Beer Law Constants and Vapor Pressures of HgI2 over HgI2(s,l)
Su, Ching-Hua; Zhu, Shen; Ramachandran, N.; Burger, A.
2002-01-01
Optical absorption spectra of the vapor phase over HgI2(s,l) were measured at sample temperatures between 349 and 610 K for wavelengths between 200 and 600 nm. The spectra show the samples sublimed congruently into HGI2 without any observed Hg or I2 absorption spectra. The Beer's Law constants for 15 wavelengths between 200 and 440 nm were derived. From these constants the vapor pressure of HgI2, P, was found to be a function of temperature for the liquid and the solid beta-phases: ln P(atm) = -7700/T(K) + 12.462 (liquid phase) and ln P(atm) = -10150/T(K) + 17.026 (beta-phase). The expressions match the enthalpies of vaporization and sublimation of 15.30 and 20.17 kcal/mole respectively, for the liquid and the beta-phase HgI2. The difference in the enthalpies gives an enthalpy of fusion of 4.87 kcal/mole, and the intersection of the two expressions gives a melting point of 537 K.
Purification of HGI2 for nuclear detector fabrication
International Nuclear Information System (INIS)
Schieber, M.M.
1978-01-01
A process for purification of mercuric iodide (HgI 2 ) to be used as a source material for the growth of detector quality crystals. The high purity HgI 2 raw material is produced by a combination of three stages: synthesis of HgI 2 from Hg and I 2 , repeated sublimation, and zone refining
Vapor Growth of Mercuric Iodide Tetragonal Prismatic Crystals
2013-03-01
placed inside a copper Faraday cage to minimize electronic noise. The measurement system consisted of an amplifier, an oscilloscope, a multi-channel...analyzer (MCA), a high voltage supply, a pulse generator, and a personal computer, all positioned outside the Faraday cage . Gamma- ray sources (241Am...measurement using a HgI2 Frisch collar detector. (a) The detector box and amplifier were placed inside a Faraday cage . (b) Details of the detec- tor
Use of HgI2 as gamma radiation detector
International Nuclear Information System (INIS)
Perez Morales, J.M.
1993-01-01
The Mercuric Iodide (HgI 2 ) has become one of the most promising room temperature semiconductors for the construction of X and gamma radiation detectors. The classical methods of spectroscopy have not demonstrated to achieve optimum results with HgI 2 detectors, mainly due to its particular carrier transport properties. Several alternative spectroscopic methods developed in the last ten years are presented and commented, selecting for a complete study one of them: 'The Partial Charge Collection Method'. The transport properties of the carriers generated by the radiation in the detector is specially important for understanding the spectroscopic behaviour of the HgI 2 detectors. For a rigorous characterization of this transport, it has been studied a digital technique for the analysis of the electric pulses produced by the radiation. Theoretically, it has been developed a Monte Carlo simulation of the radiation detection and the electronic signal treatment processes with these detectors in the energy range of 60-1300 KeV. These codes are applied to the study of the The Partial Charge Collection Method and its comparison with gaussian methods. Experimentally, this digital techniques is used for the study of the transport properties of thin HgI 2 detectors. Special interest is given to the contribution of the slower carriers, the holes, obtaining some consequent of spectroscopic interest. Finally, it is presented the results obtained with the first detectors grown and mounted in CIEMAT with own technology. (author). 129 ref
HgI2 nanostructures obtained hydrothermally for application in ionizing radiation detection
International Nuclear Information System (INIS)
Pérez Barthaburu, María; Bentos Pereira, Heinkel; Fornaro, Laura; Galain, Isabel; Aguiar, Ivana
2016-01-01
The compound semiconductor HgI 2 has been widely studied and employed as a material for ionizing radiation detection. Monocrystal growth is an intricate method for obtaining materials for this application. With the aim of finding a simpler and more effective way to develop ionizing radiation detectors, we employed HgI 2 nanostructures subjected to a hydrothermal treatment and then pressed for this purpose. In the synthesis procedure, aqueous solutions of Hg(NO 3 ) 2 and NaI were mixed until their reaction completed and the suspension obtained was then placed in a homemade autoclave and heated at 120 °C for 2, 10 or 24 h. We confirmed the HgI 2 tetragonal phase by powder XRD in all cases, independently of the synthesis conditions employed. Nanoparticles were characterized by their size and morphology by TEM. We used the HgI 2 nanostructures to obtain a pellet by applying 0.7 GPa of pressure at room temperature. The pellet was then used to construct the detector, and we studied the electrical properties of the detector and its response to 241 Am sources of different exposure rates. The resistivity and signal-to-noise ratio obtained are of the order of those reported for HgI 2 detectors assembled with monocrystals. The results obtained in this work encourage us to work further on this topic, improving the method, scaling the detector’s size and studying its spectrometric grade. (paper)
High energy proton-induced radioactivity in HgI2 crystals
International Nuclear Information System (INIS)
Porras, E.; Ferrero, J.L.; Sanchez, F.; Ruiz, J.A.; Lei, F.
1995-01-01
Mercuric iodide (HgI 2 ) semiconductor crystals are generating a lot of interest as room temperature solid state detectors for hard X-ray astronomy observations. For these applications one of the most important background sources is the cosmic proton induced radioactivity in the detector material. In order to study this background noise contribution a 1x1x1 cm HgI 2 crystal was irradiated with high energy protons. The resulting long-lived unstable isotopes and their production rates have been identified and compared with Monte Carlo simulations. ((orig.))
??????, ?. ?.; ?????????, ?. ?.; ???????, ?. ?.; ?????????, ?. ?.; ?????????, ?. ?.
2004-01-01
?? ?????? ??????????? ?????????? ???????????? ?????? ??????? ???? ??????? CdxHgi_xTe-Hg-NH4Br ??? ??????? ?????? Hg ? ????????? ?????????? 560-860? ? ??????????? ?????? ?? = 103-=-105 ?? ????????? ????????, ??? ??????? ???????? ????? ? ??????????????? ??????, ????? ? ?????? - CdBr2, Hg, ??2. ??? ????????? ??????? ??????? ???????????? CdxHgi_xTe ??????? ? = 0.2; 0.3; 0.4 ?? ????????? ??? ??? ? ??? ?????????? ??????? ???????? ??????? (??? ?????? ?????? ????? ? ???????) ????????? ??????????? ???...
Dielectric properties of nanophase Ag2HgI4 and Ag2HgI4–Al2O3 ...
Indian Academy of Sciences (India)
Unknown
ions (Leute and Rusche 1981). Many authors (Neubert ... The particles of Ag2HgI4 were separated from the suspen- sion, washed ... Capacitance (C) and dielectric loss (tan δ) were measured using a .... the energy of formation of lattice defects. Since the ... in fast-ion conductors is interpreted in terms of random hopping of ...
New thermal neutron solid-state electronic detector based on HgI2 crystals
International Nuclear Information System (INIS)
Melamud, M.; Burshtein, Z.
1983-07-01
We describe the development of a new solid-state electronic neutron detector, based on HgI 2 single crystals. Incident neutrons are absorbed in high neutron absorbing foils, such as cadmium or gadolinium, which are placed in front of a HgI 2 detector. Gamma rays, emitted as a result of the neutron absorbtion, are then absorbed in the HgI 2 , generating free charge carriers, which are collected by the electric field. The advantage of this system lies in it's manufacturing simplicity, low weight and small physical dimensions, compared to gas-filled conventional neutron detectors. The disadvantage is that the system does not discriminate between gamma rays and neutrons. A method to minimize this disadvantage is pointed out. It is as well possible to count neutrons by direct exposure of the HgI 2 to neutrons. The neutron-to-gamma transformation in that case takes place by the material nuclei themselves. This method, however, is impractical due to the interference of delayed radioactivity whose origin are 129 I nuclei. They are generated from 128 I by absorbing a neutron, and decay with a 25 min half lifetime involving gamma emissions. (author)
Phase transition study in a [Cu2 HgI4:0⋅xAgI] mixed composite system
Indian Academy of Sciences (India)
Administrator
Diffraction, thermal analysis of compound, Ag2HgI4,. Cu2HgI4, Tl2HgI4 ... nitrogen atmosphere (200 ml/min) at a heating rate of. 5°C per min and a ..... Bates J B and Farington G C 1981 Proceedings of the interna- tional conference on fast ...
Lavrentyev, A. A.; Gabrelian, B. V.; Vu, V. T.; Shkumat, P. N.; Myronchuk, G. L.; Khvyshchun, M.; Fedorchuk, A. O.; Parasyuk, O. V.; Khyzhun, O. Y.
2015-04-01
High-quality single crystal of cesium mercury tetraiodide, Cs2HgI4, has been synthesized by the vertical Bridgman-Stockbarger method and its crystal structure has been refined. In addition, electronic structure and optical properties of Cs2HgI4 have been studied. For the crystal under study, X-ray photoelectron core-level and valence-band spectra for pristine and Ar+-ion irradiated surfaces have been measured. The present X-ray photoelectron spectroscopy (XPS) results indicate that the Cs2HgI4 single crystal surface is very sensitive with respect to Ar+ ion-irradiation. In particular, Ar+ bombardment of the single crystal surface alters the elemental stoichiometry of the Cs2HgI4 surface. To elucidate peculiarities of the energy distribution of the electronic states within the valence-band and conduction-band regions of the Cs2HgI4 compound, we have performed first-principles band-structure calculations based on density functional theory (DFT) as incorporated in the WIEN2k package. Total and partial densities of states for Cs2HgI4 have been calculated. The DFT calculations reveal that the I p states make the major contributions in the upper portion of the valence band, while the Hg d, Cs p and I s states are the dominant contributors in its lower portion. Temperature dependence of the light absorption coefficient and specific electrical conductivity has been explored for Cs2HgI4 in the temperature range of 77-300 K. Main optical characteristics of the Cs2HgI4 compound have been elucidated by the first-principles calculations.
Improved fabrication of HgI2 nuclear radiation detectors by machine-cleaving
International Nuclear Information System (INIS)
Levi, A.; Burger, A.; Schieber, M.; Vandenberg, L.; Yellon, W.B.; Alkire, R.W.
1982-01-01
The perfection of machine-cleaved sections from HgI 2 bulk crystals was examined. The perfection of the machine-cleaved sections as established by gamma diffraction rocking curves was found to be much better than the perfection of hand-cleaved sections or as grown thin platelets, reaching a perfection similar to that of the wire-sawn sections of HgI 2 . A correlation between the perfection and the thickness of the machine-cleaved section was also found, i.e., the thicker the cleaved-section the more perfect it is. The reproducibility of the fabrication was significantly improved by using machine cleaving in the process of fabrication. Large single crystals of HgI 2 weighing 20 to 200 g, can be grown from the vapor phase using the TOM Technique. In order to fabricate nuclear radiation detectors from these single crystals, thin sections of about 0.4 to 0.8 mm thickness have to be prepared. Up till now, the state-of-the-art of fabricating HgI 2 nuclear radiation detectors involved two methods to get thin sections from the large single crystals: (1) hand-cleaving using a razor-blade and (2) solution wire sawing. The chemical wire sawing method involves a loss of about 50% of the crystal volume and is usually followed by a chemical polishing process which involves a significant loss of volume of the original volume. This procedure is complicated and wasteful. The traditional fabrication method, i.e., hand-cleaving followed by rapid nonselective chemical etching, is simpler and less wasteful
Designing and making of a tool used for measurements by X fluorescence using HgI2 detectors
International Nuclear Information System (INIS)
Liu-Xu, X.
1994-10-01
A new measuring apparatus by X fluorescence based on a HgI 2 detector, operating at room temperature is presented. The principal properties of HgI 2 are outlined. A computer code designed for this apparatus is developed. Some experimental results are given to illustrate the performances of the device. (author). 67 refs., 117 figs., 7 tabs
International Nuclear Information System (INIS)
Faria, L.O.
1987-01-01
Mercury Iodide (HgI 2 ) platelets were grown from the vapor phase in the presence of polymers. These platelets are convenient to be used as room temperature operating semiconductor radiation detectors. Experiments demonstrate that the growth of platelets depends on a two-stage mass transport instead of depending on just one, as it has been thought. HgI 2 platelets 30 mm 2 large and 90 μm thick were obtained in a sealed evacuated fused quartz tube and were characterized by etch pit density measurements. (author) [pt
International Nuclear Information System (INIS)
Martins, Joao F.T.; Ferraz, Caue de M.; Santos, Robinson A. dos; Mesquita, Carlos H. de; Hamada, Margarida M.
2013-01-01
The impurity effect in the surface morphology quality of HgI 2 crystals was evaluated, aiming a future application of these crystals as room temperature radiation semiconductor detector. The crystals were purified and grown by two techniques: (1) physical vapor transport (PVT) and (2) saturated solution from dimethylsulfoxide (DMSO) complexes. Systematic measurements were carried out for determining the stoichiometry, structure orientation, surface morphology and impurity of the crystal. The best quality of surface morphology was found for the crystals purified and grown by the PVT technique. Significant decrease in the impurity concentration was found, purifying the crystal by means of two successive growths by the PVT technique, while a Si contamination in the HgI 2 crystal was observed, during its growth by the DMSO method. Thus, for DMSO technique was not possible to identify the peaks of the other trace elements present as impurities in the PVT crystal, due to the high intensity of the Si peak in the DMSO crystal. It was demonstrated the impurities affect significantly the surface morphology quality from the HgI 2 crystal. Key Words: Semiconductor crystal, Radiation detector, Mercury Iodide crystal, surface morphology. (author)
International Nuclear Information System (INIS)
Faria, L.O. de.
1987-09-01
Mercury Iodide (HgI 2 ) platelets were grown from the vapor phase in the presence of polymers. These platelets are convenient to be used as room temperature operating semiconductor radiation detectors. Experiments demonstrate that the growth of platelets depends on a two-stage mass transport instead of depending on just one, as it has been thought. HgI 2 platelets 30 mm 2 large and 90 μm thick were obtained in a sealed evacuated fused quartz tube and were characterized by etch pit density measurements. (author)
Radiometric and dosimetric characteristics of HgI2 detectors
International Nuclear Information System (INIS)
Zaletin, V.M.; Krivozubov, O.V.; Torlin, M.A.; Fomin, V.I.
1988-01-01
The characteristics of HgI 2 detectors in x-ray and gamma detection in applications to radiometric and dosimetric monitoring and as portable instruments for such purposes was considered. Blocks with mosaic and sandwich structures were prepared and tested against each other and, for comparative purposes, against CdTe detectors for relative sensitivities at various gamma-quanta energies. Sensitivity dependencies on gamma radiation energy were plotted for the detector materials and structures as were current dependencies on the dose rate of x rays. Results indicated that the mercury iodide detectors could be used in radiometric and dosimetric measurements at gamma quantum energies up to and in excess of 1000 KeV
CZT Virtual Frisch-grid Detector: Principles and Applications
International Nuclear Information System (INIS)
Cui, Y.; Bolotnikov, A.; Camarda, G.; Hossain, A.; James, R.B.
2009-01-01
Cadmium Zinc Telluride (CdZnTe or CZT) is a very attractive material for using as room-temperature semiconductor detectors, because it has a wide bandgap and a high atomic number. However, due to the material's poor hole mobility, several special techniques were developed to ensure its suitability for radiation detection. Among them, the virtual Frisch-grid CZT detector is an attractive option, having a simple configuration, yet delivering an outstanding spectral performance. The goal of our group in Brookhaven National Laboratory (BNL) is to improve the performance of Frisch-ring CZT detectors; most recently, that effort focused on the non-contacting Frisch-ring detector, allowing us to build an inexpensive, large-volume detector array with high energy-resolution and a large effective area. In this paper, the principles of virtual Frisch-grid detectors are described, especially BNL's innovative improvements. The potential applications of virtual Frisch-grid detectors are discussed, and as an example, a hand-held gamma-ray spectrometer using a CZT virtual Frischgrid detector array is introduced, which is a self-contained device with a radiation detector, readout circuit, communication circuit, and high-voltage supply. It has good energy resolution of 1.4% (FWHM of 662-keV peak) with a total detection volume of ∼20 cm 3 . Such a portable inexpensive device can be used widely in nonproliferation applications, non-destructive detection, radiation imaging, and for homeland security. Extended systems based on the same technology have potential applications in industrial- and nuclear-medical-imaging
Low-temperature photoluminescence of detector-grade HgI2
International Nuclear Information System (INIS)
Merz, J.L.; Wu, Z.L.; van den Berg, L.; Schnepple, W.F.
1981-01-01
The low-temperature photoluminescence of HgI 2 is reported. Three main luminescence bands are observed, with peaks at approx. 2.30, 2.20, and 2.00 eV at 77 K. At 4.2 K, the highest energy peak shows considerable structure. The temperature dependence of these lines indicates both free and bound exciton recombination, and very small exciton binding energies (approx. 3 to 5 MeV) have been estimated. A comparison of the results of sublimation and doping experiments suggests that the lowest energy band may be related to impurities, whereas the middle-energy band is related to I content. The two strongest bound exciton lines comprising the high-energy band show systematic correlations with the middle-energy, I-related band. Further correlations between these spectral features and the performance of nuclear radiation detectors fabricated from these samples are also noted. The temperature coefficient of the band gap is estimated from the spectral shift of luminescence lines to be approximately -1.13 x 10 -4 eV/K between 32 K and 45 K
Influence of temperature upon dislocation mobility and elastic limit of single crystal HgI2
International Nuclear Information System (INIS)
Milstein, F.; Farber, B.; Kim, K.; van den Berg, L.; Schnepple, W.
1982-01-01
The practical importance of studying mechanical properties and dislocation structure of HgI 2 is reviewed briefly. Specifically, the performance of single crystal HgI 2 radiation detectors is evidently sensitive to crystalline imperfections; the dislocation structure, in turn, can be altered during detector fabrication, depending upon the mechanical properties of the crystal and the stresses to which the crystal is subjected. The influence of temperature upon dislocation mobility and plasticity in vapor-grown crystals of mercuric iodide is examined. Dislocation mobiity is determined by measuring the lengths of the longest arms of dislocation etch pit rosettes on (001) surfaces following microhardness indentation and chemical etch. Measurements were made in the range from room temperature to the phase transition temperature of 127 0 C. Dislocation mobility was found to be an increasing function of temperature, with the effect accelerating as the phase transition is approached. Increasing temperature was also found to lower the critical resolved shear stress for plastic deformation on slip on (001) planes. In these contexts, the vapor-grown crystals are clearly softer at their elevated growth temperatures. The results are discussed in terms of a dislocation model involving soft and hard glide dislocations
Edwards, Nathaniel S.; Conley, Jerrod C.; Reichenberger, Michael A.; Nelson, Kyle A.; Tiner, Christopher N.; Hinson, Niklas J.; Ugorowski, Philip B.; Fronk, Ryan G.; McGregor, Douglas S.
2018-06-01
The propagation of electrons through several linear pore densities of reticulated vitreous carbon (RVC) foam was studied using a Frisch-grid parallel-plate ionization chamber pressurized to 1 psig of P-10 proportional gas. The operating voltages of the electrodes contained within the Frisch-grid parallel-plate ionization chamber were defined by measuring counting curves using a collimated 241Am alpha-particle source with and without a Frisch grid. RVC foam samples with linear pore densities of 5, 10, 20, 30, 45, 80, and 100 pores per linear inch were separately positioned between the cathode and anode. Pulse-height spectra and count rates from a collimated 241Am alpha-particle source positioned between the cathode and each RVC foam sample were measured and compared to a measurement without an RVC foam sample. The Frisch grid was positioned in between the RVC foam sample and the anode. The measured pulse-height spectra were indiscernible from background and resulted in negligible net count rates for all RVC foam samples. The Frisch grid parallel-plate ionization chamber measurement results indicate that electrons do not traverse the bulk of RVC foam and consequently do not produce a pulse.
Frisch on Testing of Business Cycle Theories
Boumans, M.
1995-01-01
An important identifying assumption for business cycle models is contained in the mathematical form of the model, which determines the nature of its possible movements. Tinbergen's and Frisch's original understanding of business cycle theories was that of a closed model, containing only endogenous
Ambiguities in the grid-inefficiency correction for Frisch-Grid Ionization Chambers
International Nuclear Information System (INIS)
Al-Adili, A.; Hambsch, F.-J.; Bencardino, R.; Oberstedt, S.; Pomp, S.
2012-01-01
Ionization chambers with Frisch grids have been very successfully applied to neutron-induced fission-fragment studies during the past 20 years. They are radiation resistant and can be easily adapted to the experimental conditions. The use of Frisch grids has the advantage to remove the angular dependency from the charge induced on the anode plate. However, due to the Grid Inefficiency (GI) in shielding the charges, the anode signal remains slightly angular dependent. The correction for the GI is, however, essential to determine the correct energy of the ionizing particles. GI corrections can amount to a few percent of the anode signal. Presently, two contradicting correction methods are considered in literature. The first method adding the angular-dependent part of the signal to the signal pulse height; the second method subtracting the former from the latter. Both additive and subtractive approaches were investigated in an experiment where a Twin Frisch-Grid Ionization Chamber (TFGIC) was employed to detect the spontaneous fission fragments (FF) emitted by a 252 Cf source. Two parallel-wire grids with different wire spacing (1 and 2 mm, respectively), were used individually, in the same chamber side. All the other experimental conditions were unchanged. The 2 mm grid featured more than double the GI of the 1 mm grid. The induced charge on the anode in both measurements was compared, before and after GI correction. Before GI correction, the 2 mm grid resulted in a lower pulse-height distribution than the 1 mm grid. After applying both GI corrections to both measurements only the additive approach led to consistent grid independent pulse-height distributions. The application of the subtractive correction on the contrary led to inconsistent, grid-dependent results. It is also shown that the impact of either of the correction methods is small on the FF mass distributions of 235 U(n th , f).
International Nuclear Information System (INIS)
Dabrowski, A.J.; Iwanczyk, J.S.; Barton, J.B.; Huth, G.C.; Whited, R.; Ortale, C.; Economou, T.E.; Turkevich, A.L.
1980-01-01
Performance of room temperature mercuric iodide x-ray spectrometers has been recently improved through new fabrication techniques and further development of low noise associated electronic systems. This progress has extended the range of measurements to the ultra low energy x-ray region at room temperature. This paper reports the study of the effect of contact material on the performance of HgI 2 detectors in the low energy x-ray region
Enhanced R200 with Frisch-Grid CZT
Energy Technology Data Exchange (ETDEWEB)
Bolotnikov, A. [Brookhaven National Lab. (BNL), Upton, NY (United States)
2017-12-01
The goal of this project is to demonstrate an engineering prototype of a gamma ray spectrometer that uses Cadmium Zinc Telluride (CZT) in a configuration comprised of an array of position-sensitive virtual Frisch grid (PSVFG) detectors and show its capability to perform functions that would be useful to the IAEA. The detectors should achieve energy resolution of ~2% at 200 keV and <1% at > 662 keV, thereby outperforming all hand-held instruments currently in use other than cryogenically cooled germanium. BNL will make every effort to transfer the technology to an industrial partner so that robust, fieldable instruments can be manufactured.
Geometrically weighted semiconductor Frisch grid radiation spectrometers
Energy Technology Data Exchange (ETDEWEB)
McGregor, D.S. [Dept. of Nuclear Engineering and Radiological Sciences, University of Michigan, Ann Arbor, MI 48109-2104 (United States); Rojeski, R.A. [Etec Systems, Inc., 26460 Corporate Ave., Hayward, CA 94545 (United States); He, Z. [Dept. of Nuclear Engineering and Radiological Sciences, University of Michigan, Ann Arbor, MI 48109-2104 (United States); Wehe, D.K. [Dept. of Nuclear Engineering and Radiological Sciences, University of Michigan, Ann Arbor, MI 48109-2104 (United States); Driver, M. [eV Products, 375 Saxonburg Blvd., Saxonburg, PA 16056 (United States); Blakely, M. [eV Products, 375 Saxonburg Blvd., Saxonburg, PA 16056 (United States)
1999-02-11
A new detector geometry is described with relatively high gamma ray energy resolution at room temperature. The device uses the geometric weighting effect, the small pixel effect and the Frisch grid effect to produce high gamma ray energy resolution. The design is simple and easy to construct. The device performs as a gamma ray spectrometer without the need for pulse shape rejection or correction, and it requires only one signal output to any commercially available charge sensitive preamplifier. The device operates very well with conventional NIM electronic systems. Presently, room temperature (23 deg. C) energy resolutions of 2.68% FWHM at 662 keV and 2.45% FWHM at 1.332 MeV have been measured with a 1 cm{sup 3} prism shaped CdZnTe device.
[Factors associated with depressive symptoms in blue-collar and white-collar male workers].
Kawasaki, Yurika; Nishitani, Naoko; Sakakibara, Hisataka
2015-01-01
Mental disorders are increasing and their influence on productivity is a concern in the workplace. However, few studies have investigated depression among blue-collar and white-collar workers in the manufacturing industry. The purpose of this study was to clarify the factors associated with depressive symptoms, focusing on lifestyles and insomnia. A self-administered questionnaire survey was conducted of 1,963 workers at an annual health checkup in a manufacturing company. Of the 1,712 respondents (response rate: 87%), 1,258 male worker subjects (blue-collar 674; white-collar 584) were analyzed after excluding those with mental diseases. The questionnaire included items on basic attributes and lifestyle. The Athens Insomnia Scale (AIS) and The Center for Epidemiologic Studies for Depression Scale (CES-D) were used to evaluate insomnia and depressive symptoms. The incidence of depressive symptoms with CES-D scores of ≥16 was 15.1% in both the blue-collar and the white-collar workers. Insomnia with AIS scores of ≥6 were encountered in 18.8% of the blue-collar workers and 18.3% of the white-collar workers. Multiple logistic regression analyses showed that for the blue-collar workers, depressive symptoms were associated with "AIS scores ≥6" (Odds ratio (OR): 10.93; 95% confidence interval (CI): 6.12-19.15), "not get rid of fatigue with sleep" (OR: 3.36; 95%CI: 1.85-6.09), "skip breakfast over 3 times a week" (OR: 3.10; 95%CI:1.42-6.76), "no family living together" (OR: 2.08; 95%CI: 1.05-4.12), and "commuting time" (OR: 1.01; 95%CI: 1.00-1.02). For the white-collar workers, depressive symptoms were related to "AIS scores ≥6" (OR: 14.91; 95%CI: 7.54-29.49), and "no family living together" (OR: 2.54; 95%CI: 1.27-5.09). Sleep time was not associated with depression in both blue- and white-collar workers. Depressive symptoms were found in 51.6% of the blue-collar workers with insomnia with AIS scores ≥6 and 53.8% of white-collar workers. Depressive symptoms were
Field-portable high-resolution EDXRF analysis with HgI2-detector-based instrumentation
International Nuclear Information System (INIS)
Berry, P.F.; Little, S.R.; Voots, G.R.
1992-01-01
Energy dispersive x-ray fluorescence (EDXRF) analysis is well known for its efficient use of x-ray detector technology for simultaneous multielement determination. Low-intensity excitation, such as from a radioisotope source, can thus be employed and has enabled the design of many types of truly portable EDXRF instrumentation. Portable design, however, has not been without significant compromise in analytical performance because of the limited x-ray resolving power of prior detection methods, except by the use of a cryogenically operated detector. The developments we refer to stem from the use of a comparatively new x-ray detection device fabricated from mercuric iodide (HgI 2 ). For this detector, only a modest degree of cooling is required to achieve an energy resolution of > 300 eV. Two field-portable instrument designs of different hand-held measurement probe configurations are available that have applications for industrial quality assurance and environmental screening
Correlations between plastic deformation parameters and radiation detector quality in HgI2
International Nuclear Information System (INIS)
Georgeson, G.; Milstein, F.; California Univ., Santa Barbara
1989-01-01
Mercuric iodide radiation detectors of various grades of quality were subjected to shearing forces in the (001) crystallographic planes using a specially designed micromechanical shear testing fixture. Experimental measurements were made of (001) shear stress versus shear strain. Each of the stress-strain curves was described by two empirically determined deformation parameters, s 0 and σ, where s 0 is a measure of 'bulk yielding' and σ indicates the 'sharpness of yielding' during plastic deformation. It was observed that the deformation parameters of many HgI 2 single crystal samples fit the relation s 0 =8σ 2/3 and that significant deviation from this relation, with s 0 >8σ 2/3 , indicates poor detector quality. Work hardening by prior plastic deformation was also found to cause s 0 to depart (in an increasing manner) from the 8σ 2/3 relation. For good quality material that has not previously been plastically deformed, the deformation parameter s c =s 0 -2σ<19 psi; this parameter can be interpreted as the 'onset of plastic yielding'. The results are discussed in terms of dislocation mechanisms for plastic deformation, work hardening, and recovery of work hardening. (orig.)
Simulation of the anode structure for capacitive frisch grid CdZnTe detectors
International Nuclear Information System (INIS)
Min Jiahua; Shi Zhubin; Sang Wenbin; Zhao Hengyu; Teng Jianyong; Qian Yongbiao; Liu Jishan
2009-01-01
CdZnTe (CZT) capacitive Frisch grid detectors can achieve a higher detecting resolution. The anode structrure might have an important role in improving the weighting potential distribution of the detectors. In this paper, four anode structures of capacitive Frisch grid structures have been analyzed with FE simulation, based on a 3-dimensional weighting potential analysis. The weighting potential distributions in modified anode devices (Model B, C and D) are optimized compared with a square device (Model A). In model C and D, the abrupt weighting potential can be well modified. However, with increased radius of the circular electrode in Model C the weighting potential platform away from the anode becomes higher and higher and in Model D, the weighting potential does not vary too much. (authors)
Nelson, Michael E.; Mech, L. David
2011-01-01
Wolves (Canis lupus) in northeastern Minnesota cached six radio-collars (four in winter, two in spring-summer) of 202 radio-collared White-tailed Deer (Odocoileus virginianus) they killed or consumed from 1975 to 2010. A Wolf bedded on top of one collar cached in snow. We found one collar each at a Wolf den and Wolf rendezvous site, 2.5 km and 0.5 km respectively, from each deer's previous locations.
International Nuclear Information System (INIS)
Bench, G.S.; Heikkinen, D.W.; Antolak, A.J.; Morse, D.H.; Pontau, A.E.; James, R.B.; David, D.C.; Burger, A.; Van Den Berg, L.
1993-03-01
The Ion Micro-Analysis Group (IMAG) in Livermore conducts quantitative trace elemental analysis with PIXE and depth profiling with IBS using an MeV ion microbeam. The system has the capability to produce two-dimensional trace element and IBS images. PIXE analyses have been conducted on HgI 2 and PbI 2 crystals and detector materials in order to identify and quantify near surface trace contaminants. IBS measurements have been conducted to investigate elemental depth distributions in various materials. The results of measurements on several different samples are reported and a discussion of factors affecting quantitative in vacuo microanalysis of these materials is presented
Prototype Stilbene Neutron Collar
Energy Technology Data Exchange (ETDEWEB)
Prasad, M. K. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Shumaker, D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Snyderman, N. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Verbeke, J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Wong, J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2016-10-26
A neutron collar using stilbene organic scintillator cells for fast neutron counting is described for the assay of fresh low enriched uranium (LEU) fuel assemblies. The prototype stilbene collar has a form factor similar to standard He-3 based collars and uses an AmLi interrogation neutron source. This report describes the simulation of list mode neutron correlation data on various fuel assemblies including some with neutron absorbers (burnable Gd poisons). Calibration curves (doubles vs 235U linear mass density) are presented for both thermal and fast (with Cd lining) modes of operation. It is shown that the stilbene collar meets or exceeds the current capabilities of He-3 based neutron collars. A self-consistent assay methodology, uniquely suited to the stilbene collar, using triples is described which complements traditional assay based on doubles calibration curves.
Boron-Coated Straw Collar for Uranium Neutron Coincidence Collar Replacement
International Nuclear Information System (INIS)
Hu, Jianwei; Croft, Stephen; McElroy, Robert Dennis
2017-01-01
The objective of this project was to design and optimize, in simulation space, an active neutron coincidence counter (or collar) using boron-coated straws (BCSs) as a non- 3 He replacement to the Uranium Neutron Coincidence Collar (UNCL). UNCL has been used by the International Atomic Energy Agency (IAEA) and European Atomic Energy Community (Euratom) since the 1980s to verify the 235 U content in fresh light water reactor fuel assemblies for safeguards purposes. This report documents the design and optimization of the BCS collar.
Boron-Coated Straw Collar for Uranium Neutron Coincidence Collar Replacement
Energy Technology Data Exchange (ETDEWEB)
Hu, Jianwei [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Croft, Stephen [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); McElroy, Robert Dennis [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)
2017-01-01
The objective of this project was to design and optimize, in simulation space, an active neutron coincidence counter (or collar) using boron-coated straws (BCSs) as a non-3He replacement to the Uranium Neutron Coincidence Collar (UNCL). UNCL has been used by the International Atomic Energy Agency (IAEA) and European Atomic Energy Community (Euratom) since the 1980s to verify the 235U content in fresh light water reactor fuel assemblies for safeguards purposes. This report documents the design and optimization of the BCS collar.
Basu, S; Ratcliffe, G; Green, M
2015-10-01
In recent years, there has been a decline in the manufacturing sector of the UK economy with a corresponding growth of service-orientated pink-collar jobs in some regions. While the health outcomes of white- and blue-collar workers are well-established, less is known about this emerging pink-collar group. To outline the health of pink-collar workers in comparison to their white-collar counterparts across a range of indicators. Area-level percentages for white-, pink- and blue-collar workers were derived from residents' routinely collected employment data in a northern English town. Area-level health data pertaining to male and female life expectancy, respiratory deaths and deaths from cardiovascular and circulatory causes (all age and under 75 years) were obtained from the local authority and public health observatory. Multivariate regression analyses were performed to assess relationships between job collar and health. When adjusted for deprivation, areas with higher percentages of pink-collar workers experienced lower rates of death from circulatory disease under the age of 75 in comparison to white-collar workers. Other relationships between collar status and health outcomes were not statistically significant. The reasons underlying the apparent protective effect of pink-collar status for deaths from circulatory disease are uncertain and merit further study. Possibilities include differences in age, exposure to occupational hazards and lifestyle behaviours. Our work has a number of limitations and longitudinal studies with detailed exposure data should assess the long-term health outcomes of these workers using agreed definitions. © The Author 2015. Published by Oxford University Press on behalf of the Society of Occupational Medicine. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
DEFF Research Database (Denmark)
Lundgren, F; Schroeder, Torben Veith
2012-01-01
Randomized studies evaluating the effect of a vein collar at the distal anastomosis of PTFE-grafts show conflicting results. The study of the Joint Vascular Research Group (JVRG) of UK found improved primary patency while the Scandinavian Miller Collar Study (SCAMICOS) found neither any effect...
Draining Collars and Lenses in Liquid-Lined Vertical Tubes.
Jensen
2000-01-01
The speed at which an annular liquid collar drains under gravity g in a vertical tube of radius a, when the tube has an otherwise thin viscous liquid lining on its interior, is determined by a balance between the collar's weight and viscous shear stresses confined to narrow regions in the neighborhood of the collar's effective contact lines. Whether a collar grows or shrinks in volume as it drains depends on the modified Bond number B=rho g a(2)/(sigmaepsilon), where rho is the fluid density, sigma is its surface tension, and epsilona is the thickness of the thin film immediately ahead of the collar. Asymptotic methods are used here to determine the following nonlinear stability criteria for an individual collar, valid in the limit of small epsilon. For 0draining collars grow in volume and, in sufficiently long tubes, ultimately "snap off" to form stable lenses. For 0.5960drain, so that any lens ultimately ruptures, unless stabilizing intermolecular forces allow the formation of a lamella supported by a macroscopic Plateau border. If surfactant immobilizes the liquid's free surface, these critical values of B are reduced by a factor of 2 but the distance a collar must travel before it snaps off is unchanged. Gravitationally driven snap off is therefore most likely to occur in long tubes with radii substantially less than the capillary lengthscale sigma/rhog)(1/2). Copyright 2000 Academic Press.
Why Blue-Collar Blacks Help Less
Smith, Sandra Susan; Young, Kara Alexis
2013-01-01
Why are blue-collar blacks less likely to help jobseekers than jobholders from other ethnoracial groups or even than more affluent blacks? Drawing from in-depth, semi-structured interviews with 97 black and Latino workers at one large, public sector employer, we find that blue-collar black workers both helped less proactively and rejected more requests for assistance than did blue-collar Latino and white-collar black workers. We attribute blue-collar blacks’ more passive engagement to their...
30 CFR 77.1010 - Collaring holes.
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Collaring holes. 77.1010 Section 77.1010... Control § 77.1010 Collaring holes. (a) Starter steels shall be used when collaring holes with hand-held drills. (b) Men shall not hold the drill steel while collaring holes, or rest their hands on the chuck or...
Generalized collar waves in acoustic logging while drilling
International Nuclear Information System (INIS)
Wang Xiu-Ming; He Xiao; Zhang Xiu-Mei
2016-01-01
Tool waves, also named collar waves, propagating along the drill collars in acoustic logging while drilling (ALWD), strongly interfere with the needed P- and S-waves of a penetrated formation, which is a key issue in picking up formation P- and S-wave velocities. Previous studies on physical insulation for the collar waves designed on the collar between the source and the receiver sections did not bring to a satisfactory solution. In this paper, we investigate the propagation features of collar waves in different models. It is confirmed that there exists an indirect collar wave in the synthetic full waves due to the coupling between the drill collar and the borehole, even there is a perfect isolator between the source and the receiver. The direct collar waves propagating all along the tool and the indirect ones produced by echoes from the borehole wall are summarized as the generalized collar waves. Further analyses show that the indirect collar waves could be relatively strong in the full wave data. This is why the collar waves cannot be eliminated with satisfactory effect in many cases by designing the physical isolators carved on the tool. (special topic)
Collar of Lady's Wear in Qing Dynasty
Institute of Scientific and Technical Information of China (English)
LI Xiao-jun
2007-01-01
The research is started with a query that whether the width of collar in Qing Dynasty Is too small. The paper bases on the statistics which come from the collection of the Costume Museum of Donghua University. compares the results with the natlonal standard specification, then analyzes the structure and shape of collars in Qing Dynasty, and tells the relationship between collar and the garment. Furthermore, the paper discusses the function of lady's collar in Qing Dynasty and gives a suggestion that collar being an Indicator to distinguish women's wear from children's wear.
Expert System for 3D Collar Intelligent Design
Institute of Scientific and Technical Information of China (English)
LIU Yan; GENG Zhao-feng
2004-01-01
A method to set up 3D collar prototype is developed in this paper by using the technique of cubic spline and bicubic surface patch. Then the relationship between the parameters of 3D collar prototype and different collar styles are studied. Based on the relationship, we can develop some algorithms of transferring style requirements to the parameters value of the collar prototype, and obtain some generation rules for the design of 3D collar style. As such, the knowledge base can be constructed, and the intelligent design system of 3D collar style is built. Using the system, various 3D collar styles can be designed automatically to satisfy various style requirements.
Directory of Open Access Journals (Sweden)
B. Alper Gultekin
2016-01-01
Full Text Available Purpose. To compare marginal bone loss between subgingivally placed short-collar implants with machined collars and those with machined and laser-microtextured collars. Materials and Methods. The investigators used a retrospective study design and included patients who needed missing posterior teeth replaced with implants. Short-collar implants with identical geometries were divided into two groups: an M group, machined collar; and an L group, machined and laser-microtextured collar. Implants were evaluated according to marginal bone loss, implant success, and probing depth (PD at 3 years of follow-up. Results. Sixty-two patients received 103 implants (56 in the M group and 47 in the L group. The cumulative survival rate was 100%. All implants showed clinically acceptable marginal bone loss, although bone resorption was lower in the L group (0.49 mm than in the M group (1.38 mm at 3 years (p<0.01. A significantly shallower PD was found for the implants in the L group during follow-up (p<0.01. Conclusions. Our results suggest predictable outcomes with regard to bone loss for both groups; however, bone resorption was less in the L group than in the M group before and after loading. The laser-microtextured collar implant may provide a shallower PD than the machined collar implant.
Energy Technology Data Exchange (ETDEWEB)
Bai, Huaiyong; Wang, Zhimin; Zhang, Luyu; Chen, Jinxiang; Zhang, Guohui, E-mail: guohuizhang@pku.edu.cn
2016-12-21
A method for measuring the electron drift velocity in working gas is proposed. Based on the cathode and the anode signal waveforms of the Frisch-grid ionization chamber, the electron drift velocity is extracted. With this method, the electron drift velocities in Ar + 10% CH{sub 4}, Ar + 3.5% CO{sub 2} and Kr + 2.7% CO{sub 2} gases have been measured and the results are compared with the existing measurements and the simulating results. Using this method, the electron drift velocity can be monitored throughout the experiment of charged particle without bothering the measurement of other parameters, such as the energy and orientation.
WHITE COLLAR CRIME - Investigations
Nyagudi, Nyagudi Musandu
2014-01-01
WHITE COLLAR CRIME - Investigations Presentation By Dr. Nyagudi MusanduForensic Criminologist 2nd International Securityand Safety Conference and Exhibition, 16th April, 2010 a forum hosted by Events Management Solutions at the Sarit Centre, Nairobi, Kenya
Proximal femoral anatomy and collared stems in hip arthroplasty: is a single collar size sufficient?
Bonin, Nicolas; Gedouin, Jean-Emmanuel; Pibarot, Vincent; Bejui-Hughues, Jacques; Bothorel, Hugo; Saffarini, Mo; Batailler, Cécile
2017-10-03
Even if the benefits of collars are unclear, they remain widely used, in several femoral stem designs. This study aimed to determine whether collar size should be proportional to hip dimensions and morphology. The hypothesis was that the collar should be larger for greater stem sizes and for varus femoral necks. Computed Tomography scans of 204 healthy hips were digitally analysed and manually templated to determine principle dimensions, appropriate stem size and model, as well as cortical distance at the femoral calcar (ideal collar size). Univariable analysis revealed that cortical distance was moderately correlated with mediolateral offset (r = 0.572; p < 0.0001) and stem model (r = 0.520; p < 0.0001). Cortical distance was weakly correlated with head diameter (r = 0.399; p < 0.0001), stem size (r = 0.200; p = 0.017), and patient gender (r = 0.361; p < 0.0001). Multivariable analysis confirmed that stem model (p < 0.0001) and head diameter (p = 0.0162) are directly correlated to cortical distance. We found that cortical distance along the femoral calcar is directly correlated with the model of the stem implanted ('standard' or 'varus') and with the head diameter. This cortical distance indicates optimal collar size, which would grant maximum calcar coverage without prosthetic overhang. Collar size should be proportional to the size of the operated hip, and should be larger for 'varus' stem models than for 'standard' stem models.
Energy Technology Data Exchange (ETDEWEB)
Bolotnikov, A. E., E-mail: bolotnik@bnl.gov; Ackley, K.; Camarda, G. S.; Cherches, C.; Cui, Y.; De Geronimo, G.; Fried, J.; Hossain, A.; Mahler, G.; Maritato, M.; Roy, U.; Salwen, C.; Vernon, E.; Yang, G.; James, R. B. [Brookhaven National Laboratory, Upton, New York 11793 (United States); Hodges, D. [University of Texas at El Paso, El Paso, Texas 79968 (United States); Lee, W. [Korea University, Seoul 136-855 (Korea, Republic of); Petryk, M. [SUNY Binghamton, Vestal, New York 13902 (United States)
2015-07-15
We developed a robust and low-cost array of virtual Frisch-grid CdZnTe detectors coupled to a front-end readout application-specific integrated circuit (ASIC) for spectroscopy and imaging of gamma rays. The array operates as a self-reliant detector module. It is comprised of 36 close-packed 6 × 6 × 15 mm{sup 3} detectors grouped into 3 × 3 sub-arrays of 2 × 2 detectors with the common cathodes. The front-end analog ASIC accommodates up to 36 anode and 9 cathode inputs. Several detector modules can be integrated into a single- or multi-layer unit operating as a Compton or a coded-aperture camera. We present the results from testing two fully assembled modules and readout electronics. The further enhancement of the arrays’ performance and reduction of their cost are possible by using position-sensitive virtual Frisch-grid detectors, which allow for accurate corrections of the response of material non-uniformities caused by crystal defects.
International Nuclear Information System (INIS)
Oliveira Segabinaze, R. de
1994-01-01
The object of this paper is to briefly the use of fire protection collars on plastic piping systems passing through wall and floor penetration. The fire protection collars consist of a stainless steel housing, in which the leading edges of two pivoting plates are in constant pressure contact with the pipe. In case of fire these plates react on the softened pipe with a guillotine action, thereby stopping the flow; within the housing a foam material expands to fill the space when subject to the heat of the fire. The piping project has to be modified to permit the fixing of the collars to walls and floor penetrations. (author). 2 refs, 9 figs
The silent Don Juan. The concepts of love and art in the works of Max Frisch
Directory of Open Access Journals (Sweden)
Špela Virant
2012-07-01
Full Text Available In the novel Stiller and in the play Don Juan, both published in the early 1950s, Frisch already focuses on the problem of identity as one of his major themes, but it is not yet situated in a political context as, for example, in the play Andorra. In these works, the identity-problem is situated in the domain of intimate relationships and artistic creativity, offering the possibility to discuss Frisch’s concepts of art and love, which unfold through Frisch’s treatment of the traditional literary figure of Don Juan and his hubris. Frisch’s Stiller and Don Juan do not believe in God; but their frame of mind stays the same, while the position of God and his attributes are assigned to love, art and geometry. Although both literary figures in the course of events realize that this substitution is a mistake, they are unable to alter their concepts of love and art. Instead of altering the concepts, they rather resign in silence, while Max Frisch continues to search for alternatives in reflecting on the process of fictionalization and in developing innovative narrative and dramatic structures.
A beaded collar for dual micro GPS/VHF transmitter attachment to nutria
Haramis, G.M.; White, T.S.
2011-01-01
We report on the development of an approximately 85-g beaded collar for dual micro GPS/VHF transmitter attachment to semi-aquatic nutria (Myocastor coypus). Prototype collars were tested on captive nutria and refined during field trials. Central to the design was novel use of the VHF transmitter antenna as a collar. A circular collar was formed by passing the 44-cm antenna cable through a pre-made hole in the transmitter, leaving an approximately 16-cm upright antenna. GPS units were mounted separately via a hole in the base of each unit. For good satellite contact, GPS units (28 g) were maintained at the nape of the neck by counterbalance of the heavier VHF transmitters (50 g) positioned under the neck. To reduce friction, we lined the collar with alternate-sized plastic and, later, more durable nylon beads. The final collar configuration was worn for approximately 1 month deployments with only minor neck abrasion; one collar was worn successfully for 5 months. Foot entanglement remained the greatest risk of injury from the collar. By fitting collars tightly, we reduced the incidence of foot entanglement to 2 of 33 deployments (6%). Successful GPS tracks were acquired on 29 of 33 deployments (88%).
International Nuclear Information System (INIS)
Katagiri, Masaki; Onabe, Hideaki
2005-03-01
For the development of low exposure CT, we have conducted a basic study on Frisch grid avalanche diode detector to realize a high efficiency, high counting rate X-ray detector. First, we fabricated Frisch grid Si detector made of one crystal and studied their features. For the development of X-ray detector with higher performance, bonding semiconductor wafers, including different semiconductors, such as Si and CdTe, is necessary. We have bonded Si wafers by surface activation method and studied on the electric performance of bonded Si wafers. The current-voltage curve of bonded pn Si wafers showed rectifying characteristics, although Si pn junctions are made by diffusion method, generally. Second, we proposed a low dose exposure X-ray transmission method using filtered X-ray and energy subtraction method. The dose exposure with this method is estimated as low as 30% of that of using white X-rays. If we compare the dose exposure of conventional current measurement method, we would conclude further advantage of this method. With the combination of low dose exposure X-ray transmission method and the Frisch grid detector, high performance X-ray transmission method and low exposure CT system will be developed in future. (author)
Occupational contact dermatitis in blue-collar workers
DEFF Research Database (Denmark)
Schwensen, Jakob F; Menné, Torkil; Veien, Niels K
2014-01-01
BACKGROUND: Blue-collar workers have a high risk of occupational contact dermatitis, but epidemiological studies are scarce. OBJECTIVES: To investigate allergic contact dermatitis in blue-collar workers with dermatitis registered by the Danish Contact Dermatitis Group. METHODS: A retrospective...... analysis of patch test data from 1471 blue-collar workers and 1471 matched controls tested between 2003 and 2012 was performed. A logistic regression was used to test for associations. RESULTS: The blue-collar workers often had occupational hand dermatitis (p dermatitis was less commonly......, and methylchloroisothiazolinone (MCI)/methylisothiazolinone (MI). The following occupations were additionally identified as risk factors for contact sensitization to MCI/MI and MI, epoxy resins, and potassium dichromate, respectively: painting, construction work, and tile setting/terrazzo work. CONCLUSION: Contact allergy...
Comparison of Aerosol Delivery by Face Mask and Tracheostomy Collar.
Bugis, Alaa A; Sheard, Meryl M; Fink, James B; Harwood, Robert J; Ari, Arzu
2015-09-01
The purpose of this study was to compare the performance of a tracheostomy collar, Wright mask, and aerosol mask attached to a jet nebulizer in facilitating aerosolized medication delivery to the lungs. We also compared albuterol delivery with open versus closed fenestration and determined the effect of inspiratory-expiratory ratio (I:E) on aerosol delivery. Albuterol (2.5 mg/3 mL) was administered to an in vitro model consisting of an adult teaching mannequin extrathoracic and upper airway with stoma intubated with an 8-mm fenestrated tracheostomy tube. The cuff was deflated. A collecting filter at the level of the bronchi was connected to a breathing simulator at a tidal volume of 400 mL, breathing frequency of 20 breaths/min, and I:E of 2:1 and 1:2. A jet nebulizer was operated with O2 at 8 L/min. Each interface was tested in triplicate. The flow was discontinued at the end of nebulization. For each test, the nebulizer was attached to a tracheostomy collar with the fenestration open or closed, a Wright mask, or an aerosol mask. Drug was analyzed by spectrophotometry (276 nm). A paired t test and analysis of variance were performed (P mask (4.1 ± 0.6%) and aerosol mask (3.5 ± 0.04%) were both less than with the tracheostomy collar under either condition (P mask (7.2 ± 0.6%), and aerosol mask (6.1 ± 0.5%). In an adult tracheostomy model, the tracheostomy collar delivered more aerosol to the bronchi than the Wright or aerosol mask. An I:E of 2:1 caused greater aerosol deposition compared with an I:E of 1:2. During aerosol administration via a tracheostomy collar, closing the fenestration improved aerosol delivery. Copyright © 2015 by Daedalus Enterprises.
Herr, Raphael M; Bosch, Jos A; van Vianen, Annelies E M; Jarczok, Marc N; Thayer, Julian F; Li, Jian; Schmidt, Burkhard; Fischer, Joachim E; Loerbroks, Adrian
2015-06-01
Perceived injustice at work predicts coronary heart disease. Vagal dysregulation represents a potential psychobiological pathway. We examined associations between organizational justice and heart rate variability (HRV) indicators. Grounded in social exchange and psychological contract theory, we tested predictions that these associations are more pronounced among white-collar than among blue-collar workers. Cross-sectional data from 222 blue-collar and 179 white-collar men were used. Interactional and procedural justice were measured by questionnaire. Ambulatory HRV was assessed across 24 h. Standardized regression coefficients (β) were calculated. Among white-collar workers, interactional justice showed positive relationships with 24-h HRV, which were strongest during sleeping time (adjusted βs≥0.26; p values≤0.01). No associations were found for blue-collar workers. A comparable but attenuated pattern was observed for procedural justice. Both dimensions of organizational injustice were associated with lowered HRV among white-collar workers. The impact of justice and possibly its association with health seems to differ by occupational groups.
Bertinelli, F; Berthollon-Vitte, S; Glaude, D; Vanenkov, I
2006-01-01
The quality control implemented at all LHC dipole assemblers includes precise mechanical measurements of the geometry of collared coils. A cross-analysis performed between mechanical and magnetic measurements data shows a correlation between collared coils outer dimensions and the normal quadrupole multipole (b2) for one dipole assembler. The profile geometry of the single collars - as determined from 3D measurements at the collar suppliers and CERN - could not account alone for the significant left â right aperture asymmetry observed. This triggered a deeper investigation on different elements of the geometry of single collars. The results of this work show that the relative positioning of the collaring holes, allowing a small bending deformation of collars under the effect of coil pre-stress, is an important effect that generates a b2 multipole at the limit of specification. The study has deepened the understanding of the factors affecting collared coil geometry and field quality. The precision of 3D m...
