranyl selenates in aqueous solution is studied. Formation of congruently soluble Cs 2 UO 2 (SeO 4 ) 2 x2H 2 O and Cs 2 (UO 2 ) 2 x(SeO 4 ) 3 is ascertained, their crystallographic characteristics being determined

Granite - water interactions at 100 deg C, 50 MPa: an experimental study

International Nuclear Information System (INIS)

Savage, D.

1984-01-01

A monzogranite was reacted with water in hydrothermal solution equipment at 100 deg C, 50 MPa for 203 days, during which time six fluid samples were extracted at run temperature and pressure for chemical analysis. Fluid samples were analysed using ICP, INAA and standard wet chemical techniques and data are presented for 18 chemical species. Solids were examined using XRD and SEM. The high temperature speciation of the fluid phase chemistry was investigated using the geochemical software package EQ3/6. The evolution of the fluid phase chemistry is discussed in terms of mineral-fluid equilibria and the kinetics of mineral dissolution and precipitation reactions. The implications of these results to the modelling of the near-field geochemical environment of a high-level radioactive waste repository in granitic rock are discussed. (author)

Prion protein immunocytochemistry helps to establish the true incidence of prion diseases.

Science.gov (United States)

Lantos, P L; McGill, I S; Janota, I; Doey, L J; Collinge, J; Bruce, M T; Whatley, S A; Anderton, B H; Clinton, J; Roberts, G W

1992-11-23

Creutzfeldt-Jakob disease (CJD) and Gerstmann-Strüssler-Scheinker disease (GSSD) are transmissible spongiform encephalopathies or prion diseases affecting man. It has been reported that prion diseases may occur without the histological hallmarks of spongiform encephalopathies: vacuolation of the cerebral grey matter, neuronal loss and astrocytosis. These cases without characteristic neuropathology may go undiagnosed and consequently the true incidence of transmissible dementias is likely to have been under-estimated. Immunocytochemistry using antibodies to prion protein gives positive staining of these cases, albeit the pattern of immunostaining differs from that seen in typical forms. Accumulation of prion protein is a molecular hallmark of prion diseases, and thus a reproducible, speedy and cost-efficient immunocytochemical screening of unusual dementias may help to establish the true incidence of prion diseases.

A true random number generator based on mouse movement and chaotic cryptography

International Nuclear Information System (INIS)

Hu Yue; Liao Xiaofeng; Wong, Kwok-wo; Zhou Qing

2009-01-01

True random number generators are in general more secure than pseudo random number generators. In this paper, we propose a novel true random number generator which generates a 256-bit random number by computer mouse movement. It is cheap, convenient and universal for personal computers. To eliminate the effect of similar movement patterns generated by the same user, three chaos-based approaches, namely, discretized 2D chaotic map permutation, spatiotemporal chaos and 'MASK' algorithm, are adopted to post-process the captured mouse movements. Random bits generated by three users are tested using NIST statistical tests. Both the spatiotemporal chaos approach and the 'MASK' algorithm pass the tests successfully. However, the latter has a better performance in terms of efficiency and effectiveness and so is more practical for common personal computer applications.

Modeling on oxide dependent 2DEG sheet charge density and threshold voltage in AlGaN/GaN MOSHEMT

Science.gov (United States)

Panda, J.; Jena, K.; Swain, R.; Lenka, T. R.

2016-04-01

We have developed a physics based analytical model for the calculation of threshold voltage, two dimensional electron gas (2DEG) density and surface potential for AlGaN/GaN metal oxide semiconductor high electron mobility transistors (MOSHEMT). The developed model includes important parameters like polarization charge density at oxide/AlGaN and AlGaN/GaN interfaces, interfacial defect oxide charges and donor charges at the surface of the AlGaN barrier. The effects of two different gate oxides (Al2O3 and HfO2) are compared for the performance evaluation of the proposed MOSHEMT. The MOSHEMTs with Al2O3 dielectric have an advantage of significant increase in 2DEG up to 1.2 × 1013 cm-2 with an increase in oxide thickness up to 10 nm as compared to HfO2 dielectric MOSHEMT. The surface potential for HfO2 based device decreases from 2 to -1.6 eV within 10 nm of oxide thickness whereas for the Al2O3 based device a sharp transition of surface potential occurs from 2.8 to -8.3 eV. The variation in oxide thickness and gate metal work function of the proposed MOSHEMT shifts the threshold voltage from negative to positive realizing the enhanced mode operation. Further to validate the model, the device is simulated in Silvaco Technology Computer Aided Design (TCAD) showing good agreement with the proposed model results. The accuracy of the developed calculations of the proposed model can be used to develop a complete physics based 2DEG sheet charge density and threshold voltage model for GaN MOSHEMT devices for performance analysis.