Postmortem findings in collared peccaries raised in captivity in northeastern Brazil
Directory of Open Access Journals (Sweden)
Jael S. Batista
2014-11-01
Full Text Available This study is a retrospective examination of diseases in collared peccaries that were diagnosed by the Veterinary Pathology Laboratory, Universidade Federal Rural do Semiárido. Necropsy and histological examination were performed from 2005 to 2010. Of the 50 necropsied collared peccaries, 24% died due to restraint and capture myopathy; 18% died from trauma; and the remainder was diagnosed with splenic hemangioma (6%, enterolithiasis (6%, gastritis (6%, gastric ulcer (4%, intestinal volvulus (4%, gastric volvulus (2%, mammary carcinoma (2%, polycystic kidney disease (2%, pyometra (2%, and suppurative bronchopneumonia (2%. Twelve animals remained undiagnosed, seven of which (14% were in advanced autolytic condition and five of which (10% had no gross or microscopic lesions that were compatible with disease. This paper describes illnesses that have not been reported in the collared peccary, focusing on their clinical and pathological aspects.
Occupational psychosocial hazards among the emerging U.S. green collar workforce
Fernandez, Cristina A.; Moore, Kevin; McClure, Laura A.; Caban-Martinez, Alberto J.; LeBlanc, William G.; Fleming, Lora E.; Cifuentes, Manuel; Lee, David J.
2016-01-01
Objective To compare occupational psychosocial hazards in green collar versus non-green collar workers. Methods Standard Occupational Classification codes were used to link the 2010 National Health Interview Survey to the 2010 Occupational Information Network Database. Multivariable logistic regressions were used to predict job insecurity, work-life imbalance, and workplace harassment in green versus non-green collar workers. Results Most participants were white, non-Hispanic, 25–64 years of age, and obtained greater than a high school education. The majority reported not being harassed at work, no work-life imbalance, and no job insecurity. Relative to non-green collar workers (n=12,217), green collar workers (n=2,588) were more likely to report job insecurity (OR=1.13; 95% CI=1.02–1.26) and work-life imbalance (1.19; 1.05–1.35), but less likely to experience workplace harassment (0.77; 0.62–0.95). Conclusions Continuous surveillance of occupational psychosocial hazards is recommended in this rapidly emerging workforce. PMID:28045790
Trunnion Collar Removal Machine - Gap Analysis Table
International Nuclear Information System (INIS)
Johnson, M.
2005-01-01
The purpose of this document is to review the existing the trunnion collar removal machine against the ''Nuclear Safety Design Bases for License Application'' (NSDB) [Ref. 10] requirements and to identify codes and standards and supplemental requirements to meet these requirements. If these codes and standards can not fully meet these requirements then a ''gap'' is identified. These gaps will be identified here and addressed using the ''Trunnion Collar Removal Machine Design Development Plan'' [Ref. 15]. The codes and standards, supplemental requirements, and design development requirements for the trunnion collar removal machine are provided in the gap analysis table (Appendix A, Table 1). Because the trunnion collar removal machine is credited with performing functions important to safety (ITS) in the NSDB [Ref. 10], design basis requirements are applicable to ensure equipment is available and performs required safety functions when needed. The gap analysis table is used to identify design objectives and provide a means to satisfy safety requirements. To ensure that the trunnion collar removal machine performs required safety functions and meets performance criteria, this portion of the gap analysis tables supplies codes and standards sections and the supplemental requirements and identifies design development requirements, if needed
Directory of Open Access Journals (Sweden)
Yu-Wei Chen
Full Text Available A high hemoglobin glycation index (HGI and glycated hemoglobin (HbA1c level are associated with greater inflammatory status, and dipeptidyl peptidase-4 (DPP-4 inhibitors can suppress inflammation. We aimed to evaluate the relationship between HGI and the therapeutic effect of DPP-4 inhibitors.This retrospective cohort study followed 468 patients with type 2 diabetes receiving DPP-4 inhibitor treatment for 1 year. Estimated HbA1c was calculated using a linear regression equation derived from another 2969 randomly extracted patients with type 2 diabetes based on fasting plasma glucose (FPG level. The subjects were divided into two groups based on HGI (HGI = observed HbA1c - estimated HbA1c. Mixed model repeated measures were used to compare the treatment efficacy after 1 year in patients with a low (HGI<0, n = 199 and high HGI (HGI≧0, n = 269.There were no significant group differences in mean changes of FPG after 1 year (-12.8 and -13.4 mg/dL in the low and high HGI groups, respectively. However, the patients with a high HGI had a significantly greater reduction in HbA1c from baseline compared to those with a low HGI (-1.9 versus -0.3% [-20.8 versus -3.3 mmol/mol]. Improvements in glycemic control were statistically significantly associated with the tested DPP-4 inhibitors in the high HGI group (-2.4, -1.4, -1.2 and -2.2% [-26.2, -15.3, -13.1 and -24.0 mmol/mol] for vildagliptin, linagliptin, saxagliptin and sitagliptin, respectively but not in the low HGI group.The HGI index derived from FPG and HbA1c may be able to identify who will have a better response to DPP-4 inhibitors.
Use of cervical collar after whiplash injuries.
Józefiak-Wójtowicz, Anna; Stolarczyk, Artur; Deszczyński, Jarosław Michał; Materek, Magdalena; Pietras, Marta; Bażant, Katarzyna
2014-08-08
Whiplash injuries, also known as neck sprains and strains, are currently some of the most common injuries of the cervical spine. Mechanism of injury is still controversial and current treatment methods do not provide satisfactory results. In this article we present QTF classification of related disorders, epidemiological data and treatment methods. We described basic principles of using a soft collar, goals and effects of collar use and potential complications ensuing from immobilization. Authors reviewed publications comparing the effects of collar use with other methods of treatment and physiotherapy following whiplash injury.
New pulsating casing collar to improve cementing quality
Energy Technology Data Exchange (ETDEWEB)
Chen, P. [Southwest Petroleum Inst., Nanchong, Sichuan (China); He, K. [JiangHan Petroleum Administration Bureau, Qianjiang, Hubei (China); Wu, J. [Chevron Petroleum Tech. Co., Houston, TX (United States)
1998-12-31
This paper presents the design and test results of a new pulsating casing collar which improves cementing quality. The new pulsating casing collar (PCC) is designed according to the Helmholtz oscillator to generate a pulsating jet flow by self-excitation in the cementing process. By placing this new pulsating casing collar at the bottom of casing string, the generated pulsating jet flow transmits vibrating pressure waves up through the annulus and helps remove drilling mud in the annulus. It can therefore improve cementing quality, especially when eccentric annulus exists due to casing eccentricity where the mud is difficult to remove. The new pulsating casing collar consists of a top nozzle, a resonant chamber, and a bottom nozzle. It can be manufactured easily and is easy to use in the field. It has been tested in Jianghan oil-field, P.R. China. The field-test results support the theoretical analysis and laboratory test, and the cementing quality is shown greatly improved by using the new pulsating casing collar.
Mechanical test results on Dipole model C-1 25 mm aluminum collars
International Nuclear Information System (INIS)
Peters, C.
1985-02-01
This report is a summary of procedures used in collaring the SSC Dipole model C-1. Included are descriptions of the collars, instrumentation, collar pack preparation, collaring procedures, and collar dimension and coil pressure data measurements taken during and testing of the magnet
Reducing Local Scouring at Bridge Piles Using Collars and Geobags
Directory of Open Access Journals (Sweden)
Shatirah Akib
2014-01-01
Full Text Available The present study examines the use of collars and geobags for reducing local scour around bridge piles. The efficiency of collars and geobags was studied experimentally. The data from the experiments were compared with data from earlier studies on the use of single piles with a collar and with a geobag. The results showed that using a combination of a steel collar and a geobag yields the most significant scour reduction for the front and rear piles, respectively. Moreover, the independent steel collar showed better efficiency than the independent geobag below the sediment level around the bridge piles.
Influence of Austenitic Steel Collar Dimensions on Magnetic Field Harmonics in the LHC Main Dipole
Bellesia, B; Todesco, Ezio
2005-01-01
The influence of the geometry of the collars in the main LHC dipole on the magnetic field harmonics is analyzed. The study aims at finding if the collar geometry is the driving mechanism of field quality for some harmonics and if the two different collar suppliers give a special signature on the magnetic field. Data of more than 700 magnets of the LHC series dipoles are analyzed and discussed. The main result of the analysis is that the collar shape is the driving mechanism of the magnetic field harmonics only for b2 and a3 in one of the three Cold Mass Assemblers (Firm3), where only collars of the supplier S2 are used. Two independent observations support this fact: firstly, strong correlations between apertures of the same magnet as expected from the assembly procedure have been found. Secondly, the expected values based on the measured dimensions of the collars and on a magneto-static model agree with magnetic measurements both for the average and for the standard deviation.
Horse-collar aurora: A frequent pattern of the aurora in quiet times
International Nuclear Information System (INIS)
Hones, E.W. Jr.; Craven, J.D.; Frank, L.A.; Evans, D.S.; Newell, P.T.
1989-01-01
Reported here are DE 1 auroral imager observations of an auroral configuration which is given the name ''horse-collar aurora.'' The horse-collar pattern comprises the total area of auroral emissions from a single hemisphere and derives its name from the shape of the emitting area. The pattern is found in images recorded during quiet geomagnetic conditions and is possibly related to the theta aurora, another quiet time configuration of the auroras. This initial report of the DE 1 observations illustrates the horse-collar aurora with a 2-hour images sequence that displays its basic features and shows an example of its evolution into a theta-like auroral pattern. The interplanetary magnetic field was northward during this image sequence and there is some evidence for IMF B/sub y/ influence of the temporal development of the horse-collar pattern. A preliminary statistical analysis found the horse-collar pattern appearing in one-third or more of image sequences recorded during quiet conditions; it did not appear during disturbed conditions. Further study is required to establish more fully the characteristics of the horse-collar aurora and to determine its implications concerning solar wind-magnetosphere coupling when the IMF B/sub z/ is northward. copyright American Geophysical Union 1989
[Health impact assessment of "white-collar exemption" in Japan].
Fujino, Yoshihisa; Matsuda, Shinya
2007-03-01
This work conducted a health impact assessment (HIA) of the Japanese Government's proposal concerning the introduction of so called "white-collar exemption" into the Japanese labor market. We adopted the Merseyside model and performed a rapid health impact assessment to assess the potential health effects of white-collar exemption. In this HIA, several health determinants which may possibly be affected, both positively and negatively, were identified based on experts' judgments. Literature evidence was assessed using PubMed and other databases. In addition, we searched for the opinions of those affected by white-collar exemption from internet web sites, and six concerns were identified. Long working hours were identified as the most serious concern by both experts and those affected. White-collar exemption may increase irregular working patterns which may be related to sleep disorder, stress, and cardiovascular disease. Family function and social participation will also be affected by irregular working patterns. On the other hand, in terms of stress, white-collar exemption may benefit from a higher degree of job control. There are possibilities that white-collar exemption may enable an improved work-life balance and enable access of some groups of the population, such as people with disabilities or parents looking after children, greater access to the labour market. However, it is uncertain whether the benefits of white-collar exemption would overcome those of the current free-time or flex-time systems. The present work provides a wide range of health impacts of white-collar exemption, and will hopefully attract the attentions of decision-makers and those likely to be affected in order to contribute to policy-making.
Sickness benefit cuts mainly affect blue-collar workers.
Aaviksoo, E; Kiivet, R-A
2014-08-01
To analyse the impact of sick-pay cuts on the use of sickness absence by employees of different socioeconomic groups. In 2009 cuts in sick pay were implemented in reaction to an economic crisis in Estonia. Nationwide health survey data from the years 2004, 2006, 2008, and 2010 were used to evaluate sickness absence among blue-collar and white-collar workers. The dataset comprised 7,449 employees of 20-64 years of age. Difference in prevalence of absentees before and after the reform was assessed using the chi-squared test. Odds ratios (OR) for sickness absence were calculated in a multivariate logistic regression model. After the reform, the proportion of blue-collar workers who had been on sick leave decreased from 51% to 40% (pgender, age, self-rated health, and presence of chronic disease, especially among those with low incomes; in white-collar employees it reached statistical significance only in those with good self-rated health (p=0.033). In a multivariate model the odds of having lower sickness absence were highly significant only in blue-collar employees (OR 0.63; 95% confidence interval 0.51-0.77, p<0.001). The cuts in sickness benefits had a major impact on the use of sickness absence by blue-collar employees with low salaries. This indicates that lower income was a major factor hindering the use of sick leave as these employees are most vulnerable to the loss of income. © 2014 the Nordic Societies of Public Health.
Testing VHF/GPS collar design and safety in the study of free-roaming horses.
Directory of Open Access Journals (Sweden)
Gail H Collins
Full Text Available Effective and safe monitoring techniques are needed by U.S. land managers to understand free-roaming horse behavior and habitat use and to aid in making informed management decisions. Global positioning system (GPS and very high frequency (VHF radio collars can be used to provide high spatial and temporal resolution information for detecting free-roaming horse movement. GPS and VHF collars are a common tool used in wildlife management, but have rarely been used for free-roaming horse research and monitoring in the United States. The purpose of this study was to evaluate the design, safety, and detachment device on GPS/VHF collars used to collect free-roaming horse location and movement data. Between 2009 and 2010, 28 domestic and feral horses were marked with commercial and custom designed VHF/GPS collars. Individual horses were evaluated for damage caused by the collar placement, and following initial observations, collar design was modified to reduce the potential for injury. After collar modifications, which included the addition of collar length adjustments to both sides of the collar allowing for better alignment of collar and neck shapes, adding foam padding to the custom collars to replicate the commercial collar foam padding, and repositioning the detachment device to reduce wear along the jowl, we observed little to no evidence of collar wear on horses. Neither custom-built nor commercial collars caused injury to study horses, however, most of the custom-built collars failed to collect data. During the evaluation of collar detachment devices, we had an 89% success rate of collar devices detaching correctly. This study showed that free-roaming horses can be safely marked with GPS and/or VHF collars with minimal risk of injury, and that these collars can be a useful tool for monitoring horses without creating a risk to horse health and wellness.
A Collar for Marking Big Game Animals
Robert L. Phillips
1970-01-01
A Simple, inexpensive collar made of Armor-tite (a vinyl-coated nylon fabric) was designed for marking white-tailed deer (Odocoileus virginianus) and moose (Alces alces). Field tests showed that the material is easily seen and extrememly durable. It may be suitable for use on other large mammals. The collar can be quickly fitted to individual animals under field...
Seitsamo, Jorma; von Bonsdorff, Monika E; Ilmarinen, Juhani; Nygård, Clas-Håkan; Rantanen, Taina
2012-01-01
Objectives To investigate the effect of job demand, job control and job strain on total mortality among white-collar and blue-collar employees working in the public sector. Design 28-year prospective population-based follow-up. Setting Several municipals in Finland. Participants 5731 public sector employees from the Finnish Longitudinal Study on Municipal Employees Study aged 44–58 years at baseline. Outcomes Total mortality from 1981 to 2009 among individuals with complete data on job strain in midlife, categorised according to job demand and job control: high job strain (high job demands and low job control), active job (high job demand and high job control), passive job (low job demand and low job control) and low job strain (low job demand and high job control). Results 1836 persons died during the follow-up. Low job control among men increased (age-adjusted HR 1.26, 95% CI 1.12 to 1.42) and high job demand among women decreased the risk for total mortality HR 0.82 (95% CI 0.71 to 0.95). Adjustment for occupational group, lifestyle and health factors attenuated the association for men. In the analyses stratified by occupational group, high job strain increased the risk of mortality among white-collar men (HR 1.52, 95% CI 1.09 to 2.13) and passive job among blue-collar men (HR 1.28, 95% CI 1.05 to 1.47) compared with men with low job strain. Adjustment for lifestyle and health factors attenuated the risks. Among white-collar women having an active job decreased the risk for mortality (HR 0.78, 95% CI 0.60 to 1.00). Conclusion The impact of job strain on mortality was different according to gender and occupational group among middle-aged public sector employees. PMID:22422919
Increased Executive Functioning, Attention, and Cortical Thickness in White-Collar Criminals
Raine, Adrian; Laufer, William S.; Yang, Yaling; Narr, Katherine L.; Thompson, Paul; Toga, Arthur W.
2011-01-01
Very little is known on white collar crime and how it differs to other forms of offending. This study tests the hypothesis that white collar criminals have better executive functioning, enhanced information processing, and structural brain superiorities compared to offender controls. Using a case-control design, executive functioning, orienting, and cortical thickness was assessed in 21 white collar criminals matched with 21 controls on age, gender, ethnicity, and general level of criminal offending. White collar criminals had significantly better executive functioning, increased electrodermal orienting, increased arousal, and increased cortical gray matter thickness in the ventromedial prefrontal cortex, inferior frontal gyrus, somatosensory cortex, and the temporal-parietal junction compared to controls. Results, while initial, constitute the first findings on neurobiological characteristics of white-collar criminals It is hypothesized that white collar criminals have information-processing and brain superiorities that give them an advantage in perpetrating criminal offenses in occupational settings. PMID:22002326
Study of the pseudo-ternary Ag2SAs2S3HgI2 vitreous system
Boidin, R.; Le Coq, D.; Cuisset, A.; Hindle, F.; Brubach, J.-B.; Michel, K.; Bychkov, E.
2013-03-01
Chalcogenide alloys in the Ag2SAs2S3HgI2 pseudo-ternary system were synthesized and their vitreous nature was verified by X-ray diffraction. The glass transition and crystallization temperatures (Tg and Tc), the density (d), and the total electrical conductivity (σ) were measured for all samples of three series, A, B, and C corresponding to (Ag2S)50-x/2(As2S3)50-x/2(HgI2)x, (Ag2S)y(As2S3)80-y(HgI2)20 and (Ag2S)z(As2S3)50(HgI2)50-z, respectively. The maximum of Tg was approximately 160 °C for glasses with low HgI2 content whereas the maximum of density (5.75 g cm-3) was obtained for the sample in the B-series with the highest Ag2S concentration (z=60 mol%). This composition also possesses the highest conductivity at 298 K (σ298 K≈10-3 S cm-1). Unexpectedly the conductivity of the A-series samples was observed to decrease as a function of the Ag2S content. The far-infrared transmission in the 100-600 cm-1 window range (3.3-18.2 THz, 100-16.6 μm) was also given for a few glass compositions highlighting the strong influence of the HgI2 content.
Schwensen, Jakob F; Menné, Torkil; Veien, Niels K; Funding, Anne T; Avnstorp, Christian; Østerballe, Morten; Andersen, Klaus E; Paulsen, Evy; Mørtz, Charlotte G; Sommerlund, Mette; Danielsen, Anne; Andersen, Bo L; Thormann, Jens; Kristensen, Ove; Kristensen, Berit; Vissing, Susanne; Nielsen, Niels H; Thyssen, Jacob P; Johansen, Jeanne D
2014-12-01
Blue-collar workers have a high risk of occupational contact dermatitis, but epidemiological studies are scarce. To investigate allergic contact dermatitis in blue-collar workers with dermatitis registered by the Danish Contact Dermatitis Group. A retrospective analysis of patch test data from 1471 blue-collar workers and 1471 matched controls tested between 2003 and 2012 was performed. A logistic regression was used to test for associations. The blue-collar workers often had occupational hand dermatitis (p dermatitis was less commonly observed among blue-collar workers (19.6%) than among controls (23.9%) (p = 0.005). Allergens with a statistically significant association with the occupational group of blue-collar workers were epoxy resins, methyldibromo glutaronitrile, 2-bromo-2-nitro-1,3-propanediol, potassium dichromate, and methylchloroisothiazolinone (MCI)/methylisothiazolinone (MI). The following occupations were additionally identified as risk factors for contact sensitization to MCI/MI and MI, epoxy resins, and potassium dichromate, respectively: painting, construction work, and tile setting/terrazzo work. Contact allergy is a major problem among blue-collar workers. The data indicate a healthy worker effect among blue-collar workers diagnosed with dermatitis, as blue-collar workers were diagnosed significantly less often with atopic dermatitis than were controls. © 2014 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
Tribological characterization of the drill collars and casing friction couples
Ripeanu, R. G.; Badicioiu, M.; Caltaru, M.; Dinita, A.; Laudacescu, E.
2018-01-01
Drill collars are special pipes used in the drilling of wells for weighting the drill bit, enabling it to drill through the rock. In the drilling process, the drill collars are exposed to an intensive wear due to friction on inner surface of casing wall. In order to evaluate the tribological behaviour of this friction couple, paper presents the drill collars parent material, reconditioned and casing pipe chemical composition, microstructures, hardness and friction tests. For friction tests were prepared samples extracted from new and reconditioned drill collars and from casing pipes and tested on a universal tribometer. Were used plane-on-disk surface friction couples and tests were conducted at two sliding speeds and three normal loads for each materials couple. Plane static partner samples were extracted from casing pipes and disks samples were extracted from new and reconditioned drill collars. Were obtained friction coefficients values and also the temperatures increasing values due to friction working tests parameters. The temperature increasing values were obtained by measuring it with an infrared thermographic camera.
Küchler, N.; Kneifel, S.; Kollias, P.; Loehnert, U.
2017-12-01
Cumulus and stratocumulus clouds strongly affect the Earth's radiation budget and are a major uncertainty source in weather and climate prediction models. To improve and evaluate models, a comprehensive understanding of cloud processes is necessary and references are needed. Therefore active and passive microwave remote sensing of clouds can be used to derive cloud properties such as liquid water path and liquid water content (LWC), which can serve as a reference for model evaluation. However, both the measurements and the assumptions when retrieving physical quantities from the measurements involve uncertainty sources. Frisch et al. (1998) combined radar and radiometer observations to derive LWC profiles. Assuming their assumptions are correct, there will be still uncertainties regarding the measurement setup. We investigate how varying beam width, temporal and vertical resolutions, frequency combinations, and beam overlap of and between the two instruments influence the retrieval of LWC profiles. Especially, we discuss the benefit of combining vertically, high resolved radar and radiometer measurements using the same antenna, i.e. having ideal beam overlap. Frisch, A. S., G. Feingold, C. W. Fairall, T. Uttal, and J. B. Snider, 1998: On cloud radar and microwave radiometer measurements of stratus cloud liquid water profiles. J. Geophys. Res.: Atmos., 103 (18), 23 195-23 197, doi:0148-0227/98/98JD-01827509.00.
A self-adjusting expandable GPS collar for male elk
Brian L. Dick; Scott L. Findholt; Bruce K. Johnson
2013-01-01
It is a challenge to use collars on male cervids because their neck size can increase substantially during the rut and also because of growth as the animal matures. We describe how to build a self-adjusting expandable collar for yearling or adult male Rocky Mountain elk (Cervus elaphus) to which very high frequency transmitters and global...
A comparative study of the effect of soft and hard cervical collars on static postural
Directory of Open Access Journals (Sweden)
Minoo Khalkhali Zavieh
2013-01-01
Full Text Available AbstractBackground and Aim: Using cervical collars is one of the treatment methods for releaving cervical pain. The effect of limb orthotics on proprioception and postural stability has been suggested. There is not sufficient studies about the effect of cervical collars on static and dynamic stability, and the effect of soft and hard collars have not been compared with one another. The objective of this study is investigating and comparing the immediate effect of soft and hard cervical collars on static postural stability in healthy young subjects. Methods & Materials: In standing position on firm surface with closed eyes, both soft and hard collars decreased the stability and there was not any significant difference among collars. In standing positions on soft surface with closed and opened eyes, using none of the soft and hard collars did not change the stability. This quasi experimental study through repeated measure method has been conducted on 65 healthy young male and female college students. Static stability was evaluated by modified Clinical Test for Sensory Interaction and Balance (CTSIB in conditions without collar and by soft and hard cervical collars and were compared between the conditions. Results: Conclusion: Our results suggest that in static conditions, without vision, both collars decrease the stability in healthy young subjects. So considering the evaluation of stability and prevention of balance disturbance during the collar prescription seems to be necessary.
Directory of Open Access Journals (Sweden)
Vesna Kondrič Horvat
1993-12-01
Full Text Available In seiner Rede Emigranten, die er 1958 anläßlich der Georg-BtichnerPreis- Verleihung hielt und woraus das Titelzitat des vorliegenden Beitrags stammt, äußerte Max Frisch die Meinung, jeder frei gewahlte Wohnsitz solle dem Schriftsteller das unausgesprochene Gefühl der Unzugehörigkeit gestatten. Mit dem Satz: "Ich bin nicht Stiller!" (St 9 beginnt Frisch seinen 1954 veröffentlichten Roman Stiller. Ein Mann - ein Bildhauer -, der viele Versuche unternommen hat, seiner 'eigentlichen ', seelisch-existentiellen Identität zu entgehen, flieht schlieBlich, als alle anderen Versuche (sich im Spanischen Bürgerkrieg als ein mutiger Mann, sich in der Ehe als ein idealer Mann, sich in der Kunst als erfolgreicher Bildhauer zu bewahren scheitern, nach Amerika und läßt seine lungenkranke Frau Julika im Sanatorium in Davos zurück. Nach mehr als sechsjahrigem Fernbleiben kehrt er unter anderem Namen in die Heimat zurück und wird an der Schweizer Grenze - wegen vermeintlicher Verwicklung in eine Spionage-Affäre - verhaftet. An diesem Punkt beginnt der Roman.
LHC collars - 12 million high technology gems
2001-01-01
Some 12 million steel collars will keep the LHC dipole magnet structures rigid. Their production has just begun. A huge job began last week: the high speed manufacturing of twelve million steel collars for the 1250 dipole magnets of the future Large Hadron Collider, LHC. The challenge is not only a matter of quantity: these collars are very high technology components because of the important role they play in the way the collider works. One of the main difficulties with the accelerator is that the magnetic field that keeps particles in orbit must have the same configuration and intensity in all the dipoles. But when the 8.33 tesla magnetic field is on -100.000 times the earth magnetic field - it produces a very strong force that can deform the 'soft' parts of the magnets, such as superconducting coils. The force loading one metre of dipole is almost comparable with the weight of a Boeing 747 - about 400 tonnes - so a huge deformation would occur without a mechanical component to keep the whole structure rigid...
Augmented collar for assistance dog
Lemasson , Germain; Lucidarme , Philippe; Pesty , Sylvie; Duhaut , Dominique
2014-01-01
In this paper we present briefly our reflexion on how to communicate with a dog using embedded devices. We also present the prototype collar we made in order to improve the communication between an assistance dog and his disabled master.
Chang, Huan-Cheng; Wang, Mei-Chin; Liao, Hung-Chang; Cheng, Shu-Fang; Wang, Ya-Huei
2016-07-13
Since 1989, blue-collar foreign workers have been permitted to work in Taiwanese industries. Most blue-collar foreign workers apply for jobs in Taiwan through blue-collar foreign workers' agencies. Because blue-collar foreign workers are not familiar with the language and culture in Taiwan, in occupational accident education and hazard prevention, the agencies play an important role in the coordination and translation between employees and blue-collar foreign workers. The purpose of this study is to establish the agencies' role in the occupational accidents education and hazard prevention for blue-collar foreign workers in Taiwan. This study uses a qualitative method-grounded theory-to collect, code, and analyze the data in order to understand the agencies' role in occupational accident education and hazard prevention for blue-collar foreign workers in Taiwan. The results show that the duty of agencies in occupational accident education and hazard prevention includes selecting appropriate blue-collar foreign workers, communicating between employees and blue-collar foreign workers, collecting occupational safety and health information, assisting in the training of occupational safety and health, and helping blue-collar foreign workers adapt to their lives in Taiwan. Finally, this study suggests seven important points and discusses the implementation process necessary to improve governmental policies. The government and employees should pay attention to the education/training of occupational safety and health for blue-collar foreign workers to eliminate unsafe behavior in order to protect the lives of blue-collar foreign workers.
Directory of Open Access Journals (Sweden)
Huan-Cheng Chang
2016-07-01
Full Text Available Since 1989, blue-collar foreign workers have been permitted to work in Taiwanese industries. Most blue-collar foreign workers apply for jobs in Taiwan through blue-collar foreign workers’ agencies. Because blue-collar foreign workers are not familiar with the language and culture in Taiwan, in occupational accident education and hazard prevention, the agencies play an important role in the coordination and translation between employees and blue-collar foreign workers. The purpose of this study is to establish the agencies’ role in the occupational accidents education and hazard prevention for blue-collar foreign workers in Taiwan. This study uses a qualitative method—grounded theory—to collect, code, and analyze the data in order to understand the agencies’ role in occupational accident education and hazard prevention for blue-collar foreign workers in Taiwan. The results show that the duty of agencies in occupational accident education and hazard prevention includes selecting appropriate blue-collar foreign workers, communicating between employees and blue-collar foreign workers, collecting occupational safety and health information, assisting in the training of occupational safety and health, and helping blue-collar foreign workers adapt to their lives in Taiwan. Finally, this study suggests seven important points and discusses the implementation process necessary to improve governmental policies. The government and employees should pay attention to the education/training of occupational safety and health for blue-collar foreign workers to eliminate unsafe behavior in order to protect the lives of blue-collar foreign workers.
Sutton, April; Bosky, Amanda; Muller, Chandra
2016-08-01
Tensions between the demands of the knowledge-based economy and remaining, blue-collar jobs underlie renewed debates about whether schools should emphasize career and technical training or college-preparatory curricula. We add a gendered lens to this issue, given the male-dominated nature of blue-collar jobs and women's greater returns to college. Using the ELS:2002, this study exploits spatial variation in school curricula and jobs to investigate local dynamics that shape gender stratification. Results suggest a link between high school training and jobs in blue-collar communities that structures patterns of gender inequality into early adulthood. Although high school training in blue-collar communities reduced both men's and women's odds of four-year college enrollment, it had gender-divergent labor market consequences. Men in blue-collar communities took more blue-collar courses, had higher rates of blue-collar employment, and earned similar wages relative to otherwise comparable men from non-blue-collar communities. Women were less likely to work and to be employed in professional occupations, and they suffered severe wage penalties relative to their male peers and women from non-blue-collar communities. These relationships were due partly to high schools in blue-collar communities offering more blue-collar and fewer advanced college-preparatory courses. This curricular tradeoff may benefit men, but it appears to disadvantage women.
Sedentary Behavior of White Collar Office Workers-Review
Hopkin, T. J.; Sarkar, Swarjit
2016-01-01
Aim The aim of this systematic review is to evaluate the physical activity time (PAT) of white collar office workers in order to assess the levels of sedentary activity in an office environment. Analysing the office workers PAT will not only allow an insight into how an office based job could impact a person’s overall health and wellness status, but will also allow for the development of future office based inter ventions aimed at increasing the overall physical activity among white collar of...
Dependence of Magnetic Field Quality on Collar Supplier and Dimensions in the Main LHC Dipole
Bellesia, B; Santoni, C; Todesco, E
2006-01-01
In order to keep the electro-magnetic forces and to minimize conductor movements, the superconducting coils of the main Large Hadron Collider dipoles are held in place by means of austenitic steel collars. Two suppliers provide the collars necessary for the whole LHC production, which has now reached more than 800 collared coils. In this paper we first assess if the different collar suppliers origin a noticeable difference in the magnetic field quality measured at room temperature. We then analyze the measurements of the collar dimensions carried out at the manufacturers, comparing them to the geometrical tolerances. Finally we use a magneto-static model to evaluate the expected spread in the field components induced by the actual collar dimensions. These spreads are compared to the magnetic measurements at room temperature over the magnet production in order to identify if the collars, rather than other components or assembly process, can account for the measured magnetic field effects. It has been found tha...
Performance of novel materials for radiation detection: Tl3AsSe3, TlGaSe2, and Tl4HgI6
International Nuclear Information System (INIS)
Kahler, D.; Singh, N.B.; Knuteson, D.J.; Wagner, B.; Berghmans, A.; McLaughlin, S.; King, M.; Schwartz, K.; Suhre, D.; Gotlieb, M.
2011-01-01
In this paper we report on the electrical characteristics of three novel ternary compounds, Tl 3 AsSe 3 (TAS), TlGaSe 2 (TGS), and Tl 4 HgI 6 (THI), pertaining to their use as radiation detectors. The details for growth and material characterization are not presented. A semiconductor based gamma ray detector requires a material with high Z, high density, high resistivity, appropriate bandgap (1.5-2 eV), low energy/electron-hole pair, and a high μτ product. CZT is currently the best semiconductor material for room temperature gamma ray spectroscopy; however, it is extremely difficult to produce large volumes of detector grade material, making it expensive and in limited supply. DNDO/DHS began searching for other materials that might perform as well as CZT but be easier to grow and in the end lower the cost. For this purpose, we investigated the above three materials as possible replacements for CZT as gamma ray detectors. The bulk resistivity, I-V curves, X-ray response, and gamma ray response measurements for doped and undoped crystals are presented and discussed. TAS shows good X-ray and gamma ray response, but has poor resistivity, which results in large dark current and poor spectral response. TGS has good resistivity, but shows poor X-ray and gamma ray response. THI has excellent resistivity, shows some X-ray and gamma ray response, and has great potential as a gamma ray detector.
Simulations of a PSD Plastic Neutron Collar for Assaying Fresh Fuel
Energy Technology Data Exchange (ETDEWEB)
Hausladen, Paul [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Newby, Jason [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); McElroy, Robert Dennis [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)
2016-11-01
The potential performance of a notional active coincidence collar for assaying uranium fuel based on segmented detectors constructed from the new PSD plastic fast organic scintillator with pulse shape discrimination capability was investigated in simulation. Like the International Atomic Energy Agency's present Uranium Neutron Collar for LEU (UNCL), the PSD plastic collar would also function by stimulating fission in the 235U content of the fuel with a moderated 241Am/Li neutron source and detecting instances of induced fission via neutron coincidence counting. In contrast to the moderated detectors of the UNCL, the fast time scale of detection in the scintillator eliminates statistical errors due to accidental coincidences that limit the performance of the UNCL. However, the potential to detect a single neutron multiple times historically has been one of the properties of organic scintillator detectors that has prevented their adoption for international safeguards applications. Consequently, as part of the analysis of simulated data, a method was developed by which true neutron-neutron coincidences can be distinguished from inter-detector scatter that takes advantage of the position and timing resolution of segmented detectors. Then, the performance of the notional simulated coincidence collar was evaluated for assaying a variety of fresh fuels, including some containing burnable poisons and partial defects. In these simulations, particular attention was paid to the analysis of fast mode measurements. In fast mode, a Cd liner is placed inside the collar to shield the fuel from the interrogating source and detector moderators, thereby eliminating the thermal neutron flux that is most sensitive to the presence of burnable poisons that are ubiquitous in modern nuclear fuels. The simulations indicate that the predicted precision of fast mode measurements is similar to what can be achieved by the present UNCL in thermal mode. For example, the
Factors associated with blue-collar workers' risk perception of cardiovascular disease.
Hwang, Won Ju; Hong, Oisaeng; Kim, Mi Ja
2012-12-01
The purpose of this study was to investigate the contribution of actual cardiovascular disease (CVD) risk, as well as, individual, psychosocial, and work-related factors as predictors of CVD risk perception among Korean blue-collar workers. The participants were 238 Korean blue-collar workers who worked in small companies. Data were collected through a survey; anthropometric and blood pressure measures; and blood sampling for lipid levels. Blue-collar workers had high actual CVD risk and low CVD risk perception. The significant predictors of risk perception included perceived health status, alcohol consumption, knowledge of CVD risk, actual CVD risk, decision latitude, and shift work. The model explained 26% of the variance in CVD risk perception. The result suggests when occupational health nurses are giving routine health examination in small companies, they can enhance CVD risk perception in blue-collar workers by providing essential information about CVD risk factors and personal counseling on the individual worker's CVD risk status.
Criminal Trajectories of White-collar Offenders
van Onna, J.; van der Geest, V.R.; Huisman, W.; Denkers, A.J.M.
2014-01-01
Objectives:This article analyzes the criminal development and sociodemographic and criminal profile of a sample of prosecuted white-collar offenders. It identifies trajectory groups and describes their profiles based on crime, sociodemographic, and selection offence characteristics.Methods:The
Williams, Orla; Eastwick, Carol; Kingman, Sam; Giddings, Donald; Lormor, Stephen; Lester, Edward
2015-01-01
With increasing quantities of biomass being combusted in coal fired power stations, there is an urgent need to be able to predict the grindability of biomass in existing coal mills, but currently no standard biomass grindability test exists. In this study, the applicability of the Hardgrove Grindability Index (HGI) and Bond Work Index (BWI) as standard grindability tests for biomass were investigated for commercially sourced wood pellets, steam exploded pellets, torrefied pellets, sunflower p...
Neutron Collar Evolution and Fresh PWR Assembly Measurements with a New Fast Neutron Passive Collar
Energy Technology Data Exchange (ETDEWEB)
Menlove, Howard Olsen [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Geist, William H. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Root, Margaret A. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Rael, Carlos D. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Belian, Anthony P. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2017-11-02
The passive neutron collar approach removes the effect of poison rods when using a 1mm Gd liner. This project sets out to solve the following challenges: BWR fuel assemblies have less mass and less neutron multiplication than PWR; and effective removal of cosmic ray spallation neutron bursts needed via QC tests.
Advantages of heavy metal collars in directional drilling and deviation control
International Nuclear Information System (INIS)
Bradley, W.B.; Murphey, C.E.; McLamore, R.T.; Dickson, L.L.
1976-01-01
A heavy, stiff-bottom drill collar can substantially improve deviation performance, theoretically increasing penetration rates by 50 to 100 percent in deviation-prone areas. This paper presents the underlying theory, practical charts on performance characteristics, and Shell Development Co.'s experience in fabricating and field testing two depleted-uranium alloy, heavy metal collars
Directory of Open Access Journals (Sweden)
Fikret Ateş
2014-06-01
Full Text Available The purpose of this study is to examine perception of inequality and types of reaction of white and blue collar workers. The research was conducted over 120 white collar and 159 blue collar workers in an academic institution. It was determined with correlation analysis whether there is a relation between perception of inequality and reaction towards it for two groups. A significant and positive relation has been found between inequality perceptions and reaction towards inequality of blue collar workers. No significant relation has been found for white collar workers. Factor analysis was used to determine the dimensions of inequality perceptions andreactions towards inequality of blue and white collar workers. Results show that inequality perceptions and types of reactions towards inequality differ in terms of dimensions. Equity perceptions of blue collar workers are mostly based on comparisons with colleagues and nepotist behavior of their managers. White collar workers show sensitivity to the issues like salary, promotion and status. Blue collar workers prefer to report or to persuade their managers when they face with inequality. White collar workers decide to show their reactions by using more political methods.
Directory of Open Access Journals (Sweden)
Hans De Witte
2007-04-01
adopted the attitudes (and life style of white collar workers, from whom they can no longer be distinguished. Lipset’s hypothesis of the ‘authoritarianism of the working class’, on the other hand, states that blue collar workers more strongly endorse a conservative attitude on socio-cultural matters and a progressive stand concerning socio-economic issues. Both hypotheses are tested using data from a small scale survey (N = 135 among unskilled blue collar workers and lower- and mid-level white collar workers from different large companies in the region of Leuven, Belgium. The results indicate that the interviewed unskilled blue collar workers still hold a set of attitudes that distinguishes them from the interviewed white collar workers. So, the ‘embourgeoisement’ thesis was refuted. Instead, the unskilled blue collar workers were more conservative on a socio-cultural level, and more progressive concerning socio-economic issues. These results are in line with Lipset’s ‘authoritarianism of the working class’ hypothesis.
HDM model magnet mechanical behavior with high manganese steel collars
International Nuclear Information System (INIS)
Snyder, J.R.
1994-01-01
Westinghouse Electric Corporation (WEC) is presently under contract to the SSCL to design, develop, fabricate, and deliver superconducting dipole magnets for the High Energy Booster (HEB). As a first step toward these objectives SSCL supplied a design for short model magnets of 1.8 m in length (DSB). This design was used as a developmental tool for all phases of engineering and fabrication. Mechanical analysis of the HDM (High Energy Booster Dipole Magnets) model magnet design as specified by SSCL was performed with the following objectives: (1) to develop a thorough understanding of the design; (2) to review and verify through analytical and numerical analyses the SSCL model magnet design; (3) to identify any deficiencies that would violate design parameters specified in the HDM Design Requirements Document. A detailed analysis of the model magnet mechanical behavior was pursued by constructing a quarter section finite element model and solving with the ANSYS finite element code. Collar materials of Nitronic-40 and High-Manganese steel were both considered for the HEB model magnet program with the High-Manganese being the final selection. The primary mechanical difference in the two materials is the much lower thermal contraction of the High-Manganese steel. With this material the collars will contract less than the enclosing yoke producing an increased collar yoke interference during cooldown
White-collar crime: corporate and securities and commodities fraud.
Price, Marilyn; Norris, Donna M
2009-01-01
In this era of increased interest in white-collar crime, forensic psychiatrists are in a key position to study the individual characteristics of offenders. While a comprehensive theory of high-level white-collar crime should consider societal and organizational contributions, there is value in understanding the personal traits that place an individual at high risk for offending. As the impact of the criminal acts of this group has been increasingly felt by larger groups from all socioeconomic strata, there is less willingness by the public to view these crimes as victimless and harmless.
Energy Technology Data Exchange (ETDEWEB)
1969-04-09
A well swab collar which can be hoisted to bring well fluids upward through a pipe string is described. An elastic swab is used to swab a pipe having a predetermined diameter. The swab consists of a circular shaped elastomer body having an outer diameter a little smaller than the inner diameter of the pipe. The body is divided into multiple swab elements by ring-shaped grooves in the body. The swab element has truncated conical surfaces directed radially at an outward angle, then downward and consequently at an angle inward and then downward. (19 claims)
White-Collar Crimes and Financial Corruptions
Directory of Open Access Journals (Sweden)
Fatih ŞENTÜRK
2013-12-01
Full Text Available Crime, defined as act which is contrary to the law, creates negative influence in the society both economically and spiritually. There are various factors like professional experience as well as biological, psychological and sociological ones that make individuals turn to crime. Edwin Sutherland claim that life experiences and some facts learned from the environment account for occupational crimes in his study on the theory of crime in 1939. White-collar crime, which is perhaps the most important of types of crime in terms of havoc and committed by the superior contrary to common belief, has much more influence than conventional crime. This crime, which inflict significant financial loses and psychological collapse on states, communities, businesses and people, are committed by well-respected professionals in their business. In this study, white collar crimes are examined with conceptual view and detailed. Besides, this study explain this type of crime is so forceful, by giving remarkable examples on economic losses.
Hypospadias repair with the glanular-frenular collar (GFC) technique.
Özbey, Hüseyin; Etker, Şeref
2017-02-01
In the normal human penis, the glans wings merge in the midline ventrally, but are separated by the 'septum glandis' in conjunction with the frenulum. The frenulum is also included in the formation of the distal (glanular and subcoronal) urethra, which has a special part known as the 'fossa navicularis'. This has inspired a hypospadias repair technique that simulates the development of the glanular and subcoronal urethra, which can be incorporated into the repair of all cases of hypospadias. A total of 121 patients with varying degrees of hypospadias underwent surgery with the described technique: a Y-V plasty was used to dissect the inner foreskin, in a fashion that allowed for its ventral mobilization as a frenular mucosal collar. After tubularization of the proximal urethra, a partial spongioplasty was performed that extended up to the subcoronal level. The glans wings were approximated only at their outermost convexities, with a couple of subepithelial sutures, leaving a slit for the meatus. The cleft-like area between the split wings of the glans penis was filled with the terminal ends of the spongiosum and the dartos of the mucosal collar, which converged to form a septum and a neo-frenulum (glanular-frenular collar, GFC). The midline skin closure of the ventral collar and the circumferential foreskin closure was completed as usual. At a mean follow-up of 10 months, two patients developed urethral fistula (2%), six had meatal stenosis (5%), and two had glans dehiscence (2%) that resulted in meatal retraction. Overall, patients had a cosmetically satisfying appearance (Figure). Forty-one received secondary circumcision; the parents of 80 (66%) patients were satisfied with the final foreskin appearance obtained with this method. The split wings of the glans penis or so-called ventral cleft between the glans wings that accommodate the frenulum is part of normal anatomy. Hence, in hypospadias surgery, the approximated glans wings should allow for ventral support
Energy Technology Data Exchange (ETDEWEB)
Bennett, K.; Biggs, J.; Fresquez, P.R.
1997-02-01
In 1996, a study was initiated to assess seasonal habitat use and movement patterns of Rocky Mountain elk (Cervus elaphus nelsoni) using global positioning system (GPS) radio collars. As part of this study, the authors attempted to assess the accuracies of GPS (non-differentially corrected) positions under various vegetation canopies and terrain conditions with the use of a GPS ``test`` collar. The test collar was activated every twenty minutes to obtain a position location and continuously uplinked to Argos satellites to transfer position data files. They used a Telonics, Inc. uplink receiver to intercept the transmission and view the results of the collar in real time. They placed the collar on a stand equivalent to the neck height of an adult elk and then placed the stand within three different treatment categories: (1) topographical influence (canyon and mesa tops), (2) canopy influence (open and closed canopy), and (3) vegetation type influence (ponderosa pine and pinion pine-juniper). The collar was kept at each location for one hour (usually obtaining three fixes). In addition, the authors used a hand-held GPS to obtain a position of the test collar at the same time and location.
Mind over matter: exploring job stress among female blue-collar workers.
Griffin-Blake, C Shannon; Tucker, Pattie J; Liburd, Leandris
2006-12-01
Although overall health has been defined holistically as the integration of a person's optimal mental, physical, social, intellectual, and spiritual well-being, a mental health focus remains on the fringe of many public health efforts. This report describes recent efforts by the Centers for Disease Control and Prevention (CDC) to explore job stress among female blue-collar workers. Using a more holistic approach to understand its impact on blue-collar women's overall health, health-related quality of life (HRQOL) was used to assess optimal human performance. Attempting to encapsulate how overall health affects one's ability to participate and fulfill daily personal/professional tasks, HRQOL yields a broader understanding of the interaction between psychological well-being (mind) and physical functioning (matter). Embedding CDC HRQOL-4 measures into a questionnaire used as part of a larger mixed methods project, blue-collar women responded to questions about their health, including both mental and physical. For these female workers, mental health appeared to be of greater consequence, which could be interpreted as mind being more significant than matter. This paper highlights the findings related to HRQOL issues experienced by these female blue-collar workers and summarizes recommendations for effective individual and organizational approaches to address job stress.
Fourie, Josephus J; Crafford, Dionne; Horak, Ivan G; Stanneck, Dorothee
2012-07-27
The objective of the study was to determine the sustained effectiveness of 10% imidacloprid (w/w) and 4.5% flumethrin (w/w) incorporated in a slow-release matrix collar in preventing Dipylidium caninum infection in cats following repeated laboratory-infestations with fleas infected with metacestodes. Efficacy against infection with D. caninum was evaluated by infesting 16 cats with the flea Ctenocephalides felis felis infected with metacestodes of the tapeworm. Medicated collars were fitted to 8 of the cats and infestation of each cat with 200 fleas from a suitably infected batch commenced 7 days later and continued at weekly intervals until Day 28. Efficacy against fleas was evaluated 24 h after each infestation. Infection of the cats with D. caninum was verified by daily examination of the cats' faeces and immediate surroundings for proglottids from Day 21 to Day 60. Calculation of the prophylactic effectiveness of the collars in preventing infection of the cats with D. caninum was based on the difference in the geometric mean number of scoleces recovered from the gastrointestinal tracts of collared compared to untreated cats at necropsy on Day 61. Efficacy of the collars against infestation of the cats with fleas was 99.9% on Day 7 and 100% at each subsequent weekly assessment. Infection of the fleas with metacestodes was ≥40% in 7 to 13 day old fleas, but progressively decreased thereafter. At necropsy all the control cats were infected with D. caninum and harboured between 19 and 346 scoleces with a geometric mean of 58.3. A single treated cat was infected and harboured 2 scoleces. Effective prevention of infection with D. caninum, based on a comparison of the geometric mean numbers of scoleces recovered from control and treated cats, was 99.7%. The insecticidal components of the medicated collars are capable of rapidly eliminating newly-acquired infestations of fleas that are infected with the metacestodes of D. caninum, thus preventing infection with the
Directory of Open Access Journals (Sweden)
Fourie Josephus J
2012-07-01
Full Text Available Abstract Background The objective of the study was to determine the sustained effectiveness of 10% imidacloprid (w/w and 4.5% flumethrin (w/w incorporated in a slow-release matrix collar in preventing Dipylidium caninum infection in cats following repeated laboratory-infestations with fleas infected with metacestodes. Methods Efficacy against infection with D. caninum was evaluated by infesting 16 cats with the flea Ctenocephalides felis felis infected with metacestodes of the tapeworm. Medicated collars were fitted to 8 of the cats and infestation of each cat with 200 fleas from a suitably infected batch commenced 7 days later and continued at weekly intervals until Day 28. Efficacy against fleas was evaluated 24 h after each infestation. Infection of the cats with D. caninum was verified by daily examination of the cats’ faeces and immediate surroundings for proglottids from Day 21 to Day 60. Calculation of the prophylactic effectiveness of the collars in preventing infection of the cats with D. caninum was based on the difference in the geometric mean number of scoleces recovered from the gastrointestinal tracts of collared compared to untreated cats at necropsy on Day 61. Results Efficacy of the collars against infestation of the cats with fleas was 99.9% on Day 7 and 100% at each subsequent weekly assessment. Infection of the fleas with metacestodes was ≥40% in 7 to 13 day old fleas, but progressively decreased thereafter. At necropsy all the control cats were infected with D. caninum and harboured between 19 and 346 scoleces with a geometric mean of 58.3. A single treated cat was infected and harboured 2 scoleces. Effective prevention of infection with D. caninum, based on a comparison of the geometric mean numbers of scoleces recovered from control and treated cats, was 99.7%. Conclusion The insecticidal components of the medicated collars are capable of rapidly eliminating newly-acquired infestations of fleas that are infected
1:100k Digital Raster Graphic - Collars Removed
Minnesota Department of Natural Resources — A digital raster graphic (DRG) is a scanned image of an U.S. Geological Survey (USGS) standard series topographic map, including all map collar information. The...
Montenegro, Olga L; Roncancio, Nestor; Soler-Tovar, Diego; Cortés-Duque, Jimena; Contreras-Herrera, Jorge; Sabogal, Sandra; Acevedo, Luz Dary; Navas-Suárez, Pedro Enrique
2018-06-14
In South America, wild populations of peccaries coexist with domestic and feral pigs, with poorly understood consequences. We captured 58 collared peccaries ( Pecari tajacu) and 15 feral pigs ( Sus scrofa) in locations of Colombia where coexistence of these species is known. Blood samples were tested for antibodies against four viral agents, classical swine fever virus (CSFV), Aujeszky's disease virus (ADV), porcine circovirus (PCV-2), and vesicular stomatitis virus (New Jersey and Indiana subtypes) and two bacterial agents, Brucella spp. and six serovars of Leptospira interrogans. The prevalence of CSFV was 5% (3/58) in collared peccaries and 7% (1/15) in feral pigs. The prevalence of PCV-2 was 7% (1/15) in collared peccaries and 67% (2/3) in feral pigs. Vesicular stomatitis prevalence was 33% (8/24) in collared peccaries and 67% (4/6) in feral pigs. Leptospira prevalence was 78% (39/50) in collared peccary and 100% (8/8) in feral pigs; bratislava, grippotyphosa, icterohaemorrhagiae, and pomona were the most frequent serovars. Also, the only white-lipped peccary ( Tayassu pecari) sampled was positive for L. interrogans serovar bratislava and for vesicular stomatitis virus, New Jersey strain. No samples were positive for ADV or Brucella. The seroprevalence of antibodies against L. interrogans was similar to that observed in other studies. Icterohaemorrhagiae appears to be a common serovar among in situ and ex situ peccary populations. Positive antibodies against PVC-2 represent a novel report of exposure to this pathogen in Colombian peccaries. Our results indicate the possible transmission of various pathogens, important for pig farms, in the studied pig and peccaries.
GPS radio collar 3D performance as influenced by forest structure and topography
R. Scott Gamo; Mark A. Rumble; Fred Lindzey; Matt Stefanich
2000-01-01
Global Positioning System (GPS) telemetry enables biologists to obtain accurate and systematic locations of animals. Vegetation can block signals from satellites to GPS radio collars. Therefore, a vegetation dependent bias to telemetry data may occur which if quantified, could be accounted for. We evaluated the performance of GPS collars in 6 structural stage...
Birds be safe: Can a novel cat collar reduce avian mortality by domestic cats (Felis catus?
Directory of Open Access Journals (Sweden)
S.K. Willson
2015-01-01
Full Text Available The domestic cat (Felis catus has been described as the largest anthropogenic threat to songbird populations in North America. We examined the effectiveness of a novel cat collar in reducing avian and small mammal mortality by cats. The 2-inch wide Birdsbesafe® collar cover (CC is worn over a nylon quick-release collar, and the bright colors and patterns of the CC are hypothesized to warn birds of approaching cats. We conducted two seasonal trials, each lasting 12 weeks, in autumn 2013 (n=54 cats and spring 2014 (n=19 cats. Cats were randomly assigned to two groups, and CCs with interior collars were removed or put on every two weeks, to control for weather fluctuations and seasonal change. Cats wearing Birdsbesafe® CCs killed 19 times fewer birds than uncollared cats in the spring trial, and 3.4 times fewer birds in the fall. Birdsbesafe® CCs were extremely effective at reducing predation on birds. Small mammal data were less clear, but did decrease predation by half in the fall. The Birdsbesafe® CC is a highly effective device for decreasing bird predation, especially in the spring season. We suggest that the CCs be used as a conservation tool for owned as well as feral cats.