Searching for the true diet of marine predators: incorporating Bayesian priors into stable isotope mixing models.

Directory of Open Access Journals (Sweden)

André Chiaradia

Full Text Available Reconstructing the diet of top marine predators is of great significance in several key areas of applied ecology, requiring accurate estimation of their true diet. However, from conventional stomach content analysis to recent stable isotope and DNA analyses, no one method is bias or error free. Here, we evaluated the accuracy of recent methods to estimate the actual proportion of a controlled diet fed to a top-predator seabird, the Little penguin (Eudyptula minor. We combined published DNA data of penguins scats with blood plasma δ(15N and δ(13C values to reconstruct the diet of individual penguins fed experimentally. Mismatch between controlled (true ingested diet and dietary estimates obtained through the separately use of stable isotope and DNA data suggested some degree of differences in prey assimilation (stable isotope and digestion rates (DNA analysis. In contrast, combined posterior isotope mixing model with DNA Bayesian priors provided the closest match to the true diet. We provided the first evidence suggesting that the combined use of these complementary techniques may provide better estimates of the actual diet of top marine predators- a powerful tool in applied ecology in the search for the true consumed diet.

True to Yourself Leading a Values-Based Business

CERN Document Server

Albion, Mark

2006-01-01

How do you build the kind of company you've always wanted to work in--one that serves people and the planet while being financially successful, too? What do you do when you believe that business should serve the common good, but everyday business pressures--meeting payroll, battling competition, keeping customers and investors happy--are at a fever pitch? Leading a small business when you measure success more broadly than with a single financial bottom line is no easy task. True to Yourself is a practical guide to doing just that. It provides tools you can use to combine profit with purpose, m

The incidence and prognosis of true duodenal carcinomas

DEFF Research Database (Denmark)

Buchbjerg, Thomas; Fristrup, C.; Mortensen, M. B.

2015-01-01

the criteria for true PDC. The incidence was 5.4 per 1,000,000, and the pathological classification was: Adenocarcinoma 87%, mucinous adenocarcinoma 7%, carcinoma 4% and signet ring cell carcinoma 1%. Intended curative resection was performed in 28 patients (39%) (22 Whipple procedures and 6 local resections......), and all but one patient had negative resection margins. Thirteen patients (46%) had lymph node metastasis. Twenty-nine (67%) of the palliative treated patients had a single (n = 24) or double by-pass procedure (n = 5). The median and 5-year survival for the resected patients were 23 months (CI 7...

Buckling and reaction rate measurements in graphite moderated lattices fuelled with plutonium-uranium oxide clusters at temperatures up to 400 deg. C

International Nuclear Information System (INIS)

Carter, D.H.; Gibson, M.; King, D.C.; Marshall, J.; Puckett, B.J.; Richards, A.E.; Wass, T.; Wilson, D.J.

1965-07-01

The Report describes a series of experiments carried out in SCORPIO I and II on sub-critical graphite moderated lattices fuelled with 21-rod clusters of PuO 2 /UO 2 fuel. Three fuel batches with nominal plutonium: uranium ratios of 0.25%, 0.8% and 1.2% were investigated at temperatures between 20 deg. C and 400 deg. C. Because of the limited amounts of the three fuels, exponential measurements were made in 2-zone stacks, the outer regions of which were loaded with suitably matched 'reference fuel'. Fine structure distributions in the lattice cell were obtained with manganese and indium foils. Pu239/U235 fission ratios were determined both by fission chambers and by fission-product counting techniques. (author)

Systems of erbium chloride- carbamide- water and erbium nitrate- carbamide- water at 30 deg C

International Nuclear Information System (INIS)

Ajtimbetov, K.; Sulajmankulov, K.S.; Batyuk, A.G.; Ismailov, M.

1975-01-01

The systems erbium chloride - carbamide - water and erbium nitrate - carbamide - water were studied by solubility method at 30 deg C. In the system erbium chloride - carbamide - water three compounds were detected: ErClsub(3).6CO(NHsub(2))sub(2), ErClsub(3).4CO(NHsub(2))sub(2), ErClsub(3).2CO(NHsub(2))sub2.6Hsub(2)O. In the system erbium nitrate -carbamide - water two new compounds were found: Er(NOsub(3))sub(3).4CO(NHsub(2))sub2, Er(NOsub(3) )sub(3)

A Comparison between the Rhesus Monkey and the Human on the Effect of Atropine on the Electroencephalogram. Volume 2. Preliminary Statistical Analysis of Spectral EEG Waveforms in Rhesus Monkeys Exposed to Atropine.

Science.gov (United States)

1994-11-01

000000 000000 000000 000000 000000 C) H rHI HHHH HHHHH - rIr- - rIr H HHHHH 1 1 l H HHHHH- rIr- -I ri - HHHHHH H E-1~~ o~o ~ N H W~r ~ ~ W~MqU) co ýH H aiI...NMlCMMH’DHOO I-NNNMNIr- I- NNNNOnMH U) toH H H z. 000000000 000000000 Cl) H HHHHHH HHHHHHqHHH H- E-4 N MWr-N H Mr- N wMn0~r-oMMN Wl MNHOMM0O’ ro m olq~w H...ý C4k 44 4 ýL 4C 00000 HHH.-4 1- HH H HHHH HHHH U) /u) co* o nvr r-IO NOHM H0(-if0 m i c4 HooD- 00 Z 0000 000000000 00000 VI) H HHHHHH HHHHH HHHH 1

Determination of true digestible amino acids of feedstuffs utilizing cecectomized roosters

Directory of Open Access Journals (Sweden)

Eliane Aparecida da Silva

2012-09-01

Full Text Available The objective of this study was to estimate the true digestibility coefficients of amino acids and digestible amino acid values of some poultry feedstuffs. The feedstuffs were: babassu meal, sunflower meal, corn gluten meal, babassu starchy meal, meat and bone meal, common beans, pearl millet and residues of cookies, pasta and bread. The precise feeding method of Sibbald was used with adult cecectomized Leghorn roosters distributed in a completely randomized design, consisting of ten treatments and six replications with a rooster in each. The treatments were represented by the feedstuffs evaluated. The roosters were kept in a period of fasting for 36 hours and then fed 30 grams of feed. Samples were collected during 56 hours. Simultaneously, six roosters were kept fasting to make corrections to the metabolic and endogenous losses of amino acids. At the end of collections, the excreta obtained were weighed, freeze-dried and subsequently processed, so laboratory analyses were carried out and the coefficients of true digestibility of amino acids were determined. The mean values of the coefficients of true digestibility of essential and non-essential amino acids in percentage were respectively: 0.702 and 0.652 for the babassu meal; 0.852 and 0.786 for the sunflower meal; 0.928 and 0.887 for the corn gluten meal; 0.797 and 0.720 for the meat and bone meal; 0.364 and 0.339 for ground raw beans; 0.924 and 0.837 for ground pearl millet; 0.839 and 0.810 for cookie residue; 0.929 and 0.914 for pasta residue; and 0.904 and 0.899 for bread residue.

Data of evolutionary structure change: 1BYPA-1FA4A [Confc[Archive

Lifescience Database Archive (English)

Full Text Available dbChain>A 1BYPA SVTLT---EKGTY cture...>EEEE --- EEE> ATOM 522 CA SER A ...n> STTFPADAPAGEY ucture>EE ture...ucture> -- cture> ATOM 860 CA LYS A 57 7.87...yIDChain> TKISMPEEDLLN >HHH >

Data of evolutionary structure change: 1PVDA-2VBIG [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1PVDA-2VBIG 1PVD 2VBI A G SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKGMSCIITTFGVGELSALNGIAGSYAEHVG.../ss_2> 0 1PVD A 1PVDA SFNDN-SKIRM HHH ...ine>PRO CA 225 GLU CA 183 1PVD... A 1PVDA LQTPIDMSLKP

Broadband true time delay for microwave signal processing, using slow light based on stimulated Brillouin scattering in optical fibers.

Science.gov (United States)

Chin, Sanghoon; Thévenaz, Luc; Sancho, Juan; Sales, Salvador; Capmany, José; Berger, Perrine; Bourderionnet, Jérôme; Dolfi, Daniel

2010-10-11

We experimentally demonstrate a novel technique to process broadband microwave signals, using all-optically tunable true time delay in optical fibers. The configuration to achieve true time delay basically consists of two main stages: photonic RF phase shifter and slow light, based on stimulated Brillouin scattering in fibers. Dispersion properties of fibers are controlled, separately at optical carrier frequency and in the vicinity of microwave signal bandwidth. This way time delay induced within the signal bandwidth can be manipulated to correctly act as true time delay with a proper phase compensation introduced to the optical carrier. We completely analyzed the generated true time delay as a promising solution to feed phased array antenna for radar systems and to develop dynamically reconfigurable microwave photonic filters.