White-collar workers' hemodynamic responses during working hours.
Liu, Xinxin; Iwakiri, Kazuyuki; Sotoyama, Midori
2017-08-08
In the present study, two investigations were conducted at a communication center, to examine white-collar workers' hemodynamic responses during working hours. In investigation I, hemodynamic responses were measured on a working day; and in investigation II, cardiovascular responses were verified on both working and non-working days. In investigation I, blood pressure, cardiac output, heart rate, stroke volume, and total peripheral resistance were measured in 15 workers during working hours (from 9:00 am to 18:00 pm) on one working day. Another 40 workers from the same workplace participated in investigation II, in which blood pressure and heart rate were measured between the time workers arose in the morning until they went to bed on 5 working days and 2 non-working days. The results showed that blood pressure increased and remained at the same level during working hours. The underlying hemodynamics of maintaining blood pressure, however, changed between the morning and the afternoon on working days. Cardiac responses increased in the afternoon, suggesting that cardiac burdens increase in the afternoon on working days. The present study suggested that taking underlying hemodynamic response into consideration is important for managing the work-related cardiovascular burden of white-collar workers.
Lin, Yun-Ping; McCullagh, Marjorie C; Kao, Tsui-Sui; Larson, Janet L
2014-02-01
The purpose of this review is to synthesize the research evidence for the role of the work environment-workplace physical activity policies and resources and job strain factors-in explaining physical activity in white-collar workers. White-collar workers are at risk for developing a sedentary lifestyle, which contributes to all-cause mortality. Understanding how work environment can influence worker physical activity is important for the development of effective interventions. We reviewed 15 research articles that describe the relationship between work environment factors and physical activity in predominantly white-collar workers. Relatively consistent evidence was found for the effects of supportive workplace policies and resources. Weak evidence was found for the effects of job strain. Both work environment factors have the potential to influence physical activity but require further exploration to fully understand their contribution to physical activity in white-collar workers. Limitations and implications are discussed.
Mumith, A; Coathup, M; Chimutengwende-Gordon, M; Aston, W; Briggs, T; Blunn, G
2017-02-01
Massive endoprostheses rely on extra-cortical bone bridging (ECBB) to enhance fixation. The aim of this study was to investigate the role of selective laser sintered (SLS) porous collars in augmenting the osseointegration of these prostheses. The two novel designs of porous SLS collars, one with small pores (Ø700 μm, SP) and one with large pores (Ø1500 μm, LP), were compared in an ovine tibial diaphyseal model. Osseointegration of these collars was compared with that of a clinically used solid, grooved design (G). At six months post-operatively, the ovine tibias were retrieved and underwent radiological and histological analysis. Porous collars provided a significantly greater surface (p direct ingrowth of more bone and are better than current designs which rely on surface ongrowth and ECBB. Cite this article: Bone Joint J 2017;99-B:276-82. ©2017 The British Editorial Society of Bone & Joint Surgery.
Does patency after a vein collar and PTFE-bypass depend on sex and age?
DEFF Research Database (Denmark)
Lundgren, F; Schroeder, Torben Veith
2012-01-01
Randomized studies evaluating the effect of a vein collar at the distal anastomosis of PTFE-grafts show conflicting results. The study of the Joint Vascular Research Group (JVRG) of UK found improved primary patency while the Scandinavian Miller Collar Study (SCAMICOS) found neither any effect...
Energy Technology Data Exchange (ETDEWEB)
Gaudefroy, L., E-mail: laurent.gaudefroy@cea.fr [CEA, DAM, DIF, F-91297 Arpajon (France); Roger, T., E-mail: roger@ganil.fr [GANIL, CEA/DSM-CNRS/IN2P3, BP 55027, F-14076 Caen (France); Pancin, J., E-mail: pancin@ganil.fr [GANIL, CEA/DSM-CNRS/IN2P3, BP 55027, F-14076 Caen (France); Spitaels, C. [GANIL, CEA/DSM-CNRS/IN2P3, BP 55027, F-14076 Caen (France); Aupiais, J. [CEA, DAM, DIF, F-91297 Arpajon (France); Mottier, J. [Institut de Physique Nucléaire, Université Paris-Sud-11-CNRS-IN2P3, F-91406 Orsay (France)
2017-05-21
We present a twin Frisch-grid ionization chamber. The detector is meant to provide high selective power for the study of delayed gamma-ray spectroscopy of fission fragments produced via {sup 252}Cf spontaneous fission. A mean energy resolution on the kinetic energy of fission fragments of 675 keV (FWHM) is achieved and allows us to resolve masses of fragments for fission events where neutron emission is not energetically possible. The mean mass resolution measured for these particular events amounts to 0.54 mass units (FWHM). For fission events with neutron emission a resolution of 4 mass units (FWHM) is reported. Information on fragment emission angle is measured with a resolution of 0.1 on the difference of the cosines determined for both halves of the detector. A charge resolution of 4.5 charge units (FWHM) is also demonstrated.
MtDNA genetic diversity and structure of Eurasian Collared Dove (Streptopelia decaocto).
Bagi, Zoltán; Dimopoulos, Evangelos Antonis; Loukovitis, Dimitrios; Eraud, Cyril; Kusza, Szilvia
2018-01-01
The Eurasian Collared Dove (Streptopelia decaocto) is one of the most successful biological invaders among terrestrial vertebrates. However, little information is available on the genetic diversity of the species. A total of 134 Eurasian Collared Doves from Europe, Asia and the Caribbean (n = 20) were studied by sequencing a 658-bp length of mitochondrial DNA (mtDNA) cytochrome oxidase I (COI). Fifty-two different haplotypes and relatively high haplotype and nucleotide diversities (Hd±SD = 0.843±0.037 and π±SD = 0.026±0.013) were detected. Haplotype Ht1 was particularly dominant: it included 44.03% of the studied individuals, and contained sequences from 75% of the studied countries. Various analyses (FST, AMOVA, STRUCTURE) distinguished 2 groups on the genetic level, designated 'A' and 'B'. Two groups were also separated in the median-joining network and the maximum likelihood tree. The results of the neutrality tests were negative (Fu FS = -25.914; Tajima D = -2.606) and significantly different from zero (P≤0.001) for group A, whereas both values for group B were positive (Fu FS = 1.811; Tajima D = 0.674) and not significant (P>0.05). Statistically significant positive autocorrelation was revealed among individuals located up to 2000 km apart (r = 0.124; P = 0.001). The present results provide the first information on the genetic diversity and structure of the Eurasian Collared Dove, and can thereby serve as a factual and comparative basis for similar studies in the future.
Does Shoe Collar Height Influence Ankle Joint Kinematics and Kinetics in Sagittal Plane Maneuvers?
Yang, Yang; Fang, Ying; Zhang, Xini; He, Junliang; Fu, Weijie
2017-01-01
The Objective of the study is to investigate the effects of basketball shoes with different collar heights on ankle kinematics and kinetics and athletic performance in different sagittal plane maneuvers. Twelve participants who wore high-top and low-top basketball shoes (hereafter, HS and LS, respectively) performed a weight-bearing dorsiflexion (WB-DF) maneuver, drop jumps (DJs), and lay-up jumps (LJs). Their sagittal plane kinematics and ground reaction forces were recorded using the Vicon motion capture system and Kistler force plates simultaneously. Moreover, ankle dorsiflexion and plantarflexion angles, moment, power, stiffness, and jump height were calculated. In the WB-DF test, the peak ankle dorsiflexion angle (p = 0.041) was significantly smaller in HS than in LS. Additionally, the peak ankle plantarflexion moment (p = 0.028) and power (p = 0.022) were significantly lower in HS than in LS during LJs but not during DJs. In both jumping maneuvers, no significant differences were found in the jump height or ankle kinematics between the two shoe types. According to the WB-DF test, increasing shoe collar height can effectively reduce the ankle range of motion in the sagittal plane. Although the HS did not restrict the flexion–extension performance of the ankle joint during two jumping maneuvers, an increased shoe collar height can reduce peak ankle plantarflexion moment and peak power during the push-off phase in LJs. Therefore, a higher shoe collar height should be used to circumvent effects on the partial kinetics of the ankle joint in the sagittal plane. Key points An increased shoe collar height effectively reduced ankle joint ROM in the sagittal plane in weight-bearing dorsiflexion maneuver. Shoe collar height did not affect sagittal plane ankle kinematics and had no effect on performance during realistic jumping. Shoe collar height can affect the ankle plantarflexion torque and peak power during the push-off phase in lay-up jump. PMID:29238255
Directory of Open Access Journals (Sweden)
Caixia Chen
2017-08-01
Full Text Available Addressing labor issues in the apparel industry is significantly important due to customers’ increasing awareness of poor working conditions and growing labor crises in apparel production locations worldwide. Decent work is a key element to achieving fair and harmonious employment, but is not always evident in global apparel production networks. This study examines the working conditions in China’s garment manufacturing industry, which employs more than 10 million workers. A survey was administered to 313 blue-collar workers and 228 white-collar workers on issues related to decent work, including workers’ concerns, satisfaction levels and attitudes towards decent work. Regression analysis showed that workers’ attitudes are significantly related to age, education level, service length and monthly wage. Gap analysis revealed poor understanding of decent work and low satisfaction with primary indicators of decent work. However, results suggest that workers increasingly value soft factors and the overall work experience, not only financial benefits. Cluster analysis identified four clusters of workers. This study contributes to understanding garment worker perceptions of decent work and provides implications for the operationalization of decent work in China’s garment manufacturing industry.
Yzer, Marco; Weisman, Susan; Mejia, Nicole; Hennrikus, Deborah; Choi, Kelvin; DeSimone, Susan
2015-08-01
Blue-collar workers typically have high rates of tobacco use but low rates of using tobacco cessation resources available through their health benefits. Interventions to motivate blue-collar tobacco users to use effective cessation support are needed. Reasoned action theory is useful in this regard as it can identify the beliefs that shape tobacco cessation benefit use intentions. However, conventional reasoned action research cannot speak to how those beliefs can best be translated into intervention messages. In the present work, we expand the reasoned action approach by adding additional qualitative inquiry to better understand blue-collar smokers' beliefs about cessation benefit use. Across three samples of unionized blue-collar tobacco users, we identified (1) the 35 attitudinal, normative, and control beliefs that represented tobacco users' belief structure about cessation benefit use; (2) instrumental attitude as most important in explaining cessation intention; (3) attitudinal beliefs about treatment options' efficacy, health effects, and monetary implications of using benefits as candidates for message design; (4) multiple interpretations of cessation beliefs (e.g., short and long-term health effects); and (5) clear implications of these interpretations for creative message design. Taken together, the findings demonstrate how a mixed-method reasoned action approach can inform interventions that promote the use of tobacco cessation health benefits.
The effect of nozzle collar on signle phase and boiling heat transfer by planar impinging jet
International Nuclear Information System (INIS)
Shin, Chang Hwan; Yim, Seong Hwan; Cho, Hyung Hee; Wu, Seong Je
2005-01-01
The water jet impingement cooling is one of the techniques to remove the heat from high heat flux equipment. Local heat transfer of the confined water impinging jet and the effect of nozzle collar to enhance the heat transfer are investigated in the free surface jet and submerged jet. Boiling is initiated from the farthest downstream and increase of the wall temperature is reduced with developing boiling, forming the flat temperature distributions. The reduction in the nozzle-to-surface distance for H/W≤1 causes significant increases and distribution changes of heat transfer. Developed boiling reduces the differences of heat transfer for various conditions. The nozzle collar is employed at the nozzle exit. The distances from heated surface to nozzle collar, H c are 0.25W, 0.5W and 1.0W. The liquid film thickness is reduced and the velocity of wall jet increases as decreased spacing of collar to heated surface. Heat transfer is enhanced for region from the stagnation to x/W∼8 in the free surface jet and to x/W∼5 in the submerged jet. For nucleate boiling region of further downstream, the heat transfer by the nozzle collar is decreased in submerged jet comparing with higher velocity condition. It is because the increased velocity by collar is de-accelerated downstream
Ergonomic assessment of enhanced protection under body armour combat shirt neck collars.
Breeze, John; Granger, C J; Pearkes, T D; Clasper, J C
2014-03-01
Combat neck injury due to explosively propelled fragments is a significant cause of mortality and long-term morbidity in UK soldiers deployed on current operations. Reinforcing the collar of the existing under body armour combat shirt (UBACS) has been suggested as a potential method for reducing the incidence of combat neck injury. 20 soldiers serving in Afghanistan objectively compared three designs of enhanced protection UBACS (EP-UBACS) using 10 representative military tasks against a baseline of a standard UBACS. Each EP-UBACS design was trialled using three constituent materials: two layers of para-aramid felt, one layer of ultra high molecule weight polyethylene (UHMWPE) felt or two layers of a silk fabric. Subjective assessment of these nine configurations in terms of comfort, heat dissipation and overall acceptability were compared with the standard UBACS using a χ² test. All military tasks could be performed with all nine configurations of EP-UBACS. Although silk was the most comfortable material, it was not functionally practical in any of the three designs. Crossover collars incorporating UHMWPE or para-aramid were the only two of the nine configurations to demonstrate similar user acceptability to a standard UBACS. The EP-UBACS has the potential to provide neck protection without reducing performance incorporating materials analogous to either of the felts assessed in this study. The collar should provide stand-off from the skin to improve heat dissipation and comfort, which can be maximised by changing the current UBACS collar shape to one that crosses over at the front. Should a zip be desired, it should be moved to one side of the midline to reduce rubbing on the chin and be covered with ballistic protective material. Additional semi-circles of silk beneath the collar at the front and back would improve protection without affecting comfort.
Dryden, Michael W; Smith, Vicki; Davis, Wendell L; Settje, Terry; Hostetler, Joe
2016-05-17
This controlled laboratory study was designed to evaluate the efficacy of the 10 % imidacloprid/4.5 % flumethrin collar (Seresto®, Bayer Animal Health) against fleas (Ctenocephalides f. felis) on cats, when compared to fipronil (9.8 %w/w)/(s)-methoprene (11.8 % w/w) topical spot-on formulation (Frontline® Plus for Cats and Kittens, Merial). Thirty cats were randomized into three groups of ten animals based on pre-treatment flea counts: Group 1: imidacloprid/flumethrin collar; Group 2: fipronil/(s)-methoprene topical spot-on and Group 3: non-treated controls. The imidacloprid/flumethrin collars were applied one time on Day 0, while the fipronil/(s)-methoprene spot-on was administered every 30 days from Day 0 through Day 210. Cats were infested with 100 fleas on study days 0, 7, 14, 29, 59, 89, 119, 149, 179, 209 and 239. All flea counts were conducted by combing to remove fleas on post-treatment days 2, 8, 15, 30, 60, 90, 120, 150, 180, 210 and 240. The efficacy of the imidacloprid/flumethrin collar ranged from 98.2 to 100 % for eight months. The efficacy of fipronil/(s)-methoprene spot-on ranged from 68.2 to 99.9 %. Efficacy was imidacloprid/flumethrin collar group when compared to the fipronil/(s)-methoprene group on Days 90, 150 and 210 (P imidacloprid/flumethrin collar (Seresto®, Bayer Animal Health) maintained excellent ( > 98.2 %) efficacy against fleas on cats for the entire 8 month study. Monthly applications of fipronil/(s)-methoprene (Frontline® Plus for Cats and Kittens, Merial) generally had high, but variable (68.2 to 99.9 %) efficacy over the course of the eight month study. Based on the very high residual efficacy achieved by the imidacloprid/flumethrin collar in this study, veterinarians should expect that this collar will control and eliminate existing flea infestations on cats and in their in-home premises as long as every flea infested host is treated.
2013-01-18
... INTERNATIONAL TRADE COMMISSION [Docket No. 2932] Certain Electronic Bark Control Collars; Notice.... International Trade Commission. ACTION: Notice. SUMMARY: Notice is hereby given that the U.S. International Trade Commission has received a complaint entitled Certain Electronic Bark Control Collars, DN 2932; the...
DEFF Research Database (Denmark)
Slepniov, Dmitrij; Larsen, Marcus Møller; Wæhrens, Brian Vejrum
2010-01-01
of this paper is two folded: to explain why knowledge-intensive service work in manufacturing firms is increasingly subject to offshoring and to understand the effects of this process on integration mechanisms for the firms involved. The empirical part of the study is based on two qualitative case studies...... of Danish manufacturers, and on the basis of these, we first argue that the drivers of white-collar work offshoring in many respects are parallel to those of the earlier wave of blue-collar work offshoring. However, the existing offshoring and outsourcing frameworks do not necessarily adequately address....... By relating white-collar work offshoring to integration means companies instigate to manage it, we attempt to bridge the existing knowledge gaps and advance understanding of the process of white-collar work offshoring and its implications....
Mechanical behaviour of a closed collar model for an 11.5 T dipole magnet
International Nuclear Information System (INIS)
Emden, W. van; Daum, C.; Geerinck, J.
1992-03-01
A 10 cm long model of an 11.5 T Nb 3 Sn accelerator dipole magnet, which will be built in the Netherlands, with a closed ring shaped collar has been constructed. Measurements of the collar deformation and the prestress at the poles have been made with a structural analysis using the Finite Element Method (FEM) of the code ANSYS. (author). 11 refs.; 18 figs.; 7 tabs
Estrus cycle monitoring of captive collared peccaries (Pecari tajacu in semiarid conditions
Directory of Open Access Journals (Sweden)
Keilla M. Maia
2014-11-01
Full Text Available Collared peccaries (Peccary tajacu are among the most hunted species in Latin America due the appreciation of their pelt and meat. In order to optimize breeding management of captive born collared peccaries in semiarid conditions, the objective was to describe and correlate the changes in the ovarian ultrasonographic pattern, hormonal profile, vulvar appearance, and vaginal cytology during the estrus cycle in this species. During 45 days, females (n=4 were subjected each three days to blood collection destined to hormonal dosage by enzyme immunoassay (EIA. In the same occasions, evaluation of external genitalia, ovarian ultrasonography and vaginal cytology were conducted. Results are presented as means and standard deviations. According to hormonal dosage, six estrous cycles were identified as lasting 21.0 ± 5.7 days, being on average 6 days for the estrogenic phase and 15 days for the progesterone phase. Estrogen presented mean peak values of 55.6 ± 20.5 pg/mL. During the luteal phase, the high values for progesterone were 35.3 ± 4.4 ng/mL. The presence of vaginal mucus, a reddish vaginal mucosa and the separation of the vulvar lips were verified in all animals during the estrogenic peak. Through ultrasonography, ovarian follicles measuring 0.2±0.1 cm were visualized during the estrogen peak. Corpora lutea presented hyperechoic regions measuring 0.4±0.2 cm identified during luteal phase. No significant differences (P>0.05 between proportions of vaginal epithelial cells were identified when comparing estrogenic and progesterone phases. In conclusion, female collared peccaries, captive born in semiarid conditions, have an estral cycle that lasts 21.0±5.7 days, with estrous signs characterized by vulvar lips edema and hyperemic vaginal mucosa, coinciding with developed follicles and high estrogen levels.
Directory of Open Access Journals (Sweden)
Kivelä Antti
2012-10-01
Full Text Available Abstract Background Neointimal formation in atherosclerosis has been subject for intense research. However, good animal models mimicking asymmetrical lesion formation in human subjects have been difficult to establish. The aim of this study was to develop a model which would lead to the formation of eccentric lesions under macroscopically intact non-denuded endothelium. Methods We have developed a new collar model where we placed two cushions or dots inside the collar. Arterial lesions were characterized using histology and ultrasound methods. Results When this dotted collar was placed around carotid and femoral arteries it produced asymmetrical pressure on adventitia and a mild flow disturbance, and hence a change in shear stress. Our hypothesis was that this simple procedure would reproducibly produce asymmetrical lesions without any intraluminal manipulations. Intima/media ratio increased towards the distal end of the collar with the direction of blood flow under macroscopically intact endothelium. Macrophages preferentially accumulated in areas of the thickest neointima thus resembling early steps in human atherosclerotic plaque formation. Proliferating cells in these lesions and underlying media were scarce at eight weeks time point. Conclusion The improved dotted collar model produces asymmetrical human-like atherosclerotic lesions in rabbits. This model should be useful in studies regarding the pathogenesis and formation of eccentric atherosclerotic lesions.
The development and validation of a job crafting measure for use with blue-collar workers
DEFF Research Database (Denmark)
Nielsen, Karina; Abildgaard, Johan Simonsen
2012-01-01
Abstract Job crafting describes a set of proactive behaviours in which employees may engage to shape their work in order to minimize hindering job demands and maximize resources and challenging demands. Such behaviours may be particularly important among blue-collar workers whose jobs are charact......Abstract Job crafting describes a set of proactive behaviours in which employees may engage to shape their work in order to minimize hindering job demands and maximize resources and challenging demands. Such behaviours may be particularly important among blue-collar workers whose jobs...... are characterized by poor working conditions and low well-being. We present the development and adaptation of a job crafting measure that may be used among blue-collar workers, based on an existing scale by Tims, Bakker, and Derks (2012) that was not specifically developed for blue-collar workers. We test......, increasing social job resources, increasing quantitative demands and decreasing hindering job demands. These can be reliably measured with 15 items. The measure shows acceptable discriminant and criterion validity, and test-retest reliability. The findings extend the application of the original questionnaire...
Ham, Wietske H W; Schoonhoven, Lisette; Schuurmans, Marieke J; Leenen, Luke P H
2016-09-01
To describe the occurrence and severity of pressure ulcers, indentation marks and pain from the extrication collar combined with headblocks. Furthermore, the influence of time, injury severity and patient characteristics on the development of pressure ulcers, indentation marks and pain was explored. Observational. Level one trauma centre in the Netherlands. Adult trauma patients admitted to the Emergency Department in an extrication collar combined with headblocks. Between January and December 2013, 342 patients were included. Study outcomes were incidence and severity of pressure ulcers, indentation marks and pain. The following dependent variables were collected: time in the cervical collar and headblocks, Glasgow Coma Scale, Mean Arterial Pressure, haemoglobin, Injury Severity Score, gender, age, and Body Mass Index. 75.4% of the patients developed a category 1 and 2.9% a category 2 pressure ulcer. Indentation marks were observed in 221 (64.6%) patients; 96 (28.1%) had severe indentation marks. Pressure ulcers and indentation marks were observed most frequently at the back, shoulders and chest. 63.2% experienced pain, of which, 38.5% experienced severe pain. Pain was mainly located at the occiput. Female patients experienced significantly more pain (NRS>3) compared to male patients (OR=2.14, 95% CI 1.21-3.80) None of the investigated variables significantly increased the probability of developing PUs or indentation marks. The high incidence of category 1 pressure ulcers and severe indentation marks indicate an increased risk for pressure ulcer development and may well lead to more severe PU lesions. Pain due to the application of the extrication collar and headblocks may lead to undesirable movement (in order to relieve the pressure) or to bias clinical examination of the cervical spine. It is necessary to revise the current practice of cervical spine immobilization. Copyright © 2016 Elsevier Ltd. All rights reserved.
Du Plessis, Karin; Cronin, David; Corney, Tim; Green, Emma
2013-09-01
In Australia, blue-collar workers are predominantly male and form a unique and large (approximately 30%) subset of the Australian workforce. They exhibit particular health-related issues and, in comparison to other groups, often a lack of health promoting behavior. This article briefly discusses the Australian context and some of the key health issues blue-collar men face, in particular as it relates to construction workers. It reviews the impact of gender and socioeconomic factors in designing workplace health promotion interventions. This article considers practice strategies for health promoters in a specific workplace setting: it looks at meta-factors and industry-based contextual factors, including barriers to implementation and participation, while addressing common misconceptions about Australian blue-collar workers.
Mech, L. David
2011-01-01
Global Positioning System (GPS) radio-collars are increasingly used to estimate Gray Wolf (Canis lupus) kill rates. In interpreting results from this technology, researchers make various assumptions about wolf behavior around kills, yet no detailed description of this behavior has been published. This article describes the behavior of six wolves in an area of constant daylight during 30 hours, from when the pack killed a Muskox (Ovibos moschatus) calf and yearling on Ellesmere Island, Nunavut, Canada, to when they abandoned the kill remains. Although this is only a single incident, it demonstrates one possible scenario of pack behavior around a kill. Combined with the literature, this observation supports placing a radio-collar on the breeding male to maximize finding kills via GPS collars and qualifying results depending on whatever other information is available about the collared wolf's pack.
Silva, Rafaella Albuquerque E; Andrade, Andrey José de; Quint, Bruno Beust; Raffoul, Gabriel Elias Salmen; Werneck, Guilherme Loureiro; Rangel, Elizabeth Ferreira; Romero, Gustavo Adolfo Sierra
2018-03-26
There is little information on the effect of using deltamethrin-impregnated dog collars for the control of canine visceral leishmaniasis. The objective of this study was to evaluate the effectiveness of the use of 4% deltamethrin-impregnated collars (Scalibor®) in controlling visceral leishmaniasis in Lutzomyia longipalpis by comparing populations in intervention and non-intervention areas. Phlebotomine flies were captured over 30 months in four neighbourhoods with intense visceral leishmaniasis transmission in Fortaleza and Montes Claros. We calculated the rates of domicile infestation, relative abundance of Lu. longipalpis, and Lu. longipalpis distribution in each site, capture location (intra- and peridomestic locations) and area (intervention and non-intervention areas). In the control area in Fortaleza, the relative abundance of Lu. longipalpis was 415 specimens at each capture site, whereas in the intervention area it was 159.25; in Montes Claros, the relative abundance was 5,660 specimens per capture site in the control area, whereas in the intervention area it was 2,499.4. The use of dog collars was associated with a reduction in captured insects of 15% (p = 0.004) and 60% (p < 0.001) in Montes Claros and Fortaleza, respectively. We observed a lower vector abundance in the intervention areas, suggesting an effect of the insecticide-impregnated collars.
Monitoring distances travelled by horses using GPS tracking collars.
Hampson, B A; Morton, J M; Mills, P C; Trotter, M G; Lamb, D W; Pollitt, C C
2010-05-01
The aims of this work were to (1) develop a low-cost equine movement tracking collar based on readily available components, (2) conduct preliminary studies assessing the effects of both paddock size and internal fence design on the movements of domestic horses, with and without foals at foot, and (3) describe distances moved by mares and their foals. Additional monitoring of free-ranging feral horses was conducted to allow preliminary comparisons with the movement of confined domestic horses. A lightweight global positioning system (GPS) data logger modified from a personal/vehicle tracker and mounted on a collar was used to monitor the movement of domestic horses in a range of paddock sizes and internal fence designs for 6.5-day periods. In the paddocks used (0.8-16 ha), groups of domestic horses exhibited a logarithmic response in mean daily distance travelled as a function of increasing paddock size, tending asymptotically towards approximately 7.5 km/day. The distance moved by newborn foals was similar to their dams, with total distance travelled also dependent on paddock size. Without altering available paddock area, paddock design, with the exception of a spiral design, did not significantly affect mean daily distance travelled. Feral horses (17.9 km/day) travelled substantially greater mean daily distances than domestic horses (7.2 km/day in 16-ha paddock), even when allowing for larger paddock size. Horses kept in stables or small yards and paddocks are quite sedentary in comparison with their feral relatives. For a given paddock area, most designs did not significantly affect mean daily distance travelled.
Woodin, Marc C.; Skoruppa, Mary K.; Blacklock, Gene W.; Hickman, Graham C.
1999-01-01
The range of the white-collared seedeater (Sporophila torqueola), a tropical grassland species, extends from Central America northward along both coasts of Mexico (Eitniear, 1997), including Tamaulipas and Nuevo Leon (Howell and Webb, 1995). White-collared seedeaters historically occurred commonly in extreme southern Texas (Oberholser, 1974; Rappole and Blacklock, 1994). However, since about 1950, white-collared seedeaters have undergone a precipitous decline in south Texas. Studies during 1994-1996 identified only seven to nine breeding pairs in the only population known to occur in Texas, located ca. 55 km downriver of Laredo, Texas, in Zapata Co. (Eitniear, 1997). Outside of the historical range, very few records are documented. Oberholser (1974) reported that three white-collared seed- eater specimens were collected in 1948 in Webb Co., northwest of Laredo, and Arnold (1980) also collected a white-collared seedeater in Webb Co. Vagrants also have been sighted as far afield as Corpus Christi (Blacklock, 1964), ca. 200 km north of the Rio Grande (Fig. 1).
Does Abutment Collar Length Affect Abutment Screw Loosening After Cyclic Loading?
Siadat, Hakimeh; Pirmoazen, Salma; Beyabanaki, Elaheh; Alikhasi, Marzieh
2015-07-01
A significant vertical space that is corrected with vertical ridge augmentation may necessitate selection of longer abutments, which would lead to an increased vertical cantilever. This study investigated the influence of different abutment collar heights on single-unit dental implant screw-loosening after cyclic loading. Fifteen implant-abutment assemblies each consisted of an internal hexagonal implant were randomly assigned to 3 groups: Group1, consisting of 5 abutments with 1.5 mm gingival height (GH); Group2, 5 abutments with 3.5 mm GH; and Group3, 5 abutments with 5.5 mm GH. Each specimen was mounted in transparent auto-polymerizing acrylic resin block, and the abutment screw was tightened to 35 Ncm with an electric torque wrench. After 5 minutes, initial torque loss (ITL) was recorded for all specimens. Metal crowns were fabricated with 45° occlusal surface and were placed on the abutments. A cyclic load of 75 N and frequency of 1 Hz were applied perpendicular to the long axis of each specimen. After 500 000 cycles, secondary torque loss (STL) was recorded. One-way ANOVA analysis was used to evaluate the effects of abutment collar height before and after cyclic loading. One-way ANOVA showed that ITL among the groups was not significantly different (P = .52), while STL was significantly different among the groups (P = .008). Post-hoc Tukey HSD tests showed that STL values were significantly different between the abutments with 1.5 mm GH (Group1) and with 5.5 mm GH (Group3) (P = .007). A paired comparison t-test showed that cyclic loading significantly influenced the STL in comparison with the ITL in each group. Within the limitations of this study, it can be concluded that increase in height of the abutment collar could adversely affect the torque loss of the abutment screw.
The Origin of Black Smock and White Collar
Hesapcioglu, Muhsin; Meseci Giorgetti, Filiz
2009-01-01
Although there are many empirical studies on the functions of school uniform, studies which focus on the origins of school uniform are neglected. Purpose of this study is to reveal historical origins of black smock and white collar. To achieve this purpose, a qualitative research method was adopted. As a result of the research, it was determined…
Lam, Gilbert Wing Kai; Park, Eun Jung; Lee, Ki-Kwang; Cheung, Jason Tak-Man
2015-01-01
Side-step cutting manoeuvres comprise the coordination between planting and non-planting legs. Increased shoe collar height is expected to influence ankle biomechanics of both legs and possibly respective cutting performance. This study examined the shoe collar height effect on kinematics and kinetics of planting and non-planting legs during an unanticipated side-step cutting. Fifteen university basketball players performed maximum-effort side-step cutting to the left 45° direction or a straight ahead run in response to a random light signal. Seven successful cutting trials were collected for each condition. Athletic performance, ground reaction force, ankle kinematics and kinetics of both legs were analysed using paired t-tests. Results indicated that high-collar shoes resulted in less ankle inversion and external rotation during initial contact for the planting leg. The high-collar shoes also exhibited a smaller ankle range of motion in the sagittal and transverse planes for both legs, respectively. However, no collar effect was found for ankle moments and performance indicators including cutting performance time, ground contact time, propulsion ground reaction forces and impulses. These findings indicated that high-collar shoes altered ankle positioning and restricted ankle joint freedom movements in both legs, while no negative effect was found for athletic cutting performance.
2014-01-01
Background Concern has been raised that cervical collars may increase intracranial pressure in traumatic brain injury. The purpose of this study was to compare four types of cervical collars regarding efficacy of immobilizing the neck, effect on jugular venous pressure (JVP), as a surrogate for possible effect on intracranial pressure, and patient comfort in healthy volunteers. Methods The characteristics of four widely used cervical collars (Laerdal Stifneck® (SN), Vista® (VI), Miami J Advanced® (MJ), Philadelphia® (PH)) were studied in ten volunteers. Neck movement was measured with goniometry, JVP was measured directly through an endovascular catheter and participants graded the collars according to comfort on a scale 1–5. Results The mean age of participants was 27 ± 5 yr and BMI 26 ± 5. The mean neck movement (53 ± 9°) decreased significantly with all the collars (p MJ > SN > PH). Conclusion Stifneck and Miami J collars offered the most efficient immobilization of the neck with the least effect on JVP. Vista and Miami J were the most comfortable ones. The methodology used in this study may offer a new approach to evaluate clinical efficacy and safety of neck collars and aid their continued development. PMID:24906207
Tsai, Su-Ying
2012-10-19
Little is known about the health-related quality of life (HRQoL) and work-related stress and its risk factors among white-collar businessmen and management workers that migrate to high-income developing countries. A structural questionnaire survey was administered to 156 white-collar Taiwanese management personnel of representative companies of their industries in Taiwan, who were assigned long-term job positions in China. Questionnaire content included demographics and medical history, self-reported physical and mental conditions, personal lifestyle and behavior, Beck Depression Inventory, and information on HRQoL. White-collar migrant workers reported a high prevalence of alcohol consumption (72.4%) and perceived work-related stress (62.2%), and a lower prevalence of regular exercise (12.2%). Workers with higher levels of perceived work-related stress reported more alcohol consumption, a history of hyperlipidemia, and a higher prevalence of self-reported neck pain, poor sleep, and mild/moderate/severe depression. In our primary multivariate risk model to determine lifestyle and work-related stress variables and HRQoL, perceived work-related stress and a feeling of depression negatively impacted both the Physical Component Summary (PCS) and Mental Component Summary (MCS) scores of the SF-36 health survey. Hyperlipidemia and self-reported neck pain were associated with significantly lower PCS scores, whereas cardiovascular disease, gastric ulcer, and poor sleep were associated with statistically lower MCS scores. White-collar migrant workers are generally younger with high socioeconomic status. Perceived work-related stress and a feeling of depression indirectly affect HRQoL. Hyperlipidemia, self-reported neck pain, cardiovascular disease, gastric ulcer, and poor sleep also had a significant negative impact on HRQoL.
Directory of Open Access Journals (Sweden)
Su-Ying Tsai
2012-10-01
Full Text Available Little is known about the health-related quality of life (HRQoL and work-related stress and its risk factors among white-collar businessmen and management workers that migrate to high-income developing countries. A structural questionnaire survey was administered to 156 white-collar Taiwanese management personnel of representative companies of their industries in Taiwan, who were assigned long-term job positions in China. Questionnaire content included demographics and medical history, self-reported physical and mental conditions, personal lifestyle and behavior, Beck Depression Inventory, and information on HRQoL. White-collar migrant workers reported a high prevalence of alcohol consumption (72.4% and perceived work-related stress (62.2%, and a lower prevalence of regular exercise (12.2%. Workers with higher levels of perceived work-related stress reported more alcohol consumption, a history of hyperlipidemia, and a higher prevalence of self-reported neck pain, poor sleep, and mild/moderate/severe depression. In our primary multivariate risk model to determine lifestyle and work-related stress variables and HRQoL, perceived work-related stress and a feeling of depression negatively impacted both the Physical Component Summary (PCS and Mental Component Summary (MCS scores of the SF-36 health survey. Hyperlipidemia and self-reported neck pain were associated with significantly lower PCS scores, whereas cardiovascular disease, gastric ulcer, and poor sleep were associated with statistically lower MCS scores. White-collar migrant workers are generally younger with high socioeconomic status. Perceived work-related stress and a feeling of depression indirectly affect HRQoL. Hyperlipidemia, self-reported neck pain, cardiovascular disease, gastric ulcer, and poor sleep also had a significant negative impact on HRQoL.
Habitat Selection and Activity Pattern of GPS Collared Sumateran Tigers
Directory of Open Access Journals (Sweden)
Dolly Priatna
2012-12-01
Full Text Available Although translocation has been used in mitigating human-carnivore conflict for decades, few studies have been conducted on the behavioral ecology of released animals. Such information is necessary in the context of sustainable forest management. In this study we determine the type of land cover used as main habitat and examine the activity pattern of translocated tigers. Between 2008 and 2010 we captured six conflict tigers and translocated them 74-1,350 km from their capture sites in Sumatera. All tigers were fitted with global positioning system (GPS collars. The collars were set to fix 24-48 location coordinates per day. All translocated tigers showed a preference for a certain habitat type within their new home range, and tended to select the majority of natural land cover type within the landscape as their main habitat, but the availability of natural forest habitat within the landscape remains essensial for their survival. The activity of male translocated tigers differed significantly between the six time intervals of 24 hours, and their most active periods were in the afternoon (14:00-18:00 hours and in the evening (18:00-22:00 hours. Despite being preliminary, the findings of this study-which was the first such study conducted in Sumatera-highlight the conservation value of tiger translocation and provide valuable information for improving future management of conflict tigers.Keywords: activity pattern, GPS collars, habitat selection, sumateran tiger, translocation
Design and testing of a GPS/GSM collar prototype to combat cattle rustling
Directory of Open Access Journals (Sweden)
Francesco M. Tangorra
2013-10-01
Full Text Available Rustling is an age-old practice that was widespread in Italy until the first half of the 20th century. Today, incidents of cattle rustling are again being reported. However, the problem is not only found in Italy. It is also becoming a plague for ranchers in the US and is still rampant in East Africa. In Italy, the cattle rustling phenomena have usually been limited through the direct control of the herdsmen. Global positioning system (GPS and geographic information system (GIS combined technologies are increasingly applied for tracking and monitoring livestock with greater spatial and temporal resolution. However, so far, no case studies of the use of GPS technology to combat cattle rustling have been reported in the literature. The aim of this research was to develop a GPS/GSM (global system for mobile communication collar, using commercial hardware and implementing a specific software [ARVAshepherd 1.0; ARVAtec Srl, Rescaldina (MI, Italy] to track animals’ movements outside their grazing area and to signal when animals are straying outside virtual perimeters. A phase I study was conducted from January to June 2011 to build the GPS/GSM collar and to assess its performances in terms of GPS accuracy and precision, while a phase II study was conducted in July 2011 to test the GPS collar under real-life operating conditions. The static GPS positioning error achieved a circular error probable (50% and horizontal 95% accuracy of 1.462 m and 4.501 m, respectively. This is comparable with values obtained by other authors in static tests of a commercial GPS collar for grazing studies. In field tests, the system was able to identify the incorrect position of the cattle and the warning messages were sent promptly to the farmer, continuing until the animals had been repositioned inside the fence, thus highlighting the potential of the GPS/GSM collar as an anti-theft system.
Work Identity and Marital Adjustment in Blue-Collar Men.
Gaesser, David L.; Whitbourne, Susan Krauss
1985-01-01
Investigated the relationship between work-identity and satisfaction and marital adjustment in 40 married male blue-collar workers, ages 25 to 41 years. Satisfaction with extrinsic work factors related to marital adjustment, while satisfaction with intrinsic work factors negatively related to secondary role salience. Age negatively related to…
Neutron collar calibration for assay of LWR [light-water reactor] fuel assemblies
International Nuclear Information System (INIS)
Menlove, H.O.; Pieper, J.E.
1987-03-01
The neutron-coincidence collar is used for the verification of the uranium content in light-water reactor fuel assemblies. An AmLi neutron source is used to give an active interrogation of the fuel assembly to measure the 235 U content, and the 238 U content is verified from a passive neutron-coincidence measurement. This report gives the collar calibration data of pressurized-water reactor and boiling-water reactor fuel assemblies. Calibration curves and correction factors are presented for neutron absorbers (burnable poisons) and different fuel assembly sizes. The data were collected at Exxon Nuclear, Franco-Belge de Fabrication de Combustibles, ASEA-Atom, and other nuclear fuel fabrication facilities
Directory of Open Access Journals (Sweden)
Stanneck Dorothee
2012-04-01
Full Text Available Abstract Background The control of tick and flea burdens in dogs and cats has become essential to the control of important and emerging vector borne diseases, some of which are zoonoses. Flea worry and flea bite hypersensitivity are additionally a significant disease entity in dogs and cats. Owner compliance in maintaining the pressure of control measures has been shown to be poor. For these reasons efforts are continuously being made to develop ectoparasiticides and application methods that are safe, effective and easy to apply for pet owners. A new polymer matrix collar has recently been developed which is registered for 8 months use in cats and dogs. The basic properties of this collar have been investigated in several in vitro and in vivo studies. Methods The effects of imidacloprid, flumethrin and the combination were evaluated in vitro by means of whole cell voltage clamp measurement experiments conducted on isolated neuron cells from Spodoptera frugiperda. The in vitro efficacy of the two compounds and the combination against three species of ticks and their life stages and fleas were evaluated in a dry surface glass vial assay. The kinetics of the compounds over time in the collar were evaluated by the change in mass of the collar and measurement of the surface concentrations and concentrations of the actives in the collar matrix by HPLC. Hair clipped from collar treated dogs and cats, collected at various time points, was used to assess the acaricidal efficacy of the actives ex vivo. Results An in vitro isolated insect nerve model demonstrated the synergistic neurotoxic effects of the pyrethroid flumethrin and the neonicotinoid imidacloprid. An in vitro glass vial efficacy and mortality study against various life stages of the ticks Ixodes ricinus, Rhipicephalus sanguineus and Dermacentor reticulatus and against the flea (Ctenocephalides felis demonstrated that the combination of these products was highly effective against these
2012-01-01
Background The control of tick and flea burdens in dogs and cats has become essential to the control of important and emerging vector borne diseases, some of which are zoonoses. Flea worry and flea bite hypersensitivity are additionally a significant disease entity in dogs and cats. Owner compliance in maintaining the pressure of control measures has been shown to be poor. For these reasons efforts are continuously being made to develop ectoparasiticides and application methods that are safe, effective and easy to apply for pet owners. A new polymer matrix collar has recently been developed which is registered for 8 months use in cats and dogs. The basic properties of this collar have been investigated in several in vitro and in vivo studies. Methods The effects of imidacloprid, flumethrin and the combination were evaluated in vitro by means of whole cell voltage clamp measurement experiments conducted on isolated neuron cells from Spodoptera frugiperda. The in vitro efficacy of the two compounds and the combination against three species of ticks and their life stages and fleas were evaluated in a dry surface glass vial assay. The kinetics of the compounds over time in the collar were evaluated by the change in mass of the collar and measurement of the surface concentrations and concentrations of the actives in the collar matrix by HPLC. Hair clipped from collar treated dogs and cats, collected at various time points, was used to assess the acaricidal efficacy of the actives ex vivo. Results An in vitro isolated insect nerve model demonstrated the synergistic neurotoxic effects of the pyrethroid flumethrin and the neonicotinoid imidacloprid. An in vitro glass vial efficacy and mortality study against various life stages of the ticks Ixodes ricinus, Rhipicephalus sanguineus and Dermacentor reticulatus and against the flea (Ctenocephalides felis) demonstrated that the combination of these products was highly effective against these parasites. The release kinetics of
Oseni, Abidemi; Kakavas, Georg; Scholz, Martin; Petridis, Athanasios
2016-06-17
In patients with C2 rheumatoid pannus with spinal cord compression the treatment of choice is extensive surgery either through a transoral resection of the dens axis or a dorsal stabilisation, or both. We present a case of an 11-mm rheumatoid pannus with significant compression of the spinal cord, which failed surgical treatment with respect to dorsal stabilisation. Therefore, rigid cervical collar for 8 weeks followed by soft collar for another 4 weeks was chosen as a treatment option. During the follow-up period of 1 year, the pannus reduced significantly and the spinal cord decompressed. In cases where surgery is not an option or is technically very demanding, the alternative of cervical collar immobilisation is a satisfying option.
Yuan, Weihong; Leach, James; Maloney, Thomas; Altaye, Mekibib; Smith, David; Gubanich, Paul J; Barber Foss, Kim D; Thomas, Staci; DiCesare, Christopher A; Kiefer, Adam W; Myer, Gregory D
2017-08-15
Emerging evidence indicates that repetitive head impacts, even at a sub-concussive level, may result in exacerbated or prolonged neurological deficits in athletes. This study aimed to: 1) quantify the effect of repetitive head impacts on the alteration of neuronal activity based on functional magnetic resonance imaging (fMRI) of working memory after a high school football season; and 2) determine whether a neck collar that applies mild jugular vein compression designed to reduce brain energy absorption in head impact through "slosh" mitigation can ameliorate the altered fMRI activation during a working memory task. Participants were recruited from local high school football teams with 27 and 25 athletes assigned to the non-collar and collar group, respectively. A standard N-Back task was used to engage working memory in the fMRI at both pre- and post-season. The two study groups experienced similar head impact frequency and magnitude during the season (all p > 0.05). fMRI blood oxygen level dependent (BOLD) signal response (a reflection of the neuronal activity level) during the working memory task increased significantly from pre- to post-season in the non-collar group (corrected p working memory related brain activity, as well as a potential protective effect that resulted from the use of the purported brain slosh reducing neck collar in contact sports.
Ovarian folliculogenesis in collared peccary: Pecari tajacu (Artiodactyla: Tayassuidae
Directory of Open Access Journals (Sweden)
Diva Anelie Guimarães
2012-03-01
Full Text Available The sustainability and production of collared peccary (Pecari tajacu has been studied in the last few years; however, further information on its reproduction is necessary for breeding systems success. Understanding folliculogenesis aspects will contribute to effective reproductive biotechniques, which are useful in the preservation and production of wildlife. The aim of this study was to evaluate the ovarian folliculogenesis in collared peccary. Ovaries from six adult females of collared peccary were obtained through ovariectomy and analyzed. These were fixed in aqueous Bouin’s solution and sectioned into 7μm slices, stained with hematoxilin-eosin and analyzed by light microscopy. The number of pre-antral and antral follicles per ovary was estimated using the Fractionator Method. The follicles, oocytes and oocyte nuclei were measured using an ocular micrometer. Results showed that the length, width, thickness, weight, and the gross anatomy of the right and left ovaries were not significantly different. However, the mean number of corpora lutea was different between the phases of the estrous cycle (pLa sustentabilidad y la producción de pecarí de collar (Pecari tajacu han sido estudiados en los últimos años, sin embargo, más información sobre su reproducción es necesaria para el éxito de los sistemas de crianza . La comprensión de los aspectos relacionados con la foliculogénesis contribuirá con la aplicación de biotécnicas de reproducción, las cuales son útiles en la preservación y la producción de la vida silvestre. El objetivo de este estudio fue obtener datos sobre la población folicular del ovario de pecarí de collar. En relación con la población folicular en el ovario derecho, los valores de los folículos primordiales y primarios fueron similares, pero se observó que había una diferencia significativa (p<0.05 con el secundario. En el ovario izquierdo, la fase folicular presentó diferencias significativas (p<0
FORTY PLUS CLUBS AND WHITE-COLLAR MANHOOD DURING THE GREAT DEPRESSION
Directory of Open Access Journals (Sweden)
Gregory Wood
2008-01-01
Full Text Available As scholars of gender and labor have argued, chronic unemployment during the Great Depression precipitated a “crisis” of masculinity, compelling men to turn towards new industrial unions and the New Deal as ways to affirm work, breadwinning, and patriarchy as bases for manhood. But did all men experience this crisis? During the late 1930s, white-collar men organized groups called “Forty Plus Clubs” in response to their worries about joblessness and manhood. The clubs made it possible for unemployed executives to find new jobs, while at the same time recreating the male-dominated culture of the white-collar office. For male executives, Forty Plus Clubs precluded the Depression-era crisis of manhood, challenging the idea that the absence ofpaid employment was synonymous with the loss of masculinity.
Why "Working Smarter" Isn't Working: White-Collar Productivity Improvement.
Shaw, Edward
2001-01-01
Discusses the productivity and work days of white collar workers. Topics include productivity improvement; task analysis; the amount of time spent reading, and how to reduce it by improving writing skills; time spent in meetings; empowered time management; and sustaining a climate for change. (LRW)
E.C. Alexopoulos (Evangelos); A. Burdorf (Alex)
2001-01-01
textabstractOBJECTIVES: To analyze factors that determine the occurrence of sickness absence due to respiratory disorders and the time it takes to return to work. METHODS: A longitudinal study with 2 year follow up was conducted among 326 male blue collar and white
International Nuclear Information System (INIS)
Menlove, H.O.
1981-08-01
An active neutron interrogation method has been developed for the measurement of 235 U content in fresh fuel assemblies. The neutron Coincidence Collar uses neutron interrogation with an AmLi neutron source and coincidence counting the induced fission reaction neutrons from the 235 U. This manual describes the system components, operation, and performance characteristics. Applications of the Coincidence Collar to PWR and BWR types of reactor fuel assemblies are described
Jubran, Amal; Grant, Brydon J B; Duffner, Lisa A; Collins, Eileen G; Lanuza, Dorothy M; Hoffman, Leslie A; Tobin, Martin J
2013-02-20
Patients requiring prolonged mechanical ventilation (>21 days) are commonly weaned at long-term acute care hospitals (LTACHs). The most effective method of weaning such patients has not been investigated. To compare weaning duration with pressure support vs unassisted breathing through a tracheostomy collar in patients transferred to an LTACH for weaning from prolonged ventilation. Between 2000 and 2010, a randomized study was conducted in tracheotomized patients transferred to a single LTACH for weaning from prolonged ventilation. Of 500 patients who underwent a 5-day screening procedure, 316 did not tolerate the procedure and were randomly assigned to receive weaning with pressure support (n = 155) or a tracheostomy collar (n = 161). Survival at 6- and 12-month time points was also determined. Primary outcome was weaning duration. Secondary outcome was survival at 6 and 12 months after enrollment. Of 316 patients, 4 were withdrawn and not included in analysis. Of 152 patients in the pressure-support group, 68 (44.7%) were weaned; 22 (14.5%) died. Of 160 patients in the tracheostomy collar group, 85 (53.1%) were weaned; 16 (10.0%) died. Median weaning time was shorter with tracheostomy collar use (15 days; interquartile range [IQR], 8-25) than with pressure support (19 days; IQR, 12-31), P = .004. The hazard ratio (HR) for successful weaning rate was higher with tracheostomy collar use than with pressure support (HR, 1.43; 95% CI, 1.03-1.98; P = .033) after adjusting for baseline clinical covariates. Use of the tracheostomy collar achieved faster weaning than did pressure support among patients who did not tolerate the screening procedure between 12 and 120 hours (HR, 3.33; 95% CI, 1.44-7.70; P = .005), whereas weaning time was equivalent with the 2 methods in patients who did not tolerate the screening procedure within 0 to 12 hours. Mortality was equivalent in the pressure-support and tracheostomy collar groups at 6 months (55.92% vs 51.25%; 4.67% difference, 95
DEFF Research Database (Denmark)
Hansen, Åse Marie; Blangsted, Anne Katrine; Hansen, Ernst Albin
2010-01-01
The aim of the present study is to examine the association between physical activity and perceived job demand, job control, perceived stress and energy, and physiological arousal reflected by morning and evening concentrations of cortisol in saliva among white-collar workers.......The aim of the present study is to examine the association between physical activity and perceived job demand, job control, perceived stress and energy, and physiological arousal reflected by morning and evening concentrations of cortisol in saliva among white-collar workers....
Rhee, Eun-Jung; Cho, Jung-Hwan; Kwon, Hyemi; Park, Se Eun; Park, Cheol-Young; Oh, Ki-Won; Park, Sung-Woo; Lee, Won-Young
2017-12-01
The hemoglobin glycation index (HGI) is known to be correlated with the risk for cardiovascular disease. To analyze the association between incident coronary artery calcification (CAC) and the changes in HGI among participants without diabetes, over 4 years. A retrospective study of 2052 nondiabetic participants in whom the coronary artery calcium score was measured repeatedly over 4 years, as part of a health checkup program in Kangbuk Samsung Hospital in Korea, and who had no CAC at baseline. The HGI was defined as the difference between the measured and predicted hemoglobin A1c (HbA1c) levels. A total of 201 participants developed CAC after 4 years, and the mean baseline HGI was significantly higher in those patients. The incidence of CAC gradually increased from the first to the fourth quartile groups of baseline HGI. The odds ratio (OR) for incident CAC was the highest among the four groups divided by the quartiles of the baseline HGI and was significant after adjustment for confounding variables (vs first quartile group: OR, 1.632; 95% confidence interval, 1.024 to 2.601). The incidence of and risk for CAC development were significantly higher than in other groups compared with the low-to-low group after adjustment for confounding factors; however, when baseline HbA1c level was included in the model, only participants with a low-to-high HGI over 4 years showed a significantly increased OR for CAC development compared with the low-to-low group (OR, 1.722; 95% confidence interval, 1.046 to 2.833). The participants with a high baseline HGI and consistently high HGI showed a higher risk for incident CAC than those with a low baseline HGI. An increased HGI over 4 years significantly increased the risk for CAC regardless of the baseline HbA1c levels. Copyright © 2017 Endocrine Society
Does Shoe Collar Height Influence Ankle Joint Kinematics and Kinetics in Sagittal Plane Maneuvers?