Volumetric analysis demonstrates that true and false lumen remodeling persists for 12 months after thoracic endovascular aortic repair

Directory of Open Access Journals (Sweden)

Ga-Young Suh, PhD

2016-09-01

Full Text Available A 62-year-old man underwent an elephant trunk procedure followed by thoracic endovascular aortic repair (TEVAR. Computed tomography angiography-based models were built to quantify volume of the whole aorta and true and false lumens preoperatively, before TEVAR, after TEVAR, and at follow-up at 3, 6, and 12 months. With TEVAR, descending aortic true lumen volume increased by 54%, then increased additionally by 60% during 12 months. The descending aortic false lumen volume regressed continuously for 12 months following TEVAR, with the most rapid rate from 6 to 12 months at 16 cm3/month. TEVAR immediately increased true lumen volume and continued to remodel the true and false lumens throughout the following 12 months.

A Venus/Saturn Mission Study: 45deg Sphere-Cone Rigid Aeroshells and Ballistic Entries

Science.gov (United States)

Prabhu, Dinesh K.; Allen, Gary A.; Cappuccio, Gelsomina

2012-01-01

The present study considers ballistic entries into the atmospheres of Saturn and Venus using a 45deg sphere-cone rigid aeroshell (a legacy shape that has been successfully used in the Pioneer Venus and Galileo missions). For a number of entry mass and diameter combinations (i.e., various entries ballistic coefficients), entry velocities, and heading angles, the trajectory space in terms of entry flight path angles between skip out and -30deg is explored with a 3DOF trajectory code, TRAJ. Assuming that the thermal protection material of choice is carbon phenolic of flight heritage, the entry flight path angle space is constrained a posteriori by the mechanical and thermal performance parameters of the material. For mechanical performance, a 200 g limit is place on the peak deceleration load and 10 bar is assumed as the spallation pressure threshold for the legacy material. It is shown that both constraints cannot be active simultaneously. For thermal performance, a minimum margined heat flux threshold of 2.5 kW/sq cm is assumed for the heritage material. Using these constraints, viable entry flight path angle corridors are determined. Analysis of the results also hints at the existence of a "critical" ballistic coefficient beyond which the steepest possible entries are determined by the spallation pressure threshold. The results are verified against known performance of the various probes used in the Galileo and Pioneer Venus missions. It is hoped that the results presented here will serve as a baseline in the development of a new class of ablative materials for Venus and Saturn missions being considered in a future New Frontiers class of NASA missions.

Can Maltreated Children Inhibit True and False Memories for Emotional Information?

Science.gov (United States)

Howe, Mark L.; Toth, Sheree L.; Cicchetti, Dante

2011-01-01

The authors examined 284 maltreated and nonmaltreated children's (6- to 12-year-olds) ability to inhibit true and false memories for neutral and emotional information using the Deese/Roediger-McDermott (DRM) paradigm. Children studied either emotional or neutral DRM lists in a control condition or were given directed-remembering or…

Validation of Tendril TrueHome Using Software-to-Software Comparison

Energy Technology Data Exchange (ETDEWEB)

Maguire, Jeffrey B [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Horowitz, Scott G [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Moore, Nathan [Tendril, Boulder, CO (United States); Sullivan, Patrick [Tendril, Boulder, CO (United States)

2017-09-01

This study performed comparative evaluation of EnergyPlus version 8.6 and Tendril TrueHome, two physics-based home energy simulation models, to identify differences in energy consumption predictions between the two programs and resolve discrepancies between them. EnergyPlus is considered a benchmark, best-in-class software tool for building energy simulation. This exercise sought to improve both software tools through additional evaluation/scrutiny.

True-3D accentuating of grids and streets in urban topographic maps enhances human object location memory.

Directory of Open Access Journals (Sweden)

Dennis Edler

Full Text Available Cognitive representations of learned map information are subject to systematic distortion errors. Map elements that divide a map surface into regions, such as content-related linear symbols (e.g. streets, rivers, railway systems or additional artificial layers (coordinate grids, provide an orientation pattern that can help users to reduce distortions in their mental representations. In recent years, the television industry has started to establish True-3D (autostereoscopic displays as mass media. These modern displays make it possible to watch dynamic and static images including depth illusions without additional devices, such as 3D glasses. In these images, visual details can be distributed over different positions along the depth axis. Some empirical studies of vision research provided first evidence that 3D stereoscopic content attracts higher attention and is processed faster. So far, the impact of True-3D accentuating has not yet been explored concerning spatial memory tasks and cartography. This paper reports the results of two empirical studies that focus on investigations whether True-3D accentuating of artificial, regular overlaying line features (i.e. grids and content-related, irregular line features (i.e. highways and main streets in official urban topographic maps (scale 1/10,000 further improves human object location memory performance. The memory performance is measured as both the percentage of correctly recalled object locations (hit rate and the mean distances of correctly recalled objects (spatial accuracy. It is shown that the True-3D accentuating of grids (depth offset: 5 cm significantly enhances the spatial accuracy of recalled map object locations, whereas the True-3D emphasis of streets significantly improves the hit rate of recalled map object locations. These results show the potential of True-3D displays for an improvement of the cognitive representation of learned cartographic information.

Free to be me: The relationship between the true self, rejection sensitivity, and use of online dating sites.

Science.gov (United States)

Hance, Margaret A; Blackhart, Ginette; Dew, Megan

2018-01-01

Prior research (Blackhart et al., 2014) found that rejection-sensitive individuals are more likely to use online dating sites. The purpose of the current research was to explain the relationship between rejection sensitivity and online dating site usage. Study 1 examined whether true self mediated the relation between rejection sensitivity and online dating. Study 2 sought to replicate the findings of Study 1 and to examine whether self-disclosure moderated the relationship between true self and online dating in the mediation model. Results replicated those found by Blackhart et al. and also found that true self mediated the relationship between rejection sensitivity and online dating site usage. These findings suggest that rejection-sensitive individuals feel they can more easily represent their "true" selves in online environments, such as online dating sites, which partially explains why they are more likely to engage in online dating.

The LiHCOO-Sc(HCOO)3-H2O system at 25 and 50 deg C

International Nuclear Information System (INIS)

Petrova, E.V.; Itkina, L.S.

1980-01-01

Solubility in the LiHCOO-Sc(HCOO) 3 -H 2 O system at 25 and 50 deg C has been investigated using the isothermal method It has been ascertainedy s stem is a simple eutonic one. Solubility isotherms consist of two crystallization branches: lithium formate monohydrate and scandium formate. Scandium formate salts-out lithium formate from the solution. Lithium formate increases the solubility of scandium formate (in the eutonic solution more than 2 times as compared to its solubility in the pure water)

Radiodiagnosis of closed fractures of 2-5 metacarpal bones

International Nuclear Information System (INIS)

Fastykovskaya, E.D.; Kopysova, V.A.; Kuzina, I.R.

1986-01-01

A unified method of radiodiagnosis of angular deformities in subcapital fractures of 2-5 metacarpal bones was proposed. It was based on the standardization of the wrist laying for roentgenography of the oblique view strictly at the angle of 45 deg. The projection angle of deformity of the metacarpal bone was measured on a radiogram obtained and then a true value of the angular displacement of the bone fragments to the palm was determined on a nomogram (i.e. on a chart of the ratio of values of the true and projection angles). The healthy metacarpal bone heads were inclined to the palm at the angle of 13-33 deg. It was found that in subcapital fractures of 2-5 metacarpal bones certain self-correction (varying from 10 to 15 deg) of angular deformities was possible in children and adolescents only. Owing to such radiodiagnosis and a differentiated choice of therapeutic methods (in 48.8% of the patients indications for reposition were determined) good anatomical and functional results were obtained in most of the patients (96.9%)

Data of evolutionary structure change: 1PVDA-2VBIA [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1PVDA-2VBIA 1PVD 2VBI A A SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKGMSCIITTFGVGELSALNGIAGSYAEHVG.../ss_2> 0 1PVD A 1PVDA SFNDN-SKIRM HHH ... 1PVD A 1PVD...A 233 ARG CA 308 GLN CA 388 1PVD

Data of evolutionary structure change: 1EWOA-5PADA [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1EWOA-5PADA 1EWO 5PAD A A APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWF...ryChain> 5PAD A 5PADA...>5PAD A 5PADA KRGTGNSYGVCGLY ...>A 5PADA LVAQY---GIHYR HHH...Chain>A 5PADA TYPYE---GVQRY

A Transonic Wind-Tunnel Investigation of a Seaplane Configuration having a 40 Deg Sweptback Wing, TED No. NACA DE 387

Science.gov (United States)

Hieser, Gerald; Kudlacik, Louis; Gray, W. H.

1956-01-01

During the course of an aerodynamic loads investigation of a model of the Martin XP6M-1 flying boat in the.Langley 16-foot transonic tunnel, longitudinal-aerodynamic-performance information was obtained. Data were obtained at speeds up to and exceeding those anticipated for the seaplane in level flight and included the Mach number range from 0.84. to 1.09. The angle of attack was varied from -2deg to 6deg and the average Reynolds number, based on wing mean aerodyn&ic chord, was about 3.7 x 10(exp 6). This seaplane, although not designed to maintain level flight at Mach numbers beyond the force break, was found to have a transonic drag-rise coefficient of 0.0728, with an accompanying drag-rise Mach number of about 0.85. A large portion of the.drag rise and the relatively low value of drag-rise Mach number result from the axial coincidence of the maximum areas of the principal airplane components.