Directory of Open Access Journals (Sweden)
Yang Yang, Ying Fang, Xini Zhang, Junliang He, Weijie Fu
2017-12-01
Full Text Available The Objective of the study is to investigate the effects of basketball shoes with different collar heights on ankle kinematics and kinetics and athletic performance in different sagittal plane maneuvers. Twelve participants who wore high-top and low-top basketball shoes (hereafter, HS and LS, respectively performed a weight-bearing dorsiflexion (WB-DF maneuver, drop jumps (DJs, and lay-up jumps (LJs. Their sagittal plane kinematics and ground reaction forces were recorded using the Vicon motion capture system and Kistler force plates simultaneously. Moreover, ankle dorsiflexion and plantarflexion angles, moment, power, stiffness, and jump height were calculated. In the WB-DF test, the peak ankle dorsiflexion angle (p = 0.041 was significantly smaller in HS than in LS. Additionally, the peak ankle plantarflexion moment (p = 0.028 and power (p = 0.022 were significantly lower in HS than in LS during LJs but not during DJs. In both jumping maneuvers, no significant differences were found in the jump height or ankle kinematics between the two shoe types. According to the WB-DF test, increasing shoe collar height can effectively reduce the ankle range of motion in the sagittal plane. Although the HS did not restrict the flexion–extension performance of the ankle joint during two jumping maneuvers, an increased shoe collar height can reduce peak ankle plantarflexion moment and peak power during the push-off phase in LJs. Therefore, a higher shoe collar height should be used to circumvent effects on the partial kinetics of the ankle joint in the sagittal plane.
Effect of psychosocial factors on metabolic syndrome in male and female blue-collar workers.
Hwang, Won Ju; Lee, Chung Yul
2014-01-01
The purposes of this study were to examine the relationship between psychosocial factors and metabolic syndrome among male and female blue-collar workers, and which factors influence their metabolic syndrome by sex. A cross-sectional study was completed of 154 men and 80 women working at small companies in Korea. The data were collected through a structured questionnaire, blood test, and anthropometric and blood pressure measure. Metabolic syndrome was diagnosed from the results of blood test and the measurements of waist circumference and blood pressure. The prevalence of metabolic syndrome among male and female blue-collar workers was 24.0% and 7.5%, respectively. Multiple logistic regression analysis was performed to examine factors of metabolic syndrome associated with sex. After controlling for age, marital status, smoking, alcohol drinking, shift work, overtime work, and physical exercise, job stress (odds ratio [OR] = 3.10, P = 0.005) and risk perception (OR = 1.12, P = 0.016) were influencing factors for men, and low job stress (OR = 0.05, P = 0.04), low social support (OR = 1.51, P = 0.009), and risk perception (OR = 1.27, P = 0.023) for women. Metabolic syndrome among blue-collar workers is closely related to psychosocial factors, such as job stress, social support, and risk perception, with the effect of job stress a point of difference between men and women. Occupational health nurses should be cognizant of the importance of assessing the effect of psychosocial factors on cardiovascular risk for blue-collar workers. © 2012 The Authors. Japan Journal of Nursing Science © 2012 Japan Academy of Nursing Science.
Does Shoe Collar Height Influence Ankle Joint Kinematics and Kinetics in Sagittal Plane Maneuvers?
Yang, Yang; Fang, Ying; Zhang, Xini; He, Junliang; Fu, Weijie
2017-12-01
The Objective of the study is to investigate the effects of basketball shoes with different collar heights on ankle kinematics and kinetics and athletic performance in different sagittal plane maneuvers. Twelve participants who wore high-top and low-top basketball shoes (hereafter, HS and LS, respectively) performed a weight-bearing dorsiflexion (WB-DF) maneuver, drop jumps (DJs), and lay-up jumps (LJs). Their sagittal plane kinematics and ground reaction forces were recorded using the Vicon motion capture system and Kistler force plates simultaneously. Moreover, ankle dorsiflexion and plantarflexion angles, moment, power, stiffness, and jump height were calculated. In the WB-DF test, the peak ankle dorsiflexion angle (p = 0.041) was significantly smaller in HS than in LS. Additionally, the peak ankle plantarflexion moment (p = 0.028) and power (p = 0.022) were significantly lower in HS than in LS during LJs but not during DJs. In both jumping maneuvers, no significant differences were found in the jump height or ankle kinematics between the two shoe types. According to the WB-DF test, increasing shoe collar height can effectively reduce the ankle range of motion in the sagittal plane. Although the HS did not restrict the flexion-extension performance of the ankle joint during two jumping maneuvers, an increased shoe collar height can reduce peak ankle plantarflexion moment and peak power during the push-off phase in LJs. Therefore, a higher shoe collar height should be used to circumvent effects on the partial kinetics of the ankle joint in the sagittal plane.
Ropars, Pascale; Angers-Blondin, Sandra; Gagnon, Marianne; Myers-Smith, Isla H; Lévesque, Esther; Boudreau, Stéphane
2017-08-01
Shrub densification has been widely reported across the circumpolar arctic and subarctic biomes in recent years. Long-term analyses based on dendrochronological techniques applied to shrubs have linked this phenomenon to climate change. However, the multi-stemmed structure of shrubs makes them difficult to sample and therefore leads to non-uniform sampling protocols among shrub ecologists, who will favor either root collars or stems to conduct dendrochronological analyses. Through a comparative study of the use of root collars and stems of Betula glandulosa, a common North American shrub species, we evaluated the relative sensitivity of each plant part to climate variables and assessed whether this sensitivity is consistent across three different types of environments in northwestern Québec, Canada (terrace, hilltop and snowbed). We found that root collars had greater sensitivity to climate than stems and that these differences were maintained across the three types of environments. Growth at the root collar was best explained by spring precipitation and summer temperature, whereas stem growth showed weak and inconsistent responses to climate variables. Moreover, sensitivity to climate was not consistent among plant parts, as individuals having climate-sensitive root collars did not tend to have climate-sensitive stems. These differences in sensitivity of shrub parts to climate highlight the complexity of resource allocation in multi-stemmed plants. Whereas stem initiation and growth are driven by microenvironmental variables such as light availability and competition, root collars integrate the growth of all plant parts instead, rendering them less affected by mechanisms such as competition and more responsive to signals of global change. Although further investigations are required to determine the degree to which these findings are generalizable across the tundra biome, our results indicate that consistency and caution in the choice of plant parts are a key
The role of the State Audit Institution in prevention of white-collar crime in the public sector
Directory of Open Access Journals (Sweden)
Šuput Jelena
2014-01-01
Full Text Available In this paper, the author points out to the important role of the Serbian State Audit Institution in prevention of corruptive practices, felonies and white-collar crime in the public sector in the Republic of Serbia. Although the activity of supreme state auditors is not primarily aimed at detecting criminal offences in the public sector, their efforts and results in this area are by no means insignificant. This is due to the fact that state auditors are well-trained to interpret and apply the legal provisions from the area of public finance, public procurements and accountancy, regulating the budget system of revenues and expenditures whose violation may constitute a criminal offence within the scope of white-collar crime. Considering the fact that it is an independent and autonomous state authority, the Serbian Supreme Audit Institution should play a very important role in reducing 'the dark figures of white-collar crime'. In many cases, the fear of crime detection as well as the fear of being punished are sufficient to exert the preventive effect on the potential perpetrators of white-collar crimes. However, we have to bear in mind that the prevention of corruption and other felonies which are qualified as white-collar crime calls for a joint effort of all state institutions and citizens alike. Another fact which is very important for improving the operative quality of the Supreme Audit Institution is its membership in the International Organisation of Supreme Audit Institutions and cooperation with the Supreme Audit Institutions in other countries.
The Single Needle Lockstitch Machine. [Setting a Collar.] Module 5.
South Carolina State Dept. of Education, Columbia. Office of Vocational Education.
This module on sewing collars, one in a series on the single needle lockstitch sewing machine for student self-study, contains three sections. Each section includes the following parts: an introduction, directions, an objective, learning activities, student information, student self-check, check-out activities, and an instructor's final checklist.…
Increased lung function decline in blue-collar workers exposed to welding fumes.
Thaon, Isabelle; Demange, Valérie; Herin, Fabrice; Touranchet, Annie; Paris, Christophe
2012-07-01
There is no consensus at the present time about the effect of welding on lung function decline. This study compared lung function decline between blue-collar workers exposed and not exposed to welding fumes in a French longitudinal cohort of 21,238 subjects aged 37 to 52 years at inclusion. Medical data, occupation, sector of activity, and spirometry were recorded twice by occupational physicians in 1990 and 1995. A job-exposure matrix was used to identify 503 male blue-collar workers exposed to welding fumes and 709 control subjects and to define the weekly duration of exposure to welding fumes. Baseline lung function parameters were higher in workers exposed to welding fumes than in control subjects. After a 5-year follow-up, welding-fume exposure was associated with a nonsignificant decline in FVC (P = .06) and FEV(1) (P = .07) after adjustment for age, pack-years, BMI, and baseline value of the parameter. A significant accelerated decline in FEV(1) (P = .046) was also observed in never smokers exposed to welding fumes. An “exposure-response” relationship was observed between FEV(1) decline and weekly duration of exposure to welding fumes in nonsmokers but not in smokers. Blue-collar workers exposed to welding fumes showed accelerated decline in lung function, which, in nonsmokers, was related to weekly duration of exposure.
Job demands and health complaints in white and blue collar workers
Schreuder, K. J.; Roelen, C. A. M.; Koopmans, P. C.; Groothoff, J. W.
2008-01-01
Background: General health in the working population is thought to depend on working conditions. Objective: This survey studied job demands and health complaints in working white and blue collar employees. We expect physical and psychological job demands to be differentially distributed among white
Energy Technology Data Exchange (ETDEWEB)
Evans, Louise G., E-mail: evanslg@ornl.gov [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Swinhoe, Martyn T.; Menlove, Howard O. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Schwalbach, Peter; Baere, Paul De [European Commission, Euratom Safeguards Office (Luxembourg); Browne, Michael C. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States)
2013-11-21
Safeguards inspection measurements must be performed in a timely manner in order to detect the diversion of significant quantities of nuclear material. A shorter measurement time can increase the number of items that a nuclear safeguards inspector can reliably measure during a period of access to a nuclear facility. In turn, this improves the reliability of the acquired statistical sample, which is used to inform decisions regarding compliance. Safeguards inspection measurements should also maintain independence from facility operator declarations. Existing neutron collars employ thermal neutron interrogation for safeguards inspection measurements of fresh fuel assemblies. A new fast neutron collar has been developed for safeguards inspection measurements of fresh low-enriched uranium (LEU) fuel assemblies containing gadolinia (Gd{sub 2}O{sub 3}) burnable poison rods. The Euratom Fast Collar (EFC) was designed with high neutron detection efficiency to make a fast (Cd) mode measurement viable whilst meeting the high counting precision and short assay time requirements of the Euratom safeguards inspectorate. A fast mode measurement reduces the instrument sensitivity to burnable poison rod content and therefore reduces the applied poison correction, consequently reducing the dependence on the operator declaration of the poison content within an assembly. The EFC non-destructive assay (NDA) of typical modern European pressurized water reactor (PWR) fresh fuel assembly designs have been simulated using Monte Carlo N-particle extended transport code (MCNPX) simulations. Simulations predict that the EFC can achieve 2% relative statistical uncertainty on the doubles neutron counting rate for a fast mode measurement in an assay time of 600 s (10 min) with the available {sup 241}AmLi (α,n) interrogation source strength of 5.7×10{sup 4} s{sup −1}. Furthermore, the calibration range of the new collar has been extended to verify {sup 235}U content in variable PWR fuel
International Nuclear Information System (INIS)
Evans, Louise G.; Swinhoe, Martyn T.; Menlove, Howard O.; Schwalbach, Peter; Baere, Paul De; Browne, Michael C.
2013-01-01
Safeguards inspection measurements must be performed in a timely manner in order to detect the diversion of significant quantities of nuclear material. A shorter measurement time can increase the number of items that a nuclear safeguards inspector can reliably measure during a period of access to a nuclear facility. In turn, this improves the reliability of the acquired statistical sample, which is used to inform decisions regarding compliance. Safeguards inspection measurements should also maintain independence from facility operator declarations. Existing neutron collars employ thermal neutron interrogation for safeguards inspection measurements of fresh fuel assemblies. A new fast neutron collar has been developed for safeguards inspection measurements of fresh low-enriched uranium (LEU) fuel assemblies containing gadolinia (Gd 2 O 3 ) burnable poison rods. The Euratom Fast Collar (EFC) was designed with high neutron detection efficiency to make a fast (Cd) mode measurement viable whilst meeting the high counting precision and short assay time requirements of the Euratom safeguards inspectorate. A fast mode measurement reduces the instrument sensitivity to burnable poison rod content and therefore reduces the applied poison correction, consequently reducing the dependence on the operator declaration of the poison content within an assembly. The EFC non-destructive assay (NDA) of typical modern European pressurized water reactor (PWR) fresh fuel assembly designs have been simulated using Monte Carlo N-particle extended transport code (MCNPX) simulations. Simulations predict that the EFC can achieve 2% relative statistical uncertainty on the doubles neutron counting rate for a fast mode measurement in an assay time of 600 s (10 min) with the available 241 AmLi (α,n) interrogation source strength of 5.7×10 4 s −1 . Furthermore, the calibration range of the new collar has been extended to verify 235 U content in variable PWR fuel designs in the presence of up to
Merıç, Gökçe; Erkmen, Erkan; Kurt, Ahmet; Eser, Atilim; özden, Ahmet Utku
2011-11-01
The purpose of the study was to compare the effects of two distinct collar geometries of implants on stress distribution in the bone around the implants supporting cantilever fixed partial dentures (CFPDs) as well as in the implant-abutment complex and superstructures. The three-dimensional finite element method was selected to evaluate the stress distribution. CFPDs which was supported by microthread collar structured (MCS) and non-microthread collar structured (NMCS) implants was modeled; 300 N vertical, 150 N oblique and 60 N horizontal forces were applied to the models separately. The stress values in the bone, implant-abutment complex and superstructures were calculated. In the MCS model, higher stresses were located in the cortical bone and implant-abutment complex in the case of vertical load while decreased stresses in cortical bone and implant-abutment complex were noted within horizontal and oblique loading. In the case of vertical load, decreased stresses have been noted in cancellous bone and framework. Upon horizontal and oblique loading, a MCS model had higher stress in cancellous bone and framework than the NMCS model. Higher von Mises stresses have been noted in veneering material for NMCS models. It has been concluded that stress distribution in implant-supported CFPDs correlated with the macro design of the implant collar and the direction of applied force.
Li, Xun; Liang, Huiying; Li, Xuelian; Guan, Peng; Yin, Zhihua; Zhou, Baosen
2010-01-27
To characterize the smoking patterns of hospitality employees in blue-collar and service occupations, and to examine its relations with psychosocial work conditions. The Shenyang Hospitality Industry Employees Survey-a face-to-face cross-sectional study of representative hospitality industry employees-was conducted between March and July 2008. A total of 4,213 workers were selected using stratified random cluster sampling designs, and final analyses were performed on 2,508 blue-collar and service subjects. Multilevel-logistic regression models were used to estimate the contribution of psychosocial work conditions to smoking status. Blue-collar and service employees smoked at a rate 1.4 times that of the general population (49.4% vs. 35.8%), more particularly for females (12.9% vs. 3.08%). Strain jobs had significantly higher odds ratio of daily smoking (OR 2.09, 95%CI: 1.28-3.41) compared to the relaxed category. The passive jobs (OR 2.01, 95%CI 1.27 to 3.17), highest job demands (OR 1.72, 95%CI: 1.13-2.61), and lowest job control (OR 2.56, 95%CI: 1.57-4.16) were also associated with a significantly higher daily smoking ratio. The negative relationship between job stability and smoking behavior was slightly stronger among daily than occasional smokers. However, neither job strain nor any of its components was found to be significantly associated with occasional smoking. Smoking in hospitality blue-collar and service employees is certainly a major occupational health problem in Shenyang. This evidence also suggests an association between psychosocial-work conditions and smoking status, and implies that more intervention studies where changes in work environment are carried out in combination with health promotion interventions should be performed.
DEFF Research Database (Denmark)
Lundgren, F; Schroeder, Torben Veith
2012-01-01
The aim of this paper was to study the effect on patency rate of different types of vein collar (Miller's original or St Mary's boot), different length/height shapes of vein collar, and different vein collar volumes at the distal anastomosis of PTFE-bypass grafts to below-knee arteries in patients...
Molano Alvarez, Esteban; Murillo Pérez, María del Ara; Salobral Villegas, María Teresa; Domínguez Caballero, Mireia; Cuenca Solanas, Manuela; García Fuentes, Carlos
2004-01-01
Cervical collars are essential in the treatment of patients with suspicion or verification of acute cervical spine injury (ACSI). One of the complications of these devices is the development of pressure scores (PS). This study aims to determine its incidence in our unit, the characteristics of patients with ACSI who suffer PS due to the collar and to describe aspects related with these injuries. We include 92 patients with ACSI hospitalized more than 24 hours from January 2002 to December 2003. We analyze demographic variables, incidence, risk factors and characteristics of the PS that develop. The incidence of these lesions was 23.9%. Patients with PS presented: a higher injury severity score (ISS) (37.5 9.8 vs. 31.3 14.9), a greater percentage of catheter carriers of intracraneal pressure (ICP) (55.6% vs. 16.2%), longer time of mechanical ventilation (15.4 8.2 vs. 6.1 9) and longer stays (24.6 10.9 vs. 10 10.3), all statistically significant (pACSI, elevated ISS, monitoring of ICP, mechanical ventilation and prolonged stays is required. The occipital zone requires special attention due to the seriousness of the injuries recorded. We suggest a specific multidisciplinary protocol for this problem.
Directory of Open Access Journals (Sweden)
Hans Solli-Soether
2012-01-01
Full Text Available Knowledge and learning are important in combating financial crime generallyand white-collar crime in particular. The purpose of this research is to generateinsights into prevention approaches in practice that may reflect on acontingent approach. The five hundred largest business companies in termsof annual turnover were identified in Norway for our empirical study of whitecollarcrime. A paper letter was mailed to the chief financial officer (CFOasking him or her to fill in the questionnaire to be found on a web site usinga password found in the letter. The open-ended question in the questionnaireto CFOs about prevention of white-collar crime was formulated as follows:How can white-collar crime best be prevented in your company? Survey resultsindicate an even distribution of respondents emphasizing control and respondentsemphasizing influence. This empirical research steps back from manybest practice articles and provides insights into preferences of chief financialofficers on how to prevent white-collar crime in the company.
SUZUKI, Seitaro; YOSHINO, Koichi; TAKAYANAGI, Atsushi; ISHIZUKA, Yoichi; SATOU, Ryouichi; KAMIJO, Hideyuki; SUGIHARA, Naoki
2015-01-01
This cross-sectional study was conducted to examine tooth loss and associated factors among professional drivers and white-collar workers. The participants were recruited by applying screening procedures to a pool of Japanese registrants in an online database. The participants were asked to complete a self-reported questionnaire. A total of 592 professional drivers and 328 white-collar workers (male, aged 30 to 69 years) were analyzed. A multiple logistic regression analysis was performed to ...
Fourie, Josephus J; Crafford, Dionne; Horak, Ivan G; Stanneck, Dorothee
2013-08-01
The objective of the study was to determine the sustained effectiveness of 10 % imidacloprid and 4.5 % flumethrin, incorporated in a slow-release matrix collar, in preventing Dipylidium caninum infection in dogs after repeated laboratory infestations with fleas infected with metacestodes of this tapeworm. Efficacy against infection with D. caninum was evaluated by infesting 16 dogs with cat fleas (Ctenocephalides felis) on study days 7, 14, 21, 28, 35 and 42, from batches suitably infected with D. caninum metacestodes. Prior to each post-treatment infestation the D. caninum infection rate for the fleas was determined by microscopically examining 100 fleas for D. caninum metacestodes. The D. caninum prevalence in the fleas used for infestations ranged from 23 % to 52 %. Medicated collars were fitted to 8 of the dogs on study day 0. The weight of the IVP collars varied between 35.48 g and 38.48 g (average 37.16 g), whilst animal weight varied between 12.20 kg and 17.98 kg (treated group, n = 8, average 14.79 kg). Seven days later infestation of each of the 16 dogs with 250 fleas commenced. Infestations continued at weekly intervals until Day 42 with efficacy against fleas evaluated 24 hours after each infestation. From Days 21 to 74, infection of the dogs with D. caninum was verified (daily examination of faeces and cages for the presence of expelled proglottids). Calculation of prophylactic effectiveness of the collars in preventing infection with D. caninum was based on the difference in geometric mean numbers of scoleces between groups at necropsy on Day 75. Effective prevention of infection with D. caninum was found to be 96.6 %. Efficacy of the collars against fleas was ≥ 99.9 % for the duration of the assessment period. Newly acquired infestations of fleas are rapidly eliminated by the insecticidal components of the medicated collars over a period of several months. In the event of fleas being infected with metacestodes, with D. caninum can be prevented in
International Nuclear Information System (INIS)
Gonzalez, M.; Perez, J. M.
1996-01-01
The aim of the present work is to describe the steps followed to fabricate an ionizing radiation detector based on synthetic mercuric iodide monocrystal layers. Firstly, the crystalline orientation method has been describe, which is needed before the layer cutting perpendicularly to the (001) crystallographic. It is also defined the proceeding to crystal face finishing by a mechanical polishing and subsequent chemical etching. then, the metal electrode deposition and the view connection has been explained. Finally, the technique followed to encapsulate the detector with a polymeric thin film deposition has been described. (Author) 10 refs
International Nuclear Information System (INIS)
Gonzalez, M.; Perez, J.M.
1996-01-01
The aim of the present work is to describe the steps followed to fabricate an ionizing radiation detector based on synthetic mercuric iodide monocrystal layers. Firstly, the crystalline orientation method has been describe, which is needed before the layer cutting perpendicullarly to the (001) crystallographyc. It is also defined the proceeding to crystal face finishing by a mechanical polishing and subsequent chemical etching. Then, the metal electrode deposition and the wire connection has been explained. Finally, the technique followed to encapsulate the detector with a polimeric thin film deposition has been described
How Blue-Collar Workers on 4-Day Workweeks Use Their Time
Maklan, David Mark
1977-01-01
Describes a study of the behavior of male blue-collar workers on 4-day workweeks, revealing that they participate in the same activities as similar 5-day workers. Discussion focuses on the impact of the 4-day week on use of time and on the individual's satisfaction with leisure activities. (TA)
Biometric monitor with electronics disposed on or in a neck collar
2012-01-01
A highly portable biometric monitor is disclosed. At least one remote sensor member (12, 12') includes one or more biometric sensors (20, 22, 24, 25) configured for operative coupling with a patient. A neck collar (14, 114, 214, 314, 414) includes electronics (36, 40, 42, 44, 46, 48) for operating
Jubran, Amal; Grant, Brydon J.B.; Duffner, Lisa A.; Collins, Eileen G.; Lanuza, Dorothy M.; Hoffman, Leslie A.; Tobin, Martin J.
2013-01-01
Context Patients requiring prolonged mechanical ventilation (more than 21 days) are commonly weaned at long-term acute care hospitals (LTACHs). The most effective method of weaning such patients has not been investigated. Objective To compare weaning duration with pressure support versus unassisted breathing through a tracheostomy (trach collar) in patients transferred to a LTACH for weaning from prolonged ventilation. Design, Settings, and Participants Between 2000 and 2010, a randomized study was conducted in tracheotomized patients transferred to a single LTACH for weaning from prolonged ventilation. Of 500 patients who underwent a five-day screening procedure, 316 failed and were randomly assigned to wean with pressure support (n=155) or a trach collar (n=161). Six- and twelve-month survival was also determined. Main outcome measure Primary outcome was weaning duration. Secondary outcome was survival at six and twelve months after enrollment. Results Of 316 patients, four were withdrawn and not included in analysis. Of 152 patients in the pressure-support arm, 68 (44.7%) were weaned; 22 (14.5%) died. Of 160 patients in the trach-collar arm, 85 (53.1%) were weaned; 16 (10.0%) died. Median weaning time was shorter with trach collar than with pressure support: 15 [interquartile range, 8–25] versus 19 [12–31] days, p=0.004. The hazard ratio (HR) for successful weaning rate was higher with trach collar than with pressure support (HR, 1.43; 95% confidence interval [CI], 1.03–1.98, p<0.03) after adjusting for baseline clinical covariates. Trach collar achieved faster weaning than did pressure support among subjects who failed the screening procedure at 12–120 hours (HR, 3.33; 95% CI, 1.44–7.70, p<0.01), whereas weaning time was equivalent with the two methods in patients who failed the screening procedure within 0–12 hours. Mortality was equivalent in the pressure-support and trach-collar arms at six months (55.9% versus 51.3%; 4.7 difference, 95% CI −6
Januario, Leticia B; Batistao, Mariana V; Coury, Helenice Jcg; Oliveira, Ana Beatriz; Sato, Tatiana O
2014-01-01
The aim of this study was to evaluate musculoskeletal and psychosocial perception and compare these conditions regarding the type of job (white or blue-collar) and the type of management model (private or public). Forty-seven public white-collar (PuWC), 84 private white-collar (PrWC) and 83 blue-collar workers (PrBC) were evaluated. Job Content Questionnaire (JCQ) and Utrecht Work Engagement Scale (UWES) were applied to evaluate psychosocial factors. Nordic Musculoskeletal Questionnaire (NMQ) was used to assess musculoskeletal symptoms. Pressure Pain Threshold (PPT) was measured to evaluate sensory responses. According to JCQ, all groups were classified as active profile. There was a significant association between work engagement and workers' categories (p workers had the highest scores for all the UWES domains, while PrBC had the lowest ones. PPT showed that PrBC workers had an increased sensitivity for left deltoid (p workers had an increased sensitivity for both epicondyles than PuWC (right p 0.05). This study showed differences in psychosocial risk factors and musculoskeletal symptoms in workers engaged in different types of jobs and work organization. Personal and work-related characteristics, psychosocial factors and PPT responses were different across workers' group. Despite all, there was no significant difference in reported symptoms across the groups, possibly indicating that the physical load is similar among the sectors.
Directory of Open Access Journals (Sweden)
Roseli Chela Fenille
1999-10-01
Full Text Available Foram avaliados, em casa de vegetação, os efeitos das seguintes variáveis sobre a patogenicidade de Rhizoctonia solani GA-4 HGI a plantas de feijão (Phaseolus vulgaris L., em solo artificialmente infestado: presença de materiais orgânicos com diferentes relações C:N (torta de mamona e bagaço de cana; níveis de decomposição da matéria orgânica, e condições de umidade do solo incorporado. A umidade do solo até o momento da semeadura foi mantida sob duas condições: 20% ou acima de 80% da capacidade de campo. Foram realizadas semeaduras aos 0, 7, 14, 21, 28 e 35 dias após inoculação e incorporação. As avaliações foram realizadas 14 dias após cada semeadura. O material com baixa relação C:N propiciou o aumento da incidência de R. solani no feijoeiro, enquanto o material com alta relação C:N não interferiu na incidência do patógeno. A incidência de R. solani no feijoeiro, em solo incorporado, foi independente da condição de umidade.The pathogenicity of Rhizoctonia solani AG-4 HGI on bean (Phaseolus vulgaris L. plants was evaluated, in artificially infested soil under greenhouse conditions, when submitted to the following treatments: amendments with different C:N ratios (castor-oil cake and sugar-cane bagasse; different organic matter decomposition levels; different moisture contents of the amended soil. Until the moment of sowing the soil moisture was maintained at 20% of the moisture-holding capacity or above 80%. The sowings were made at 0, 7, 14, 21, 28 and 35 days after the inoculation and amendments incorporation. Evaluations were carried out 14 days after each sowing date. The amendment with low C:N ratio increased the incidence of R. solani on bean plants, in any decomposition level, whereas the amendment with high C:N ratio did not interfere on the incidence of the pathogen. The incidence of R. solani on bean plants, in a soil amended with both castor-oil cake or sugar-cane bagasse, was independent of the
Original Paper Effects of oxen yoke and donkey collar on traction ...
African Journals Online (AJOL)
The realization of mechanized zaï with draft animal encounters the weakness of hitch traction capabilities. To overcome this issue, a study was conducted in three villages in the northern Burkina Faso with the aim at evaluating the effect of improved yoke and improved collar respectively with oxen and donkey harnessing on ...
Terregino, Calogero; Cattoli, Giovanni; Grossele, Barbara; Bertoli, Elena; Tisato, Ernesto; Capua, Ilaria
2003-02-01
Eurasian collared doves (Streptopelia decaocto) are thought to originate from India and they have colonized, throughout the centuries, the Middle East and, more recently, Mediterranean countries such as Italy and Spain. In the present paper we report of the isolation and characterization of Newcastle disease viruses (NDV) obtained from Eurasian collared doves during 2000-2001, and compare them to isolates obtained from feral pigeons (Columba livia) during the same period. All isolates could be classified as avian paramyxovirus type 1 (APMV1) and belonged to the pigeon variant group (PPMV1), as their haemagglutinating activity was inhibited by mAb 161/617 which is specific for PPMV1. The intracerebral pathogenicity indices ranged from 0.68 to 1.38 and all isolates contained multiple basic amino acids at the deduced cleavage site of the fusion protein, which is a typical feature of virulent viruses. Phylogenetic analysis of the isolates indicate that 18/20 of these form a separate cluster from the isolates obtained from pigeons in the same period. These findings suggest that different lineages are circulating in feral pigeon populations, and that a separate lineage affects Eurasian collared doves.
Heijden, van der G.A.H.; Schepers, J.J.L.; Nijssen, E.J.
2012-01-01
The purpose of this study is to investigate white collar employees' temporary relief strategies to workplace boredom. Building on self-regulation theory we define two responses: engaging in distraction and work indifference. We also investigate whether some individuals are more likely to engage in
Breeze, John; Allanson-Bailey, L C; Hunt, N C; Delaney, R; Hepper, A E; Lewis, E A
2015-03-01
Protecting the neck from explosively propelled fragments has traditionally been achieved through a collar attached to the ballistic vest. An Enhanced Protection Under Body Armour Combat Shirt (EP-UBACS) collar has been identified as an additional method of providing neck protection but limited evidence as to its potential medical effectiveness exists to justify its procurement. Entry wound locations and resultant medical outcomes were determined using Abbreviated Injury Scale (AIS) for all fragmentation neck wounds sustained by UK soldiers between 01 January 2010 and 31 December 2011. Data were prospectively entered into a novel computerised tool base and comparisons made between three EP-UBACS neck collar designs in terms of predicted reduction in AIS scores. All collars reduced AIS scores, with the greatest reduction provided by designs incorporating increased standoff from the neck and an additional semi-circle of ballistic material underneath the collar at the front and back. This technique confirms that reinforcing the neck collar of an EP-UBACS would be expected to reduce injury severity from neck wounds. However, without knowledge of entry wound locations for injuries to other body areas as well as the use of AIS scores without clinical or pathological verification its further use in the future may be limited. The ability to overlay any armour design onto a standardised human was potentially the most useful part of this tool and we would recommend developing this technique using underlying anatomical structures and not just the skin surface. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://group.bmj.com/group/rights-licensing/permissions.
Krantz, Gunilla; Berntsson, Leeni; Lundberg, Ulf
2005-04-01
The aim of this study was to analyse how paid work, unpaid household tasks, child care, work-child care interactions and perceived work stress are associated with reported symptoms in male and female white-collar employees. A questionnaire was mailed to 1300 men and 1300 women belonging to the white-collar sector, with at least 35 hours of regular employment a week and a participant age of between 32 and 58 years. It contained items relating to total workload (hours spent on paid work, unpaid household tasks and childcare), subjective indices for work stress and symptoms. The response rate was 65% (743 women; 595 men). Gender difference in symptom prevalence was tested by analyses of variance. Odds ratios were used to estimate the bivariate associations between work-related variables and symptom prevalence. A multivariate analysis estimated the effect of paid and unpaid work interaction, work-childcare interplay and possible synergy. The frequency and severity of symptoms was higher in women than in men (P women's health was determined by the interaction between conditions at work and household duties (OR 2.09; 1.06-4.14), whereas men responded more selectively to long working hours, i.e. >50 h/week (OR 1.61; 1.02-2.54). However, childcare (women.
Directory of Open Access Journals (Sweden)
Alana A. Borges
Full Text Available ABSTRACT: The cryopreservation of somatic tissue in collared peccaries promotes an alternative source of genetic material of this specie. The solid-surface vitrification (SSV is a great option for tissue conservation; nevertheless, the optimization of SSV requirements is necessary, especially when referred to cryoprotectants that will compose the vitrification solution. Therefore, the aim was to evaluate the effect of the presence of 0.25 M sucrose in addition to different combinations (only or association and concentrations (1.5 M or 3.0 M of ethylene glycol (EG and/or dimethyl sulfoxide (DMSO in the somatic tissue vitrification of collared peccaries. Subsequently, we tested six combinations of cryoprotectants with or without sucrose in Dulbecco modified Eagle medium (DMEM plus 10% fetal bovine serum (FBS. Thus, 3.0 M EG with sucrose was able to maintain normal tissue characteristics compared with non-vitrified (control, especially for the volumetric ratio of epidermis (61.2 vs. 58.7% and dermis (34.5 vs. 36.6%, number of fibroblast (90.3 vs. 127.0, argyrophilic nucleolar organizer region (AgNOR ratio (0.09 vs. 0.17% and nucleus area (15.4 vs. 14.5 μm2 respectively. In conclusion, 3.0 M EG with 0.25 M sucrose and 10% FBS resulted in a better cryoprotectant composition in the SSV for somatic tissue of collared peccaries.
Fatigue as prognostic risk marker of mental sickness absence in white collar employees.
Roelen, C A M; Heymans, M W; van Rhenen, W; Groothoff, J W; Twisk, J W R; Bültmann, U
2014-06-01
To investigate fatigue as prognostic risk marker for identifying working employees at risk of long-term sickness absence (SA). At baseline, fatigue was measured in 633 white collar employees with the checklist individual strength (CIS) including scales for fatigue severity, reduced concentration, reduced motivation, and reduced physical activity. SA was medically certified by an occupational physician in the 3rd or 4th SA week with diagnostic codes according to the 10th version of the International Classification of Diseases. Medically certified SA was retrieved at the individual level from an occupational health register after 1-year follow-up. CIS scores were investigated as prognostic risk markers predicting medically certified SA and particularly SA certified as mental SA. 614 employees (N = 378 men and N = 236 women) had complete data and were eligible for analysis; 63 (10 %) had medically certified SA of whom 39 (6 %) had mental SA. Fatigue severity and total CIS scores were associated with medically certified SA in men, but poorly discriminated between men with and without medically certified SA. Fatigue severity, reduced concentration, reduced motivation, and total CIS scores were also associated with mental SA in men. CIS and its reduced concentration scale were valid prognostic risk markers of mental SA. CONCLUSION Fatigue was a prognostic risk marker of mental SA in white collar men. The CIS should be further validated as a screening tool for the risk of mental SA in white collar working populations.
Calvo-Guirado, José Luis; López-López, Patricia Jara; Maté Sánchez de Val, José Eduardo; Mareque-Bueno, Javier; Delgado-Ruiz, Rafael Arcesio; Romanos, Georgios E
2015-07-01
The study aims to assess the soft tissue level (STL) and crestal bone level (CBL), of titanium dental implants with different mixed collar abutments configurations. This study included 48 implants with the same dimensions. They were divided into two groups of 24 implants each one: implants with a polished collar of 2 mm plus a roughened area of 0.8 mm (CONTROL) and implants with a polished collar of 0.8 mm plus a micro-threated and roughened area of 2 mm (TEST). The implants were inserted randomly in the post-extraction sockets of P2, P3, P4, and M1 bilaterally in the lower jaw of six foxhound dogs. STL and CBL were evaluated after 8 and 12 weeks by histology and histometry. All implants were clinically and histologically osseointegrated. Healing patterns examined microscopically at 8 and 12 weeks for both groups yielded similar qualitative findings for the STL evaluation, without significant differences between groups (P > 0.05). CBL was significantly higher in the buccal side in comparison with the lingual side for both groups (P implant shoulder to the top of the bony crest) and IS-C (distance from the implant shoulder to the first bone-to-implant contact) values significantly higher for control group in comparison with test (P < 0.05). At 12 weeks, CBL showed increased values for both groups that were higher in controls group in comparison with test (P < 0.05). Bony crest resorption could not be avoided both at test and control sites. However, the neck conformation at the test sites reduced the buccal bone resorption. Soft tissue dimensions were similar both at the test and control sites. © 2014 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
Meriç, Gökçe; Erkmen, Erkan; Kurt, Ahmet; Eser, Atilim; Ozden, Ahmet Utku
2012-01-01
The purpose of the study was to compare the effects of two distinct collar geometries of implants on stress distribution in the bone as well as in the fixture-abutment complex, in the framework and in the veneering material of 3-unit fixed partial denture (FPD). The 3-dimensional finite element analysis method was selected to evaluate the stress distribution in the system composed of 3-unit FPD supported by two different dental implant systems with two distinct collar geometries; microthread collar structure (MCS) and non-microthread collar structure (NMCS). In separate load cases, 300 N vertical, 150 N oblique and 60 N horizontal, forces were utilized to simulate the multidirectional chewing forces. Tensile and compressive stress values in the cortical and cancellous bone and von Mises stresses in the fixture-abutment complex, in the framework and veneering material, were simulated as a body and investigated separately. In the cortical bone lower stress values were found in the MCS model, when compared with NMCS. In the cancellous bone, lower stress values were observed in the NMCS model when compared with MCS. In the implant-abutment complex, highest von Mises stress values were noted in the NMCS model; however, in the framework and veneering material, highest stress values were calculated in MCS model. MCS implants when compared with NMCS implants supporting 3-unit FPDs decrease the stress values in the cortical bone and implant-abutment complex. The results of the present study will be evaluated as a base for our ongoing FEA studies focused on stress distribution around the microthread and non-microthread collar geometries with various prosthesis design.
Archibald, Reid S.
A novel flame spray collar called the Coanda Assisted Spray Manipulation collar (CSM) has been tested for use on the Sulzer Metco 5P II combustion flame spray gun. A comparison study of the stock nozzle and the CSM has been performed by evaluating the porosity, surface roughness, microhardness, tensile strength and microscopy of normal and off-normal sprayed NiAl deposits. The use of the CSM collar resulted in the need to position the sprayed coupons closer to the gun, which in turn affected the particle impact energy and particle temperatures of the NiAl powder. For the CSM, porosities had a larger scatterband, surface roughness was comparably the same, microhardness was lower, and tensile strength was higher. The microscopy analysis revealed a greater presence of unmelted particles and steeper intersplat boundaries for the CSM. For both processes, the porosity and surface roughness increased and the microhardness decreased as the spray angle decreased.
Ahmad, Kamarul Zaman; Bakar, Raida Abu
2003-01-01
Responses from 204 of 300 Malaysian white-collar workers were analyzed for the association between training variables (availability of support, benefits, motivation, environment) and four types of organizational commitment. All training variables were significantly correlated with affective, normative, and overall commitment. Availability of…
The impact of long working hours on psychosocial stress response among white-collar workers.
Lee, Kyungjin; Suh, Chunhui; Kim, Jong-Eun; Park, Jae Oh
2017-02-07
This study examined the association between long working hours and psychosocial stress responses. In total, 1,122 white-collar workers from a company in Korea completed self-administered questionnaires following a lecture about the study aim, procedures, and confidentiality. Psychosocial stress responses were evaluated using the Psychosocial Well-being Index - Short Form (PWI-SF), and psychosocial working conditions were evaluated with the Korean Occupational Stress Scale - Short Form (KOSS-SF). Multivariate logistic regression analysis was performed after adjusting for demographic variables and psychosocial working conditions to examine associations between long working hours and psychosocial stress responses. In comparison with the reference group, which worked 40-44 hours per week, the crude odds ratio (OR) of the respondents who worked 60 or more hours was 4.56 (95% confidence interval (CI), 2.55-8.15) in terms of psychosocial stress responses. After adjusting for demographic variables, the adjusted OR of those working ≥60 hours was 5.61 (95% CI, 3.01-10.47). After adjusting for both demographic variables and psychosocial working conditions, the adjusted OR of those working ≥60 hours was 3.25 (95% CI, 1.56-6.79). This study found that long working hours are significantly related to psychosocial stress responses among white-collar workers in one Korean company.
Wolever, Thomas M S; Chiasson, Jean-Louis; Josse, Robert G; Leiter, Lawrence A; Maheux, Pierre; Rabasa-Lhoret, Rémi; Rodger, N Wilson; Ryan, Edmond A
2017-04-01
To determine the long-term effects of changing the amount or source of dietary carbohydrate on quality of life (QOL), symptoms and dietary satisfaction in people with type 2 diabetes. Subjects with diabetes treated by diet alone (n=162) were randomly assigned to high-carbohydrate/high-glycemic-index (HGI) diets; high-carbohydrate/low-glycemic-index (LGI) diets; or lower-carbohydrate/high-monounsaturated-fat (LC) diets for 1 year. We measured QOL at baseline and at study's end, and we measured symptoms and dietary satisfaction quarterly. The HGI, LGI and LC diets contained, respectively, 47±1, 52±1 and 40±1% energy carbohydrate; 30±1, 27±1 and 40±1% fat with GI 64±0.4, 55±0.4 and 59±0.4. Significantly more participants reported increased flatulence on LGI than on LC and HGI diets at 3 months (41%, 19%, 14%; pvs. 14%, 19%; pvs. 22%, 23%; pcarbohydrate diet than on the 50% carbohydrate diet, the LGI diet was no less satisfying than the HGI diet. Changes in appetite and dietary satisfaction may influence body weight and glycemic control, or vice-versa. Copyright © 2016 Canadian Diabetes Association. Published by Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Menlove, H.O.; Marzo, M.A.S.; de Almeida, S.G.; de Almeida, M.C.; Moitta, L.P.M.; Conti, L.F.; de Paiva, J.R.T.
1985-11-01
The neutron-coincidence collar has been evaluated for the measurement of pressurized-water reactor (PWR) fuel assemblies at the Fabrica de Elementos Combustiveis plant in Resende, Brazil. This evaluation was part of the cooperative-bilateral-safeguards technical-exchange program between the United States and Brazil. The neutron collar measures the 235 U content per unit length of full fuel assemblies using neutron interrogation and coincidence counting. The 238 U content is measured in the passive mode without the AmLi neutron-interrogation source. The extended evaluation took place over a period of 6 months with both scanning and single-zone measurements. The results of the tests gave a coincidence-response standard deviation of 0.7% (sigma = 1.49% for mass) for the active case and 2.5% for the passive case in 1000-s measurement times. The length measurement in the scanning mode was accurate to 0.77%. The accuracies of different calibration methods were evaluated and compared
"Blue-Collar Blues" uurib töösuhteid uutes oludes / Janar Ala
Ala, Janar, 1979-
2009-01-01
Tööproblemaatikat käsitlev näitus "Blue-Collar Blues" Tallinna Kunstihoones ja Tallinna Kunstihoone galeriis 31. jaanuarini 2010, kuraator Anders Härm. Lähemalt belgia-mehhiko kunstniku Francis Alys'e videost, austria kunstniku Oliver Ressleri ning venetsueela-saksa politoloogi Dario Azzelini videost "Viis tehast. Tööliste kontroll Venezuelas"
Directory of Open Access Journals (Sweden)
Gustafsson Lars
2010-12-01
Full Text Available Abstract Background Because of their functional significance, the Major Histocompatibility Complex (MHC class I and II genes have been the subject of continuous interest in the fields of ecology, evolution and conservation. In some vertebrate groups MHC consists of multiple loci with similar alleles; therefore, the multiple loci must be genotyped simultaneously. In such complex systems, understanding of the evolutionary patterns and their causes has been limited due to challenges posed by genotyping. Results Here we used 454 amplicon sequencing to characterize MHC class IIB exon 2 variation in the collared flycatcher, an important organism in evolutionary and immuno-ecological studies. On the basis of over 152,000 sequencing reads we identified 194 putative alleles in 237 individuals. We found an extreme complexity of the MHC class IIB in the collared flycatchers, with our estimates pointing to the presence of at least nine expressed loci and a large, though difficult to estimate precisely, number of pseudogene loci. Many similar alleles occurred in the pseudogenes indicating either a series of recent duplications or extensive concerted evolution. The expressed alleles showed unambiguous signals of historical selection and the occurrence of apparent interlocus exchange of alleles. Placing the collared flycatcher's MHC sequences in the context of passerine diversity revealed transspecific MHC class II evolution within the Muscicapidae family. Conclusions 454 amplicon sequencing is an effective tool for advancing our understanding of the MHC class II structure and evolutionary patterns in Passeriformes. We found a highly dynamic pattern of evolution of MHC class IIB genes with strong signals of selection and pronounced sequence divergence in expressed genes, in contrast to the apparent sequence homogenization in pseudogenes. We show that next generation sequencing offers a universal, affordable method for the characterization and, in perspective
Stark, Danica J; Vaughan, Ian P; Ramirez Saldivar, Diana A; Nathan, Senthilvel K S S; Goossens, Benoit
2017-01-01
The development of GPS tags for tracking wildlife has revolutionised the study of home ranges, habitat use and behaviour. Concomitantly, there have been rapid developments in methods for estimating habitat use from GPS data. In combination, these changes can cause challenges in choosing the best methods for estimating home ranges. In primatology, this issue has received little attention, as there have been few GPS collar-based studies to date. However, as advancing technology is making collaring studies more feasible, there is a need for the analysis to advance alongside the technology. Here, using a high quality GPS collaring data set from 10 proboscis monkeys (Nasalis larvatus), we aimed to: 1) compare home range estimates from the most commonly used method in primatology, the grid-cell method, with three recent methods designed for large and/or temporally correlated GPS data sets; 2) evaluate how well these methods identify known physical barriers (e.g. rivers); and 3) test the robustness of the different methods to data containing either less frequent or random losses of GPS fixes. Biased random bridges had the best overall performance, combining a high level of agreement between the raw data and estimated utilisation distribution with a relatively low sensitivity to reduced fixed frequency or loss of data. It estimated the home range of proboscis monkeys to be 24-165 ha (mean 80.89 ha). The grid-cell method and approaches based on local convex hulls had some advantages including simplicity and excellent barrier identification, respectively, but lower overall performance. With the most suitable model, or combination of models, it is possible to understand more fully the patterns, causes, and potential consequences that disturbances could have on an animal, and accordingly be used to assist in the management and restoration of degraded landscapes.
Directory of Open Access Journals (Sweden)
Danica J Stark
Full Text Available The development of GPS tags for tracking wildlife has revolutionised the study of home ranges, habitat use and behaviour. Concomitantly, there have been rapid developments in methods for estimating habitat use from GPS data. In combination, these changes can cause challenges in choosing the best methods for estimating home ranges. In primatology, this issue has received little attention, as there have been few GPS collar-based studies to date. However, as advancing technology is making collaring studies more feasible, there is a need for the analysis to advance alongside the technology. Here, using a high quality GPS collaring data set from 10 proboscis monkeys (Nasalis larvatus, we aimed to: 1 compare home range estimates from the most commonly used method in primatology, the grid-cell method, with three recent methods designed for large and/or temporally correlated GPS data sets; 2 evaluate how well these methods identify known physical barriers (e.g. rivers; and 3 test the robustness of the different methods to data containing either less frequent or random losses of GPS fixes. Biased random bridges had the best overall performance, combining a high level of agreement between the raw data and estimated utilisation distribution with a relatively low sensitivity to reduced fixed frequency or loss of data. It estimated the home range of proboscis monkeys to be 24-165 ha (mean 80.89 ha. The grid-cell method and approaches based on local convex hulls had some advantages including simplicity and excellent barrier identification, respectively, but lower overall performance. With the most suitable model, or combination of models, it is possible to understand more fully the patterns, causes, and potential consequences that disturbances could have on an animal, and accordingly be used to assist in the management and restoration of degraded landscapes.
Lucas, Kristen
2011-01-01
This study explicitly links processes of anticipatory socialization to social mobility and reproduction. An examination of the socializing messages exchanged between blue-collar parents (n = 41) and their children (n = 25) demonstrate that family-based messages about work and career seldom occur in straightforward, unambiguous ways. Instead,…
Cervical Spine Collar Removal by Emergency Room Nurses: A Quality Improvement Project.
Fontaine, Guillaume; Forgione, Massimo; Lusignan, Francis; Lanoue, Marc-André; Drouin, Simon
2018-05-01
The Canadian C-Spine Rule (CCR) is a clinical decision aid to facilitate the safe removal of cervical collars in the alert, orientated, low-risk adult trauma patient. Few health care settings have assessed initiatives to train charge nurses to use the CCR. This practice improvement project conducted in a secondary trauma center in Canada aimed to (1) train charge nurses of the emergency room to use the CCR, (2) monitor its use throughout the project period, and (3) compare the assessments of the charge nurses with those of emergency physicians. The project began with the creation of an interdisciplinary team. Clinical guidelines were established by the interdisciplinary project team. Nine charge nurses of the emergency room were then trained to use the CCR (3 on each 8-hour shift). The use of the CCR was monitored throughout the project period, from June 1 to October 5, 2016. The 3 aims of this practice improvement project were attained successfully. Over a 5-month period, 114 patients were assessed with the CCR. Charge nurses removed the cervical collars for 54 of 114 patients (47%). A perfect agreement rate (114 of 114 patients, 100%) was attained between the assessments of the nurses and those of physicians. This project shows that the charge nurses of a secondary trauma center can use the CCR safely on alert, orientated, and low-risk adult trauma patients as demonstrated by the agreement in the assessments of emergency room nurses and physicians. Crown Copyright © 2017. Published by Elsevier Inc. All rights reserved.
2011-01-01
Background Recent systematic reviews on psychological therapies of fibromyalgia syndrome (FMS) did not consider hypnosis/guided imagery (H/GI). Therefore we performed a systematic review with meta-analysis of the efficacy of H/GI in FMS. Methods We screened http://ClinicalTrials.gov, Cochrane Library, MEDLINE, PsycINFO and SCOPUS (through December 2010). (Quasi-) randomized controlled trials (CTs) comparing H/GI with controls were analyzed. Outcomes were pain, sleep, fatigue, depressed mood and health-related quality of life (HRQOL). Effects were summarized using standardized mean differences (SMD). Results Six CTs with 239 subjects with a median of 9 (range 7-12) H/GI-sessions were analysed. The median number of patients in the H/GI groups was 20 (range 8-26). Three studies performed follow-ups. H/GI reduced pain compared to controls at final treatment (SMD -1.17 [95% CI -2.21, -0.13]; p = 0.03). H/GI did not reduce limitations of HRQOL at final treatment (SMD -0.90 [95% CI -2.55, 0.76]; p = 0.29) compared to controls. Effect sizes on fatigue, sleep and depressed mood at final treatment and follow-up and on pain and HRQOL at follow-up were not calculated because of limited data available. The significant effect on pain at final treatment was associated with low methodological and low treatment quality. Conclusion Further studies with better treatment quality and adequate methodological quality assessing all key domains of FMS are necessary to clarify the efficacy of H/GI in FMS. PMID:21676255
"Blue-Collar Blues" : kõigi maade töötud, ühinege! / Ants Juske
Juske, Ants, 1956-2016
2009-01-01
Rahvusvaheline näitus "Blue-Collar Blues" Tallinna Kunstihoones ja Kunstihoone galeriis 31. jaanuarini 2010. Kuraator Anders Härm. Näituse ajendiks on 1. juulist 2009 Eestis kehtima hakanud töölepinguseadus, näituse fookus on töösuhetel
An Examination of Blue- versus White-Collar Workers' Conceptualizations of Job Satisfaction Facets
Hu, Xiaoxiao; Kaplan, Seth; Dalal, Reeshad S.
2010-01-01
This study examined the degree to which blue- versus white-collar workers differentially conceptualize various job facets, namely the work itself, co-workers, supervisors, and pay. To examine these potential differences, we conducted a series of analyses on job satisfaction ratings from two samples of university workers. Consistent with the study…
Analysis of the collar-whisker structure of temperate lactococcal bacteriophage TP901-1
DEFF Research Database (Denmark)
Vegge, Christina Skovgaard; Neve, Horst; Brøndsted, Lone
2006-01-01
Proteins homologous to the protein NPS (neck passage structure) are widespread among lactococcal phages. We investigated the hypothesis that NPS is involved in the infection of phage TP901-1 by analysis of an NPS mutant. NPS was determined to form a collar-whisker complex but was shown to be none...
Tracking maize pollen development by the Leaf Collar Method.