Spin Hall effect in a 2DEG in the presence of magnetic couplings

International Nuclear Information System (INIS)

Gorini, C; Schwab, P; Dzierzawa, M; Raimondi, R; Milletari, M

2009-01-01

It is now well established that the peculiar linear-in-momentum dependence of the Rashba (and of the Dresselhaus) spin-orbit coupling leads to the vanishing of the spin Hall conductivity in the bulk of a two-dimensional electron gas (2DEG). In this paper we discuss how generic magnetic couplings change this behaviour providing then a potential handle on the spin Hall effect. In particular we examine the influence of magnetic impurities and an in-plane magnetic field. We find that in both cases there is a finite spin Hall effect and we provide explicit expressions for the spin Hall conductivity. The results can be obtained by means of the quasiclassical Green function approach, that we have recently extended to spin-orbit coupled electron systems.

Diffusion and agglomeration of helium in stainless steel in the temperature range from RT to 600 deg. C

International Nuclear Information System (INIS)

Zhang, C.H.; Chen, K.Q.; Zhu, Z.Y.

2000-01-01

Diffusion of helium and formation of helium bubbles in stainless steel in conditions of atomic displacement in the temperature range from RT to 600 deg. C are studied theoretically using standard rate equations. The dissociative mechanism via self-interstitial/He replacement is assumed to control helium diffusion and bubble formation. The numerical analysis shows that the temperature dependence of the effective diffusion coefficient of helium, the number density and the mean radius of bubbles has two distinctly different regimes with the transition occurring around 300 deg. C. The effective diffusion coefficient of helium, the number density and the mean radius of bubbles show weak temperature dependence in the low temperature regime, while they change abruptly with temperature in the high temperature regime. The results are qualitatively in agreement with the results of our experimental study on helium diffusion and bubble formation in helium-implanted 316L stainless steel. However, the discrepancy in the absolute values of number density and mean radius of bubbles between theoretical and experimental studies indicates that helium diffusion and bubble formation may be controlled by some athermal mechanisms in the low temperature regime

Buckling and reaction rate measurements in graphite moderated lattices fuelled with plutonium-uranium oxide clusters at temperatures up to 400 deg. C

Energy Technology Data Exchange (ETDEWEB)

Carter, D H; Gibson, M; King, D C; Marshall, J; Puckett, B J; Richards, A E; Wass, T; Wilson, D J [General Reactor Physics Division, Atomic Energy Establishment, Winfrith, Dorchester, Dorset (United Kingdom)

1965-07-15

The Report describes a series of experiments carried out in SCORPIO I and II on sub-critical graphite moderated lattices fuelled with 21-rod clusters of PuO{sub 2}/UO{sub 2} fuel. Three fuel batches with nominal plutonium: uranium ratios of 0.25%, 0.8% and 1.2% were investigated at temperatures between 20 deg. C and 400 deg. C. Because of the limited amounts of the three fuels, exponential measurements were made in 2-zone stacks, the outer regions of which were loaded with suitably matched 'reference fuel'. Fine structure distributions in the lattice cell were obtained with manganese and indium foils. Pu239/U235 fission ratios were determined both by fission chambers and by fission-product counting techniques. (author) 14 refs, 30 figs, 18 tabs

Commissioning measurements for photon beam data on three TrueBeam linear accelerators, and comparison with Trilogy and Clinac 2100 linear accelerators

Science.gov (United States)

2013-01-01

This study presents the beam data measurement results from the commissioning of three TrueBeam linear accelerators. An additional evaluation of the measured beam data within the TrueBeam linear accelerators contrasted with two other linear accelerators from the same manufacturer (i.e., Clinac and Trilogy) was performed to identify and evaluate any differences in the beam characteristics between the machines and to evaluate the possibility of beam matching for standard photon energies. We performed a comparison of commissioned photon beam data for two standard photon energies (6 MV and 15 MV) and one flattening filter‐free (“FFF”) photon energy (10 FFF) between three different TrueBeam linear accelerators. An analysis of the beam data was then performed to evaluate the reproducibility of the results and the possibility of “beam matching” between the TrueBeam linear accelerators. Additionally, the data from the TrueBeam linear accelerator was compared with comparable data obtained from one Clinac and one Trilogy linear accelerator models produced by the same manufacturer to evaluate the possibility of “beam matching” between the TrueBeam linear accelerators and the previous models. The energies evaluated between the linear accelerator models are the 6 MV for low energy and the 15 MV for high energy. PDD and output factor data showed less than 1% variation and profile data showed variations within 1% or 2 mm between the three TrueBeam linear accelerators. PDD and profile data between the TrueBeam, the Clinac, and Trilogy linear accelerators were almost identical (less than 1% variation). Small variations were observed in the shape of the profile for 15 MV at shallow depths (linear accelerators; the TrueBeam data resulted in a slightly greater penumbra width. The diagonal scans demonstrated significant differences in the profile shapes at a distance greater than 20 cm from the central axis, and this was more notable for the 15 MV energy. Output factor

Construction of Chained True Score Equipercentile Equatings under the Kernel Equating (KE) Framework and Their Relationship to Levine True Score Equating. Research Report. ETS RR-09-24

Science.gov (United States)

Chen, Haiwen; Holland, Paul

2009-01-01

In this paper, we develop a new chained equipercentile equating procedure for the nonequivalent groups with anchor test (NEAT) design under the assumptions of the classical test theory model. This new equating is named chained true score equipercentile equating. We also apply the kernel equating framework to this equating design, resulting in a…

True Nature of Supply Network Communication Structure

Directory of Open Access Journals (Sweden)

Lokhman Hakim bin Osman

2016-04-01

Full Text Available Globalization of world economy has altered the definition of organizational structure. Global supply chain can no longer be viewed as an arm-length structure. It has become more complex. The complexity demands deeper research and understanding. This research analyzed a structure of supply network in an attempt to elucidate the true structure of the supply network. Using the quantitative Social Network Analysis methodology, findings of this study indicated that, the structure of the supply network differs depending on the types of network relations. An important implication of these findings would be a more focus resource management upon network relationship development that is based on firms’ positions in the different network structure. This research also contributes to the various strategies of effective and efficient supply chain management.

Digestibility coefficient and true digestible amino acid values of different cultivars of maize for poultry

Directory of Open Access Journals (Sweden)

Márcia Antonia Bartolomeu Agustini

2015-04-01

Full Text Available The digestibility and true digestible amino acid content of eight cultivars of maize was determined using the method of force-feeding roosters cecectomized. The experimental design was completely randomized, represented by eight cultivars, five replicates and a rooster each. Five roosters were kept fasting for corrections corresponding to metabolic and endogenous losses of amino acids. Significant differences (P <0.05 among maize cultivars for the true digestibility of amino acids, methionine, threonine, arginine, cystine and serine were observed. The values of true digestibility coefficients for essential amino acids, for methionine, threonine and arginine ranged from 85.61 to 93.57%, from 66.27 to 84.97% and 83.39 to 93.10% respectively. For the other essential amino acids, the average values were: 72.84% for lysine, 85.64% for methionine+cystine, 87.29% for histidine, 85.33% for valine, 87.11% for isoleucine, 94.04% for leucine and 90.65% for phenylalanine. The true digestibility coefficients of nonessential amino acids cystine and serine that showed significant difference ranged from 73.97 to 89.21% and from 77.31 to 92.68%, respectively. For other non-essential amino acids, average values were 88.28% for alanine, 82.68% for aspartic acid, 92.19% for glutamic acid and 87.84% for tyrosine. Due to the variations observed, it is recommended periodic analyzes of maize cultivars used to formulate diets, to ensure the feed quality and the performance of the animals.

A Qualitative Assessment of the My True Body Bariatric Surgery Preparation Program

Science.gov (United States)

Nakamura, Tracy; Mamary, Edward

2013-01-01

Background: The My True Body (MTB) group intervention incorporates cognitive restructuring and social support into bariatric surgery preparation. Purpose: To identify and describe program components that support long-term behavioral modifications and influence confidence in healthy weight maintenance. Methods: Semistructured telephone interviews…

On the necessity of identifying the true parameter in adaptive LQ control

NARCIS (Netherlands)

Polderman, Jan W.

1986-01-01

In adaptive control problems one may drop the requirement of identifying the true system in order to simplify the problem of control. It will be shown that in the adaptive LQ control problem this does not at all lead to an easier problem.

Physicochemical properties of the CsNO2-CsOH-H2O ternary system at 25 deg C

International Nuclear Information System (INIS)

Protsenko, P.I.; Medvedev, B.S.; Popova, T.B.

1977-01-01

Saturated solutions of the CsNO 2 - CsOH- H 2 O system have been studied at 25 deg C by the methods of solubility, viscosity, electric conductivity, refractometry and density. It is stated that no solid phase of a new composition is formed in the system. While adding hydroxide to the saturated solution of cesium nitride, a considerable salting-out of the latter takes place

Fatigue limit of Zircaloy-2 under variable one-directional tension and temperature 300 deg C

International Nuclear Information System (INIS)

Spasic, Z.; Simic, G.