Begcy, Kevin; Dresselhaus, Thomas
2017-12-01
An easy and highly reproducible nondestructive method named the Leaf Collar Method is described to identify and characterize the different stages of pollen development in maize. In plants, many cellular events such as meiosis, asymmetric cell division, cell cycle regulation, cell fate determination, nucleus movement, vacuole formation, chromatin condensation and epigenetic modifications take place during pollen development. In maize, pollen development occurs in tassels that are confined within the internal stalk of the plant. Hence, identification of the different pollen developmental stages as a tool to investigate above biological processes is impossible without dissecting the entire plant. Therefore, an efficient and reproducible method is necessary to isolate homogeneous cell populations at individual stages throughout pollen development without destroying the plant. Here, we describe a method to identify the various stages of pollen development in maize. Using the Leaf Collar Method in the maize inbreed line B73, we have determined the duration of each stage from pollen mother cells before meiosis to mature tricellular pollen. Anther and tassel size as well as percentage of pollen stages were correlated with vegetative stages, which are easily recognized. The identification of stage-specific genes indicates the reproducibility of the method. In summary, we present an easy and highly reproducible nondestructive method to identify and characterize the different stages of pollen development in maize. This method now opens the way for many subsequent physiological, morphological and molecular analyses to study, for instance, transcriptomics, metabolomics, DNA methylation and chromatin patterns during normal and stressful conditions throughout pollen development in one of the economically most important grass species.
Sperm morphological and morphometric evaluation in captive collared peccaries (Pecari tajacu
Directory of Open Access Journals (Sweden)
Patrícia C. Sousa
2013-07-01
Full Text Available The aim of this study was to compare different staining methods for the evaluation of sperm morphology by light microscopy and also to describe the morphometry of the entire sperm in collared peccaries (Pecari tajacu. Semen from 10 males was obtained by electroejaculation and evaluated for sperm motility, vigor, and concentration. Semen smears were prepared through three different staining methods: Bengal rose, brome-phenol blue, and eosin-nigrosin. Smears were evaluated under light microscopy and sperm morphologic alterations were determined in percentage. In addition, sperm morphometric analysis was conducted by light microscopy coupled to image analyzer software. The smears stained with Bengal Rose provide the best results for the visualization of the sperm tail, midpiece, and head. The use of eosin-nigrosin stain did not allow an adequate impregnation, and some sperm presented a few contrasts with the background. A higher incidence of bent coiled tails was verified in the use of brome-phenol blue staining (P<0.05. Through morphometric evaluation, it was observed that the tail occupies the greatest proportion (89% of the sperm which presents a discretely elongated head. According to the results, the use of the Bengal Rose stain is recommended for the morphologic evaluation of the collared peccary sperm.
Sandmark, Hélène
2009-01-01
To investigate associations between long-term sick-listing and factors at work and in family life. Associations were investigated in a cross-sectional case-referent study. The study base included women in white-collar jobs, aged 30-55 years, living in three urban areas in Sweden between February 2004 and October 2004. A postal questionnaire was constructed with questions on occupational and family circumstances, and sent to 513 randomly selected female white-collar workers, of whom 233 had ongoing sick-leave of 90 days or more. The response rate was 81% (n = 413). Most of the women in this study were in managerial positions. The unadjusted associations showed that sick-listed women with children showed the highest estimates regarding reported long working hours, bullying, high mental strain, low control and low influence at work, and work-family imbalance. In a regression model, the strongest associations were: experiencing too high mental strain in work tasks (odds ratio (OR) = 2.57, 95% confidence interval (CI) = 2.09-3.15) and low control and influence at work (OR=2.17, 95% CI= 1.60-2.94). Sick-listed women reported an overall higher dissatisfaction with their workplace and working life. There seems to be a greater tendency for the sick-listed women in this study to experience low control and too high mental strain at work and to live in traditional family relationships with unequal opportunities. The women who were sick-listed were probably less able to cope with work stress and to find a balance between work and family life.
Carlucci, A.; Raimondo, M.L.; Santos, J.; Phillips, A.J.L.
2012-01-01
Plectosphaerella cucumerina, most frequently encountered in its Plectosporium state, is well known as a pathogen of several plant species causing fruit, root and collar rot, and collapse. It is considered to pose a serious threat to melon (Cucumis melo) production in Italy. In the present study, an
Job Attitudes of Black and White Workers: Male Blue-Collar Workers in Six Companies
Katzell, Raymond A.; And Others
1974-01-01
A 74-item attitude questionnaire was administered in six companies to 101 black and 87 white male blue-collar employees holding similar jobs in the same company. Differences between the two ethnic groups were not marked, both in terms of job satisfaction and in other respects. (Author)
Development of High-Resolution Scintillator Systems
International Nuclear Information System (INIS)
Larry A. Franks; Warnick J. Kernan
2007-01-01
Mercuric iodide (HgI2) is a well known material for the direct detection of gamma-rays; however, the largest volume achievable is limited by the thickness of the detector which needs to be a small fraction of the average trapping length for electrons. We report results of using HgI2 crystals to fabricate photocells used in the readout of scintillators. The optical spectral response and efficiency of these photocells were measured and will be reported. Nuclear response from an HgI2 photocell that was optically matched to a cerium-activated scintillator is presented and discussed. Further improvements can be expected by optimizing the transparent contact technology
Nawrocka, Agnieszka; Garbaciak, Wiesław; Cholewa, Jarosław; Mynarski, Władysław
2018-04-01
The aim of this study was to evaluate the association between meeting recommendations on physical activity for health in leisure-time and the ability to work among Polish white-collar workers. The study used a cross-sectional design with a convenience sample of 360 white-collar workers. Participants recorded 7-day physical activity logs, including form, duration and intensity of leisure-time physical activities. The results were compared to health recommendations. A standardized Work Ability Index (WAI) questionnaire was used in assessing the ability to work. Participants who met health recommendations achieved higher scores of the WAI (mean score = 41.93) in comparison to those who were not sufficiently physically active (mean score = 39.35) (p health-related physical activity recommendations almost double the odds of reaching at least good work ability (OR = 1.94, 95% CI = 1.12-3.36). Meeting leisure-time physical activity recommendations (especially the criterion of vigorous physical activity) is significantly related to higher self-assessed ability to work among white-collar workers.
Using Collar worn Sensors to Forecast Thermal Strain in Military Working Dogs
2016-04-22
Using Collar-worn Sensors to Forecast Thermal Strain in Military Working Dogs James R. Williamson, Austin R. Hess, Christopher J. Smalt, Delsey M...these estimates for forecasting and monitoring thermal strain is assessed based on performance in out of sample prediction of core temperature (Tc...time step (100 Hz) from the magnitude of the three- dimensional acceleration vector, ai , which is independent of sensor orientation. Next, the
Effects of Collar Permeability on the Field Quality of the Large Aperture Quadrupoles for the LHC
Catalan-Lasheras, N; Kirby, G; Mess, K H; Ostojic, R; Russenschuck, Stephan
2008-01-01
The LHC contains a number of large aperture quadrupoles (MQY) in the insertions. The acceptance of these magnets was based on warm magnetic measurements performed before delivery to CERN. During the series production of the MQY quadrupoles, the permeability of the collars drifted from the nominal value, and effects on the transfer function and multipole components became evident. To study the effects on the magnetic field, variable permeability of the stainless-steel collars as a function of local field and temperature was introduced into a numerical model. Comparing the results with measured data, we could isolate the contribution of permeability deviation on the magnetic field quality. The extrapolation of transfer function and field multipoles to operating temperature and current gives the necessary offsets, which are compared with measurements on a reduced set of magnets.
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science. M Abdul Khadar. Articles written in Bulletin of Materials Science. Volume 23 Issue 5 October 2000 pp 361-367 Nanomaterials. Dielectric properties of nanophase Ag2HgI4 and Ag2HgI4–Al2O3 nanocomposites · S Sankara Narayanan Potty M Abdul Khadar · More Details ...
DEFF Research Database (Denmark)
Andersen, Lars Louis; Mortensen, Ole Steen; Hansen, Jørgen Vinsløv
2011-01-01
Objective To estimate the impact of pain in different body regions on future long-term sickness absence (LTSA) among blue- and white-collar workers. Method Prospective cohort study in a representative sample of 5603 employees (the Danish Work Environment Cohort Study) interviewed in 2000, and fol......Objective To estimate the impact of pain in different body regions on future long-term sickness absence (LTSA) among blue- and white-collar workers. Method Prospective cohort study in a representative sample of 5603 employees (the Danish Work Environment Cohort Study) interviewed in 2000...... consecutive weeks. Age, gender, body mass index, smoking and diagnosed disease were controlled for. Results In 2000 the prevalence among blue- and white-collar workers, respectively, of severe pain was 33% and 29% (neck/shoulder), 33% and 25% (low back), 16% and 11% (hand/wrists), and 16% and 12% (knees......). During 2001-2002, the prevalence of LTSA among blue- and white-collar workers was 18% and 12%, respectively. Hand/wrist pain (HR 1.49, 95% CI 1.23 to 1.81) and low back pain (HR 1.30, 95% CI 1.11 to 1.53) were significant risk factors among the total cohort. Neck/shoulder pain was a significant risk...
Borges, Alana A; Lira, Gabriela P O; Nascimento, Lucas E; Queiroz Neta, Luiza B; Santos, Maria V O; Oliveira, Moacir F; Silva, Alexandre R; Pereira, Alexsandra F
2018-04-01
Skin vitrification is a promising and alternative tool for the conservation of biodiversity, especially for wild mammals, such as collared peccaries. Several factors can affect the success of this procedure, such as the cryoprotectant solution used. Therefore, this study was carried out to compare the efficiency of various vitrification solutions for recovery of viable cells after in vitro culture of cryopreserved skin tissues derived from the collared peccary, aiming to study the application in biobanking, where cellular use is not immediately required. Then, Dulbecco's modified Eagle's medium (DMEM) composed of 2.2 g/L sodium bicarbonate and 10% fetal bovine serum (FBS) was supplemented with 3.0 M ethylene glycol (EG) or 3.0 M dimethyl sulfoxide (DMSO) or 1.5 M EG plus 1.5 M DMSO with or without sucrose (SUC; 0.25 M) to produce six solutions for solid-surface vitrification. After warming, skin tissues were cultured in vitro and recovered cells were analyzed for morphology, adhesion, subconfluence, and proliferative activity for developing the growth curve and determining the population doubling time (PDT), and viability by Trypan Blue. The vitrification did not alter the ability of the tissues to adhere to the culture dish, as well as the day of all explants with cell growth, subconfluence samples, subconfluence total time, and PDT (p > 0.05). Moreover, independent of the cryoprotectant solution used, the vitrification altered the day of all attached explants (p 0.05). Additionally, for viability after the third passage, only the EG-SUC group maintained the cell quality (88.3%), when compared with the nonvitrified (97.8%, p > 0.05). In conclusion, DMEM with 10% FBS, 3.0 M EG, and 0.25 M sucrose was the most efficient solution for vitrifying collared peccary skin tissues, leading to the in vitro culture of viable cells.
B. Kuijper (Barbara); J.T. Tans; A. Beelen (Anita); F. Nollet (Frans); M. de Visser (Marianne)
2009-01-01
textabstractOBJECTIVE: To evaluate the effectiveness of treatment with collar or physiotherapy compared with a wait and see policy in recent onset cervical radiculopathy. DESIGN: Randomised controlled trial. SETTING: Neurology outpatient clinics in three Dutch hospitals. PARTICIPANTS: 205 patients
Blue-Collar Affluence in a Remote Mining Town: Challenging the Modernist Myth of Education
Forsey, Martin
2015-01-01
Based on research in Karratha, a remote resource town in Western Australia, this paper explores the ways in which blue-collar affluence disturbs the meritocratic mythology of formal education. In the opening decade of the twenty-first century Karratha was one of Australia's most affluent towns, yet its adult population was characterised by a level…
Kuijper, Barbara; Tans, Jos Th J.; Beelen, Anita; Nollet, Frans; de Visser, Marianne
2009-01-01
Objective To evaluate the effectiveness of treatment with collar or physiotherapy compared with a wait and see policy in recent onset cervical radiculopathy. Design Randomised controlled trial. Setting Neurology outpatient clinics in three Dutch hospitals. Participants 205 patients with symptoms and
Adam J. Gaylord; Dana M. Sanchez
2014-01-01
Direct behavioral observations of multiple free-ranging animals over long periods of time and large geographic areas is prohibitively difficult. However, recent improvements in technology, such as Global Positioning System (GPS) collars equipped with motion-sensitive activity monitors, create the potential to remotely monitor animal behavior. Accelerometer-equipped...
Pauli, Felix Asher
2012-01-01
The Green Jobs Green New York (GJGNY) Act of 2009 was designed to reduce energy consumption by creating green collar workforce and providing energy efficiency audits to the public. The problem addressed in this study is the discrepancy between the expectations of Green Jobs Green New York Act of 2009 and the implementation of this policy. This…
Directory of Open Access Journals (Sweden)
David M Hallman
2015-11-01
Full Text Available Prolonged sitting is associated with increased risk for cardiovascular diseases and mortality. However, research into the physiological determinants underlying this relationship is still in its infancy. The aim of the study was to determine the extent to which occupational and leisure-time sitting are associated with nocturnal heart rate variability (HRV in blue-collar workers. The study included 138 blue-collar workers (mean age 45.5 (SD 9.4 years. Sitting-time was measured objectively for four days using tri-axial accelerometers (Actigraph GT3X+ worn on the thigh and trunk. During the same period, a heart rate monitor (Actiheart was used to sample R-R intervals from the electrocardiogram. Time and frequency domain indices of HRV were only derived during nighttime sleep, and used as markers of cardiac autonomic modulation. Regression analyses with multiple adjustments (age, gender, body mass index, smoking, job-seniority, physical work-load, influence at work, and moderate-to-vigorous physical activity were used to investigate the association between sitting time and nocturnal HRV. We found that occupational sitting-time was negatively associated (p < 0.05 with time and frequency domain HRV indices. Sitting-time explained up to 6% of the variance in HRV, independent of the covariates. Leisure-time sitting was not significantly associated with any HRV indices (p > 0.05. In conclusion, objectively measured occupational sitting-time was associated with reduced nocturnal HRV in blue-collar workers. This indicates an attenuated cardiac autonomic regulation with increasing sitting-time at work regardless of moderate-to-vigorous physical activity. The implications of this association for cardiovascular disease risk warrant further investigation via long-term prospective studies and intervention studies.
Diiodido[methyl 2-(quinolin-8-yloxyacetate-κN]mercury(II
Directory of Open Access Journals (Sweden)
Yu-Hong Wang
2012-08-01
Full Text Available In the title mononuclear complex, [HgI2(C12H11NO3], the HgII ion has a distorted trigonal–planar coordination sphere defined by two I− anions and the N atom of a methyl 2-(quinolin-8-yloxyacetate ligand. In the crystal, face-to-face π–π stacking interactions, with a centroid–centroid distance of 3.563 (9 Å, are observed.
International Nuclear Information System (INIS)
Wehring, B.W.
1988-01-01
Advanced alpha-particle detectors made of heavy elements were investigated as alternatives to silicon surface-barrier detectors for the ''foil-neutralization technique'' of alpha-particle diagnostics in fusion reactors with high neutron backgrounds. From an extensive literature review, it was decided that HgI 2 would make a more suitable detector for alpha-particle diagnostics than other heavy element detectors such as CdTe. Thus, HgI 2 detectors were designed and fabricated. Experimental tests were performed to determine detector characteristics and detector responses to alpha particles. Radiation noise measurements were also performed using the North Carolina State University PULSTAR nuclear reactor for both the HgI 2 detectors and commercial Si(Au) surface barrier detectors. 15 refs., 1 fig
9 CFR 2.50 - Time and method of identification.
2010-01-01
... Administrator. 2 In general, well fitted collars made of leather or plastic will be acceptable under this.... APHIS will determine the acceptability of a material proposed for usage as collars from the standpoint... approved by the Administrator; or (iii) A plastic-type collar acceptable to the Administrator which has...
Schwarz, Frank; Hegewald, Andrea; Becker, Jürgen
2014-01-01
Objectives To address the following focused question: What is the impact of implant–abutment configuration and the positioning of the machined collar/microgap on crestal bone level changes? Material and methods Electronic databases of the PubMed and the Web of Knowledge were searched for animal and human studies reporting on histological/radiological crestal bone level changes (CBL) at nonsubmerged one-/two-piece implants (placed in healed ridges) exhibiting different abutment configurations, positioning of the machined collar/microgap (between 1992 and November 2012: n = 318 titles). Quality assessment of selected full-text articles was performed according to the ARRIVE and CONSORT statement guidelines. Results A total of 13 publications (risk of bias: high) were eligible for the review. The weighted mean difference (WMD) (95% CI) between machined collars placed either above or below the bone crest amounted to 0.835 mm favoring an epicrestal positioning of the rough/smooth border (P abutment configurations. Due to a high heterogeneity, a meta-analysis was not feasible. Conclusions While the positioning of the machined neck and microgap may limit crestal bone level changes at nonsubmerged implants, the impact of the implant–abutment connection lacks documentation. PMID:23782338
Association between long working hours and sleep problems in white-collar workers.
Nakashima, Motoko; Morikawa, Yuko; Sakurai, Masaru; Nakamura, Koshi; Miura, Katsuyuki; Ishizaki, Masao; Kido, Teruhiko; Naruse, Yuchi; Suwazono, Yasushi; Nakagawa, Hideaki
2011-03-01
The purpose of this study is to examine the association between long work hours and sleep disturbance among white-collar workers. We evaluated 1510 male white-collar full-time employees, between the ages of 18 and 59 years, using a comprehensive sleep quality questionnaire, the Pittsburgh Sleep Quality Index (PSQI). All subjects worked in a light metal products factory in Japan. The mean number of monthly overtime work hours was determined using data from the previous 6 months from timecard records. Subjects were divided into five groups based on quintiles of the mean number of monthly overtime work hours: 63. Leisure time physical activity, drinking habits just before sleep, presence of family/partner and health status were used as confounding factors in the multiple regression model. The prevalence of short sleep hours, impairment of sleep efficiency and daytime dysfunction among seven components of PSQI increased, in a dose-response relationship, with overtime work hours. The prevalence of high global score (>5.5 points) was highest in workers with overtime hours ≥50 h week(-1). The odds ratios after adjustment for confounding factors for high global score using less than 26 h as a reference group were 1.67 for workers with ≥50 h and long work hours correlate with reduced sleep quality in a dose-response manner. © 2010 European Sleep Research Society.
Histology of palate and soft palate tonsil of collared peccary (Tayassu tajacu).
Teófilo, T S; Morais, M R P T; Dias, G F; Diniz, A N; Chaves, H S A; Fontenele-Neto, J D
2014-10-01
Peccaries are characterized by a prominent skin gland, known as scent gland, which is located in the middle of the rump. These animals are able to survive in a great variety of habitats, from humid tropical forests to semi-arid areas. They are omnivorous animals, and their diet includes fibrous material, vegetables, fruits, small vertebrates and insects. Collared peccary hard palate and soft palate tonsils were studied, macroscopic morphometric data were collected and tissue samples were paraffin-embedded. Sections were stained with HE, Gomori's trichrome and von Kossa; the first two were used to study general organization and the latter to detect calcium deposits. The hard palate showed one incisive papilla followed by several rugae united by a distinct raphe. The hard palate is lined by a keratinised squamous epithelium resting on a dense connective, whereas in the soft palate, the epithelium is parakeratinised and showed lymphocyte infiltration. The palate showed several pacinian corpuscles in the propria-submucosa. Two ovoid-shaped tonsils were found in the soft palate, and several crypts were observed on its surface. The epithelium was highly infiltrated by lymphocytes, and within the crypts, tonsilloliths were frequently observed. The study showed that the general organization of collared peccary palate is similar to other species, but in its oropharynx, only the soft palate tonsil was present and the pacinian corpuscles formed small aggregates. © 2013 Blackwell Verlag GmbH.
Bezerra, José Artur Brilhante; da Silva, Andréia Maria; Peixoto, Gislayne Christianne Xavier; da Silva, Mariana de Araújo; Franco de Oliveira, Moacir; Silva, Alexandre Rodrigues
2014-05-01
In order to establish protocols for gamete recovery from accidentally killed wild animals, or to take advantage of those slaughtered by captive breeders, we assess the influence of two methods on the recovery of epididymal sperm from collared peccaries, and verify the effect of centrifugation on such gametes. Genitalia from nine animals were used. For each animal, one epididymis was processed by flotation and the other was processed by retrograde flushing, both using a buffered media based on Tris. Following recovery, sperm were evaluated for motility, vigor, viability, functional membrane integrity, and morphology. A 1-mL aliquot of each sample was centrifuged, the supernatant removed, and the pellet suspended and evaluated as fresh samples. The sperm characteristics did not differ between the samples collected by flotation or retrograde flushing (P methods was affected by centrifugation. In conclusion, epididymal sperm from collared peccaries can be efficiently collected through flotation or retrograde flushing, but not when either is followed by centrifugation.
Growth of mercuric iodide single crystals from dimethylsulfoxide
International Nuclear Information System (INIS)
Carlston, R.C.
1976-01-01
Dimethylsulfoxide is used as a solvent for the growth of red mercuric iodide (HgI 2 ) crystals for use in radiation detectors. The hygroscopic property of the solvent allows controlled amounts of water to enter into the solvent phase and diminish the large solubility of HgI 2 so that the precipitating solid collects as well-defined euhedral crystals which grow into a volume of several cc
Long working hours and risk for hypertension in Japanese male white collar workers
Nakanishi, N; Yoshida, H; Nagano, K; Kawashimo, H; Nakamura, K; Tatara, K
2001-01-01
STUDY OBJECTIVE—To evaluate the association of long working hours with the risk for hypertension. DESIGN—A five year prospective cohort study. SETTING—Work site in Osaka, Japan. PARTICIPANTS—941 hypertension free Japanese male white collar workers aged 35-54 years were prospectively examined by serial annual health examinations. Men in whom borderline hypertension and hypertension were found during repeated surveys were defined as incidental cases of borderline hypertension and hypertension. ...
First results of feral cats (Felis catus) monitored with GPS collars in New Zealand
CSIR Research Space (South Africa)
Recio, MR
2010-04-01
Full Text Available -monitoring of feral cats injection of 0.12?0.20 ml of Antisedan? (Atipamezone hydrochloride) reversed the effect of Domitor. Individuals were weighed, sexed and visually inspected, and fitted with a GPS data-logger collar (Sirtrack, Havelock North, NZ, http.... __________________________________________________________________________________________________________________________________________________________________ Sex Capture Tracking period No. of No. of potential Fix rate No. of fixes % of fixes date (days) fixes fixes percentage HDOP < 9 used...
Mercuric iodide composite films using polyamide, polycarbonate and polystyrene fabricated by casting
International Nuclear Information System (INIS)
Ugucioni, J.C.; Ghilardi Netto, T.; Mulato, M.
2010-01-01
Mercuric iodide (HgI 2 ) composite films were obtained by using the casting technique. Insulator polymers such as polyamide, polycarbonate and polystyrene were mixed to HgI 2 crystallites forming a final sub-millimeter thick self-standing film. Fabrication temperature varied from 10 to 100 o C, and total fabrication time reached at most 5 min. The larger the fabrication temperature, the thinner the film and the smaller its electrical resistivity. Electrical characterization was performed in the dark, under UV illumination and under mammographic X-ray exposure. The final properties of the films are discussed and related to fabrication conditions. The optimized composite film might be a better candidate for use as X-ray detector for medical imaging, in place of the single HgI 2 crystalline device.
DEFF Research Database (Denmark)
Lundgren, Fredrik; Bergqvist, David; Norgren, Lars
2010-01-01
Patency and limb salvage after synthetic bypass to the arteries below-knee are inferior to that which can be achieved with autologous vein. Use of a vein collar at the distal anastomosis has been suggested to improve patency and limb salvage, a problem that is analysed in this randomised clinical...
Directory of Open Access Journals (Sweden)
Y. Abdallah Mohamed
2015-06-01
Full Text Available Scour around bridge supports such as abutments can result in structural collapse and loss of life and property, so there is a need to control and minimize the local scour depth. In this paper, numerical and experimental studies were carried out to investigate the effect of different relative radii of the bridge abutment provided with collar on local scour depth. A 3-D numerical model is developed to simulate the scour at bridge abutment using SSIIM program. This model solves 3-D Navier–Stokes equations and a bed load conservation equation. The k–ε turbulence model is used to solve the Reynolds-stress term. It was found the curvature shape of bridge abutment provided with collar could share to reduce the local scour depth by more 95%. In addition, the results of simulation models agree well with the experimental data.
The impact of long working hours on psychosocial stress response among white-collar workers
LEE, Kyungjin; SUH, Chunhui; KIM, Jong-Eun; PARK, Jae Oh
2016-01-01
This study examined the association between long working hours and psychosocial stress responses. In total, 1,122 white-collar workers from a company in Korea completed self-administered questionnaires following a lecture about the study aim, procedures, and confidentiality. Psychosocial stress responses were evaluated using the Psychosocial Well-being Index - Short Form (PWI-SF), and psychosocial working conditions were evaluated with the Korean Occupational Stress Scale - Short Form (KOSS-S...
Ham, Wietske H W; Schoonhoven, Lisette; Schuurmans, Marieke J; Leenen, Luke P H
OBJECTIVES: To describe the occurrence and severity of pressure ulcers, indentation marks and pain from the extrication collar combined with headblocks. Furthermore, the influence of time, injury severity and patient characteristics on the development of pressure ulcers, indentation marks and pain
Ham, W.H.; Schoonhoven, L.; Schuurmans, M.J.; Leenen, L.P.
2016-01-01
OBJECTIVES: To describe the occurrence and severity of pressure ulcers, indentation marks and pain from the extrication collar combined with headblocks. Furthermore, the influence of time, injury severity and patient characteristics on the development of pressure ulcers, indentation marks and pain
Schuler, Krysten L; Green, David E; Justice-Allen, Anne E; Jaffe, Rosemary; Cunningham, Mark; Thomas, Nancy J; Spalding, Marilyn G; Ip, Hon S
2012-06-01
Eurasian collared doves (Streptopelia decaocto) have expanded their range across the United States since their introduction several decades ago. Recent mortality events in Eurasian collared doves in Arizona and Montana, USA, during the winter of 2009-2010 were the result of pigeon paramyxovirus (PPMV), a novel disease agent. The first instance of mortality by this emerging infectious disease in this species occurred in Florida in 2001 with subsequent disease events in 2006 and 2008. Full diagnostic necropsies were performed on carcasses from the three states. PPMV was identified by RT-PCR and virus isolation and was sequenced to the VIb genotype of avian paramyxovirus-1 (APMV). Other APMVs are common in a variety of free-ranging birds, but concern is warranted because of the potential for commingling of this species with native birds, virus evolution, and threats to domestic poultry. Improved surveillance for wildlife mortality events and efforts to prevent introduction of non-native animals could reduce the threat of introducing new pathogens.
Blue-collar workplaces: a setting for reducing heart health inequalities in New Zealand?
Novak, Brad; Bullen, Chris; Howden-Chapman, Philippa; Thornley, Simon
2007-09-07
To review the evidence for the effectiveness of workplaces as settings for cardiovascular health promotion and reduction of heart health inequalities in New Zealand. Literature review and structured appraisal of 154 articles meeting inclusion criteria, of which one review and three trials addressed cardiovascular interventions specifically, and four systematic reviews addressed the effectiveness of workplace health promotion programmes generally. The reviewed studies showed that workplaces have good potential as settings for health promotion. We found mixed but largely supportive evidence that workplace interventions can lead to improvements in health outcomes, workplace environments, lifestyles, and productivity. Workplace programmes that ranked highest in both clinical and cost-effectiveness targeted industries employing large numbers of blue-collar workers, tackled multiple risk factors, intervened at both individual and environmental levels and incorporated occupational safety components. Such programmes appear to offer a substantial return on investment for employers in other countries, but local evidence is lacking. Employers and workers in blue-collar industries should be encouraged to participate in comprehensive heart health promotion programmes as a strategy for reducing existing socioeconomic and ethnic disparities in health. However, high-quality evidence of improved employee health and productivity is needed from well-designed New Zealand-based research to ensure that these programmes are optimally configured for effectiveness and attractive to employers and employees alike.
Roelen, Corné A M; van Rhenen, Willem; Groothoff, Johan W; van der Klink, Jac J L; Bültmann, Ute
2014-04-01
Prolonged fatigue adversely affects an individual's performance and functioning. The present study investigated the prospective associations between prolonged fatigue and sickness absence (SA) during 1-year follow-up. At baseline, a convenience sample of white-collar employees received the 20-item Checklist Individual Strength (CIS), which measures prolonged fatigue by covering the dimensions fatigue severity, reduced concentration, reduced motivation, and reduced physical activity. SA episodes were registered during the 1-year follow-up distinguishing between short-term (1-7 days) and long-term ( 7 days) SA episodes. Baseline CIS scores were linked to SA during follow-up by negative binomial regression models in which age, gender, job grade, and prior SA were controlled for. Six hundred and thirty-three (56 %) employees participated in the study of which 598 had complete data and were eligible for analysis. Gender was a significant effect modifier of the relationship between prolonged fatigue and SA. Therefore, the results were stratified for men (N = 365) and women (N = 233). In white-collar men, fatigue severity and reduced concentration were positively associated with the number of long-term SA episodes, while other fatigue dimensions were not significantly related to SA. In white-collar women, prolonged fatigue was not associated with SA during 1-year follow-up. The results of this study warrant more attention for prolonged fatigue in occupational healthcare practice and research. Early identification of and treatment for prolonged fatigue might prevent future health problems and SA, especially in white-collar men.
Trends in abundance of collared lemmings near Cape Churchill, Manitoba, Canada
Reiter, M.E.; Andersen, D.E.
2008-01-01
Regular, multiannual cycles observed in the population abundance of small mammals in many arctic and subarctic ecosystems have stimulated substantial research, particularly among population ecologists. Hypotheses of mechanisms generating regular cycles include predator-prey interactions, limitation of food resources, and migration or dispersal, as well as abiotic factors such as cyclic climatic variation and environmental stochasticity. In 2004 and 2005, we used indirect methods to estimate trends in population size of Richardson's collared lemmings (Dicrostonyx richardsoni) retrospectively, and evaluated the extent of synchrony between lemming populations at 2 coastal tundra study areas separated by approximately 60 km near Cape Churchill, Manitoba, Canada. We collected scars on willow plants (Salix) resulting from lemming feeding. Ages of scars ranged from 0 to 13 years at both study areas. Scar-age frequency appeared cyclic and we used nonlinear Poisson regression to model the observed scar-age frequency. Lemming populations cycled with 2.8-year periodicity and the phase of the cycle was synchronous between the 2 study areas. We suggest that our approach could be applied in multiple settings and may provide the most efficient way to gather data on small mammals across both space and time in a diversity of landscapes. ?? 2008 American Society of Mammalogists.
Sołtysik, Bartłomiej K; Kroc, Łukasz; Pigłowska, Małgorzata; Guligowska, Agnieszka; Śmigielski, Janusz; Kostka, Tomasz
2017-05-01
Assessment of the work and life conditions of 60 to 65-year-old seniors with regard to type of work and quality of life (QoL). The European Foundation for Improvement of Living and Working Conditions Questionnaire and the EuroQol 5D were used to evaluate work and life conditions and QoL in the three age- and sex-matched 60 to 65-year-old groups (white-collar, manual workers, and unemployed subjects, 100 each group, 50% of women). Manual workers and unemployed subjects had lower QoL score (0 to 100 point scale) than white-collar workers (accordingly 72.2; 71.2; 76.2; P working subjects (n = 200), QoL was inversely associated with reported health problems (P work (P work, while in the intellectual group (n = 100) mainly by health factors. Quality of work and health assessment are the main domains that influence older workers' QoL and may contribute to the shortening of the work period and accelerated transfer to retirement. Quality of work assessment seems especially important in older manual workers.
Root deformation reduces tolerance of lodgepole pine to attack by Warren root collar weevil.
Robert, Jeanne A; Lindgren, B Staffan
2010-04-01
Surveys were conducted on regenerating stands of lodgepole pine to determine the relationship between root deformation and susceptibility to attack by the Warren root collar weevil, Hylobius warreni Wood. The total number of trees attacked by H. warreni did not differ between planted and natural trees. A matched case-control logistic regression suggested that root cross-sectional area was more important in predicting weevil attack for naturally regenerated trees than for planted trees, but weevils were associated with a larger reduction in height-to-diameter ratios for trees with planted root characteristics than for trees with natural root form. Neither the stability of attacked versus unattacked trees differed significantly and there was no significant interaction of weevil attack and tree type, but weevil-killed trees had different root characteristics than alive, attacked trees. Lateral distribution and root cross-sectional area were significant predictors of alive attacked trees versus weevil-killed trees, suggesting that trees with poor lateral spread or poor root cross-sectional area are more likely to die from weevil attack. We conclude that root deformation does not necessarily increase susceptibility to attack but may increase the likelihood of mortality. Thus, measures to facilitate good root form are needed when planting pine in areas with high risk of Warren root collar weevil attack.
Directory of Open Access Journals (Sweden)
Muhammad Faisol Chowdhury
2016-12-01
Full Text Available This paper investigates the managerial interpretation of the terms “error of judgement” and “white-collar crime” in relation to the evasion or negligence observed in administering occupational health and safety (OHS provisions in the apparel manufacturing sector of Bangladesh. The research is qualitative in nature and follows an interpretivist paradigm. The questionnaire responses were collected from 20 mid- and top-level managers from 10 large apparel manufacturing factories located on the outskirts of Dhaka. The research reveals that all of the respondents have adequate knowledge about the relevant OHS provisions and safety protocols imposed on them by the local government and the global supply chain. They believe that the correct administration of the OHS provisions will reduce workplace accidents effectively. The research unfolds that the respondents interpret in different ways the terms "error of judgement” and “white-collar crime” in association with OHS negligence and evasion. Although empirical evidence shows that this type of negligence and evasion are considered as white-collar crime and punishable, most of the respondents in this research do not subscribe to this notion and alternatively believe that it is an “error of judgement” and therefore non-punishable.
DEFF Research Database (Denmark)
Andersen, Lars Louis; Mortensen, Ole Steen; Hansen, Jørgen Vinsløv
2011-01-01
Objective To estimate the impact of pain in different body regions on future long-term sickness absence (LTSA) among blue- and white-collar workers. Method Prospective cohort study in a representative sample of 5603 employees (the Danish Work Environment Cohort Study) interviewed in 2000, and fol......Objective To estimate the impact of pain in different body regions on future long-term sickness absence (LTSA) among blue- and white-collar workers. Method Prospective cohort study in a representative sample of 5603 employees (the Danish Work Environment Cohort Study) interviewed in 2000......, and followed in 2001-2002 in a national sickness absence register. Cox regression analysis was performed to assess the risk estimates of mutually adjusted severe pain in the neck/shoulder, low back, hand/wrist and knees for onset of LTSA, defined as receiving sickness absence compensation for at least 3...... consecutive weeks. Age, gender, body mass index, smoking and diagnosed disease were controlled for. Results In 2000 the prevalence among blue- and white-collar workers, respectively, of severe pain was 33% and 29% (neck/shoulder), 33% and 25% (low back), 16% and 11% (hand/wrists), and 16% and 12% (knees...
Convenience in white-collar crime: A resource perspective
Directory of Open Access Journals (Sweden)
Petter Gottschalk
2017-03-01
Full Text Available White-collar offenders have access to resources that make financial crime convenient. In the rare case of crime suspicion, resources are available in terms of professional attorney work, control over internal investigations, and public relations support. Hiring private investigators at an early stage of potential crime disclosure enables the organization to control the investigation mandate and influence the investigation process and the investigation output. Getting an early start on reconstruction of the past in terms of a fraud examination makes it possible for the suspect and the organization to influence what facts are relevant and how facts might be assessed in terms of possible violations of the penal code. Convenience aspects of private investigations are discussed in this article in terms of five internal investigations, two in the United States (General Motors and Lehman Brothers and three in Norway (Telenor VimpelCom, DNB Bank, and Norwegian Football Association. The aim of this research is to contribute insights into convenience associated with internal private investigations.
Changing Workplaces to Reduce Work-Family Conflict: Schedule Control in a White-Collar Organization
Kelly, Erin L.; Moen, Phyllis; Tranby, Eric
2011-01-01
Work-family conflicts are common and consequential for employees, their families, and work organizations. Can workplaces be changed to reduce work-family conflict? Previous research has not been able to assess whether workplace policies or initiatives succeed in reducing work-family conflict or increasing work-family fit. Using longitudinal data collected from 608 employees of a white-collar organization before and after a workplace initiative was implemented, we investigate whether the initi...
Interpretación en arqueología : piezas de collar de una necrópolis navarra
Directory of Open Access Journals (Sweden)
Amparo Castiela Rodríguez
2005-01-01
Full Text Available Los restos de ajuar, recuperados en la necrópolis que han seguido el rito de la cremación, nos llegan muy alterados y requieren en ocasiones un esfuerzo especial para su comprensión. En el caso de varias piezas procedentes de La Atalaya, que formaban parte de collares, cuya interpretación ofrecemos
Crystal growth and applications of mercuric iodide. Report S-242-TP
International Nuclear Information System (INIS)
Schieber, M.; Roth, M.; Schnepple, W.F.
1983-01-01
A brief summary is given of a paper which discusses the crystal growth of mercuric iodide, a high-Z wide bandgap semiconductor suitable as a low noise, room temperature x-ray and gamma-ray detector. The paper summarized also reviews the state-of-the-art of the synthesis and purification of the starting material, mechanical properties and dislocation structure of HgI 2 , and recent success in the development of thick HgI 2 spectrometers
Introduction to fifth international workshop on mercuric iodide nuclear radiation detectors
International Nuclear Information System (INIS)
Schieber, M.
1982-01-01
Mercuric iodide is a wide bandgap semiconductor, with Eg approx. = 2.14 eV at room temperature. Therefore, HgI 2 is totally different from the well-studied, narrower gap, elemental semiconductors such as Si and Ge, and also different in its physical and chemical properties from the known semiconductor binary zinc-blend compounds such as GaAs or InP. The purpose of studies in the last decade was to further our understanding of HgI 2 ; recent progress is reported
Sun, Feng-Hua; Wong, Stephen Heung-Sang; Liu, Zhi-Gang
2016-01-01
The purpose of this study was to investigate whether both glycemic index (GI) and breakfast fructose content affect appetite during the postprandial period and recovery period after 1 hr of brisk walking. Ten healthy young men (age: 21.7 ± 1.5 y, body mass index: 20.9 ± 1.1 kg∙m(-2), VO2max: 53.7 ± 3.7 mL∙kg(-1)∙min(-1)) completed 1 hr of brisk walking at 46% VO2max 2 hr after eating one of three isocaloric breakfasts: a low-GI breakfast not including fructose content (LGI), a low-GI breakfast including fructose beverage (LGIF) and a high-GI breakfast (HGI). All breakfasts provided 1.0 g∙kg(-1) body weight carbohydrates, and the calculated GI values for the three breakfasts were 41, 39, and 72, respectively. In the LGIF and HGI trials, approximately 25% of participants' energy was derived from either fructose or glucose beverage. Appetite scores were measured every 30 min during the 2-hr postprandial period and 1-hr recovery period. During the postprandial period, the incremental areas under the blood response curve values of glucose and insulin were higher in the HGI trial, compared with those in the LGI and LGIF trials. At 30 and 60 min during the recovery period, the appetite scores were lower in the LGIF trial than those in the LGI and HGI trials. No differences were observed between the LGI and HGI trials. Breakfast fructose content, rather than GI, seems to affect appetite during the recovery period after 1 hr of brisk walking. Copyright © 2015 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Shenshen Cai
2014-08-01
Full Text Available In 2007, Li Ke’s novel A Story of Lala’s Promotion (Du Lala Shengzhi Ji became a bestseller among Chinese white-collar workers in foreign-owned (Western companies and struck a chord with the Chinese middle class. The novel revolves around office politics, Western company culture and the white-collar lifestyle, the ‘shelved ladies’ phenomenon and middle-class aesthetics. To decipher the embedded cultural codes of this book, this study undertakes a textual analysis of the plots of A Story of Lala’s Promotion and its filmic adaptation, Go Lala Go! (Du Lala Shengzhi Ji dir. Xu Jinglei, 2010. This paper conducts a trans-media adaption study (from fiction to film to examine three interrelated themes in the novel and the film. First, focusing on the influence of Western corporate culture on Chinese white-collar workers under economic globalisation, the widely circulating rules of Western workplaces are interpreted, clarifying the acculturating process of Western culture over its Chinese counterpart. The paper further explains that on the platform provided by foreign companies, and with the influence and training of Western corporate culture, intelligent and diligent young Chinese aspirational women struggle and realise their dreams in the workplace. Second, employing a feminist perspective, an attempt is made to address the situation of contemporary Chinese white-collar women represented by the contemporary social phenomenon of the ‘shelved ladies’, which also serves as an emblem of female independence and individualism. Third, through an analysis of the filmic adaptation, which focuses on the white-collar female’s lifestyle and consumption habits, the paper also highlights the contemporary Chinese population’s pursuit of a middle-class identity and aesthetic that mirrors the overwhelming consumerism of post-socialist China.
Shenshen Cai
2014-01-01
In 2007, Li Ke’s novel A Story of Lala’s Promotion (Du Lala Shengzhi Ji) became a bestseller among Chinese white-collar workers in foreign-owned (Western) companies and struck a chord with the Chinese middle class. The novel revolves around office politics, Western company culture and the white-collar lifestyle, the ‘shelved ladies’ phenomenon and middle-class aesthetics. To decipher the embedded cultural codes of this book, this study undertakes a textual analysis of the plots of A Story of ...
Effects of Mixed Isoenergetic Meals on Fat and Carbohydrate Metabolism during Exercise in Older Men
Directory of Open Access Journals (Sweden)
Minoo Bassami
2011-01-01
Full Text Available The present study was designed to investigate the effects of four different meals on fat and CHO metabolism during subsequent exercise in elderly males. Eight healthy males (age: 63.3 ± 5.2 years reported to the physiology laboratory on four separate occasions, each of which was allocated for the performance of a 30-minute exercise on a cycle ergometer at 60% ̇VO2max after having normal (N, high fat (HF, high carbohydrate high glycaemic index (HGI and high carbohydrate low glycaemic index (LGI meals. Fat oxidation during exercise after the meals (HF=0.26±0.04 g/min; N=0.21±0.04 g/min; HGI=0.22±0.03 g/min; LGI=0.19±0.03 g/min was not significant (>.05, and neither were the rates of carbohydrate oxidation (N=1.79±0.28, HF=1.58±0.22, HGI=1.68±0.22, and LGI=1.77±0.21 g/m. NEFA concentration increased after HF (<.05 but decreased after HGI and LGI (<.05. Glucose concentration decreased as a result of exercise after HF, and LGI (<.05 whereas insulin concentration decreased significantly during exercise after N, HF, and HGI (<.05. It can be concluded that, in elderly males, feeding isoenergetic meals containing different proportions of carbohydrate and fat do not significantly alter oxidation of fat and CHO during exercise in spite of changes in some circulating metabolites.
High gradient lens for charged particle beam
Chen, Yu-Jiuan
2014-04-29
Methods and devices enable shaping of a charged particle beam. A dynamically adjustable electric lens includes a series of alternating a series of alternating layers of insulators and conductors with a hollow center. The series of alternating layers when stacked together form a high gradient insulator (HGI) tube to allow propagation of the charged particle beam through the hollow center of the HGI tube. A plurality of transmission lines are connected to a plurality of sections of the HGI tube, and one or more voltage sources are provided to supply an adjustable voltage value to each transmission line of the plurality of transmission lines. By changing the voltage values supplied to each section of the HGI tube, any desired electric field can be established across the HGI tube. This way various functionalities including focusing, defocusing, acceleration, deceleration, intensity modulation and others can be effectuated on a time varying basis.
El collar de la paloma : tratado sobre el amor y los amantes
Directory of Open Access Journals (Sweden)
Paulina López Pita
1999-01-01
Full Text Available Se recoge en este trabajo la opinión que algunos estudiosos han dado sobre una de las mejores obras de la literatura árabe, calificada por don Emilio García Gómez de auténtica joya literaria. Su autor, el ilustre polígrafo cordobés, Ibn Hazm (994-1064, comenzó a escribirla en el año 1022 en unas duras condiciones, como él mismo reconoce, cuando se hallaba cautivo en dativa. Por entonces, el califato cordobés mostraba ya sus primeros síntomas de debilidad. Esta obra esta escrita en árabe purísimo y en rica prosa en la que se intercalan versos con un profundo sentimiento. En ella su autor nos narra aspectos del amor basados en su propia experiencia, y en lo que le contaron gentes de fiar, transmitiendo, en suma, como amaron las gentes de al-Andalus durante el gobierno de la dinastía omeya; por este motivo, algunos consideran, en parte, este libro como la autobiografía de su autor y de las gentes que le rodearon. Ibn Hazm compuso esta obra por encargo de un amigo y a través de ella le ofrece, por la amistad que les une, «ayuda» para alcanzar la verdad. En los sucesivos capítulos de que consta «El collar», el autor nos habla de los fundamentos del amor, entre los que destaca, la esencia del amor, las formas de enamoramiento,etc... de los accidentes del amor y de sus cualidades loables y vituperables; de las malaventuras que sobrevienen al amor, de la fealdad del pecado y de la castidad. No obstante, a pesar del plan previo establecido por el autor, estos temas se mezclan unos con otros, y de ello se excusa Ibn Hazm. «El collar de la paloma» ha tenido una gran divulgación, siendo traducido a las principales lenguas, y en él han querido encontrar, estudiosos de la literatura medieval ciertas similitudes.This report contains some opinión from several experts about one of the masterpieces of the arab literature, considered as an authentic jewel by Emilio García Gómez. Its author, the famous cordovan polygraph Ibn Hazm (994
Long working hours and risk for hypertension in Japanese male white collar workers.
Nakanishi, N; Yoshida, H; Nagano, K; Kawashimo, H; Nakamura, K; Tatara, K
2001-05-01
To evaluate the association of long working hours with the risk for hypertension. A five year prospective cohort study. Work site in Osaka, Japan. 941 hypertension free Japanese male white collar workers aged 35-54 years were prospectively examined by serial annual health examinations. Men in whom borderline hypertension and hypertension were found during repeated surveys were defined as incidental cases of borderline hypertension and hypertension. 336 and 88 men developed hypertension above the borderline level and definite hypertension during the 3940 and 4531 person years, respectively. After controlling for potential predictors of hypertension, the relative risk for hypertension above the borderline level, compared with those who worked hours per day, was 0.63 (95% confidence intervals (CI): 0.43, 0.91) for those who worked 10.0-10.9 hours per day and 0.48 (95% CI: 0.31, 0.74) for those who worked > or = 11.0 hours per day. The relative risk for definite hypertension, compared with those who worked hours per day, was 0.33 (95% CI: 0.11, 0.95) for those who worked > or = 11.0 hours per day. The multivariate adjusted slopes of diastolic blood pressure (DBP) and mean arterial blood pressure (MABP) during five years of follow up decreased as working hours per day increased. From the multiple regression analyses, working hours per day remained as an independent negative factor for the slopes of systolic blood pressure, DBP, and MABP. These results indicate that long working hours are negatively associated with the risk for hypertension in Japanese male white collar workers.
1999-01-01
This document concerns the award of two contracts for the supply of 12 500 000 fine-blanked austenitic steel collars in three different shapes and of two different types for the cold masses of the LHC superconducting dipole magnets. Following a market survey carried out among 70 firms in fourteen Member States and one firm in Japan, a call for tenders (IT-2469/LHC/LHC) was sent on 3 June 1999 to eleven firms in five Member States and one firm in Japan. By the closing date, CERN had received five tenders. The Finance Committee is invited to agree to the negotiation of two contracts with: - MALVESTITI (IT) for the supply of up to 7 812 500 fine-blanked austenitic steel collars, which represents 5/8 of the total quantity required for the cold masses of the LHC superconducting dipole magnets, for a total amount of up to 6 908 509 Swiss francs, subject to revision for contractual deliveries after 31 December 2001, with an option for the supply of up to 4 687 500 additional fine-blanked austenitic steel collars, wh...
Berntsson, L; Lundberg, U; Krantz, G
2006-12-01
To analyse gender differences in paid and unpaid workload and symptoms in matched groups of Swedish white-collar workers with children. Paid and unpaid workload and perceived stress from paid work, conflict between demands and control over household work were measured by a total workload (TWL) questionnaire. Some symptoms were rated with regard to frequency and severity as a measure of health. Cross-sectional analyses were performed. Matched groups of male (n = 440) and female (n = 529) well-educated white-collar workers in full-time employment, aged 32-58 years and living with children in the home. Women in higher positions in Sweden are healthier than the average population of women, but report more symptoms than men in the same position as well as more stress from paid work, more conflict between demands and a greater TWL. However, women also reported more control over household duties and TWL was not associated with more symptoms. The men were mainly focused on their paid work role and perhaps even more so than men in the general population as they were fairly resistant to feelings of conflicting demands. Even among matched groups of full-time employed, well-educated men and women, traditional gender differences in division of responsibilities and time allocation were found. Even though the women were healthy at this stage, they might risk future ill health, owing to high workload, stress and feelings of conflicting demands.
Measuring the actual I-131 thyroid uptake curve with a collar detector system: a feasibility study
Energy Technology Data Exchange (ETDEWEB)
Brinks, Peter; Van Gils, Koen; Dickerscheid, Dennis B.M.; Habraken, Jan B.A. [Department of Medical Physics, St. Antonius Hospital, Nieuwegein (Netherlands); Kranenborg, Ellen; Lavalaye, Jules [Department of Nuclear Medicine, St. Antonius Hospital, Nieuwegein (Netherlands)
2017-06-15
Radionuclide therapy using I-131 is commonly used for the treatment of benign thyroid diseases. The therapeutic dose to be administered is calculated based on the type of disease, the volume of the thyroid, and the measured uptake percentage. This methodology assumes a similar biological half-life of iodine, whereas in reality a large variation in biological half-life is observed. More knowledge about the actual biological half-life of iodine for individual patients will improve the quantification of the delivered radiation dose during radioiodine therapy and could aid the evaluation of the success of the therapy. In this feasibility study we used a novel measurement device [Collar Therapy Indicator (CoTI)] to measure the uptake curve of patients undergoing I-131 radioiodine therapy. The CoTI device is a light-weight wearable device that contains two independent gamma radiation detectors that are placed in a collar. By comparing results of thyroid uptake measurements with results obtained with a gamma camera, the precision of the system is demonstrated. Additionally, for three patients the uptake curve is measured during 48 h of admission in the hospital. The presented results demonstrate the feasibility of the new measurement device to measure the uptake curve during radioiodine therapy. (orig.)
DEFF Research Database (Denmark)
Bowie, Rauri C. K.; Fjeldså, Jon; Kiure, Jacob
2016-01-01
a cautious approach and formally describe the Rubeho and Udzungwa greater double-collared sunbird population as a subspecies of Cinnyris whytei. This new sunbird taxon has been recorded only above 1700 m in scrub on the forest/grassland ecotone in a very restricted area in the Rubeho and Udzungwa Highlands...
Prevalence of radiographic appearance of pneumoconiosis in an unexposed blue collar population
International Nuclear Information System (INIS)
Castellan, R.M.; Sanderson, W.T.; Petersen, M.R.
1985-01-01
Blue collar employees currently working in environments free from exposure to respiratory hazards were examined with chest radiography and a standard occupational history questionnaire. Workers who had worked for a total of 5 yr or more in previous jobs with possible hazardous respiratory exposures were excluded. Each radiograph was read independently by 3 NIOSH-certified ''B'' readers. For small opacities, the median profusion was accepted as a summary reading. The 1,422 readable films represented a population of 50.6% males, 49.4% females, 52.5% whites, 44.2% blacks, 47.0% current smokers, and 38.5% nonsmokers. The mean age was 33.8 yr, with a range from 16 to 70 yr. Small opacities of profusion greater than or equal to 1/0 were identified in only 3 (0.21%) of the radiographs--2 with small rounded opacities and 1 with small irregular opacities. Small irregular opacities of profusion category greater than or equal to 0/1 were statistically associated with age, gender, and pack-years of smoking. The results suggest that using the median of 3 independent readings should rarely result in interpretation of chest radiographs as ''positive'' for pneumoconiosis in active workers who have not had significant dust exposure
Synchronous genetic turnovers across Western Eurasia in Late Pleistocene collared lemmings.
Palkopoulou, Eleftheria; Baca, Mateusz; Abramson, Natalia I; Sablin, Mikhail; Socha, Paweł; Nadachowski, Adam; Prost, Stefan; Germonpré, Mietje; Kosintsev, Pavel; Smirnov, Nickolay G; Vartanyan, Sergey; Ponomarev, Dmitry; Nyström, Johanna; Nikolskiy, Pavel; Jass, Christopher N; Litvinov, Yuriy N; Kalthoff, Daniela C; Grigoriev, Semyon; Fadeeva, Tatyana; Douka, Aikaterini; Higham, Thomas F G; Ersmark, Erik; Pitulko, Vladimir; Pavlova, Elena; Stewart, John R; Węgleński, Piotr; Stankovic, Anna; Dalén, Love
2016-05-01
Recent palaeogenetic studies indicate a highly dynamic history in collared lemmings (Dicrostonyx spp.), with several demographical changes linked to climatic fluctuations that took place during the last glaciation. At the western range margin of D. torquatus, these changes were characterized by a series of local extinctions and recolonizations. However, it is unclear whether this pattern represents a local phenomenon, possibly driven by ecological edge effects, or a global phenomenon that took place across large geographical scales. To address this, we explored the palaeogenetic history of the collared lemming using a next-generation sequencing approach for pooled mitochondrial DNA amplicons. Sequences were obtained from over 300 fossil remains sampled across Eurasia and two sites in North America. We identified five mitochondrial lineages of D. torquatus that succeeded each other through time across Europe and western Russia, indicating a history of repeated population extinctions and recolonizations, most likely from eastern Russia, during the last 50 000 years. The observation of repeated extinctions across such a vast geographical range indicates large-scale changes in the steppe-tundra environment in western Eurasia during the last glaciation. All Holocene samples, from across the species' entire range, belonged to only one of the five mitochondrial lineages. Thus, extant D. torquatus populations only harbour a small fraction of the total genetic diversity that existed across different stages of the Late Pleistocene. In North American samples, haplotypes belonging to both D. groenlandicus and D. richardsoni were recovered from a Late Pleistocene site in south-western Canada. This suggests that D. groenlandicus had a more southern and D. richardsoni a more northern glacial distribution than previously thought. This study provides significant insights into the population dynamics of a small mammal at a large geographical scale and reveals a rather complex
Castleberry, Stephen B.