1968-11-01

A vacuum chamber wad designed and constructed. It was suitable for study of materials at higher temperatures in vacuum or controlled atmospheres. Zircaloy-2 fatigue at 300 deg C in argon atmosphere was measured. Character of strain is variable one directional (A=1) tension. Obtained results are presented in tables and in the form of Veler's curve. The obtained fatigue limit was σ - 15 kp/mm 2 . The Locati method was allied as well and fatigue limit value obtained was 15,75 kp/mm 2 . Error calculated in reference to the previous value obtained by classical methods was 5% [sr

A Screening Mechanism Differentiating True from False Pain during Empathy.

Science.gov (United States)

Sun, Ya-Bin; Lin, Xiao-Xiao; Ye, Wen; Wang, Ning; Wang, Jin-Yan; Luo, Fei

2017-09-13

Empathizing with another's suffering is important in social interactions. Empathic behavior is selectively elicited from genuine, meaningful pain but not from fake, meaningless scenarios. However, the brain's screening mechanism of false information from meaningful events and the time course for the screening process remains unclear. Using EEG combined with principle components analysis (PCA) techniques, here we compared temporal neurodynamics between the observation of pain and no-pain pictures as well as between true (painful expressions and needle-penetrated arms) and false (needle-penetrated faces with neutral expressions) pain pictures. The results revealed that pain vs. no-pain information is differentiated in the very early ERP components, i.e., the N1/P1 for the face and arm pictures categories and the VPP/N170 for the facial expression category while the mid-latency ERP components, N2 and P3, played key roles in differentiating true from false situations. The complex of N2 and P3 components may serve as a screening mechanism through which observers allocate their attentions to more important or relevant events and screen out false environmental information. This is the first study to describe and provide a time course of the screening process during pain empathy. These findings shed new light on the understanding of empathic processing.

True mean rate measuring system

International Nuclear Information System (INIS)

Eichenlaub, D.P.

1980-01-01

A digital radiation-monitoring system for nuclear power plants uses digital and microprocessor circuitry to enable rapid processing of pulse information from remote radiation monitors. The pulse rates are analyzed to determine whether new pulse-rate information is statisticaly the same as that previously received and to determine the best possible averaging time, which can be changed so that the statistical error remains below a specified level while the system response time remains short. Several data modules each process the pulse-rate information from several remote radiation monitors. Each data module accepts pulse data from each radiation monitor and measures the true average or mean pulse rate of events occurring with a Poisson distribution to determine the radiation level. They then develop digital output signals which indciate the respective radiation levels and which can be transmitted via multiplexer circuits for additional processing and display. The data modules can accept signals from remote control stations or computer stations via the multiplexer circuit to change operating thresholds and alarm levels in their memories. A check module scans the various data modules to determine whether the output signals are valid. It also acts as a redundant data module and will automatically replace an inoperative unit. (DN)

Accelerator Physics Code Web Repository

CERN Document Server

Zimmermann, Frank; Bellodi, G; Benedetto, E; Dorda, U; Giovannozzi, Massimo; Papaphilippou, Y; Pieloni, T; Ruggiero, F; Rumolo, G; Schmidt, F; Todesco, E; Zotter, Bruno W; Payet, J; Bartolini, R; Farvacque, L; Sen, T; Chin, Y H; Ohmi, K; Oide, K; Furman, M; Qiang, J; Sabbi, G L; Seidl, P A; Vay, J L; Friedman, A; Grote, D P; Cousineau, S M; Danilov, V; Holmes, J A; Shishlo, A; Kim, E S; Cai, Y; Pivi, M; Kaltchev, D I; Abell, D T; Katsouleas, Thomas C; Boine-Frankenheim, O; Franchetti, G; Hofmann, I; Machida, S; Wei, J

2006-01-01

In the framework of the CARE HHH European Network, we have developed a web-based dynamic acceleratorphysics code repository. We describe the design, structure and contents of this repository, illustrate its usage, and discuss our future plans, with emphasis on code benchmarking.

Data of evolutionary structure change: 1VL8A-2UVDE [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1VL8A-2UVDE 1VL8 2UVD A E FDLRGRVALVTGGSRGLGFGIAQGLAEAGCSVVVASRN-...eq1> -MLKGKVALVTGASRGIGRAIAIDLAKQGANVVVNYAGNEQKANEVVDEIKKL-GSDAIAVRADVANAED...>E 2UVDE VNYAGNEQKAN EEE H...in>E 2UVDE EIKKL-GSDAI HHH...yChain> 2UVD E 2UVDE VGVTG-NPGQA<