2007-01-01
Marketing educators bear some responsibility for teaching ethics and legal issues to their students. Visits to white-collar criminals in a federal prison camp are one method of achieving this task. This article develops and empirically assesses ten objectives for such a visit by MBA and undergraduate marketing classes. Undergraduates rated the…
Directory of Open Access Journals (Sweden)
Carlos Eduardo B. Moura
2007-09-01
.Collared peccary (Tayassu tajacu belongs to the Tayassuidae family, characterized by a "collar" of white hairs that cross behind the neck and extend bilaterally in front of the shoulders. It can be found from south-western United States to Argentina. In the literature a shortage of data is verified regarding the functional anatomy of the collared peccaries, especially of studies that involve the anatomy of the brachial plexus. To elucidate the behavior of this plexus of collared peccaries and with the purpose to contribute for the development of compared anatomy, this study was accomplished. Thirty animals of different ages were used (17 males and 13 females coming from the Wild Animal Multiplication Center of the "Universidade Federal Rural do Semiárido" Mossoró, Rio Grande do Norte, Brazil. After slaughter bilateral dissection of the brachial plexuses took place, and the results were registered in schematic drawings and the dispositions grouped in tables for subsequent statistical analysis based on the percentile frequency. It was found that the Plexus brachialis of collared peccaries is the result of established communications, mainly among the Rami ventrales of the last three cervical nerves and of the first two thoracic nerves, having a contribution of the fourth and fifth cervical nerves in 16.67% and 50.00% of the cases, respectively. In 40.00% of the dissections the most frequent plexus was of the type C6, C7, C8, T1 and T2. The main nerves derived from brachial plexus of the collared peccaries and its respective origins had been: Nervus suprascapularis (C6, C7, Nn. subscapulares (C5, C6 e C7 or C6 e C7, N. axillaris (C6, C7, N. musculocutaneus (C7, C8, N. medianus (C7, C8, T1, T2, N. radialis (C8, T1, T2, N. ulnaris (C8, T1, T2, cranialis (C7, and caudalis (C7, C8 Nn. pectorales , N. thoracodorsalis (C6, C7, C8, N. thoracicus longus (C7, C8, and N. thoracicus lateralis (C8, T1, T2.
Berntsson, L; Lundberg, U; Krantz, G
2006-01-01
Objective To analyse gender differences in paid and unpaid workload and symptoms in matched groups of Swedish white‐collar workers with children. Design and setting Paid and unpaid workload and perceived stress from paid work, conflict between demands and control over household work were measured by a total workload (TWL) questionnaire. Some symptoms were rated with regard to frequency and severity as a measure of health. Cross‐sectional analyses were performed. Participants Matched groups of male (n = 440) and female (n = 529) well‐educated white‐collar workers in full‐time employment, aged 32–58 years and living with children in the home. Results Women in higher positions in Sweden are healthier than the average population of women, but report more symptoms than men in the same position as well as more stress from paid work, more conflict between demands and a greater TWL. However, women also reported more control over household duties and TWL was not associated with more symptoms. The men were mainly focused on their paid work role and perhaps even more so than men in the general population as they were fairly resistant to feelings of conflicting demands. Conclusion Even among matched groups of full‐time employed, well‐educated men and women, traditional gender differences in division of responsibilities and time allocation were found. Even though the women were healthy at this stage, they might risk future ill health, owing to high workload, stress and feelings of conflicting demands. PMID:17108304
Workload, work stress, and sickness absence in Swedish male and female white-collar employees.
Krantz, Gunilla; Lundberg, Ulf
2006-01-01
This study aimed to analyse, in a homogeneous population of highly educated men and women, gender differences in self-reported sickness absence as related to paid and unpaid work and combinations of these (double exposure), as well as to perceived work stress and work-home conflict, i.e. conflict between demands from the home and work environment. A total of 743 women and 596 men, full-time working white-collar employees randomly selected from the general Swedish population aged 32-58, were assessed by a Swedish total workload instrument. The influence of conditions in paid and unpaid work and combinations of these on self-reported sickness absence was investigated by multivariate regression analyses. Analysis of variance (ANOVA) was used to assess differences between men and women. Overtime was associated with lower sickness absence, not only for men but also for women, and a double-exposure situation did not increase the risk of sick leave. Contrary to what is normally seen, conflict between demands did not emerge as a risk factor for sickness absence for women, but for men. Our assumption that sickness absence patterns would be more similar for white-collar men and women than for the general population was not confirmed. However, the women working most hours were also the least sick-listed and assumed less responsibility for household chores. These women were mainly in top-level positions and therefore we conclude that men and women in these high-level positions seem to share household burdens more evenly, but they can also afford to employ someone to assist in the household.
A study on the growth of compound semiconductor single crystal by TOM technique
International Nuclear Information System (INIS)
Kim, H.C.; Kwon, S.I.; Chung, M.K.; Chang, J.S.
1981-01-01
This paper describes the merit of the HgI 2 single crystals obtained by solution growth, 2- and 3-region temperature growth, and temperature oscillation growth for soft γ-ray detectors which can be operated at room temperature. Special efforts are put on the design, construction, and operation of the TOM (Temperature Oscillation Method) single crystal growing furnace. Experimental results show that HgI 2 detectors fabricated by vapour phase growth method usually exhibit sufficient enough detector characteristics for soft γ-ray spectrometry. However, further investigation should be carried out to eliminate detector deterioration due to polarization effect. (author)
Olneck, Michael R.
This study used five data sets to investigate the effects of measured cognitive skills on educational attainment, and the effects of cognitive skills and educational attainment on occupational status and earning among men with low test scores, as compared to men with high test scores, and among men with blue-collar fathers, as compared to men with…
DEFF Research Database (Denmark)
Krog-Mikkelsen, Inger; Sloth, Birgitte; Dimitrov, Dimiter
2011-01-01
At present, it is difficult to determine whether glycemic index (GI) is an important tool in the prevention of lifestyle diseases, and long-term studies investigating GI with diets matched in macronutrient composition, fiber content, energy content, and energy density are still scarce. We...... investigated the effects of 2 high-carbohydrate (55%) diets with low GI (LGI; 79) or high GI (HGI; 103) on postprandial blood profile, subjective appetite sensations, energy expenditure (EE), substrate oxidation rates, and ad libitum energy intake (EI) from a corresponding test meal (LGI or HGI) after...... composition, fiber content, and energy density. The LGI meal resulted in lower plasma glucose, serum insulin, and plasma glucagon-like peptide (GLP)-1 and higher plasma glucose-dependent insulinotropic polypeptide concentrations than the HGI meal (P ≤ 0.05). Ratings of fullness were slightly higher...
Cap’n’collar differentiates the mandible from the maxilla in the beetle Tribolium castaneum
2012-01-01
Background The biting mandible of the arthropods is thought to have evolved in the ancestor of the insects, crustaceans and myriapods: the Mandibulata. A unique origin suggests a common set of developmental genes will be required to pattern the mandible in different arthropods. To date we have functional studies on patterning of the mandibular segment of Drosophila melanogaster showing in particular the effects of the gene cap’n’collar (cnc), however, the dipteran head is far from representative of insects or of more distantly related mandibulates; Drosophila does not even possess a mandibular appendage. To study the development of a more representative insect mandible, we chose the red flour beetle Tribolium castaneum and investigated the function of the Tribolium orthologs of cap’n’collar (Tc-cnc) and the Hox gene Deformed (Tc-Dfd). In order to determine the function of Tc-cnc and Tc-Dfd, transcripts were knocked down by maternal RNA interference (RNAi). The effects of gene knockdown were examined in the developing embryos and larvae. The effect of Tc-cnc and Tc-Dfd knockdown on the expression of other genes was determined by using in situ hybridization on Tribolium embryos. Results Our analyses show that Tc-cnc is required for specification of the identity of the mandibular segment of Tribolium and differentiates the mandible from maxillary identity. Loss of Tc-cnc function results in a transformation of the mandible to maxillary identity as well as deletion of the labrum. Tc-Dfd and the Tribolium homolog of proboscipedia (Tc-mxp = maxillopedia), Hox genes that are required to pattern the maxillary appendage, are expressed in a maxilla-like manner in the transformed mandible. Tribolium homologs of paired (Tc-prd) and Distal-less (Tc-Dll) that are expressed in the endites and telopodites of embryonic appendages are also expressed in a maxilla-like manner in the transformed mandible. We also show that Tc-Dfd is required to activate the collar of Tc
Landsberg, G M; Beck, A; Lopez, A; Deniaud, M; Araujo, J A; Milgram, N W
2015-09-12
The objective of the study was to assess the effects of a dog-appeasing pheromone (DAP) collar in reducing sound-induced fear and anxiety in a laboratory model of thunderstorm simulation. Twenty-four beagle dogs naïve to the current test were divided into two treatment groups (DAP and placebo) balanced on their fear score in response to a thunderstorm recording. Each group was then exposed to two additional thunderstorm simulation tests on consecutive days. Dogs were video-assessed by a trained observer on a 6-point scale for active, passive and global fear and anxiety (combined). Both global and active fear and anxiety scores were significantly improved during and following thunder compared with placebo on both test days. DAP significantly decreased global fear and anxiety across 'during' and 'post' thunder times when compared with baseline. There was no significant improvement in the placebo group from baseline on the test days. In addition, the DAP group showed significantly greater use of the hide box at any time with increased exposure compared with the placebo group. The DAP collar reduced the scores of fear and anxiety, and increased hide use in response to a thunder recording, possibly by counteracting noise-related increased reactivity. British Veterinary Association.
Daly, Maria; Tai, Chen-Jei; Deng, Chung-Yeh; Chien, Li-Yin
2009-01-14
Traditional Chinese medicine (TCM) has remained an integral part of Chinese culture and society for thousands of years. In Taiwan TCM is a recognized element of its National Health Insurance Scheme. However, there is no knowledge about how TCM is accessed by foreign workers from a non-Asian cultural background. The objectives of this study were to investigate the prevalence and patterns of TCM use among non-Asian white-collar workers living in Taiwan, and examine factors likely to influence their use of TCM. This study applied a cross-sectional survey design. A total of 207 white-collar foreign workers of a non-Asian background currently holding National Health Insurance cards who had lived in Taiwan for 4 months or more participated in this study. The prevalence of TCM use was 45%. The most frequently used therapies were traditional Chinese herbs/medicine and acupuncture. Factors indicating the likelihood of TCM usage were age 31-40 years, visit to an allopathic medical doctor in the last year, ability to read Chinese, having a friend or family member available to assist in the use of TCM, and access to information about TCM services available in Taiwan. Utilization of TCM by people of a non-Asian background living in Taiwan appears to be most influenced by enabling factors including language ability, access to information, and informal reference persons.
DEFF Research Database (Denmark)
Kongsted, Alice; Montvilas, Erisela Qerama; Kasch, Helge
2007-01-01
practitioners within 10 days after a whiplash injury and randomized to: 1) immobilization of the cervical spine in a rigid collar followed by active mobilization, 2) advice to "act-as-usual," or 3) an active mobilization program (Mechanical Diagnosis and Therapy). Follow-up was carried out after 3, 6, and 12......-extension trauma to the cervical spine. It is unclear whether this, in some cases disabling, condition can be prevented by early intervention. Active interventions have been recommended but have not been compared with information only. Methods. Participants were recruited from emergency units and general......Study Design. Randomized, parallel-group trial. Objective. To compare the effect of 3 early intervention strategies following whiplash injury. Summary of Background Data. Long-lasting pain and disability, known as chronic whiplash-associated disorder (WAD), may develop after a forced flexion...
DEFF Research Database (Denmark)
Kongsted, Alice; Montvilas, Erisela Qerama; Kasch, Helge
2007-01-01
Study Design. Randomized, parallel-group trial. Objective. To compare the effect of 3 early intervention strategies following whiplash injury. Summary of Background Data. Long-lasting pain and disability, known as chronic whiplash-associated disorder (WAD), may develop after a forced flexion......-extension trauma to the cervical spine. It is unclear whether this, in some cases disabling, condition can be prevented by early intervention. Active interventions have been recommended but have not been compared with information only. Methods. Participants were recruited from emergency units and general...... practitioners within 10 days after a whiplash injury and randomized to: 1) immobilization of the cervical spine in a rigid collar followed by active mobilization, 2) advice to "act-as-usual," or 3) an active mobilization program (Mechanical Diagnosis and Therapy). Follow-up was carried out after 3, 6, and 12...
Directory of Open Access Journals (Sweden)
Fátima Aparecida da Silva-Barreto
2010-06-01
Full Text Available Os grupos 3 e 4 de anastomose (AG-3 e AG-4 do fungo Rhizoctonia solani são importantes grupos associados à batata no mundo. No Brasil, o AG-3 é relatado afetando principalmente batata e fumo. Já o AG-4 causa perdas consideráveis em culturas de importância econômica, como a soja, o feijão e o amendoim, podendo ocorrer também em hortaliças como o espinafre, o pimentão, o brócolis, o tomate, a batata e frutíferas como o melão. Recentemente foi constatada, em Brasília-DF, a associação de R. solani a plantas invasoras em áreas de cultivo de batata. Entretanto, não há informação a respeito da etiologia do patógeno bem como do papel de espécies invasoras como outras hospedeiras no ciclo do patógeno. Objetivou-se com esse estudo caracterizar isolados de R. solani obtidos de batata e de outras três espécies de plantas invasoras associadas a áreas de cultivo da cultura: juá-de-capote [Nicandra physaloides (L. Pers., Solanaceae], beldroega (Portulaca oleracea L., Portulacaceae, e caruru (Amaranthus deflexus L., Amaranthaceae. Foi confirmada a hipótese de que os isolados obtidos de R. solani de beldroega, caruru e juá-de-capote pertencem ao grupo 4 de anastomose e são patogênicos à batata, exceto o isolado de beldroega. Estes isolados apresentaram patogenicidade cruzada às três espécies e também patogênicos à maria-pretinha (Solanum americanum Mill., uma outra espécie de Solanaceae invasora. A classificação dos isolados no grupo AG-4 HGI ou no grupo AG-4 HGIII (isolado de caruru foi confirmada através de características culturais e moleculares (seqüenciamento da região ITS-5.8S do rDNA. Os resultados deste trabalho trazem implicações importantes para o manejo das podridões radiculares de Rhizoctonia em batata.The anastomosis groups 3 and 4 (AG-3 and AG-4 of the fungus Rhizoctonia solani are important groups associated with potatoes worldwide. In Brazil, the AG-3 is reported affecting mainly potatoes and
Deng Chung-Yeh; Tai Chen-Jei; Daly Maria; Chien Li-Yin
2009-01-01
Abstract Background Traditional Chinese medicine (TCM) has remained an integral part of Chinese culture and society for thousands of years. In Taiwan TCM is a recognized element of its National Health Insurance Scheme. However, there is no knowledge about how TCM is accessed by foreign workers from a non-Asian cultural background. The objectives of this study were to investigate the prevalence and patterns of TCM use among non-Asian white-collar workers living in Taiwan, and examine factors l...
Energy Technology Data Exchange (ETDEWEB)
Nguyen, Tam Cong, E-mail: tam.nguyen.cong@energia.mta.hu; Huszti, Jozsef; Nguyen, Quan Van
2015-09-01
Effect of double false pulses of preamplifiers in neutron coincidence collar was investigated to explain non-parallel shape of calibrated D/S–M{sub Pu} curves of two commercial neutron coincidence collars, JCC-31 and JCC-13. Two curves, which were constructed from D/S ratio (doubles and singles count rate), and Pu content M{sub Pu}, of the same set of secondary standard PuBe neutron sources, should be parallel. Non-parallelism rises doubt about usability of the method based on this curve for determination of Pu content in PuBe neutron sources. We have shown in three steps that the problem originates from double false pulses of preamplifiers in JCC-13. First we used a pulse train diagram for analyzing the non-parallel shape, second we used Rossi-Alpha distribution measured by pulse train recorder developed in our institute and finally, we investigated the effect of inserted noise pulses. This implies a new type of QA test option in traditional multiplicity shift registers for excluding presence of double false pulses.
Source-specific social support and circulating inflammatory markers among white-collar employees.
Nakata, Akinori; Irie, Masahiro; Takahashi, Masaya
2014-06-01
Despite known beneficial effects of social support on cardiovascular health, the pathway through which sources of support (supervisor, coworkers, family/friends) influence inflammatory markers is not completely understood. We investigated the independent and moderating associations between social support and inflammatory markers. A total of 137 male white-collar employees underwent a blood draw for measurement of high-sensitive C-reactive protein (hs-CRP), interleukin-6 (IL-6), tumor necrosis factor alpha (TNF-α), monocyte and leukocyte counts, and completed a questionnaire on social support. Multivariable linear regression analyses controlling for covariates revealed that supervisor support was inversely associated with IL-6 (β = -0.24, p markers. Social support from the immediate supervisor may be a potential mechanism through which social support exerts beneficial effects on inflammatory markers in working men.
Campbell, Matthew D; Gonzalez, Javier T; Rumbold, Penny L S; Walker, Mark; Shaw, James A; Stevenson, Emma J; West, Daniel J
2015-03-01
Patients with type 1 diabetes face heightened risk of hypoglycemia after exercise. Subsequent overfeeding, as a preventative measure against hypoglycemia, negates the energy deficit after exercise. Patients are also required to reduce the insulin dose administered with postexercise foods to further combat hypoglycemia. However, the insulin dose is dictated solely by the carbohydrate content, even though postprandial glycemia is vastly influenced by glycemic index (GI). With a need to control the postexercise energy balance, appetite responses after meals differing in GI are of particular interest. We assessed the appetite response to low-glycemic index (LGI) and high-glycemic index (HGI) postexercise meals in type 1 diabetes patients. This assessment also offered us the opportunity to evaluate the influence of GI on appetite responses independently of insulinemia, which confounds findings in individuals without diabetes. Ten physically active men with type 1 diabetes completed 2 trials in a randomized crossover design. After 45 min of treadmill exercise at 70% of the peak oxygen uptake, participants consumed an LGI (GI ∼37) or HGI (GI ∼92) meal with a matched macronutrient composition, negligible fiber content, and standardized insulin-dose administration. The postprandial appetite response was determined for 180 min postmeal. During this time, circulating glucose, insulin, glucagon, and glucagon-like peptide-1 (GLP-1) concentrations and subjective appetite ratings were determined. The HGI meal produced an ∼60% greater postprandial glucose area under the curve (AUC) than did the LGI meal (P = 0.008). Insulin, glucagon, and GLP-1 did not significantly differ between trials (P > 0.05). The fullness AUC was ∼25% greater after the HGI meal than after the LGI meal (P < 0.001), whereas hunger sensations were ∼9% lower after the HGI meal than after the LGI meal (P = 0.001). Under conditions of matched insulinemia and fiber, an HGI postexercise meal suppresses
Directory of Open Access Journals (Sweden)
Fatma Arık Çolakoğlu
2015-12-01
Full Text Available Ülkemizdeki tüketimi genellikle taze olarak gerçekleşen su ürünleri kolay bozulabilen gıdalardır. Bu ürünlerin raf ömrü süresi ve tüketim kalitesinin uzun süre korunabilmesi ülke ekonomisi ve halk sağlığı açısından büyük önem taşımaktadır. Özellikle son yıllarda koruyucu katkı maddeleri kullanılarak, su ürünlerinin raf ömrünün uzatılmasına yönelik çalışmalar ilgi çekmektedir. Bu bağlamda yapılan çalışmada, Çanakkale yöresinde avcılığı yapılan ve frische-star ile muamele edilen taze karideslerin duyusal ve mikrobiyolojik olarak raf ömrü süreleri tespit edilmeye çalışılmıştır. Mikrobiyolojik analizlerde toplam aerob bakteri sayısına ve ayrıca bozulma bakterilerinden Pseudomonas, Enterobactericea miktarına bakılmıştır. Duyusal analizlerde ise karidesler; renk, koku, tekstür ve tat açısından incelenmiştir
Daly, Maria; Tai, Chen-Jei; Deng, Chung-Yeh; Chien, Li-Yin
2009-01-01
Background Traditional Chinese medicine (TCM) has remained an integral part of Chinese culture and society for thousands of years. In Taiwan TCM is a recognized element of its National Health Insurance Scheme. However, there is no knowledge about how TCM is accessed by foreign workers from a non-Asian cultural background. The objectives of this study were to investigate the prevalence and patterns of TCM use among non-Asian white-collar workers living in Taiwan, and examine factors likely to influence their use of TCM. Methods This study applied a cross-sectional survey design. A total of 207 white-collar foreign workers of a non-Asian background currently holding National Health Insurance cards who had lived in Taiwan for 4 months or more participated in this study. Results The prevalence of TCM use was 45%. The most frequently used therapies were traditional Chinese herbs/medicine and acupuncture. Factors indicating the likelihood of TCM usage were age 31–40 years, visit to an allopathic medical doctor in the last year, ability to read Chinese, having a friend or family member available to assist in the use of TCM, and access to information about TCM services available in Taiwan. Conclusion Utilization of TCM by people of a non-Asian background living in Taiwan appears to be most influenced by enabling factors including language ability, access to information, and informal reference persons. PMID:19144152
Kendler, K S; Maes, H H; Lönn, S L; Morris, N A; Lichtenstein, P; Sundquist, J; Sundquist, K
2015-08-01
We sought to clarify the etiological contribution of genetic and environmental factors to total criminal behavior (CB) measured as criminal convictions in men and women, and to violent (VCB), white-collar (WCCB) and property criminal behavior (PCB) in men only. In 21 603 twin pairs from the Swedish Twin Registry, we obtained information on all criminal convictions from 1973 to 2011 from the Swedish Crime Register. Twin modeling was performed using the OpenMx package. For all criminal convictions, heritability was estimated at around 45% in both sexes, with the shared environment accounting for 18% of the variance in liability in females and 27% in males. The correlation of these risk factors across sexes was estimated at +0.63. In men, the magnitudes of genetic and environmental influence were similar in the three criminal conviction subtypes. However, for violent and white-collar convictions, nearly half and one-third of the genetic effects were respectively unique to that criminal subtype. About half of the familial environmental effects were unique to property convictions. The familial aggregation of officially recorded CB is substantial and results from both genetic and familial environmental factors. These factors are moderately correlated across the sexes suggesting that some genetic and environmental influences on criminal convictions are unique to men and to women. Violent criminal behavior and property crime are substantially influenced respectively by genetic and shared environmental risk factors unique to that criminal subtype.
Directory of Open Access Journals (Sweden)
Deng Chung-Yeh
2009-01-01
Full Text Available Abstract Background Traditional Chinese medicine (TCM has remained an integral part of Chinese culture and society for thousands of years. In Taiwan TCM is a recognized element of its National Health Insurance Scheme. However, there is no knowledge about how TCM is accessed by foreign workers from a non-Asian cultural background. The objectives of this study were to investigate the prevalence and patterns of TCM use among non-Asian white-collar workers living in Taiwan, and examine factors likely to influence their use of TCM. Methods This study applied a cross-sectional survey design. A total of 207 white-collar foreign workers of a non-Asian background currently holding National Health Insurance cards who had lived in Taiwan for 4 months or more participated in this study. Results The prevalence of TCM use was 45%. The most frequently used therapies were traditional Chinese herbs/medicine and acupuncture. Factors indicating the likelihood of TCM usage were age 31–40 years, visit to an allopathic medical doctor in the last year, ability to read Chinese, having a friend or family member available to assist in the use of TCM, and access to information about TCM services available in Taiwan. Conclusion Utilization of TCM by people of a non-Asian background living in Taiwan appears to be most influenced by enabling factors including language ability, access to information, and informal reference persons.
Directory of Open Access Journals (Sweden)
César Luis Barrio-Amorós
2010-07-01
Full Text Available Three new species of collared frogs of the genus Mannophryne are described from Venezuela. Two are newly discovered taxa from the Venezuelan Andes, whereas the third species, previously confused with M. trinitatis, is from the Caracas area in the Cordillera de la Costa. The call of the three new species and that of Mannophryne collaris are described. Taxonomic, zoogeographic, and conservation issues are discussed.
Metabolic changes after a hypocaloric, low-glycemic-index diet in obese children.
Parillo, M; Licenziati, M R; Vacca, M; De Marco, D; Iannuzzi, A
2012-07-01
A low glycemic index (LGI) diet has been proposed as a treatment for obesity in adults; few studies have evaluated LGI diets in obese children. The purpose of the study was to compare the effects of two diets, with similar energy intakes, but different glycemic indexes in a pediatric outpatient setting. A parallel- group, randomized controlled trial was conducted, and 22 obese outpatient children with a body mass index (BMI) Z-score >2 (11 females and 11 males, BMI 28.9±2.9 kg/m²) were included in the study. Patients were randomly allocated to a hypocaloric LGI (GI:60), or to a hypocaloric high glycemic index (HGI) diet (GI:90). The LGI and HGI diets were almost equivalent for macronutrient composition. Anthropometric and biochemical parameters were measured at baseline and after 6 months. In both groups there were significant decreases in BMI, BMI Z-score, blood pressure, and high-sensitivity C-reactive protein. Only LGI diets produced a significant decrease in waist circumference and homeostasis model assessment. Analysis of variance demonstrated that the BMI Z-score decrease from baseline values was significantly greater after the LGI diet than after the HGI diet [-0.20 (95% confidence interval (CI) -0.29 to -0.10) vs -0.34 (95%CI -0.43 to -0.24)], mean difference between groups -0.14 (95%CI -0.27 to -0.01), pdiet (phypocaloric LGI diet has beneficial metabolic effects in comparison to a hypocaloric HGI diet in obese children.
Fabrication of high gradient insulators by stack compression
Harris, John Richardson; Sanders, Dave; Hawkins, Steven Anthony; Norona, Marcelo
2014-04-29
Individual layers of a high gradient insulator (HGI) are first pre-cut to their final dimensions. The pre-cut layers are then stacked to form an assembly that is subsequently pressed into an HGI unit with the desired dimension. The individual layers are stacked, and alignment is maintained, using a sacrificial alignment tube that is removed after the stack is hot pressed. The HGI's are used as high voltage vacuum insulators in energy storage and transmission structures or devices, e.g. in particle accelerators and pulsed power systems.
Kaur, Bhupinder; Quek Yu Chin, Rina; Camps, Stefan; Henry, Christiani Jeyakumar
2016-06-01
Low glycaemic index (GI) foods are known to minimize large fluctuations in blood glucose levels and have been suggested to increase fat oxidation. The objective of this study was to simultaneously investigate glucose excursion and substrate oxidation in a whole body calorimetre when Chinese male subjects were provided a low or high GI meal. In a randomized, controlled crossover non blind design, 12 healthy Chinese male adults (BMI 21.8 ± 1.3 kgm -2 ) attended two sessions consisting of either four low or high glycaemic meals (LGI vs HGI). Breakfast, lunch and snack were consumed in a whole body calorimetre while dinner was consumed at home. Daily changes in glycaemic response (GR) and postprandial GR responses were measured using a continuous glucose monitoring system. The GR was further calculated to obtain the incremental area under the curve (iAUC) for glucose concentrations. Glycaemic variability was calculated as mean amplitude of glycaemic excursion (MAGE). Substrate oxidation was calculated by measuring respiratory quotient and urine nitrogen excretion. After LGI meals in the whole body calorimetre, iAUC for glucose (P = 0.008) was lower compared to the HGI session. The HGI treatment produced a significantly greater MAGE than the LGI treatment over the 24 hour period (P fat oxidation and lower carbohydrate oxidation were observed following breakfast and lunch when comparing LGI to HGI (P fat oxidation over carbohydrate oxidation when compared to HGI mixed meals. The consumption of low GI meals may be a strategic approach in improving overall glycaemia and increasing fat oxidation in Asians consuming a high carbohydrate diet.
Cattle behaviour classification from collar, halter, and ear tag sensors
Directory of Open Access Journals (Sweden)
A. Rahman
2018-03-01
Full Text Available In this paper, we summarise the outcome of a set of experiments aimed at classifying cattle behaviour based on sensor data. Each animal carried sensors generating time series accelerometer data placed on a collar on the neck at the back of the head, on a halter positioned at the side of the head behind the mouth, or on the ear using a tag. The purpose of the study was to determine how sensor data from different placement can classify a range of typical cattle behaviours. Data were collected and animal behaviours (grazing, standing or ruminating were observed over a common time frame. Statistical features were computed from the sensor data and machine learning algorithms were trained to classify each behaviour. Classification accuracies were computed on separate independent test sets. The analysis based on behaviour classification experiments revealed that different sensor placement can achieve good classification accuracy if the feature space (representing motion patterns between the training and test animal is similar. The paper will discuss these analyses in detail and can act as a guide for future studies.
International Nuclear Information System (INIS)
Oremland, R.S.; Culbertson, C.W.; Winfrey, M.R.
1991-01-01
The biogeochemical cycling of mercury has received considerable attention because of the toxicity of methylmercury, its bioaccumulation in biota, and its biomagnification in aquatic food chains. The formation of methylmercury is mediated primarily by microorganisms. Demethylation of monomethylmercury in freshwater and estuarine sediments and in bacterial cultures was investigated with 14 CH 3 HgI. Under anaerobiosis, results with inhibitors indicated partial involvement of both sulfate reducers and methanogens, the former dominated estuarine sediments, while both were active in freshwaters. Aerobes were the most significant demethylators in estuarine sediments, but were unimportant in freshwater sediments. Products of anaerobic demthylation were mainly 14 CO 2 as well as lesser amounts of 14 CH 4 . Acetogenic activity resulted in fixation of some 14 CO 2 produced from 14 CH 3 HgI into acetate. Aerobic demethylation in estuarine sediments produced only 14 CH 4 , while aerobic demethylation in freshwater sediments produced small amounts of both 14 CH 4 and 14 CO 2 . Two species of Desulfovibrio produced only traces of 14 CH 4 from 14 CH 3 HgI, while a culture of a methylotrophic methanogen formed traces of 14 CO 2 and 14 CH 4 when grown on trimethylamine in the presence of the 14 CH 3 HgI. These results indicate that both aerobes and anaerobes demethylate mercury in sediments, but that either group may dominate in a particular sediment type. Aerobic demethylation in the estuarine sediments appeared to proceed by the previously characterized organomercurial-lyase pathway, because methane was the sole product. This indicates the presence of an oxidative pathway, possibly one in which methylmercury serves as an analog of one-carbon substrates
Odden, Morten; Athreya, Vidya; Rattan, Sandeep; Linnell, John D C
2014-01-01
Understanding the nature of the interactions between humans and wildlife is of vital importance for conflict mitigation. We equipped five leopards with GPS-collars in Maharashtra (4) and Himachal Pradesh (1), India, to study movement patterns in human-dominated landscapes outside protected areas. An adult male and an adult female were both translocated 52 km, and exhibited extensive, and directional, post release movements (straight line movements: male = 89 km in 37 days, female = 45 km in 5 months), until they settled in home ranges of 42 km2 (male) and 65 km2 (female). The three other leopards, two adult females and a young male were released close to their capture sites and used small home ranges of 8 km2 (male), 11 km2 and 15 km2 (females). Movement patterns were markedly nocturnal, with hourly step lengths averaging 339±9.5 m (SE) during night and 60±4.1 m during day, and night locations were significantly closer to human settlements than day locations. However, more nocturnal movements were observed among those three living in the areas with high human population densities. These visited houses regularly at nighttime (20% of locations human settlements both day and night. The small home ranges of the leopards indicate that anthropogenic food resources may be plentiful although wild prey is absent. The study provides clear insights into the ability of leopards to live and move in landscapes that are extremely modified by human activity.
Directory of Open Access Journals (Sweden)
Jacob RUB
2017-01-01
Full Text Available The purpose of the present article is to elaborate a valid method of forecasting of the potential offender during the hiring process by means of pre-employment tests as an integral part of the process of prevention and counteracting of the phenomenon of white-collar criminality in the realm of Penal Politics of the Republic of Moldova and the State of Israel. Namely, the „personality coefficient” of the potential offender, which, in the author’s opinion, will define better the likelihood of success in perpetrating a white-collar crime. As a result, a new methodology and tactics for the earlier reducing of white-collar criminality at workplace a new and original scale of pre-employment test valid for hiring process which will be justifiable not only from economical and sociological standpoint, but also from criminological point of view in the process of white-collar criminality reducing.Prognozarea şi reducerea criminalităţii gulerelor albe prin metoda testărilor pre-angajatoare în politica penală a statului: rezultatele empirice pentru Moldova şi IsraelScopul propus în acest articol constă în elaborarea unei metode valide pentru identificarea criminalilor potenţiali în procesul de angajare prin teste de pre-selecţie privite ca parte integrantă a procesului de prevenire şi combatere a fenomenului criminalităţii gulerelor albe în cadrul politicii penale a Republicii Moldova şi a Statului Israel. În special, este propus spre utilizare „coeficientul personalităţii” potenţialului infractor care, în opinia autorului, va defini mai precis probabilitatea săvârşirii crimei gulerelor albe. Prin urmare, este propusă şi argumentată o nouă metodologie şi tactică de reducere a criminalităţii gulerelor albe la locul de muncă, precum şi un model original de testare pre-angajare oportun din perspectivă economică, sociologică şi criminologică.
Nakata, Akinori; Irie, Masahiro; Takahashi, Masaya
2013-01-01
Although a single-item job satisfaction measure has been shown to be reliable and inclusive as multiple-item scales in relation to health, studies including immunological data are few. The purpose of this study was to evaluate the validity of single-item job and family life satisfaction based on its association with immune indices. A total of 189 white-collar employees (70% men) underwent a blood draw for the measurement of natural killer (NK), total T, and B cell counts as well as plasma immunoglobulin (Ig) G concentrations and completed single-item job and family life satisfaction measures, respectively. The response options for satisfaction measures were 'dissatisfied' (coded 1) to 'satisfied' (coded 4). Spearman's partial correlations controlling for cofactors revealed that increased job satisfaction was positively associated with NK cells (rsp=0.201, p=0.007) and IgG (rsp=0.178, p=0.018), while family life satisfaction was unrelated to immune indices. Those who reported a combination of low job/low family life satisfaction had significantly lower NK and higher B cell counts than those with a high job/high family life satisfaction. Our study suggests that the single-item summary measure of job satisfaction, but not family life satisfaction, may be a valid tool to evaluate immune status in healthy white-collar employees.
Soundarya Chowdary, Mandava; Sudhir, Kudlur Maheswarappa; Reddy, Vuyurru Chandrasekhara; Krishna Kumar, Rachakorda Veera Venkata Sathya Sai; Srinivasulu, Gomasani
2016-01-01
Oral diseases not only cause pain, but severely impair large number of individuals and can affect various aspects of life, including oral functions, appearance and interpersonal relationships. The aim of the study was to assess the interrelationship between oral impact on daily performance (OIDP) scores, socio-demographic characteristics, dental caries experience and periodontal status. A cross-sectional descriptive epidemiological study was conducted on a sample of 250 white-collar port workers who were willing to participate. OIDP was assessed using pre-validated questionnaire. Oral health status was assessed using modified World Health Organisation (1997) Proforma. Test of association was conducted between the OIDP score, socio-demographic variables, and periodontal status; loss of attachment was determined by using chi-square statistics and Mann-Whitney test. Logistic regression was performed to identify significant predictors of OIDP scores by inputting clinical oral examination variables into the equation, stepwise. A total of 250 white-collar workers in the port participated in the study with mean age of 34.67 ± 6.36. Among them, 219 were males and 31 were females. The OIDP items most commonly affected by oral health status were eating and enjoying food (48.4%), cleaning teeth (48%), sleeping and relaxing (44.4%).There was statistically significant relationship between missing teeth in the decayed missing filled teeth component and OIDP score (p workers in the port. Physical functions of teeth like eating and cleaning of teeth, sleeping and relaxing were more affected.
1999-01-01
This document concerns the award of a contract for the supply of 410 mm-wide austenitic steel strips for the collars of the LHC superconducting dipole magnets. Following a market survey carried out among 39 firms in twelve Member States and two firms in Japan, a call for tenders (IT-2618/LHC/LHC) was sent on 3 June 1999 to five firms in four Member States and two firms in Japan. The Council agreed to the Management?s proposal to invite Japanese industry to participate, where appropriate, in calls for tenders for supplies for the LHC Project (CERN/CC/2110). By the closing date, CERN had received six tenders. The Finance Committee is invited to approve the negotiation of a contract with the firm NIPPON STEEL CORPORATION (JP) for the supply of 11 000 tonnes of 410 mm-wide austenitic steel strips for the collars of the LHC superconducting dipole magnets for a total amount of 4 298 943 000 Japanese yen, subject to revision for contractual deliveries after 31 December 2000, with an option for the supply of up to 10...
Mechanical design and analysis of the 2D cross-section of the SSC collider dipole magnet
International Nuclear Information System (INIS)
Strait, J.; Kerby, J.; Bossert, R.; Carson, J.; Spigo, G.; Turner, J.R.
1991-05-01
The 50 mm aperture collider dipole magnet uses stainless steel collars to position the conductors at the locations specified by the magnetic design and to prestress the coil to prevent conductor motion under excitation. The collars are supported by the vertically-split yoke and cold mass skin to reduce their deflection under excitation. The collar interior is designed to give the coil its required shape at the operating temperature taking into account all deflections that occur from assembly and cooldown. 13 refs., 2 figs., 1 tab
Improved yield of high resolution mercuric iodide gamma-ray spectrometers
International Nuclear Information System (INIS)
Gerrish, V.; van den Berg, L.
1990-01-01
Mercuric iodide (HgI 2 ) exhibits properties which make it attractive for use as a solid state nuclear radiation detector. The wide bandgap (E g = 2.1 eV) and low dark current allow room temperature operation, while the high atomic number provides a large gamma-ray cross section. However, poor hole transport has been a major limitation in the routine fabrication of high-resolution spectrometers using this material. This paper presents the results of gamma-ray response and charge transport parameter measurements conducted during the past year at EG ampersand G/EM on 96 HgI 2 spectrometers. The gamma-ray response measurements reveal that detector quality is correlated with the starting material used in the crystal growth. In particular, an increased yield of high-resolution spectrometers was obtained from HgI 2 which was synthesized by precipitation from an aqueous solution, as opposed to using material from commercial vendors. Data are also presented which suggest that better spectrometer performance is tied to improved hole transport. Finally, some initial results on a study of detector uniformity reveal spatial variations which may explain why the correlation between hole transport parameters and spectrometer performance is sometimes violated. 6 refs., 3 figs
Kaviani, M; Chilibeck, P D; Yee, P; Zello, G A
2016-01-01
Background/Objectives: Exercise performed shortly before (that is, within half a day of) a high-fat meal is beneficial for stimulating fat oxidation after the meal and reducing postprandial triglycerides (TG). This benefit of exercise is unfortunately negated if the after-exercise food choice to replace the calories expended during exercise is one containing high-glycemic index (HGI) carbohydrates. We determined the effect of consuming low-glycemic index (LGI) carbohydrates after an exercise session on fat oxidation and TG after a subsequent high-fat meal. Subjects/Methods: Using a randomized, counterbalanced crossover design, 23 overweight or obese individuals (body mass index ⩾25 kg m−2) performed: walking exercise (90 min) at 1800 h followed by no meal (EX); exercise followed by a meal with LGI carbohydrates (that is, lentils, EX-LGI); exercise followed by a meal with HGI carbohydrates (that is, instant potatoes, white bread, EX-HGI); and a control condition with no exercise or meal. After a 10-h overnight fast, participants were given a standardized high-fat meal. Fat oxidation was estimated before and for 6 h after this meal from respiratory gas measures and TG determined from blood samples. Results: Fat oxidation (mean±s.d.) was higher with EX (6.9±1.7 g h−1) than EX-HGI (6.3±1.6 g h−1; P=0.007) and Control (5.9±1.7 g h−1; P=0.00002), and EX-LGI (6.6±1.7 g h−1) was higher than Control (P=0.002). TG total area under the curve was 18–32% lower with EX and EX-LGI compared with control (P=0.0005 and P=0.0001, respectively) and EX-HGI (P=0.05 and P=0.021, respectively). Conclusions: A meal containing HGI carbohydrates consumed after an evening exercise session cancels the beneficial effect of exercise for stimulating fat oxidation and lowering TG after a subsequent high-fat meal, whereas consuming a post-exercise meal with LGI carbohydrates retains the positive effect of exercise. PMID:27376698
Directory of Open Access Journals (Sweden)
Katarzyna Kulma
Full Text Available Life-history theory predicts that the trade-off between parasite defense and other costly traits such as reproduction may be most evident when resources are scarce. The strength of selection that parasites inflict on their host may therefore vary across environmental conditions. Collared flycatchers (Ficedula albicollis breeding on the Swedish island Öland experience a seasonal decline in their preferred food resource, which opens the possibility to test the strength of life-history trade-offs across environmental conditions. We used nested-PCR and quantitative-PCR protocols to investigate the association of Haemosporidia infection with reproductive performance of collared flycatcher females in relation to a seasonal change in the external environment. We show that despite no difference in mean onset of breeding, infected females produced relatively more of their fledglings late in the season. This pattern was also upheld when considering only the most common malaria lineage (hPHSIB1, however there was no apparent link between the reproductive output and the intensity of infection. Infected females produced heavier-than-average fledglings with higher-than-expected recruitment success late in the season. This reversal of the typical seasonal trend in reproductive output compensated them for lower fledging and recruitment rates compared to uninfected birds earlier in the season. Thus, despite different seasonal patterns of reproductive performance the overall number of recruits was the same for infected versus uninfected birds. A possible explanation for our results is that infected females breed in a different microhabitat where food availability is higher late in the season but also is the risk of infection. Thus, our results suggest that another trade-off than the one we aimed to test is more important for explaining variation in reproductive performance in this natural population: female flycatchers appear to face a trade-off between the risk
Gamma-ray detectors for intelligent, hand-held radiation monitors
International Nuclear Information System (INIS)
Fehlau, P.E.
1983-01-01
Small radiation detectors based on HgI 2 , bismuth germanate (BGO), plastic, or NaI(Tl) detector materials were evaluated for use in small, lighweight radiation monitors. The two denser materials, HgI 2 and BGO, had poor resolution at low-energy and thus performed less well than NaI(Tl) in detecting low-energy gamma rays from bare, enriched uranium. The plastic scintillator, a Compton recoil detector, also performed less well at low gamma-ray energy. Two small NaI(Tl) detectors were suitable for detecting bare uranium and sheilded plutonium. One became part of a new lightweight hand-held monitor and the other found uses as a pole-mounted detector for monitoring hard-to-reach locations
Health beliefs of blue collar workers. Increasing self efficacy and removing barriers.
Wilson, S; Sisk, R J; Baldwin, K A
1997-05-01
The study compared the health beliefs of participants and non-participants in a blood pressure and cholesterol screening held at the worksite. A cross sectional, ex-post facto design was used. Questionnaires measuring health beliefs related to cardiac screening and prevention of cardiac problems were distributed to a convenience sample of 200 blue-collar workers in a large manufacturing plant in the Midwest. One hundred fifty-one (75.5%) completed questionnaires were returned, of which 45 had participated in cardiac worksite screening in the past month. A multivariate analysis of variance was used to analyze data. Participants perceived significantly fewer barriers to cardiac screening and scored significantly higher on self efficacy than non-participants. These findings concur with other studies identifying barriers and self efficacy as important predictors of health behavior. Occupational health nurses' efforts are warranted to reduce barriers and improve self efficacy by advertising screenings, scheduling them at convenient times and locations, assuring privacy, and keeping time inconvenience to a minimum.
Compressive Strength Prediction of Square Concrete Columns Retrofitted with External Steel Collars
Directory of Open Access Journals (Sweden)
Pudjisuryadi, P.
2013-01-01
Full Text Available Transverse confining stress in concrete members, commonly provided by transverse reinforcement, has been recognized to enhance strength and ductility. Nowadays, the confining method has been further developed to external confinement approach. This type of confinement can be used for retrofitting existing concrete columns. Many external confining techniques have been proven to be successful in retrofitting circular columns. However, for square or rectangular columns, providing effective confining stress by external retrofitting method is not a simple task due to high stress concentration at column’s corners. This paper proposes an analytical model to predict the peak strength of square concrete columns confined by external steel collars. Comparison with the experimental results showed that the model can predict the peak strength reasonably well. However, it should be noted that relatively larger amount of steel is needed to achieve comparable column strength enhancement when it is compared with those of conve tional internally-confined columns.
Directory of Open Access Journals (Sweden)
K M Hassan
2012-01-01
Full Text Available Background: Hirayama disease (HD is benign focal amyotrophy of the distal upper limbs, often misdiagnosed as motor neuron disease. Routine magnetic resonance imaging (MRI is often reported normal. Objective: To study the clinicoradiological profile of hand wasting in young males. Materials and Methods: Patients presenting with insidious-onset hand wasting from March 2008 to May 2011 were evaluated electrophysiologically. Cervical MRI in neutral position was done in 11 patients and flexion contrast imaging was done in 10 patients. Results: All patients were males less than 25 years of age, with median age 23 years, except one patient who was 50 years old. Duration of illness was 3 months to 3 years. All (100% had oblique amyotrophy, four (36% cold paresis, 10 (91% minipolymyoclonus and three (27% had fasciculations. Regional reflexes were variably absent. Two patients (18% had brisk reflexes of lower limbs with flexor plantars. Electromyography (EMG showed chronic denervation in the C7-T1 myotomes. Neutral position MRI showed loss of cervical lordosis in 10/11 (91%, localized lower cervical cord atrophy in 9/11 (82%, asymmetric cord flattening in 11/11 (100% and intramedullary hyperintensity in 2/11 (18%; flexion study showed loss of dural attachment, anterior displacement of dorsal dura, epidural flow voids in 9/10 (90% and enhancing epidural crescent in 10/10 (100%. Clinical profile, imaging and electrophysiological findings of the patient aged 50 years will be described in detail as presentation at this age is exceptional. Collar therapy slowed progression in most cases. Conclusion: Clinical features of HD corroborated well with electrophysiological diagnosis of anterior horn cell disease of lower cervical cord. While dynamic contrast MRI is characteristic, routine studies have a high predictive value for diagnosis. Prompt diagnosis is important to institute early collar therapy.
Directory of Open Access Journals (Sweden)
Stanneck Dorothee
2012-03-01
Full Text Available Abstract Background The objective of these two GCP multicentre European clinical field studies was to evaluate the long-term efficacy and safety of a new imidacloprid/flumethrin collar (Seresto®, Bayer AnimalHealth, Investigational Veterinary Product(IVP in dogs and cats naturally infested with fleas and/or ticks in comparison to a dimpylat collar ("Ungezieferband fuer Hunde/fuer Katzen", Beaphar, Control Product (CP. Methods 232 (IVP and 81 (CP cats and 271(IVP and 129 (CP dogs were treated with either product according to label claims and formed the safety population. Flea and tick counts were conducted in monthly intervals for up to 8 months in the efficacy subpopulation consisting of 118 (IVP + 47 (CP cats and 197 (IVP + 94 (CP dogs. Efficacy was calculated as reduction of infestation rate within the same treatment group and statistically compared between the two treatment groups. Results Preventive efficacy against fleas in cats/dogs varied in the IVP group between 97.4%/94.1% and 100%/100% (overall mean: 98.3%/96.7% throughout the 8 month period and in the CP group between 57.1%/28.2% and 96.1%/67.8% (overall mean: 79.3%/57.9%. Preventive efficacy against ticks in cats/dogs varied in the IVP group between 94.0%/91.2% and 100%/100% (overall mean: 98.4%/94.7% throughout the 8 month period and in the CP group between 90.7%/79.9% and 100%/88.0% (overall mean: 96.9%/85.6%. The IVP group was statistically non-inferior to the CP group, and on various assessment days, statistical superiority was proven for flea and tick count reduction in dogs and cats. Both treatments proved to be safe in dogs and cats with mainly minor local observations at the application site. There was moreover, no incidence of any mechanical problem with the collar in dogs and cats during the entire study period. Conclusions The imidacloprid/flumethrin collar proved to reduce tick counts by at least 90% and flea counts by at least 95% for a period of at least 7-8 months in
2012-01-01
Background The objective of these two GCP multicentre European clinical field studies was to evaluate the long-term efficacy and safety of a new imidacloprid/flumethrin collar (Seresto®, Bayer AnimalHealth, Investigational Veterinary Product(IVP)) in dogs and cats naturally infested with fleas and/or ticks in comparison to a dimpylat collar ("Ungezieferband fuer Hunde/fuer Katzen", Beaphar, Control Product (CP)). Methods 232 (IVP) and 81 (CP) cats and 271(IVP) and 129 (CP) dogs were treated with either product according to label claims and formed the safety population. Flea and tick counts were conducted in monthly intervals for up to 8 months in the efficacy subpopulation consisting of 118 (IVP) + 47 (CP) cats and 197 (IVP) + 94 (CP) dogs. Efficacy was calculated as reduction of infestation rate within the same treatment group and statistically compared between the two treatment groups. Results Preventive efficacy against fleas in cats/dogs varied in the IVP group between 97.4%/94.1% and 100%/100% (overall mean: 98.3%/96.7%) throughout the 8 month period and in the CP group between 57.1%/28.2% and 96.1%/67.8% (overall mean: 79.3%/57.9%). Preventive efficacy against ticks in cats/dogs varied in the IVP group between 94.0%/91.2% and 100%/100% (overall mean: 98.4%/94.7%) throughout the 8 month period and in the CP group between 90.7%/79.9% and 100%/88.0% (overall mean: 96.9%/85.6%). The IVP group was statistically non-inferior to the CP group, and on various assessment days, statistical superiority was proven for flea and tick count reduction in dogs and cats. Both treatments proved to be safe in dogs and cats with mainly minor local observations at the application site. There was moreover, no incidence of any mechanical problem with the collar in dogs and cats during the entire study period. Conclusions The imidacloprid/flumethrin collar proved to reduce tick counts by at least 90% and flea counts by at least 95% for a period of at least 7-8 months in cats and dogs
Uchida, Mitsuo; Kaneko, Minoru; Kawa, Shigeyuki
2014-03-27
As detailed associations between personality and long work hours are unclear, we assessed associations between personality dimensions and overtime work among Japanese white-collar workers. From records of hours worked over 12 months by 267 office workers in an organization within the service industry, average overtime work hours per month and occurrence of excessive overtime was determined for each worker. Excessive overtime was defined as > 45 overtime work hours per month for at least one month. Responses to a questionnaire assessing socio-demographic and workplace-related factors and the Big Five personality test were analyzed. Associations between personality factors and overtime work were assessed by multivariate logistic regression analysis. Low Extraversion was associated with excessive overtime work (OR 2.02, 95%CI 1.02 - 4.02, P = 0.04). It is suggested that workers with low Extraversion can't share work when busy to avoid excessive overtime. Personality factors should be considered in studies evaluating work time. Moreover, strengthening communication among workers with low Extraversion may reduce excessive overtime work and associated health problems.
Hiby, Elly; Tasker, Lou
2018-02-06
Dog-mediated human rabies can be eliminated through mass dog vaccination. Despite leading authorities in human and animal health uniting to advance effective and humane rabies control, some governments resort to lethal methods, which are unethical, often inhumane and ineffective. To end the inhumane culling of dogs in response to rabies, World Animal Protection launched 'Red Collar'; a five-year campaign (2011-2016) that worked with governments to promote the implementation of mass dog vaccination for rabies control. We present the findings from a qualitative evaluation of 'Red Collar', conducted both regionally and with national focus on Bangladesh, China, Indonesia, the Philippines and Zanzibar, Tanzania. Through semi-structured interviews and written contributions from stakeholders ( n = 54), we compared perceptions of changes with stated campaign goals to capture recommendations for future work. The campaign successfully generated momentum for implementation of mass dog vaccination by targeted governments. Lessons learned were established: Value of a consistent animal welfare 'voice'; the need to explore the motivations behind culling; the need to capacity build; time required for the 'ripple effect' to inspire humane control in other countries; importance of monitoring and evaluation of indicators; time and effort required for exit strategies and prior preparation for a robust response to culling.
Mechanical design and analysis of the 2D cross-section of the SSC collider dipole magnet
International Nuclear Information System (INIS)
Strait, J.; Kerby, J.; Bossert, R.; Carson, J.
1991-05-01
This paper describes the mechanical design of the two dimensional cross-section of the base-line collider dipole magnet for the Superconducting Super Collider. The components described here are the collar laminations, the tapered keys that lock the upper and lower collars, the yoke laminations, the cold mass shell. We describe in detail the shape of the outer surface of the collars which defines the yoke-collar interface, and the shape of the collar interior, which defines the conductor placement. Other features of the collar and yoke will be described in somewhat less detail. 20 refs., 12 figs. , 6 tabs
An assessment of chemical properties and hardgrove grindability index of punjab coal
International Nuclear Information System (INIS)
Shahzad, M.; Iqbal, M.M.; Hassan, S.A.
2014-01-01
This paper deals with the delamination of chemical properties and hardgrove grindability index (HGI) of coal samples collected from three different coal fields of Punjab; Eastern Salt Range, Central Salt Range and Makerwal coal fields. The chemical properties of Punjab coal reveal that most of the Punjab coal belongs to sub-bituminous category except coal of Tunnel C section of Makerwal Collieries and Iqbal Mineral coal mine of Dalwal, which are high volatile bituminous and lignite, respectively. The results of the research show that the HGI values of Punjab coal vary from 57 to 92. The eastern salt range coals are found to be the softest coals among that of three coal fields. It was further observed that the HGI values of the Punjab coal decrease with increasing moisture content, fixed carbon and sulphur contents, while it has a positive relation with volatile matter, ash content and gross calorific value. It was concluded that moisture content at its lower range has negligible effect on HGI of the Punjab coal. (author)
Villumsen, Morten; Holtermann, Andreas; Samani, Afshin; Madeleine, Pascal; Jørgensen, Marie Birk
2016-03-01
This study aimed to investigate the association between forward bending of the trunk and low-back pain intensity (LBPi) among blue-collar workers in Denmark as well as whether the level of social support modifies the association. In total, 457 workers were included in the study. The forward bending of ≥ 30° was computed from accelerometer recordings for several consecutive days during work, categorized into long (highest tertile) and short-moderate (remaining tertiles) duration. LBPi was measured on a 0-10 scale and categorized into low (≤ 5) and high (>5) pain. Self-reported social support was categorized into low, moderate, and high levels. Multi-adjusted logistic regressions estimated the association between forward bending and LBPi and the effect modification by social support. Forward bending and LBPi were not significantly associated but modified by social support. Workers with low social support and long duration of forward bending had higher likelihood of high LBPi [odds ratio (OR) 2.97, 95% confidence interval (95% CI) 1.11-7.95] compared to workers with high social support and long duration of forward bending. Among workers with low social support, workers with long duration of forward bending had higher likelihood of high LBPi (OR 3.28, 95% CI 0.99-10.90) compared to workers with short-moderate duration of forward bending. Among workers with high social support, workers with long duration of forward bending had reduced likelihood of high LBPi (OR 0.39, 95% CI 0.16-0.95) compared to workers with short-moderate duration of forward bending. Social support modifies the association between objectively measured forward bending and LBPi among blue-collar workers.
Patel, Mayur B; Humble, Stephen S; Cullinane, Daniel C; Day, Matthew A; Jawa, Randeep S; Devin, Clinton J; Delozier, Margaret S; Smith, Lou M; Smith, Miya A; Capella, Jeannette M; Long, Andrea M; Cheng, Joseph S; Leath, Taylor C; Falck-Ytter, Yngve; Haut, Elliott R; Como, John J
2015-02-01
With the use of the framework advocated by the Grading of Recommendations Assessment, Development and Evaluation (GRADE) Working Group, our aims were to perform a systematic review and to develop evidence-based recommendations that may be used to answer the following PICO [Population, Intervention, Comparator, Outcomes] question:In the obtunded adult blunt trauma patient, should cervical collar removal be performed after a negative high-quality cervical spine (C-spine) computed tomography (CT) result alone or after a negative high-quality C-spine CT result combined with adjunct imaging, to reduce peri-clearance events, such as new neurologic change, unstable C-spine injury, stable C-spine injury, need for post-clearance imaging, false-negative CT imaging result on re-review, pressure ulcers, and time to cervical collar clearance? Our protocol was registered with the PROSPERO international prospective register of systematic reviews on August 23, 2013 (REGISTRATION NUMBER: CRD42013005461). Eligibility criteria consisted of adult blunt trauma patients 16 years or older, who underwent C-spine CT with axial thickness of less than 3 mm and who were obtunded using any definition.Quantitative synthesis via meta-analysis was not possible because of pre-post, partial-cohort, quasi-experimental study design limitations and the consequential incomplete diagnostic accuracy data. Of five articles with a total follow-up of 1,017 included subjects, none reported new neurologic changes (paraplegia or quadriplegia) after cervical collar removal. There is a worst-case 9% (161 of 1,718 subjects in 11 studies) cumulative literature incidence of stable injuries and a 91% negative predictive value of no injury, after coupling a negative high-quality C-spine CT result with 1.5-T magnetic resonance imaging, upright x-rays, flexion-extension CT, and/or clinical follow-up. Similarly, there is a best-case 0% (0 of 1,718 subjects in 11 studies) cumulative literature incidence of unstable
Donati, Giuseppe; Kesch, Kristina; Ndremifidy, Kelard; Schmidt, Stacey L.; Ramanamanjato, Jean-Baptiste; Borgognini-Tarli, Silvana M.; Ganzhorn, Joerg U.
2011-01-01
Background Frugivorous primates are known to encounter many problems to cope with habitat degradation, due to the fluctuating spatial and temporal distribution of their food resources. Since lemur communities evolved strategies to deal with periods of food scarcity, these primates are expected to be naturally adapted to fluctuating ecological conditions and to tolerate a certain degree of habitat changes. However, behavioral and ecological strategies adopted by frugivorous lemurs to survive in secondary habitats have been little investigated. Here, we compared the behavioral ecology of collared lemurs (Eulemur collaris) in a degraded fragment of littoral forest of south-east Madagascar, Mandena, with that of their conspecifics in a more intact habitat, Sainte Luce. Methodology/Principal Findings Lemur groups in Mandena and in Sainte Luce were censused in 2004/2007 and in 2000, respectively. Data were collected via instantaneous sampling on five lemur groups totaling 1,698 observation hours. The Shannon index was used to determine dietary diversity and nutritional analyses were conducted to assess food quality. All feeding trees were identified and measured, and ranging areas determined via the minimum convex polygon. In the degraded area lemurs were able to modify several aspects of their feeding strategies by decreasing group size and by increasing feeding time, ranging areas, and number of feeding trees. The above strategies were apparently able to counteract a clear reduction in both food quality and size of feeding trees. Conclusions/Significance Our findings indicate that collared lemurs in littoral forest fragments modified their behavior to cope with the pressures of fluctuating resource availability. The observed flexibility is likely to be an adaptation to Malagasy rainforests, which are known to undergo periods of fruit scarcity and low productivity. These results should be carefully considered when relocating lemurs or when selecting suitable areas for
GAPR2: A DTN Routing Protocol for Communications in Challenged, Degraded, and Denied Environments
2015-09-01
Centre in Central Kenya . Collars that were capable of recording GPS locations and detailed activity logs were attached to 30 zebras. The collars...the same links [32]. 2.2.4 Future Applications of the Technology Internet retailers envision using tens of thousands of drones to deliver packages to...Marines 4 - 10 100m / 125kBps One grp per area 1 / 20 Humvee 50 – 80 3 km / 250kBps Transits between platoons 1 / 2 Drone 40 - 70 4 km / 125kBps Drone
International Nuclear Information System (INIS)
Devred, A.
1999-02-01
In 1991, the Laboratoire Europeen pour la Physique des Particules (CERN) has launched the fabrication in industry of seven 10 m long, 50 mm twin aperture dipole magnet prototypes for the Large Hadron Collider (LHC). The design and specific features of these magnets have been described elsewhere. In this paper, we review some of the coil and collared-coil assembly data and we analyze the influence of tooling imperfections on magnet assembly. (author)
Kabir-Mokamelkhah, Elaheh; Bahrami-Ahmadi, Amir; Aghili, Negar
2016-01-01
Background: Impairment in quality of life and mental health had been reported in the previous studies as the results of musculoskeletal disorders among workers. Mental health has a wide concept and contains different disorders including anxiety, depression or even decreased quality of life, all of which having challengeable impacts on work- related characters such as work productivity and absensism. The present study aimed at evaluating work- related stress and quality of life among Iranian blue-collar workers of Fars ABFA Company with selfreported low back pain. Methods: In the present study, we focused on the low back pain among 451 blue-collar workers and assessed their work- related stress and quality of life status using DASS-21 and short form questionnaire (SF-36), respectively. Independent sample t-test was used to compare the qualitative variables, and chi-square test was utilized for statistical analysis of the qualitative variables. Results: Mean of the total score of quality of life among workers with low back pain was significantly lower than in those workers without low back pain. The mean of work- related stress score was significantly higher in workers with low back pain than in workers without low back pain. The mean quality of life subdomains in patients with low back pain was significantly lower than in workers without low back pain. Conclusion: Findings of the present study revealed that workers with low back pain had lower quality of life score and higher work- related stress score. These findings should be considered in designing preventive programs rather than controlling the pain.
Changing Workplaces to Reduce Work-Family Conflict: Schedule Control in a White-Collar Organization.
Kelly, Erin L; Moen, Phyllis; Tranby, Eric
2011-04-01
Work-family conflicts are common and consequential for employees, their families, and work organizations. Can workplaces be changed to reduce work-family conflict? Previous research has not been able to assess whether workplace policies or initiatives succeed in reducing work-family conflict or increasing work-family fit. Using longitudinal data collected from 608 employees of a white-collar organization before and after a workplace initiative was implemented, we investigate whether the initiative affects work-family conflict and fit, whether schedule control mediates these effects, and whether work demands, including long hours, moderate the initiative's effects on work-family outcomes. Analyses clearly demonstrate that the workplace initiative positively affects the work-family interface, primarily by increasing employees' schedule control. This study points to the importance of schedule control for our understanding of job quality and for management policies and practices.
Determination of U-235 quantity in fresh fuel elements by neutron coincidence collar technique
International Nuclear Information System (INIS)
Almeida, M.C.M. de; Almeida, S.G. de; Marzo, M.A.S.; Moita, L.P.M.
1990-01-01
The U-235 quantity per lenght of fresh fuel assemblies of the Angra-I first recharge was determined by Neutron Coincidence Collar technique (N.C.C.). This technique is well-founded in fresh fuel assemblies activation by thermal neutrons from AmLi source to generate U-235 fission neutrons. These neutrons are detected by coincidence method in polyethylene structure where 18 He-3 detectors were placed. The coincidence counting results, in active mode (AmLi), showed 0,7% to standard deviation and equal to 1,49% to mass in 1000s of counting. The accuracies of different calibration methods were evaluated and compared. The results showed that the operator declared values are consistent. This evaluation was part of technical-exchange program between Safeguards Laboratory from C.N.E.N. and Los Alamos National Lab., United States. (author)
Electrical and photomechanical effects of plastic deformation of mercuric iodide
International Nuclear Information System (INIS)
Marschall, J.; Milstein, F.; Gerrish, V.
1991-01-01
The effects of bulk plastic deformation of mercuric iodide (HgI 2 ), upon some of the electronic properties relevant to the performance of HgI 2 as a radiation detector were examined experimentally. Hole lifetimes, as well as hole and electron mobilities, were measured at various stages of sample deformation. Hole lifetimes were found to decrease by a factor of 2 under strains of several percent; carrier mobilities varied within experimental error, except during creep loading where electron and hole mobilities decreased by about 65 % and 25 %, respectively. Additionally, dark current measurements were made on specimens with varying degrees of accumulated plastic damage caused by c plane shear. Dark current values did not strongly reflect the extent of bulk plastic damage in deformed specimens. 16 refs., 4 figs., 1 tab
Genetic restoration in the eastern collared lizard under prescribed woodland burning.
Neuwald, Jennifer L; Templeton, Alan R
2013-07-01
Eastern collared lizards of the Ozarks live in glades--open, rocky habitats embedded in a woodland matrix. Past fire suppression had made the woodlands a barrier to dispersal, leading to habitat destruction, fragmentation and local extinction. Reintroduced populations of lizards were subjected to 10 years of habitat fragmentation under continued fire suppression followed by twelve years of landscape restoration with prescribed burns. Prior to prescribed burning, genetic diversity decreased within glades and differentiation increased among glades. With woodland burning, genetic diversity within glades first decreased during an expanding colonization phase, but then increased as a dynamically stable metapopulation was established. Population differentiation among glades also stabilized in the metapopulation under weak isolation-by-distance. This study is one of the first to examine the genetic changes in a species of conservation concern throughout all the stages of decline and recovery and shows the importance of landscape-level restoration for maintaining the genetic integrity of populations. This study also demonstrates how mark-recapture and genetic data together can yield detailed insight into metapopulation dynamics that would be impossible from just one type of data alone. © 2013 John Wiley & Sons Ltd.
Fine structure and development of the collar enamel in gars, Lepisosteus oculatus, Actinopterygii
Sasagawa, Ichiro; Ishiyama, Mikio; Yokosuka, Hiroyuki; Mikami, Masato
2008-06-01
The fine structure of collar enamel and the cells constituting the enamel organ during amelogenesis in Lepisosteus oculatus was observed by light, scanning electron and transmission electron microscopy. In the enamel, slender crystals were arranged perpendicular to the surface and the stripes that were parallel to the surface were observed, suggesting that the enamel in Lepisosteus shares common morphological features with that in sarcopterygian fish and amphibians. Ameloblasts containing developed Golgi apparatus, rough endoplasmic reticulum (rER) and secretory granules were found in the secretory stage. In the maturation stage, a ruffled border was not seen at the distal end of the ameloblasts, while many mitochondria and lysosome-like granules were obvious in the distal cytoplasm. The enamel organ consisted of the outer dental epithelial cells, stratum reticulum cells and ameloblasts, but there was no stratum intermedium. It is likely that the ameloblasts have less absorptive function in comparison with the inner dental epithelial cells facing cap enameloid.
Directory of Open Access Journals (Sweden)
Thaís C. Sanches
2013-04-01
Full Text Available Hematological results are reported for 13 giant anteaters (Myrmecophaga tridactyla and 13 collared anteaters (Tamandua tetradactyla. Animals were captive-reared adults held at the Fundação Parque Zoológico de São Paulo (São Paulo, SP, Brazil and Parque Zoológico Municipal Quinzinho de Barros (Sorocaba, SP, Brazil, and were considered healthy on physical examination. Examined parameters included red blood cell count, white blood cell count, hematocrit, hemoglobin concentration, mean corpuscular volume, mean corpuscular hemoglobin, mean corpuscular hemoglobin concentration, total plasmatic protein and differential leukocyte counts. Also, a survey for hemoparasites was done and none was observed in thin blood smears. The results were generally similar to those previously reported in the exiguous literature for these species, providing further reference data for the interpretation of laboratory results besides health monitoring, assisting early disease diagnosis and providing relevant information for conservation programs for these species.
Muhammad Faisol Chowdhury
2016-01-01
This paper investigates the managerial interpretation of the terms “error of judgement” and “white-collar crime” in relation to the evasion or negligence observed in administering occupational health and safety (OHS) provisions in the apparel manufacturing sector of Bangladesh. The research is qualitative in nature and follows an interpretivist paradigm. The questionnaire responses were collected from 20 mid- and top-level managers from 10 large apparel manufacturing factories located on the ...
Use of thick HgI2 detectors as intelligent spectrometers
International Nuclear Information System (INIS)
Olmos, P.; Garcia-Belmonte, G.; Perez, J.M.; Diaz, J.C.
1990-01-01
Mercuric iodide is a very attractive material to detect ionizing radiation due to its high stopping power and wide energy gap, which allows the use of a small and compact detector at room temperature. However, the spectroscopic performances of these detectors are poor in comparisons with other more popular semiconductors with better transport characteristics. This effect becomes dramatic when thick crystals are used. The partial charge-collection method is reported to be the most suitable one for enhancing the energy resolution achieved with thick detectors. A Monte Carlo simulation of the behavior of the model and its dependence with crystals and electronic parameters is presented, giving operating rules that optimize the system performance in each situation. Specially designed hardware has been developed to extract the maximum information of the charge pulse produced by photon-detector interaction, according with the results of the simulation. As a final step, an automatic isotope-identification process, based on the use of neutral networks, is performed, the identification being the true output of the whole system. Due to the strong dependence of this output on the free hardware parameters, an adaptive network is designed to act on these parameters in such a way that the system converges automatically to the best identification. (orig.)
International Nuclear Information System (INIS)
Menlove, H.O.; Keddar, A.
1982-08-01
The passive neutron Coincidence Collar, which was developed for the verification of plutonium content in fast reactor fuel subassemblies, has been field tested using Prototype Fast Reactor fuel. For passive applications, the system measures the 240 Pu-effective mass from the spontaneous fission rate, and in addition, a self-interrogation technique is used to determine the fissile content in the subassembly. Both the passive and active modes were evaluated at the Windscale Works in the United Kingdom. The results of the tests gave a standard deviation 0.75% for the passive count and 3 to 7% for the active measurement for a 1000-s counting time. The unit will be used in the future for the verification of plutonium in fresh fuel assemblies
Watanabe, Kazuhiro; Kawakami, Norito; Otsuka, Yasumasa; Inoue, Shigeru
2018-05-31
Psychological and environmental determinants have been discussed for promoting physical activity among workers. However, few studies have investigated effects of both workplace environment and psychological determinants on physical activity. It is also unknown which domains of physical activities are promoted by these determinants. This study aimed to investigate main and interaction effects of workplace environment and individual self-regulation for physical activity on domain-specific physical activities among white-collar workers. A multi-site longitudinal study was conducted at baseline and about 5-month follow-up. A total of 49 worksites and employees within the worksites were recruited. Inclusion criteria for the worksites (a) were located in the Kanto area, Japan and (b) employed two or more employees. Employee inclusion criteria were (a) employed by the worksites, (b) aged 18 years or older, and (c) white-collar workers. For outcomes, three domain-specific physical activities (occupational, transport-related, and leisure-time) at baseline and follow-up were measured. For independent variables, self-regulation for physical activity, workplace environments (parking/bike, signs/bulletin boards/advertisements, stairs/elevators, physical activity/fitness facilities, work rules, written policies, and health promotion programs), and covariates at baseline were measured. Hierarchical Linear Modeling was conducted to investigate multilevel associations. Of the recruited worksites, 23 worksites and 562 employees, and 22 worksites and 459 employees completed the baseline and the follow-up surveys. As results of Hierarchical Linear Modeling, stairs/elevator (γ=3.80 [SE=1.80], ppsychological approaches to increase effect sizes to promote overall physical activity.
Directory of Open Access Journals (Sweden)
Nurcan DEMİRCİOĞLU
2004-02-01
Full Text Available In this study; 2+0 aged, bare root, Daday-Koldandere origin of Scotch pine seedlings, produced at Kastamonu–Taşköprü forest nursery, were used. First the morphological characters of the seedlings were determined and the appropriateness to TS 2265/February 1988 were examined. Furthermore, the sensitiveness of quality classification both TSI and newly formed for the mentioned scotch pine seedlings were checked with discriminate analysis. In the conclusion, the average values of the seedling height, the root collar diameter, seedling height / root collar diameter ratio, stem dry weight / root dry weight ratio, dry root percent, quality index of 2+0 aged scotch pine seedlings were determined as 11.62 cm, 2.93 mm, 40.14, 2.34, 30.65 %, 0.32 respectively. In addition, 92.7 % of the seedlings as to the seedling height criterion, 98.7 % of the seedlings as to the root collar diameter criterion, 91.4 % of the seedlings as to the seedling height - root collar diameter criterion, 92.7 % of the seedlings as to the stem dry weight / root dry weight ratio criterion were included in first quality class in respect of TSI quality classification.
The effect of elevated reproductive effort onhumoral immune function in collared flycatcher females
Cichoń, Mariusz; Dubiec, Anna; Chadzińska, Magdalena
2001-02-01
In order to test whether high reproductive investments impair immune function in naturally breeding collared flycatchers, we performed a brood manipulation experiment and simultaneously induced an immune response by challenging birds with a non-pathogenic antigen - sheep red blood cells (SRBC). Females rearing experimentally enlarged number of nestlings showed significantly lower level of specific anti-SRBC antibodies than control females attending unaltered broods, but only in one of the two study years. The haemoconcentration of leukocytes did not differ between the two groups in both study years. The significant difference in immunological responsiveness between control and enlarged group coincided with differences in survival probability to the next breeding season: females attending enlarged broods showed lower probability of survival than control females, but there was no relationship between the level of immune response and survival probability. Our results indicate that reproduction may indeed trade for resources with immune functions at least in terms of specific antibody production. However, as in the other studies on reproductive costs, these costs seem not always to be pronounced.
Directory of Open Access Journals (Sweden)
A. B. Chaplygina
2015-03-01
Full Text Available The study is based on taxonomic and quantitative analysis of feed ration of nestlings and structure of nidikolas of collared flycatcher (Ficedula albicollis (Temminck, 1815. Ecological features and consortium relations of flycatchers and their specific feeding behavior were analyzed. Materials were collected in May – July 2009–2014 on the transformed territories of North-Eastern Ukraine. Functioning of trophic structure of biogeocenosis with the participation of flycatcher as a heterotrophic core of big autotrophic group was studied. Spatial and trophic relations of flycatcher with the woody vegetation and insect-phytophages (leaf beetles, leafhoppers, and barbels have been described. In the feed ration of flycatcher nestlings the prevalence is given to representatives of Hexapoda (83%, including Lepidoptera (16 families, 24%, Hymenoptera (12 families, 23% and Coleoptera (40 families, 15%. We characterize trophic groups of arthropods in the consortium of flycatchers: phytophages (33%, zoophages (45%, parasites, bloodsuckers, saprophages (16%, necrophages (4%, coprophages, keratophages. Fauna of arthropods of collared flycatcher nests was analyzed. Nests of birds as a heterotrophic consortium is the habitat of invertebrates with 293 taxons belonging to the Hexapoda, Arachnida, Malacostraca and Myriaroda, sometimes Mollusca. In the trophic structure of the population of flycatcher the representatives of Hexapoda dominate (278 species, where the first place is given to zoophages (127 species, 45%, including parasites (Culicidae, Tabanidae, Mallophaga, Hippoboscidae, Aphaniptera. The second are phytophages (78 species, 28%, the third – decomposers (75 species, 27%, and the last presenting detritivores (48 species, 18% and necrophages (27 species, 10%. Constant ectoparasitic species of flycatchers are Ricinus sp. (Mallophaga, Ornithomyia avicularia L. (Diptera, Protocalliphora azurea chrysorrhea Mg. (Diptera, Ceratophyllus sp. (Aphaniptera
Rode, Karyn D.; Pagano, Anthony M.; Bromaghin, Jeffrey F.; Atwood, Todd C.; Durner, George M.; Simac, Kristin S.; Amstrup, Steven C.
2014-01-01
Context: The potential for research methods to affect wildlife is an increasing concern among both scientists and the public. This topic has a particular urgency for polar bears because additional research is needed to monitor and understand population responses to rapid loss of sea ice habitat.Aims: This study used data collected from polar bears sampled in the Alaska portion of the southern Beaufort Sea to investigate the potential for capture to adversely affect behaviour and vital rates. We evaluated the extent to which capture, collaring and handling may influence activity and movement days to weeks post-capture, and body mass, body condition, reproduction and survival over 6 months or more.Methods: We compared post-capture activity and movement rates, and relationships between prior capture history and body mass, body condition and reproductive success. We also summarised data on capture-related mortality.Key results: Individual-based estimates of activity and movement rates reached near-normal levels within 2–3 days and fully normal levels within 5 days post-capture. Models of activity and movement rates among all bears had poor fit, but suggested potential for prolonged, lower-level rate reductions. Repeated captures was not related to negative effects on body condition, reproduction or cub growth or survival. Capture-related mortality was substantially reduced after 1986, when immobilisation drugs were changed, with only 3 mortalities in 2517 captures from 1987–2013.Conclusions: Polar bears in the southern Beaufort Sea exhibited the greatest reductions in activity and movement rates 3.5 days post-capture. These shorter-term, post-capture effects do not appear to have translated into any long-term effects on body condition, reproduction, or cub survival. Additionally, collaring had no effect on polar bear recovery rates, body condition, reproduction or cub survival.Implications: This study provides empirical evidence that current capture
Kaul-Strehlow, Sabrina; Urata, Makoto; Praher, Daniela; Wanninger, Andreas
2017-08-01
A tubular nervous system is present in the deuterostome groups Chordata (cephalochordates, tunicates, vertebrates) and in the non-chordate Enteropneusta. However, the worm-shaped enteropneusts possess a less complex nervous system featuring only a short hollow neural tube, whereby homology to its chordate counterpart remains elusive. Since the majority of data on enteropneusts stem from the harrimaniid Saccoglossus kowalevskii, putative interspecific variations remain undetected resulting in an unreliable ground pattern that impedes homology assessments. In order to complement the missing data from another enteropneust family, we investigated expression of key neuronal patterning genes in the ptychoderid Balanoglossus misakiensis. The collar cord of B. misakiensis shows anterior Six3/6 and posterior Otx + Engrailed expression, in a region corresponding to the chordate brain. Neuronal Nk2.1/Nk2.2 expression is absent. Interestingly, we found median Dlx and lateral Pax6 expression domains, i.e., a condition that is reversed compared to chordates. Comparative analyses reveal that adult nervous system patterning is highly conserved among the enteropneust families Harrimaniidae, Spengelidae and Ptychoderidae. BmiDlx and BmiPax6 have no corresponding expression domains in the chordate brain, which may be indicative of independent acquisition of a tubular nervous system in Enteropneusta and Chordata.
Development of the mercury iodide semiconductor crystal for application as a radiation detector
International Nuclear Information System (INIS)
Martins, Joao Francisco Trencher
2011-01-01
In this work, the establishment of a technique for HgI growth and preparation of crystals, for use as room temperature radiation semiconductor detectors is described. Three methods of crystal growth were studied while developing this work: physical vapor transport (PVT); saturated solution of HgI 2 , using two different solvents; (a) dimethyl sulfoxide (DMSO) and (b) acetone, and the Bridgman method. In order to evaluate the obtained crystals by the three methods, systematic measurements were carried out for determining the stoichiometry, structure, orientation, surface morphology and impurity of the crystal. The influence of these physical chemical properties on the crystals development was studied, evaluating their performance as radiation detectors. The X-ray diffractograms indicated that the crystals were, preferentially, oriented in the (001) e (101) directions with tetragonal structure for all crystals. Nevertheless, morphology with a smaller deformation level was observed for the crystal obtained by the PVT technique, comparing to other methods. Uniformity on the surface layer of the PVT crystal was detected, while clear incrustations of elements distinct from the crystal could be viewed on the DMSO crystal surface. The best results as to radiation response were found for the crystal grown by physical vapor transport. Significant improvement in the HgI z2 radiation detector performance was achieved for purer crystals, growing the crystal twice by PVT technique. (author)
Directory of Open Access Journals (Sweden)
Padmaja Durga
2012-01-01
Full Text Available Background: It is difficult to visualise the larynx using conventional laryngoscopy in the presence of cervical spine immobilisation. Airtraq® provides for easy and successful intubation in the neutral neck position. Objective: To evaluate the effectiveness of Airtraq in comparison with the Mc Coy laryngoscope, when performing tracheal intubation in patients with neck immobilisation using hard cervical collar and manual in-line axial cervical spine stabilisation. Methods: A randomised, cross-over, open-labelled study was undertaken in 60 ASA I and II patients aged between 20 and 50 years, belonging to either gender, scheduled to undergo elective surgical procedures. Following induction and adequate muscle relaxation, they were intubated using either of the techniques first, followed by the other. Intubation time and Intubation Difficulty Score (IDS were noted using Mc Coy laryngoscope and Airtraq. The anaesthesiologist was asked to grade the ease of intubation on a Visual Analogue Scale (VAS of 1-10. Chi-square test was used for comparison of categorical data between the groups and paired sample t-test for comparison of continuous data. IDS score and VAS were compared using Wilcoxon Signed ranked test. Results: The mean intubation time was 33.27 sec (13.25 for laryngoscopy and 28.95 sec (18.53 for Airtraq (P=0.32. The median IDS values were 4 (interquartile range (IQR 1-6 and 0 (IQR 0-1 for laryngoscopy and Airtraq, respectively (P=0.007. The median Cormack Lehane glottic view grade was 3 (IQR 2-4 and 1 (IQR 1-1 for laryngoscopy and Airtraq, respectively (P=0.003. The ease of intubation on VAS was graded as 4 (IQR 3-5 for laryngoscopy and 2 (IQR 2-2 for Airtraq (P=0.033. There were two failures to intubate with the Airtraq. Conclusion: Airtraq improves the ease of intubation significantly when compared to Mc Coy blade in patients immobilised with cervical collar and manual in-line stabilisation simulating cervical spine injury.
Ironija i satira u dramskim djelima Maxa Frischa: Mehanizmi suočavanja s izazovima 20. stoljeća
Directory of Open Access Journals (Sweden)
Katarina Žeravica
2014-12-01
Full Text Available Irony and satire, two complex phenomena, find their respective places in the dramatic works of Max Frisch (1911–1991, a Swiss playwright and novelist and have gone through many changes gaining on different meanings, depending on the socio-cultural context, dominant literary and philosophical theories of a certain period of time in which they were analyzed and recognized as such. The aim of this paper is to show that Max Frisch, a 20th century intellectual who witnessed the major political, cultural and social changes of the second half of the 20th century in Europe and worldwide, uses irony and satire for coping with the reality and challenges of the time he lived in. Keywords: Max Frisch, dramatic work, irony, satire, 20th centuryNeutralna pozicija koju je Švicarska imala za vrijeme Drugoga svjetskog rata, a zbog koje je ostala pošteđena ratnih zbivanja te otvorenost klasičnim, ali i suvremenim europskim i svjetskim književnim te kazališnim utjecajima, stvorili su pozitivno ozračje za dobru, aktualnu i suvremenu švicarsku dramsku književnost na njemačkom jeziku nakon 1945. godine čiji predstavnik postaje jedan od najvećih švicarskih književnika, Max Frisch (1911–1991. U svojoj dugogodišnjoj književnoj karijeri Frisch je bio iznimno aktivan kao prozaist, napisavši pet romana, pet pripovijesti te četiri dnevnika, ali i kao dramatičar, ostavivši bogat dramski opus koji broji jedanaest dramskih ostvarenja napisanih između 1945. i 1978. godine. Upravo će Frischove drame biti predmetom ovoga rada, odnosno naglasak će biti na onima koje su se analizom pokazale najreprezentativnijima u cilju dokazivanja postojanja ironije i satire u istima kao mehanizmima suočavanja s izazovima koje je pred čovjeka-intelektualca stavilo 20. stoljeće, ali i kao sredstvima putem kojih Frisch progovara, kritizira i prokazuje besmisao jednog vremena kojemu je i sâm pripadao.
DEFF Research Database (Denmark)
Levisen, Vinie Diana Hvidbak; Castaño, Francisco Mansilla; Jensen, Camilla Skovbjerg
2017-01-01
applications affect the level of physical activity amongst blue collar men as well as the frequency of how often they think and do something for their own physical health. Methods: Controlled clinical trial, men, aged 19–62 years, working in industrial companies, who are assigned to an intervention group (n=35.......9 to 68.8 kg (P=0.02); oxygen absorption in the fitness test, from 3.09 to 3.22 L/min (P=0.03); VAS, how often the men do something to improve their own physical health, from 6.00 to 7.00 (P=0.0051). There are improved parameters in the intervention group for resting heart rate (RHR), fitness test, fat......-by-step control increases the physical activity level of blue-collar men as well as how often they think and do something to improve their physical health. Significant improvement is seen in their muscle mass and oxygen uptake as well as in relation to how often they do something to improve their own health....
Metzler, Yannick Arnold; Bellingrath, Silja
2017-01-01
The European steel industry's workforce is highly heterogeneous and consists of various occupational groups, presumably facing different psychosocial stressors. The few existing studies on the subject mainly focused on physical constraints of blue-collar workers, whereas the supposable psychosocial workload received only little research attention. This is remarkable considering the challenges associated with statutory required risk assessment of psychosocial hazards. Valid measures of hazard analysis must account for various stressors and reliably identify them, also between occupational groups. The present study, based on a sample of blue- and white-collar workers ( N = 124) from the European steel industry, aims to provide a first insight into psychosocial stressors and strain at work in this rarely researched industrial sector. Furthermore, two well-known theoretical roadmaps in job analysis are examined regarding their utility for risk assessment in heterogeneous workforces: the German standard version of the Copenhagen Psychosocial Questionnaire (COPSOQ) and the short version of the effort-reward imbalance questionnaire. Hierarchical multiple regression analyses revealed that the COPSOQ was better suited to predict various strain indices in the present sample. Especially stressors relating to socioemotional aspects, such as work-privacy conflict, revealed a reasonable impact, indicating the need for comprehensive solutions at the organizational level instead of solutions focusing on single workplaces. To conclude, a broadly diversified and validated approach in psychosocial risk assessment is needed to adequately assess the variety of psychosocial factors at work and in different occupational groups.
The semi-conductor detectors: art state, new concepts
International Nuclear Information System (INIS)
Pochet, T.
1993-01-01
After a brief recall of signal formation principle in a detector and of its different operation modes, the high Z materials as CdTe, HgI 2 , GaAs ,Ge and Si are presented, followed by the new 'thin layer' semiconductors
Directory of Open Access Journals (Sweden)
A. S. Zolotov
2013-01-01
Full Text Available The article is devoted to the history of one of the methods of conservative treatment humeral transcondylar extensor fractures in children - a method «collar and cuff». The second and very common name of this method is connected with the name of the american orthopaedist Walter Blount. «The method of Blount» is mentioned in many domestic and foreign sources. Nevertheless the analysis of publications on the history of the discussed method of treatment indicates the priority in this matter other famous doctor - British podiatrist Robert Jones.
Bled, F.; Royle, J. Andrew; Cam, E.
2011-01-01
Invasive species are regularly claimed as the second threat to biodiversity. To apply a relevant response to the potential consequences associated with invasions (e.g., emphasize management efforts to prevent new colonization or to eradicate the species in places where it has already settled), it is essential to understand invasion mechanisms and dynamics. Quantifying and understanding what influences rates of spatial spread is a key research area for invasion theory. In this paper, we develop a model to account for occupancy dynamics of an invasive species. Our model extends existing models to accommodate several elements of invasive processes; we chose the framework of hierarchical modeling to assess site occupancy status during an invasion. First, we explicitly accounted for spatial structure and how distance among sites and position relative to one another affect the invasion spread. In particular, we accounted for the possibility of directional propagation and provided a way of estimating the direction of this possible spread. Second, we considered the influence of local density on site occupancy. Third, we decided to split the colonization process into two subprocesses, initial colonization and recolonization, which may be ground-breaking because these subprocesses may exhibit different relationships with environmental variations (such as density variation) or colonization history (e.g., initial colonization might facilitate further colonization events). Finally, our model incorporates imperfection in detection, which might be a source of substantial bias in estimating population parameters. We focused on the case of the Eurasian Collared-Dove (Streptopelia decaocto) and its invasion of the United States since its introduction in the early 1980s, using data from the North American BBS (Breeding Bird Survey). The Eurasian Collared-Dove is one of the most successful invasive species, at least among terrestrial vertebrates. Our model provided estimation of the
Patterns of physical activity and obesity indices among white-collar men in Taiwan.
Liou, Yiing Mei
2007-06-01
The purposes of this study were to identify patterns of physical activity among white-collar men in Taiwan and to analyze the relationships between physical activity patterns and obesity indices. This cross-sectional survey included 350 subjects (between 21 and 75 years old). The Monitoring Trends and Determinants of Cardiovascular Disease Optional Study of Physical Activity Questionnaire (MOSPA-Q), developed and published by the World Health Organization (WHO) was used to measure subjects' daily energy expenditures attributed to physical activity. Obesity indices included body weight, body mass index (BMI), waist/hip ratio (WHR), body fat percentage, total cholesterol, triglycerides, high-density lipoprotein (HDL), and low-density lipoprotein (LDL). Three patterns of physical activity, namely work-oriented, active, and light-active lifestyles, were identified through cluster analysis. The work-oriented group reported spending the most amount of time on work-related activities (10.5 hours/week). The active group spent the most time (1 hour/day) of the three groups on leisure activities. The light-active group spent the most time (7 hours/day) of the three groups on light activities. Referencing the 150 minutes/week of moderate- intensity physical activity recommended by the US Centers for Disease Control and prevention (CDC) for health gain as a cut-off point, 1.1%, 15.2%, and 29.1% of subjects in the active, light-active and work-oriented groups, respectively, failed to achieve this minimal level. Those in the work-oriented group categorized in high work-overload and prevalent inactivity situations returned the worst obesity indices (Body weight, BMI, WHR, and body fat percentages) adjusted by age.
Contribution to determination of coal grindability using Hardgrove method
Tichánek, František
2008-01-01
The paper deals with determination of grindability of coal using Hardgrove method. Some non-availabilities of determination are mentioned as well as factors affecting grindability and relations for conversion of Hardgrove Grindability Index (HGI) values to Bond Work Index (Wi). Paper also provides information on utilization of Hardgrove method in Czech Republic and indicates HGI values for coal from OKD-Karvina region. Příspěvek se zabývá stanovením melitelnosti uhlí pomocí metody Hardgrov...
Directory of Open Access Journals (Sweden)
Zhenchuang Tang
2017-01-01
Full Text Available Abstract Background As the first meal of the day, breakfast plays an important role in supplying energy and nutrients, which are critical to working and learning activities. A three-phase crossover study was designed to investigate the effects of breakfast on cognitive function among Chinese white-collar workers. The planned study protocol is presented. Methods A total of 264 participants aged 25–45 years will be recruited from Shenyang and Chongqing. Self-administered questionnaires will be used to collect information on age, gender, marital status, education level, occupation, smoking habits, drinking habits, and breakfast behaviours. The participants will be randomly assigned to 3 equal-sized groups (Groups A, B, and C and will be provided with a nutrition-adequate breakfast, a nutrition-inadequate breakfast, or no breakfast, respectively. Each participant will receive the breakfast treatment on the basis of assignment to one of three sequences (ABC/BCA/CAB. Each participant will complete a battery of cognitive tests assessing short-term memory, attention, and working memory 120 minutes after breakfast. Mood will be measured through a self-administered questionnaire assessing the dimensions of positive and negative frames of mind. Additionally, fasting blood glucose and postprandial 2-hour blood glucose levels will be tested with a blood-glucose meter (Roche ACCU-CHEK®-Performa. All the participants will take all the tests in three successive weeks, and the order of presentation will be counter-balanced across groups. Discussion The present study will be the first investigation of the effect of breakfast food type and quality on cognitive function amongst white-collar workers in China. We predict that a nutrition-adequate breakfast, compared with a nutrition-inadequate breakfast and no breakfast, will significantly improve short-term cognitive function. The results of this study should provide scientific evidence of the effect of
Feasibility study of a photoconductor based dosimeter for quality assurance in radiotherapy
Lee, Y. K.; Kim, S. W.; Kim, J. N.; Kang, Y. N.; Kim, J. Y.; Lee, D. S.; Kim, K. T.; Han, M. J.; Ahn, K. J.; Park, S. K.
2017-09-01
With the recent market entries of new types of linear accelerators (LINACs) with a multi leaf collimator (MLC) mounted on them, high-precision radiosurgery applying a LINAC to measure high-dose radiation on the target region has been gaining popularity. Systematic and accurate quality assurance (QA) is of vital important for high-precision radiosurgery because of its increased risk of side effects including life-threatening ones such as overexposure of healthy tissues to high-dose radiation beams concentrated on small areas. Therefore, accurate dose and dose-distribution measurements are crucial in the treatment procedure. The accurate measurement of the properties of beams concentrated on small areas requires high-precision dosimeters capable of high-resolution output and dose mapping as well as accurate dosimetry in penumbra regions. In general, the properties of beams concentrated on small areas are measured using thermos luminescent dosimeters (TLD), diode detectors, ion chambers, diamond detectors, or films, and many papers have presented the advantages and disadvantages of each of these detectors for dosimetry. In this study, a solid-state photoconductor dosimeter was developed, and its clinical usability was tested by comparing its relative dosimetric performance with that of a conventional ion chamber. As materials best-suited for radiation dosimeters, four candidates namely lead (II) iodide (PbI2), lead (II) oxide (PbO), mercury (II) iodide (HgI2), and HgI2/ titanium dioxide (TiO2) composite, the performances of which were proved in previous studies, were used. The electrical properties of each candidate material were examined using the sedimentation method, one of the particle-in-binder (PIB) methods, and unit-cell-type prototypes were fabricated. The unit-cell samples thus prepared were cut into specimens of area 1 × 1 cm2 with 400-μ m thickness. The electrical properties of each sample, such as sensitivity, dark current, output current, rising time
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science. S L Sharma. Articles written in Bulletin of Materials Science. Volume 25 Issue 2 April 2002 pp 85-93 Materials Synthesis. Photoelectronic properties of HgI2 crystals for nuclear radiation detection · S L Sharma H N Acharya · More Details Abstract Fulltext PDF. Photoelectronic ...
Directory of Open Access Journals (Sweden)
Sebastián Llanos-Soto
Full Text Available Abstract A total of 277 rufous-collared sparrows, Zonotrichia capensis Müller, 1776 (Emberizidae, were examined for external parasites. The birds were captured using mist nets in seven locations in northern and central Chile. Additionally, seven carcasses from central Chile (the Biobío region were necropsied to evaluate the presence of endoparasite infection. Ectoparasites were found on 35.8% (99/277 of the examined birds and they were represented by the following arthropods: feather mites Amerodectes zonotrichiae Mironov and González-Acuña, 2014 (Analgoidea: Proctophyllodidae, Proctophyllodes polyxenus Atyeo and Braasch, 1966 (Analgoidea: Proctophyllodidae, and Trouessartia capensis Berla, 1959 (Analgoidea: Trouessartiidae; a louse Philopterus sp. (Phthiraptera: Ischnocera; and ticks Amblyomma tigrinum Koch, 1844 (Acari: Ixodidae and Ixodes auritulus Neumann, 1904 (Acari: Ixodidae. Two of the seven necropsied carcasses were infected with the acanthocephalan Mediorhynchus papillosus Van Cleave, 1916 (Gigantorhynchida: Gigantorhynchidae. To our knowledge, this study reports P. polyxenus, Philopterus sp., A. tigrinum, and M. papillosus for the first time for Z. capensis and expands the distributional range for T. capensis to Chile.
DEFF Research Database (Denmark)
Aller, E E J G; Larsen, Thomas Meinert; Holst, Claus
2014-01-01
Background:A high dietary protein (P) content and low glycemic index (GI) have been suggested to be beneficial for weight management, but long-term studies are scarce.Objective:The DIOGENES randomized clinical trial investigated the effect of P and GI on weight loss maintenance in overweight...... or obese adults in 8 centers across Europe. This study reports the 1-year results in 2 of the centers that extended the intervention to 1 year.Method:After an 8-week low calorie diet (LCD), 256 adults (BMI>27 kg/m(2)) were randomized to 5 ad libitum diets for 12 months: high P/low GI (HP/LGI), high P/high...... GI (HP/HGI), low P/low GI (LP/LGI), low P/high GI (LP/HGI) and a control diet. During the first 6 months foods were provided for free through a shop system, during the whole 12-month period subjects received guidance by a dietician. Primary outcome variable was the change in body weight over the 12...
Gerard, M. (Editor); Edwards, P. W. (Editor)
1985-01-01
Techniques for improving the productivity of white-collar workers while maintaining high product quality are examined in reviews and reports. The emphasis is on the application of strategies developed in the private sector to government-agency and aerospace-industry operations. Topics discussed include international competition, organizational attitudes and orientation, management practices, education and training, renewing large organizations, encouraging innovation, national initiatives, employee involvement, management involvement, and applications of new technology.
IL-6 RESPONSES TO GLYCAEMIC INDEX DURING RECOVERY FROM EXERCISE
Directory of Open Access Journals (Sweden)
S.H. Hasani
2015-06-01
Full Text Available Purpose: This study examined the effect of meal with different glycaemic index (GI on plasma IL-6 concentration and glucose metabolism after maximal lengthening contractions of the knee extensors. Using a cross-over design, Material : 10 healthy males completed 5 sets of 10 lengthening (eccentric contractions at 120% 1 repetition-maximum. Subjects were randomized to consume the GI beverage (high-GI, low-GI (15% weight per volume; 3 g/kg BM or placebo in three times within 10 min following exercise, and again at 50 and 110 min during recovery time. Blood samples were collected before exercise and after 0.60, 180 min and 24 h of recovery. Results: Concentration of plasma IL-6 in HGI group was less than LGI and Pla groups. IL-6 tended to significantly increase after exercise in recovery time in 3 groups (all P < 0.05, except for 24 hours (P = 1.00, furthermore there was significant difference for IL-6 between placebo and high glycemic groups in 3hours after exercise (P=.016. Concentration of serum CK in HGI group was less than LGI and Pla groups, CK was significantly elevated at all times points during recovery in 3 groups (all P < 0.05, except for 1 hour after exercise in HGI group (P = 0.31, but there was no significant difference for CK between groups. Conclusion: In summary, consuming HGI carbohydrate during recovery from exercise attenuate plasma IL-6 concentration.
Directory of Open Access Journals (Sweden)
Paulo César Simões Borges
1995-08-01
Full Text Available Grandes investimentos em tecnologia de informação (TI vêm sendo canalizados para a melhoria dos processos empresariais. Esses investimentos limitam-se, em geral, à automação pura e simples dos processos já existentes na companhia, os quais continuam sendo realiza-dos pelos mesmos profissionais e regidos pelos mesmos princípios anteriores à TI. Um corolário deste tipo de automação é o pequeno ganho de produtividade do trabalho de colarinho branco. Uma alternativa para este problema é a reengenharia de processos, que por meio do uso criativo da TI e da gestão por processos procura estabelecer novas formas muito mais eficientes de realizar o trabalho. Entretanto, tais formas alteram, freqüente e fundamentalmente, o perfil do profissional e a natureza de seu trabalho. É sobre estes impactos que estaremos discorrendo ao longo deste artigo.Huge investiments in information technology (IT have been directed to business process improvements. Generally, such investments are limited to the sole automation of already existing processes, which continue to be performed according to the same rules and by the same professionals prior to IT. A consequence of this kind of automation is the low producti-vity increase in white collar work. An alternative to this problem is business process reengi-neering, which, via the creative use of IT, strives to establish much more effective ways of performing work. However, very often such new ways affect the professional skills and the nature of the work. This paper discusses the impacts of IT on white collar work.
High resolution multiple sampling ionization chamber (MUSIC) sensitive to position coordinates
International Nuclear Information System (INIS)
Petrascu, H.; Kumagai, H.; Tanihata, I.; Petrascu, M.
1999-01-01
A new type of MUSIC sensitive to position coordinates is reported. The development of the first version of this type of chamber is based on the principles presented by Badhwar in 1973. The present detector will be used in experiments on fusion by using radioactive beams. This chamber due to the high resolution is suitable to identification and tracking of low Z particles. One of our goals, when we started this work, was to reduce as much as possible the Z value of particles that can be 'seen' by an ionization chamber. The resolution of the chamber was significantly improved by connecting the preamplifiers directly to the MUSIC's pads. These preamplifiers are able to work in vacuum and very low gas pressure. In this way the value of signal to noise ratio was increased by a factor of ∼10. The detector is of Frisch grid type, with the anode split into 10 active pads. It is the first model of a MUSIC with the field shared between the position grid and the anode pads. The Frisch grid was necessary because the detector is originally designed for very accurate energy measurements and particle identification. A drawing of this detector is shown. The detector itself consists of four main parts. The first one is the constant field-gradient cage, sandwiched in between the cathode and the Frisch grid. The second is the Frisch grid. The third is the position grid located under the Frisch grid. The last one is the plate with the anode pads. The cage is made of 100 μm Cu-Be wires. Every wire was tensioned with a weight representing half of its breaking limit. The Frisch grid was done on an aluminium frame, on which 20 μm W wires spaced 0.3 mm, were wound. For the position grid, 10 groups of 20 μm gold plated W wires have been used. Each group consisted of 5 wires spaced 0.9 mm and connected in parallel. The anode pads 7.8 x 60 mm 2 were perpendicular to the beam direction. Each pad and each of the position wire groups were connected to a preamplifier. The energy resolution
ORF Alignment: NC_002973 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available EKPASLICIAGGDTPLLTIEALIKANQTGEVDFSE 60 ... Query: 121 IDDRGGMDFXXXXXXXXXXXXFNEPFVPVDVNCHVVELDDVTKRVMSKYFDTDLPLT...HGI 180 ... IDDRGGMDF ... FNEPFVPVDVNCHVVELDDVTKRVMSKYFDTDLPLTHGI Sbjct: 121 IDDRGGMDFILLGIGLNGHIGFNEPFVPVDVNCHVVELDDVTKRVMSKYFDTDLPLTHGI 180 ...
A simple Bragg detector design for AMS and IBA applications
Energy Technology Data Exchange (ETDEWEB)
Müller, Arnold Milenko; Döbeli, Max; Seiler, Martin; Synal, Hans-Arno
2015-08-01
A new compact Bragg type gas ionization chamber (GIC) has been built for use as particle counter in AMS and IBA applications. The detector stands out due to its simple concept, which does not include a Frisch grid. Test experiments have been performed with ions in the mass range from He to Th and energies ranging from 30 keV to 2.5 MeV, in order to find optimal measurement conditions and to characterize the detector performance. For projectiles heavier than Al at energies below 2.5 MeV the obtained energy resolution is comparable with that of a state-of-the-art GIC with Frisch grid and clearly outperforms solid state detectors. Additionally the operation of this simplified Bragg GIC in the electron multiplication mode was investigated for the first time, which allows the detection of radiocarbon ions at energies below 50 keV with an energy resolution of the order of 10 keV.
[The association between early blood glucose fluctuation and prognosis in critically ill patients].
Tang, Jian; Gu, Qin
2012-01-01
To investigate the association between early blood glucose level fluctuation and prognosis of critically ill patients. A retrospective study involving 95 critically ill patients in intensive care unit (ICU) was conducted. According to the 28-day outcome after admission to ICU, the patients were divided into nonsurvivors (43 cases) and survivors (52 cases), and the blood glucose level in them was monitored in the first 72 hours. Blood glucose concentration at admission (BGadm), mean blood glucose level (MBG), hyperglycemia index (HGI), glycemic lability index (GLI), incidence of hypoglycemia and total dosage of intravenous insulin for each patient were compared. The index as an independent risk factor of mortality was determined by multivariate logistic regression analysis and the predictor value by comparing the area under the receiver operating characteristic curve (ROC curve, AUC) of each index. The BGadm (mmol/L), MBG (mmol/L), HGI and the incidence of hypoglycemia showed no significant differences between nonsurvivors and survivors [BGadm: 9.87 ± 4.48 vs. 9.26 ± 3.07, MBG: 8.59 ± 1.23 vs. 8.47 ± 1.01, HGI(6.0): 2.45 ± 0.94 vs. 1.68 ± 1.05, HGI(8.3): 0.84 ± 0.70 vs. 0.68 ± 0.51, the incidence of hypoglycemia: 9.30% vs. 5.77%, all P > 0.05], but acute physiology and chronic health evaluation II (APACHE II ) score, GLI and the total dosage of intravenous insulin (U) were significantly higher in nonsurvivors than survivors [APACHE II score: 23 ± 6 vs. 19 ± 6, GLI: 56.96 (65.43) vs. 23.87 (41.62), the total dosage of intravenous insulin: 65.5 (130.5) vs. 12.5 (90.0), all P curve was plotted, the AUC of APACHE II score and GLI was respectively 0.69 and 0.71, and there was no significant difference (P > 0.05). Early fluctuation of blood glucose is a significant independent risk factor of mortality in critically ill patients. Control the early fluctuation of blood glucose concentration might improve the patients' outcome.
Type A and type behaviors and factors related to job satisfaction among male white-collar workers.
Hagihara, A; Tarumi, K; Morimoto, K
1998-01-01
Numerous studies have examined the health effects of Type A behavior and job satisfaction/dissatisfaction, but we know very little about the relationship between aspects of the work environment related to job satisfaction and the Type A behavior pattern. In the present study, we analyzed data concerning work Stressors, private aspects of life, and job satisfaction among male white-collar workers (n=657) in a large steel company, and identified the respective aspects of the work environment related to job satisfaction among groups divided by Type A/B behavior patterns.We found that the nature of predictors for job satisfaction varied with the behavior type. "Being not busy at work" (pjob satisfaction among the Type A workers while "working less than 10 hours per day" (pjob satisfaction among the Type workers. "Work performance is evaluated" was a significant predictor of job satisfaction among all three behavior types (A, B, and A/B).Our results can provide information useful for the creation of programs to lower the level of job dissatisfaction and mental stress depending upon the behavior type of employees.
Gustafsson, Lars; Qvarnström, Anna
2006-02-01
According to the original "sexy son" hypothesis, a female may benefit from pairing with an already-mated male despite a reduction in fecundity because her sons inherit their father's attractiveness. We used data from a long-term study of collared flycatchers (Ficedula albicollis) collected during 24 years to test this prediction. Our results show that the sons of polygynously mated females fledged in poor condition and therefore did not inherit their father's large forehead patch (a condition-dependent display trait) or mating status. From the female's perspective, polygynous pairing resulted in fewer recruited grandchildren than did a monogamous pairing. The reproductive value of sons did not outweigh the fecundity costs of polygyny because the low paternal care reduced the attractiveness of sons. When there are long-lasting parental effects on offspring attractiveness, costs of polygyny may include the production of nonsexy sons.
THE EFFECT OF GLYCEMIC INDEX ON PLASMA IL-6 IN SUB-MAX EXERCISE
Directory of Open Access Journals (Sweden)
S.H. Hasani
2015-05-01
Full Text Available Purpose: This study examined the effect of a pre-exercise meal with different glycemic index (GI on plasma IL-6 concentration and glucose metabolism during sub-max exercise (endurance performance run. Material : Ten men completed 1 h running at 70%-75% VO2max on a level treadmill on three occasions. In each trial, one of the three prescribed beverages as meal, i.e. high GI and low GL or placebo was consumed by the subjects 45 min before exercise. Blood samples were collected before, after, 1h and 24h after exercise. Result: Concentration of Plasma IL-6 in LGI group was less than HGI and Pla groups, IL-6 tended to significantly increase after exercise in groups (all P < 0.05, also there was significant difference for plasma IL-6 concentration between placebo and low glycemic groups in after exercise (P=.003 and 1hour after exercise (P=.005 . CK was significantly elevated at all- time points after exercise in 3 groups (all P < 0.05. Concentration of serum CK in LGI group was less than HGI and Pla groups but there not significantly. The consumption of the LGI beverage before exercise could minimize the increasing of plasma IL-6 concentration immediately after exercise and during the 1 h recovery period compared with the HGI beverage and Pla. Conclusion: This result suggested that the LGI beverage consumed as pre-exercise meal could modify the inflammatory response in prolonged exercise.
THE EFFECT OF GLYCEMIC INDEX ON PLASMA IL-6 IN SUB-MAX EXERCISE
Directory of Open Access Journals (Sweden)
Hasani S.H.
2015-04-01
Full Text Available Purpose: This study examined the effect of a pre-exercise meal with different glycemic index (GI on plasma IL-6 concentration and glucose metabolism during sub-max exercise (endurance performance run. Material : Ten men completed 1 h running at 70%-75% VO2max on a level treadmill on three occasions. In each trial, one of the three prescribed beverages as meal, i.e. high GI and low GL or placebo was consumed by the subjects 45 min before exercise. Blood samples were collected before, after, 1h and 24h after exercise. Result: Concentration of Plasma IL-6 in LGI group was less than HGI and Pla groups, IL-6 tended to significantly increase after exercise in groups (all P < 0.05, also there was significant difference for plasma IL-6 concentration between placebo and low glycemic groups in after exercise (P=.003 and 1hour after exercise (P=.005 . CK was significantly elevated at all- time points after exercise in 3 groups (all P < 0.05. Concentration of serum CK in LGI group was less than HGI and Pla groups but there not significantly. The consumption of the LGI beverage before exercise could minimize the increasing of plasma IL-6 concentration immediately after exercise and during the 1 h recovery period compared with the HGI beverage and Pla. Conclusion: This result suggested that the LGI beverage consumed as pre-exercise meal could modify the inflammatory response in prolonged exercise.
Lundberg, U; Mårdberg, B; Frankenhaeuser, M
1994-12-01
A questionnaire assessing various aspects of paid as well as unpaid forms of productive activity was mailed to stratified samples of male and female white collar workers, approximately matched for educational and occupational level. Data from 501 men and 679 women employed full time revealed traditional gender differences in terms of main responsibility for household duties, child care etc. In keeping with this, women reported higher levels of work overload, stress and conflict than men, which increased significantly with the number of children at home. The various stress indices reached a peak between the ages of 35 and 39. Men reported more autonomy in their paid work whereas women reported more control at home. Men and women at the upper managerial levels reported more control over their total work situation and less conflict between demands.
「汝、偶像をつくるなかれ」 : フリッシュの掌編「ストーリー」に関する情動の生態学的考察
中村, 靖子; NAKAMURA, Yasuko
2012-01-01
Max Frischs kurze Geschichte „Story“, enthalten im Tagebuch 1946–1949 (1950), erzählt von dem fortwährenden Warten einer Frau auf ihren Mann, der als Soldat während des ersten Weltkriegs in russische Gefangenschaft geriet und nach Kriegsende nicht mehr zurückgekehrt ist – ein Frauenschicksal, wie es die beiden Weltkriege in übergroßer Zahl hervorgebracht haben. Bei Frisch will die Frau aber den Tod ihres Mannes nicht wahrhaben und wartet unbeirrt auf seine Rückkehr. Ihre feste Überzeugung, da...
Structural and spectral properties of 4-phenoxyphthalonitrile dye ...
Indian Academy of Sciences (India)
and HOMO–LUMO gap of (TiO2)60 cluster is −7·52, −2·97 and 4·55 eV ... 694·7, 785·7, 510·6, 611·2 and 802·9 a.u., respectively (Seidl ... eleven C–C–N inplane bend- ...... Frisch M J et al 2003 Gaussian 03 (Pittsburgh, PA: Gaussian, Inc.).
Lesão do colo do cafeeiro, causada pelo calor Collar injury- young coffe plants caused by heat
Directory of Open Access Journals (Sweden)
Coaracy M. Franco
1961-01-01
Full Text Available Tem sido observada ocasionalmente uma lesão no colo de cafeeiros novos ao nível do solo. .Estudos dc laboratório mostraram que o caule de cafeeiros novos foram danificados quando ao redor dêle se fêz circular água aquecida às temperaturas de 45 o 50ºC. O aquecimento da superfície do solo, compreendendo o colo de cafeeiro vegetando em laminados, com o auxílio de uma lâmpada de raios infravermelhos, resultou em lesão semelhante àquela observada nas culturas. Essa lesão apareceu em tratamentos cujas temperaturas estiveram entre 44 e 51°C. O fato dessas temperaturas serem freqüentemente observadas em solos expostos ao sol, sugere que a lesão do caule do cafeeiro, observada freqüentemente em cafèzais novos, seja conseqüência do aquecimento excessivo da superfície do solo pelos raios solares.A collar injury of young, field coffee plants at the soil level has been observed occasionally in the summer. The location of the abnormality and the season when it appears .suggested that excessive heating of the soil surface by the sun rays could be its cause. Two experiments were then conducted in the laboratory to investigate this bypothesis. The first experiment consisted in circulating water at the desired temperature around the stem ofyoung coffee plants, using the same apparatus described in a previous paper. In a second experiment the base of the stem and the soil around it was heated by means of a G. E. 250 watts infrared industrial reflector. By changing the distance between the heat source and the plant, different temperatures at the soil surface could be obtained. The results of the first experiment showed that 4 plants out of o that were treated at 45ºC showed injury; the other 2 plants survived without damage. From 5 plants that were treated at 50ºC, 2 showed injury and 3 died shortly after the treatment. All plants subjected to the temperature treatments at 35°C and 40ºC survived without damage, while those treated at 55º
Directory of Open Access Journals (Sweden)
Sandmark Hélène
2010-04-01
Full Text Available Abstract Background Sick leave rates in Sweden have been significant since the end of the 1990s. In this paper we focus on individual female white-collar workers and explore various factors and setting-based sources of ill health in working life and in private life, in order to understand impaired work ability, leading ultimately to long-term sick leave. Methods A qualitative methodology was chosen, and thematic, open-ended interviews were carried out with 16 women. The interviewees were strategically selected from a cohort of 300 women in full-time white-collar jobs in high-level positions, living in three urban areas in Sweden, and on long-term sick leave ≥90 days. A qualitative content analysis was carried out. Results The informants in the study were generally well educated, but a few had surprisingly little formal education considering their salary level and position on the labour market. The women were in professional positions more commonly held by men, either as specialists with some degree of managerial role or as executives with managerial responsibilities. Both external and internal stressors were identified. The analysis indicated that being in these gender-typed jobs could have induced sex discrimination and role conflicts. The women expressed strong agreement regarding success in working life, but emphasised the lack of competence matching in their present jobs. They also lacked the sense of having a rewarding job, saw leadership as weak, and disliked their present workplace and colleagues. Impaired health may have hindered them from changing jobs; conversely, their locked-in positions could have resulted in deterioration in their health status. The women displayed personal overcommitment, both at work and in private life, and had difficulties in setting limits. Conclusions Factors in working life, as well as in private life, played an important role in the informants' deteriorated health and long-term sick leave. Job and
Sandmark, Hélène; Renstig, Monica
2010-04-26
Sick leave rates in Sweden have been significant since the end of the 1990s. In this paper we focus on individual female white-collar workers and explore various factors and setting-based sources of ill health in working life and in private life, in order to understand impaired work ability, leading ultimately to long-term sick leave. A qualitative methodology was chosen, and thematic, open-ended interviews were carried out with 16 women. The interviewees were strategically selected from a cohort of 300 women in full-time white-collar jobs in high-level positions, living in three urban areas in Sweden, and on long-term sick leave > or =90 days. A qualitative content analysis was carried out. The informants in the study were generally well educated, but a few had surprisingly little formal education considering their salary level and position on the labour market. The women were in professional positions more commonly held by men, either as specialists with some degree of managerial role or as executives with managerial responsibilities. Both external and internal stressors were identified. The analysis indicated that being in these gender-typed jobs could have induced sex discrimination and role conflicts. The women expressed strong agreement regarding success in working life, but emphasised the lack of competence matching in their present jobs. They also lacked the sense of having a rewarding job, saw leadership as weak, and disliked their present workplace and colleagues. Impaired health may have hindered them from changing jobs; conversely, their locked-in positions could have resulted in deterioration in their health status. The women displayed personal overcommitment, both at work and in private life, and had difficulties in setting limits. Factors in working life, as well as in private life, played an important role in the informants' deteriorated health and long-term sick leave. Job and workplace mismatching, problems in connection with company profitability
YAMAGUCHI Kazuo
2013-01-01
This article analyzes the determinants of sex difference in the proportion of managers among white-collar regular workers by using linked data of the employers and employees of Japanese firms obtained from the International Comparative Surveys on Work-Life Balance conducted by the Research Institute of Economy, Trade and Industry. First, the article shows that reasons for "having few or no female managers," such as women's job quit rate, given as responses by employer surveys conducted by the...
MacKay, K A; Tucker, A J; Duncan, A M; Graham, T E; Robinson, L E
2012-09-01
Epidemiological studies suggest whole grain consumption is associated with a reduced risk of cardiovascular disease (CVD), possibly through alterations in glucose metabolism and subsequent effects on plasminogen activator inhibitor (PAI)-1, a novel biomarker for CVD. Our aim was to investigate the effect of 6 wk of whole grain wheat sourdough bread consumption versus refined white bread on PAI-1. Normoglycemic/normoinsulinemic (NGI; n = 14; age 53 ± 6 y; BMI 26.5 ± 2.9 kg/m(2)) and hyperglycemic/hyperinsulinemic (HGI; n = 14; age 57 ± 7 y; BMI 35.7 ± 5.7 kg/m(2)) adults incorporated whole grain wheat sourdough (162.5 g) or white (168.8 g) bread into their diet, for 6 wk in a randomized crossover study. Pre- and post-intervention, fasting blood samples were analyzed for PAI-1 (primary outcome), as well as glucose, insulin and glucagon (secondary outcomes) at fasting and postprandially after an oral glucose tolerance test (OGTT). Anthropometric measures, fasting glucose, insulin, glucagon and PAI-1 antigen and activity were not different between treatments in either NGI or HGI adults. Glucose incremental area under the curve (iAUC) was lower (19%, P = 0.02) after 6 wk consumption of whole grain wheat sourdough bread compared to white bread in the HGI group, with no differences in insulin or glucagon iAUC in either group. Our data showed decreased glucose iAUC after an OGTT following 6 wk whole grain wheat bread consumption in adults with differing glycemic/insulinemic status, but no improvements in PAI-1 or fasting glycemic parameters. Copyright © 2010 Elsevier B.V. All rights reserved.
Komorowski, P A
2000-01-01
The localization of possible electrical faults in superconducting accelerator magnets may, in most cases, be a complex, expensive and time-consuming process. In particular, inter-turn short circuits and failures of the ground insulation are well detectable when the magnet is collared, but often disappear after disassembly for repair due to the release of the pre-stress in the coils. The fault localization method presented in this paper is based on the measurement and analysis of the magnetic field generated inside the magnet aperture by a high voltage pulse. The presence of the fault modifies the distribution of the current in the coils and produces a distortion of the magnetic field. The described method aims at locating both the longitudinal and azimuthal position of the fault-affected area. The test method, the transient case FEM models and the implemented experimental set-up are presented and discussed for the LHC dipole models.
FACTORS AFFECTING ROAD TRAFFIC NOISE ANNOYANCE AMONG WHITE-COLLAR EMPLOYEES WORKING IN TEHRAN
Directory of Open Access Journals (Sweden)
*1I. Alimohammadi, 2P. Nassiri, 3M. Azkhosh, 4M. Hoseini
2010-01-01
Full Text Available The effect of personal and attitudinal factors, noise level, hearing status and psychological traits on traffic-related noise annoyance among white-collar employees working in Tehran has been carefully analyzed. This survey has been conducted by interviewing 495 citizens working in non-manufacturing industries in Tehran, using questionnaires, Weinstein noise sensitivity scale, Beck’s depression, Buss and perry’s aggression, Zung’s anxiety, job satisfaction and Eysenc’s personality inventory. These citizens were office workers or store employees. Noise annoyance was determined both by numerical-based questionnaire criterion and by verbal index. Personal information, attitudinal factors and hearing conditions were determined using a general questionnaire. The amount of workplace noise the participants were exposed to was directly measured at their workplaces. It was revealed that among personal factors, age (p=0.030, marital status (p=0.004, residential period (p=0.001 and wealth (p=0.04 were related to noise annoyance. Attitudinal factors including sensitivity to noise (p=0.001, individual’s opinion on the need to control the noise (p=0.000 and individuals’ assessment of the amount of the workplace ambient noise (p= 0.000 were found to have relationship with noise annoyance. No meaningful relationship was seen between the equivalent noise level (p=0.879 and statistical noise level of L90 (p=0.909. The present study revealed that among all effective factors involved in noise annoyance, attitudinal factors had the most significant role in this regard.
Troyer, G L
2000-01-01
High pressure xenon ionization chamber detectors are possible alternatives to traditional thallium doped sodium iodide (NaI(Tl)) and hyperpure germanium as gamma spectrometers in certain applications. Xenon detectors incorporating a Frisch grid exhibit energy resolutions comparable to cadmium/zinc/telluride (CZT) (e.g. 2% (at) 662keV) but with far greater sensitive volumes. The Frisch grid reduces the position dependence of the anode pulse risetimes, but it also increases the detector vibration sensitivity, anode capacitance, voltage requirements and mechanical complexity. We have been investigating the possibility of eliminating the grid electrode in high-pressure xenon detectors and preserving the high energy resolution using electronic risetime compensation methods. A two-electrode cylindrical high pressure xenon gamma detector coupled to time-to-amplitude conversion electronics was used to characterize the pulse rise time of deposited gamma photons. Time discrimination was used to characterize the pulse r...
Maldonado, Karin; Bozinovic, Francisco; Rojas, José M; Sabat, Pablo
2011-01-01
The climatic variability hypothesis (CVH) states that species are geographically more widespread at higher latitudes because individuals have a broader range of physiological tolerance or phenotypic flexibility as latitude and climatic variability increase. However, it remains unclear to what extent climatic variability or latitude, acting on the phenotype, account for any observed geographical gradient in mean range size. In this study, we analyzed the physiological flexibility within the CVH framework by using an intraspecific population experimental approach. We tested for a positive relationship between digestive-tract flexibility (i.e., morphology and enzyme activities) and latitude and climatic and natural diet variability in populations of rufous-collared sparrows (Zonotrichia capensis) captured in desert (27°S), Mediterranean (33°S), and cold-temperate (41°S) sites in Chile. In accordance with the CVH, we observed a positive relationship between the magnitude of digestive-tract flexibility and environmental variability but not latitude. The greatest digestive flexibility was observed in birds at middle latitudes, which experience the most environmental variability (a Mediterranean climate), whereas individuals from the most stable climates (desert and cold-temperate) exhibited little or no digestive-tract flexibility in response to experimental diets. Our findings support the idea that latitudinal gradients in geographical ranges may be strongly affected by the action of regional features, which makes it difficult to find general patterns in the distribution of species.
Brock, Amanda R; Seto, Mabel; Smith-Bolton, Rachel K
2017-07-01
Regeneration is a complex process that requires an organism to recognize and repair tissue damage, as well as grow and pattern new tissue. Here, we describe a genetic screen to identify novel regulators of regeneration. We ablated the Drosophila melanogaster larval wing primordium by inducing apoptosis in a spatially and temporally controlled manner and allowed the tissue to regenerate and repattern. To identify genes that regulate regeneration, we carried out a dominant-modifier screen by assessing the amount and quality of regeneration in adult wings heterozygous for isogenic deficiencies. We have identified 31 regions on the right arm of the third chromosome that modify the regenerative response. Interestingly, we observed several distinct phenotypes: mutants that regenerated poorly, mutants that regenerated faster or better than wild-type, and mutants that regenerated imperfectly and had patterning defects. We mapped one deficiency region to cap-n-collar ( cnc ), the Drosophila Nrf2 ortholog, which is required for regeneration. Cnc regulates reactive oxygen species levels in the regenerating epithelium, and affects c-Jun N-terminal protein kinase (JNK) signaling, growth, debris localization, and pupariation timing. Here, we present the results of our screen and propose a model wherein Cnc regulates regeneration by maintaining an optimal level of reactive oxygen species to promote JNK signaling. Copyright © 2017 by the Genetics Society of America.
Nagaya, Teruo; Hibino, Minoru; Kondo, Yasuaki
2018-01-01
Headache in employees may be linked with both overwork and sleep restriction induced by long working hours. Inter-relationships among working hours, sleep duration and headache were investigated. Cross-sectional analyses for prevalent headache (n = 35,908) and 1-year follow-up analyses for incident headache (n = 19,788) were conducted in apparently healthy white-collar men aged 25-59 years. Headache (yes/no), working hours and sleep duration were based on self-administered questionnaire. After determination of relationships between working hours and sleep duration, logistic regression analysis estimated odds ratio (OR) and 95% confidence interval for prevalent and incident headache according to working hours (35-44, 45-49, 50-59 and ≥60 h/week) and sleep duration (≥7, 6-6.9, 5-5.9 and working hours and sleep duration on OR were checked. Covariates in the analyses were age, body mass index, drinking, smoking and exercise. Prevalent and incident headache was found in 1979 (5.5%) men and 707 (3.6%) men, respectively. Working hours were inversely associated with sleep duration. OR for prevalent and incident headache rose with increasing working hours and with reducing sleep duration, regardless of influences of the covariates. Working hours and sleep duration had no interactive effects on OR for prevalent or incident headache. The results indicate that long working hours directly and indirectly (via short sleep duration) induce headache even in apparently healthy white-collar men. Headache in employees may be useful for early detection of adverse health effects by long working hours.
A Novel Role of MerC in Methylmercury Transport and Phytoremediation of Methylmercury Contamination.
Sone, Yuka; Uraguchi, Shimpei; Takanezawa, Yasukazu; Nakamura, Ryosuke; Pan-Hou, Hidemitsu; Kiyono, Masako
2017-01-01
MerC, encoded by merC in the transposon Tn21 mer operon, is a heavy metal transporter with potential applications for phytoremediation of heavy metals such as mercuric ion and cadmium. In this study, we demonstrate that MerC also acts as a transporter for methylmercury. When MerC was expressed in Escherichia coli XL1-Blue, cells became hypersensitive to CH 3 Hg(I) and the uptake of CH 3 Hg(I) by these cells was higher than that by cells of the isogenic strain. Moreover, transgenic Arabidopsis plants expressing bacterial MerC or MerC fused to plant soluble N-ethylmaleimide-sensitive factor attachment protein receptors (SNAREs) accumulated CH 3 Hg(I) effectively and their growth was comparable to the wild-type plants. These results demonstrate that when the bacterium-derived merC gene is ectopically introduced in genetically modified plants, MerC expression in the transgenic plants promotes the transport and sequestration of methylmercury. Thus, our results show that the expression of merC in Arabidopsis results in transgenic plants that could be used for the phytoremediation and elimination of toxic methylmercury from the environment.
Chu, A H Y; Ng, S H X; Tan, C S; Win, A M; Koh, D; Müller-Riemenschneider, F
2016-05-01
Prolonged sedentary behaviour has been associated with various detrimental health risks. Workplace sitting is particularly important, providing it occupies majority of total daily sedentary behaviour among desk-based employees. The aim of this systematic review and meta-analysis was to examine the effectiveness of workplace interventions overall, and according to different intervention strategies (educational/behavioural, environmental and multi-component interventions) for reducing sitting among white-collar working adults. Articles published through December 2015 were identified in five online databases and manual searches. Twenty-six controlled intervention studies published between 2003 and 2015 of 4568 working adults were included. All 26 studies were presented qualitatively, and 21 studies with a control group without any intervention were included in the meta-analysis. The pooled intervention effect showed a significant workplace sitting reduction of -39.6 min/8-h workday (95% confidence interval [CI]: -51.7, -27.5), favouring the intervention group. Multi-component interventions reported the greatest workplace sitting reduction (-88.8 min/8-h workday; 95% CI: -132.7, -44.9), followed by environmental (-72.8 min/8-h workday; 95% CI: -104.9, -40.6) and educational/behavioural strategies -15.5 min/8-h workday (95% CI:-22.9,-8.2). Our study found consistent evidence for intervention effectiveness in reducing workplace sitting, particularly for multi-component and environmental strategies. Methodologically rigorous studies using standardized and objectively determined outcomes are warranted. © 2016 World Obesity. © 2016 World Obesity.
Damsgaard, Camilla T; Papadaki, Angeliki; Jensen, Signe M; Ritz, Christian; Dalskov, Stine-Mathilde; Hlavaty, Petr; Saris, Wim H M; Martinez, J Alfredo; Handjieva-Darlenska, Teodora; Andersen, Malene R; Stender, Steen; Larsen, Thomas M; Astrup, Arne; Mølgaard, Christian; Michaelsen, Kim F
2013-06-01
Dietary strategies to improve early cardiovascular markers in overweight children are needed. We investigated the effect of dietary protein and glycemic index (GI) on cardiovascular markers and metabolic syndrome (MetS) scores in 5- to 18-y-old children of overweight/obese parents from 8 European centers. Families were randomized to 1 of 5 diets consumed ad libitum: high protein (HP) or low protein (LP) combined with high GI (HGI) or low GI (LGI), or a control diet. At 6 centers, families received dietary instruction (instruction centers); at 2 centers, free foods were also provided (supermarket centers). Diet, anthropometry, blood pressure, and serum cardiovascular markers (lipid profile, glucose regulation, and inflammation) were measured in 253 children at baseline, 1 mo, and/or 6 mo. Protein intake was higher in the HP groups (19.9 ± 1.3% energy) than in the LP groups at 6 mo (16.8 ± 1.2% energy) (P = 0.001). The GI was 4.0 points lower (95% CI: 2.1, 6.1) in the LGI compared with the HGI groups (P pressure (P children, particularly in those undergoing most intensive intervention.
Metabolic response to different glycemic indexes of pre-exercise meal
Directory of Open Access Journals (Sweden)
Valéria Cristina de Faria
2015-08-01
Full Text Available INTRODUCTION: To ensure performance and health, the type of food and the time of pre-exercise ingestion should be considered by practitioners of morning physical activity. Objective: This study assessed the metabolic response after pre-exercise meals with different glycemic indexes (GI and in the fasting state adopting different types of hydration.METHODS: Twelve men performed four experimental tests; two with pre-exercise meals of high GI (HGI and low GI (LGI, and two were performed in the fasting state with hydration: water (H2O and carbohydrate drink (CHO. Each test consisted of a pre-exercise rest period of 30 minutes followed by 60 minutes of cycle ergometer with continuous load equivalent to 60% of the extrapolated maximal oxygen consumption (VO2MaxExt. During the exercise, participants were hydrated every 15 minutes with 3mL per kg body weight. During each experimental test, venous blood samples were obtained for fasting and at 15-minute intervals during rest, and every 20 minutes during exercise. The gas analysis was carried out in periods of 5 minutes every 20 minutes of exercise.RESULTS: There was no difference in substrate oxidation. After 20 minutes of exercise, pre-exercise food intake procedures showed similar behavior, having only reduced blood glucose levels compared to fasting procedures (p<0.01. There was maintenance of blood glucose at stable and higher levels during exercise in relation to the other tests in the fast procedure with CHO.CONCLUSION: The data suggest that despite the similar metabolic behavior between LGI and HGI meals, the adoption of a LGI meal before the morning exercise seems to be a more suitable feeding practice due to higher tendency of rebound hypoglycemia after HGI meal and when morning exercise is performed on fasting, hydration with CHO seems to minimize the hypoglycemic risk arising from that state.
Hartvig Frisch og "Pest over Europa"
DEFF Research Database (Denmark)
Fledelius, Karsten
2013-01-01
Vil populistiske bevægelser i dagens Europa udhule demokratiet og skabe stater med en formel retsorden, som bliver vendt mod syndebukke og udnyttes til diskrimination af etniske, sociale og religiøse mindretal – som i 1930erne?...
International Nuclear Information System (INIS)
Garg, Lalit; Jain, Neeraj; Agrawal, Sachin; Chauhan, Udit; Goel, Vandana; Puri, Sunil Kumar
2016-01-01
Delayed presentation of post-traumatic aortic pseudoaneurysm and its fistulous communication with the right renal vein is a very rare entity. Most of the cases described in literature are due to abdominal aortic aneurysm (AAA) rupture into the left renal vein. To the best of our knowledge, communication with the right renal vein has not been described in published literature. Our patient also had a circumaortic renal collar, which is a rare renal vein anomaly. Aortic pseudoaneurysm, its fistulous communication with the right renal vein and circumaortic renal collar in a single patient is of extremely rare occurrence. A 29-year-old male presented to the cardiology department with complaints of breathlessness, abdominal pain and hematuria for the last 6 months. On clinical examination there was evidence of audible bruit over the abdomen. He had a past history of a gunshot injury around two years back. CT angiography revealed a large partially calcified pseudoaneurysm arising from the right lateral wall of the abdominal aorta with the neck of the pseudoaneurysm at juxtarenal location with a fistula between the anterior wall of the pseudoaneurysm and the posterior wall of the right renal vein. There was an associated incidental finding of circumaortic left renal vein with gross aneurysmal dilatation of both pre- and retro-aortic part of the renal vein. Delayed presentation of aortic pseudoaneurysm with its fistulous communication with the right renal vein is a rare entity. CT angiography is a non-invasive modality for diagnosis of the exact site of communication, length of aneurysm, proximal and distal extent of the affected segment and its relationship with surrounding structures
Directory of Open Access Journals (Sweden)
Mingfeng Wang
2013-01-01
Full Text Available Rhizoma coptidis, the root of Coptis chinensis Franch, has been used in China as a folk medicine in the treatment of diabetes for thousands of years. Berberine, one of the active ingredients of Rhizoma coptidis, has been reported to improve symptoms of diabetes and to treat experimental cardiac hypertrophy, respectively. The objective of this study was to evaluate the potential effect of berberine on cardiomyocyte hypertrophy in diabetes and its possible influence on peroxisome proliferator-activated receptor-α (PPARα/nitric oxide (NO signaling pathway. The cardiomyocyte hypertrophy induced by high glucose (25.5 mmol/L and insulin (0.1 μmol/L (HGI was characterized in rat primary cardiomyocyte by measuring the cell surface area, protein content, and atrial natriuretic factor mRNA expression level. Protein and mRNA expression were measured by western blot and real-time RT-PCR, respectively. The enzymatic activity of NO synthase (NOS was measured using a spectrophotometric assay, and NO concentration was measured using the Griess assay. HGI significantly induced cardiomyocyte hypertrophy and decreased the expression of PPARα and endothelial NOS at the mRNA and protein levels, which occurred in parallel with declining NOS activity and NO concentration. The effect of HGI was inhibited by berberine (0.1 to 100 μmol/L, fenofibrate (0.3 μmol/L, or L-arginine (100 μmol/L. MK886 (0.3 μmol/L, a selective PPARα antagonist, could abolish the effects of berberine and fenofibrate. NG-nitro-L-arginine-methyl ester (100 μmol/L, a NOS inhibitor, could block the effects of L-arginine, but only partially blocked the effects of berberine. These results suggest that berberine can blunt HGI-induced cardiomyocyte hypertrophy in vitro, through the activation of the PPARα/NO signaling pathway.
Energy Technology Data Exchange (ETDEWEB)
Wright, Catherine S.; Berends, Rebecca F. [Department of Life Sciences, School of Health and Life Sciences, Glasgow Caledonian University, 70 Cowcaddens Road, Glasgow G4 0BA (United Kingdom); Flint, David J. [Strathclyde Institute of Pharmacy and Biomedical Sciences, University of Strathclyde, 161 Cathedral Street, Glasgow G4 0RE (United Kingdom); Martin, Patricia E.M., E-mail: Patricia.Martin@gcu.ac.uk [Department of Life Sciences, School of Health and Life Sciences, Glasgow Caledonian University, 70 Cowcaddens Road, Glasgow G4 0BA (United Kingdom)
2013-02-15
Reducing Cx43 expression stimulates skin wound healing. This is mimicked in models when Cx43 function is blocked by the connexin mimetic peptide Gap27. IGF-I also stimulates wound healing with IGFBP-5 attenuating its actions. Further, the IGF-I to IGFBP-5 ratio is altered in diabetic skin, where wound closure is impaired. We investigated whether Gap27 remains effective in augmenting scrape-wound closure in human skin wound models simulating diabetes-induced changes, using culture conditions with raised glucose, insulin and IGFBP-5. Gap27 increased scrape-wound closure in normal glucose and insulin (NGI) and to a lesser extent in high glucose and insulin (HGI). IGF-I enhanced scrape-wound closure in keratinocytes whereas IGFBP-5 inhibited this response. Gap27 overcame the inhibitory effects of IGFBP-5 on IGF-I activity. Connexin-mediated communication (CMC) was reduced in HGI, despite raised Cx43, and Gap27 significantly decreased CMC in NGI and HGI. IGF-I and IGFBP-5 did not affect CMC. IGF-I increased keratinocyte proliferation in NGI, and Gap27 increased proliferation in NGI to a greater extent than in HGI. We conclude that IGF-I and Gap27 stimulate scrape-wound closure by independent mechanisms with Gap27 inhibiting Cx43 function. Gap27 can enhance wound closure in diabetic conditions, irrespective of the IGF-I:IGFBP-5 balance. - Highlights: ► Human organotypic and keratinocyte ‘diabetic’ skin models were used to demonstrate the ability of Gap27 to improve scrape-wound closure. ► Gap27 enhanced scrape-wound closure by reducing Cx43-mediated communication, whereas IGFBP-5 retarded cell migration. ► IGF-I and IGFBP-5 did not affect connexin-mediated pathways. ► Gap27 can override altered glucose, insulin, IGF-I, and IGFBP-5 in ‘diabetic’ skin models and thus has therapeutic potential.
Hagihara, A; Tarumi, K; Nobutomo, K
2000-04-01
Although previous studies have examined the buffering effects of social support and coping style on the relationship between stress and alcohol consumption, they have typically relied on analysis of variance (ANOVA) or regression analysis. In addition, few studies have examined the potential stress-buffering effects of drinking with coworkers after work on the relationship between job stress and job dissatisfaction. In the present study, using a signal detection analysis, we evaluated the interactions of drinking with coworkers after work and work-stressor variables among Japanese white-collar workers (n = 397) in 1997. The analysis was performed for two groups of subjects divided based on their status in the company. This was necessary because in Japan the obligations to drink socially increase with one's rising status in the company. In both the "staff members and lower-level managers" and "middle-level and higher-level managers' groups, an interaction between work-stressor variables and drinking variables was observed. The findings imply that drinking with coworkers after work ameliorated the sense of job dissatisfaction, but only among those subjects who already had lower levels of work stressors. For subjects with high levels of work stressors, attitudes toward drinking with coworkers were unrelated to job satisfaction levels.
Fabrication of radiation detectors with HgI2 crystals grown from a solution
International Nuclear Information System (INIS)
Friant, Alain; Mellet, Jean; Saliou, Charles; Mohammed Brahim, Tayeb.
1979-01-01
Mercuric Iodide crystals grown from a solution of molecular complexes with dimethylsulfoxide have been evaluated as γ-ray and X-ray room temperature detectors. Compared with materials grown from the vapor phase these crystals are characterized by a larger size, a lower level of native defects, but a higher impurity level. Detector technology, X-ray and γ-ray (up to 662 keV) detection properties and characterization measurements (T.S.C., photoconductivity, photovoltaic effect) are described. The effect of light on crystal properties is briefly discussed [fr
Directory of Open Access Journals (Sweden)
Voillemot Marie
2012-08-01
Full Text Available Abstract Background Evidence is accumulating that telomere length is a good predictor of life expectancy, especially early in life, thus calling for determining the factors that affect telomere length at this stage. Here, we investigated the relative influence of early growth conditions and origin (genetics and early maternal effects on telomere length of collared flycatchers (Ficedula albicollis at fledging. We experimentally transferred hatchlings among brood triplets to create reduced, control (i.e. unchanged final nestling number and enlarged broods. Results Although our treatment significantly affected body mass at fledging, we found no evidence that increased sibling competition affected nestling tarsus length and telomere length. However, mixed models showed that brood triplets explained a significant part of the variance in body mass (18% and telomere length (19%, but not tarsus length (13%, emphasizing that unmanipulated early environmental factors influenced telomere length. These models also revealed low, but significant, heritability of telomere length (h2 = 0.09. For comparison, the heritability of nestling body mass and tarsus length was 0.36 and 0.39, respectively, which was in the range of previously published estimates for those two traits in this species. Conclusion Those findings in a wild bird population demonstrate that telomere length at the end of the growth period is weakly, but significantly, determined by genetic and/or maternal factors taking place before hatching. However, we found no evidence that the brood size manipulation experiment, and by extension the early growth conditions, influenced nestling telomere length. The weak heritability of telomere length suggests a close association with fitness in natural populations.
Directory of Open Access Journals (Sweden)
Horak Ivan G
2012-04-01
Full Text Available Abstract Background Two studies evaluating the efficacy of an imidacloprid/flumethrin collar (Seresto®, Bayer Animal Health, IVP, a deltamethrin collar (Scalibor®, MSD, CP1, a fipronil/(s-methoprene spot-on (Frontline Combo®, Merial, CP2, a dinotefuran/pyriproxyfen/permethrin spot-on (Vectra 3D®, Ceva, CP3 and an amitraz/fipronil/(s-methoprene spot-on (Certifect®, Merial, CP4/CP5 against repeated infestations with Rhipicephalus sanguineus and Ctenocephalides felis felis on dogs were conducted over periods of 226 days and 71 days respectively. Methods The first study comprised 4 groups of treated dogs and one untreated control group, and the second 3 groups of treated dogs and one control group. Each group consisted of 8 dogs. All dogs were infested with ticks and fleas at regular intervals. Ticks were counted 6 h, 18 h or 48 h after infestations and fleas 24 h after infestations. Efficacies of the treatments were calculated by comparison with the untreated control groups using standard descriptive statistics. Results The protective 48 h tick efficacy was 97.8% to 100% for the IVP (226 days, 69.3% to 97.4% for CP1 (170 days, 99.6% to 43.4% for CP2 (35 days and 98% to 61.4% for CP3 (35 days. The protective 18 h tick efficacy was 98% to 99.6% for the IVP (71 days, 100% to 86.5% for CP4 (29 days, 100% to 72.8% for CP4 after re-treatment (35 days and 98.8% to 54.3% for CP5 (35 days. The protective 6 h tick efficacy was 85.6% at Day 7 and 90.1% to 97.1% from Day 14 onwards for the IVP (70 days, 92.3% to 70.7% for CP4 (35 days, 97.5% to 65.2% for CP4 after re-treatment (35 days and 95.1% to 51.8% for CP5 (35 days. The protective 24 h flea efficacy was 99.5/90.9% to 100% for the IVP (71/226 days, 66.7% to 83% for CP1 (170 days, 100% to 88.5% for CP2 (35 days, 100% to 73.3% for CP3 (35 days, 100% to 98.7% for CP4 (35 days, 100% to 87.5% for CP4 after re-treatment (35 days and 100% to 79.5% for
Birn, J.; Hones, E. W., Jr.; Craven, J. D.; Frank, L. A.; Elphinstone, R. D.; Stern, D. P.
1991-01-01
The boundary between open and closed field lines is investigated in the empirical Tsyganenko (1987) magnetic field model. All field lines extending to distances beyond -70 R(E), the tailward velocity limit of the Tsyganenko model are defined as open, while all other field lines, which cross the equatorial plane earthward of -70 R(E) and are connected with the earth at both ends, are assumed closed. It is found that this boundary at the surface of the earth, identified as the polar cap boundary, can exhibit the arrowhead shape, pointed toward the sun, which is found in horse collar auroras. For increasing activity levels, the polar cap increases in area and becomes rounder, so that the arrowhead shape is less pronounced. The presence of a net B(y) component can also lead to considerable rounding of the open flux region. The arrowhead shape is found to be closely associated with the increase of B(z) from the midnight region to the flanks of the tail, consistent with a similar increase of the plasma sheet thickness.
Directory of Open Access Journals (Sweden)
Yung-Sheng Lin
2015-09-01
Full Text Available The purpose of this study is to assess the beneficial effects of a far-infrared-emitting collar (FIRC on the management of neck disorders. A neck disorder is generalized as neck muscle pain and its relative mental disorders because the etiologies of the neck’s multidimensional syndrome are either muscle impairment or psychiatric distress. This is the first study to determine the efficacy of a FIRC by evaluating objective physical evidence and psychometric self-reports using a parallel-arm randomized sham-controlled and single-blinded design. In this trial, 60 participants with neck disorders were observed at baseline and post-intervention. Compared to the placebo group after a 30-min intervention, the FIRC demonstrated a statistically significant biological effect in elevating skin temperature and promoting blood circulation with p-values 0.003 and 0.020, respectively. In addition, FIRC application significantly reduced neck muscle tension, relieved pain, ameliorated fatigue, improved depression, and decreased anxiety. The FIRC could therefore be a potential treatment for neck disorders.
Neutron detection with cryogenics and semiconductors
International Nuclear Information System (INIS)
Bell, Zane W.; Carpenter, D.A.; Cristy, S.S.; Lamberti, V.E.; Burger, Arnold; Woodfield, Brian F.; Niedermayr, Thomas; Dragos Hau, I.; Labov, Simon E.; Friedrich, Stephan; Geoffrey West, W.; Pohl, Kenneth R.; Berg, Lodewijk van den
2005-01-01
The common methods of neutron detection are reviewed with special attention paid to the application of cryogenics and semiconductors to the problem. The authors' work with LiF- and boron-based cryogenic instruments is described as well as the use of CdTe and HgI 2 for direct detection of neutrons. (copyright 2005 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)
Ndjaboue, Ruth; Brisson, Chantal; Talbot, Denis; Vézina, Michel
2017-03-01
Prospective studies which evaluated whether the effects of chronic exposure to psychosocial work factors on mental health persisted over time are scarce. For the first time, this study evaluated: 1) the effect of chronic exposure to effort-reward imbalance over 5years on the prevalence of high psychological distress among men and women, and 2) the persistence of this effect over time. Overall, 1747 white-collar workers from three public organizations participated in a prospective study. Psychological distress and effort-reward imbalance were measured using validated questionnaires at baseline, and at 3- and 5-year follow-ups. Prevalence ratios (PRs) of high psychological distress were estimated using log-binomial regression according to baseline and repeated exposure. Compared to unexposed workers, those with repeated exposure to effort-reward imbalance had a higher prevalence of high psychological distress. Workers exposed only at some time-points also had a higher prevalence. The deleterious effect of repeated exposure observed at the 3-year follow-up persisted at the 5-year follow-up among women (PR=2.48 95% confidence interval (CI) 1.97-3.11) and men (PR=1.91 95% CI 1.20-3.04). These effects were greater than those found using a single baseline measurement. The current study supported a deleterious effect of repeated exposure to effort-reward imbalance on psychological distress, and a lack of adaptation to these effects over time among men and women. Since psychological distress may later lead to severe mental problems, current results highlight the need to consider exposure to these adverse work factors in primary and secondary preventions aimed at reducing mental health problems at work. Copyright © 2017 Elsevier Inc. All rights reserved.
Mercury monohalides: suitability for electron electric dipole moment searches.
Prasannaa, V S; Vutha, A C; Abe, M; Das, B P
2015-05-08
Heavy polar diatomic molecules are the primary tools for searching for the T-violating permanent electric dipole moment of the electron (eEDM). Valence electrons in some molecules experience extremely large effective electric fields due to relativistic interactions. These large effective electric fields are crucial to the success of polar-molecule-based eEDM search experiments. Here we report on the results of relativistic ab initio calculations of the effective electric fields in a series of molecules that are highly sensitive to an eEDM, the mercury monohalides (HgF, HgCl, HgBr, and HgI). We study the influence of the halide anions on E_{eff}, and identify HgBr and HgI as attractive candidates for future electric dipole moment search experiments.
Ndjaboué, R; Brisson, C; Vézina, M; Blanchette, C; Bourbonnais, R
2014-01-01
Little is known about the effects of psychosocial work factors on objectively assessed mental health problems leading to medically certified absence. Only one study has evaluated the prospective effects of effort-reward imbalance (ERI) at work with regards to this outcome. The present study aimed to evaluate the effects of ERI on the incidence of medically certified absence for mental health problems. The study included 2086 white-collar workers (63.3% women) employed in public organisations in Quebec city. Participants were followed over a 9-year period. Medical absences from work were collected from employers' files and psychosocial factors were measured using the ERI questionnaire. Cox regression models were used to estimate the incidence of certified sickness absence due to mental health problems that lasted 5 workdays or more, while controlling for confounders. Workers exposed to ERI had a higher risk of a first spell of medically certified absence for mental health problems (HR=1.38, 95% CI 1.08 to 1.76) compared with unexposed workers. Low reward was significantly associated with a high risk among men (HR=2.80, 95% CI 1.34 to 5.89) but not in women. (HR=1.24, 95% CI 0.90 to 1.73). Effort at work had no effect on certified absence. All these effects were adjusted for potential confounders. ERI and low reward at work were prospectively associated with medically certified absence for mental health problems. These effects seem to differ by gender. Primary prevention that is aimed at reducing these stressors should be considered to help reduce the incidence of such severe mental health problems.
Natural selection and inheritance of breeding time and clutch size in the collared flycatcher.
Sheldon, B C; Kruuk, L E B; Merilä, J
2003-02-01
Many characteristics of organisms in free-living populations appear to be under directional selection, possess additive genetic variance, and yet show no evolutionary response to selection. Avian breeding time and clutch size are often-cited examples of such characters. We report analyses of inheritance of, and selection on, these traits in a long-term study of a wild population of the collared flycatcher Ficedula albicollis. We used mixed model analysis with REML estimation ("animal models") to make full use of the information in complex multigenerational pedigrees. Heritability of laying date, but not clutch size, was lower than that estimated previously using parent-offspring regressions, although for both traits there was evidence of substantial additive genetic variance (h2 = 0.19 and 0.29, respectively). Laying date and clutch size were negatively genetically correlated (rA = -0.41 +/- 0.09), implying that selection on one of the traits would cause a correlated response in the other, but there was little evidence to suggest that evolution of either trait would be constrained by correlations with other phenotypic characters. Analysis of selection on these traits in females revealed consistent strong directional fecundity selection for earlier breeding at the level of the phenotype (beta = -0.28 +/- 0.03), but little evidence for stabilising selection on breeding time. We found no evidence that clutch size was independently under selection. Analysis of fecundity selection on breeding values for laying date, estimated from an animal model, indicated that selection acts directly on additive genetic variance underlying breeding time (beta = -0.20 +/- 0.04), but not on clutch size (beta = 0.03 +/- 0.05). In contrast, selection on laying date via adult female survival fluctuated in sign between years, and was opposite in sign for selection on phenotypes (negative) and breeding values (positive). Our data thus suggest that any evolutionary response to selection on
Time-Series Measurements of Atmospheric and Oceanic CO2 and O2 in the Western Gulf of Maine
2008-09-01
is 2 meters in diameter and 3.5 m tall with a Surlyn foam flotation collar (Gilman Corporation). The Surlyn foam was cut with two chines so that...the flotation in the lightweight foam, the buoy with full 978-1-4244-2620-1/08/$25.00 ©2008 IEEE Report Documentation Page Form ApprovedOMB No. 0704...deployments, necessitating routine servicing (buoy pulled on deck in good weather and cleaned) (Figure 8). Modifications to a 90/10 copper -nickel
Gupta, Nidhi; Heiden, Marina; Aadahl, Mette; Korsh?j, Mette; J?rgensen, Marie Birk; Holtermann, Andreas
2016-01-01
INTRODUCTION: The aim of the study was to investigate if (a) substituting total sedentary time or long sedentary bouts with standing or various types of physical activity and (b) substituting long sedentary bouts with brief sedentary bouts; is associated with obesity indicators using a cross sectional isotemporal substitution approach among blue-collar workers.METHODS: A total of 692 workers from transportation, manufacturing and cleaning sectors wore an Actigraph GT3X+ accelerometer on the t...
International Nuclear Information System (INIS)
TROYER, G.L.
2000-01-01
High pressure xenon ionization chamber detectors are possible alternatives to traditional thallium doped sodium iodide (NaI(Tl)) and hyperpure germanium as gamma spectrometers in certain applications. Xenon detectors incorporating a Frisch grid exhibit energy resolutions comparable to cadmium/zinc/telluride (CZT) (e.g. 2% (at) 662keV) but with far greater sensitive volumes. The Frisch grid reduces the position dependence of the anode pulse risetimes, but it also increases the detector vibration sensitivity, anode capacitance, voltage requirements and mechanical complexity. We have been investigating the possibility of eliminating the grid electrode in high-pressure xenon detectors and preserving the high energy resolution using electronic risetime compensation methods. A two-electrode cylindrical high pressure xenon gamma detector coupled to time-to-amplitude conversion electronics was used to characterize the pulse rise time of deposited gamma photons. Time discrimination was used to characterize the pulse rise time versus photo peak position and resolution. These data were collected to investigate the effect of pulse rise time compensation on resolution and efficiency
Spectral response of THM grown CdZnTe crystals
DEFF Research Database (Denmark)
Chen, H.; Awadalla, S.A.; Harris, F.
2008-01-01
The spectral response of several crystals grown by the Traveling Heater Method (THM) were investigated. An energy resolution of 0.98% for a Pseudo Frisch-Grid of 4 × 4 × 9 mm3 and 2.1% FWHM for a coplanar-grid of size 11 × 11 × 5 mm3 were measured using 137Cs-662 keV. In addition a 4% FWHM at 122...
Study of the sorption of Tin on human Teeth using the radioactive Tracer Technique
International Nuclear Information System (INIS)
Alian, G.; Helal, A.
1997-01-01
Dental amalgam is prepared from an amalgam alloy and mercury. For a low-copper amalgam alloy the reaction, thereby involved, is as follows (1). Ag 3 Sn(gamma) + Hg(I) → Ag 2 Hg 3 (gamma 1) + Sn 7.8 Hg (Gamma 2) + Ag 3 Sn(gamma) Unreacted excess for an admixed high-copper alloy the amalgamation reaction can be presented as follows Ag 3 Sn(gamma) + Ag-Cu (eutectic) + Hg(I) → Ag 2 Hg 3(gamma 1) + Sn-7.8 Hg (gamma 2) + Ag 3 Sn(gamma) unreacted + Ag-Cu (eutectic) unreacted and later Sn 7.8 Hg(gamma 2) + Ag-Cu (eutectic) → Cu 6 Sn 5 (eta) + Ag 2 Hg 3 (gamma 1) The destructive attack of the amalgam in the oral environment through chemical or electrochemical reaction (corrosion) gives rise to various ionic species of the amalgam components. The various phases of an amalgam have different corrosion potentials because of their different chemical compositions. Thus electrochemical measurements on pure phases have shown that the Ag 2 Hg 3 phase (gamma) has highest corrosion resistance, followed by the Ag 3 Sn, Ag 3 Cu 2 , Cu 3 Sn, Cu 6 Sn 5 and the Sn 708 Hg phase (Gamma 2 ). However, this behaviour for the pure phases is changed to some extent in the dental amalgam. Usually neither the gamma nor the gamma 1 phase is corroded as easily as the gamma 2 phase
Sohn, Woon-Mok; Yong, Tai-Soon; Eom, Keeseon S; Sinuon, Muth; Jeoung, Hoo-Gn; Chai, Jong-Yil
2017-06-01
The metacercariae of Artyfechinostomum malayanum (Leiper, 1911) Mendheim, 1943 were discovered in Pila sp. snails purchased from a market in Phnom Penh, Cambodia. They were isolated from the snails using the artificial digestion technique and were orally fed to 2 hamsters, 1 rat, and 2 mice to obtain the adult flukes. The metacercariae were round, 145-165 μm in diameter, having a cyst wall of 6-10 μm in thickness, a head collar and collar spines, and characteristic features of excretory granules. Adult flukes were recovered in the small intestines of the animals at days 14 and 32 post infection and were morphologically observed using a light microscope and a scanning electron microscope. They were plump or elongated, ventrally curved, 6.0-8.1 × 1.6-2.0 mm in size, and characterized by the head collar bearing 43 collar spines, including 5 end group ones on each side, a long cirrus sac extending beyond the posterior margin of the ventral sucker, a submedian ovary, and 2 deeply lobed testes. Eggs in uteri were operculate, ovoid to ellipsoid, and 120-135 × 68-75 μm in size. In scanning electron microscopy, the head collar was prominent with collar spines looking like horns. Scale-like tegumental spines were densely distributed on the ventral surface between the head collar and ventral sucker. Sensory papillae were distributed mainly on the tegument around suckers. By this study, it has been first confirmed that the life cycle of A. malayanum exists in Cambodia.
Uchida, Mitsuo; Morita, Hiroshi
2018-06-01
Although long work hours have been associated with various physical health problems, studies of their association with mental health have yielded inconsistent results, due to differences in study settings, study outcome and/or unmeasured background factors. In this study, we used a propensity score method to evaluate the association between work hours and depressive state. A total of 467 Japanese white-collar workers were surveyed and divided into long and regular work hour groups according to overtime work records. Propensity score matching was performed based on 32 individual background and workplace factors, yielding 74 pairs of propensity-matched subjects. CES-D score, an indicator of depressive state, did not differ significantly among the two groups (p=0.203). However, work motivation, work control, social support and emotional stability correlated with CES-D score. These findings suggest that work control and social support factors are more associated with depressive state than control of work hours. These results also suggest that it is possible to use propensity score matching to evaluate the association between work hours and mental health in occupational study settings. Further studies, in larger populations, are required to determine the association between work hours and mental health parameters.
Krist, Milos
2009-09-01
1. Despite the central importance for life-history theory, egg-size effects on offspring fitness are still considered ambiguous. Most previous studies were only observational and consequently might suffer from uncontrolled correlations between egg size and parental/territory quality. Even after cross-fostering is performed, direct genetic effects and parental adjustment of post-natal care might confound our estimates of egg-size effects per se. 2. I performed a full cross-fostering experiment in the collared flycatcher (Ficedula albicollis) exchanging the whole clutches between pairs of nests. I statistically controlled for direct genetic effects and parental feeding frequencies. I followed young until recruitment to estimate the long-term effects of egg size and parental provisioning. In addition, I compared the effects obtained in the cross-fostering experiment with those obtained from a set of unmanipulated nests. 3. Egg size per se affected offspring morphology in both the short and long term, while having no effect on offspring survival and immunity. Egg-size effects were not confounded by parental post-natal care and direct genetic effects. 4. The number of care-givers was an influential predictor of nestling performance. Apart from the variation caused by this factor, feeding frequencies had no consistent effect on offspring performance. 5. Fitness benefits of large eggs may be difficult to establish due to variation of egg-size effects between years and habitats. Feeding frequency may affect offspring state but offspring state may also affect feeding frequency. Varying causality between feeding rate and offspring state may preclude the detection of a positive effect of the former on the latter.
Trudel, Xavier; Milot, Alain; Gilbert-Ouimet, Mahée; Duchaine, Caroline; Guénette, Line; Dalens, Violaine; Brisson, Chantal
2017-08-15
We examined the association between effort-reward imbalance (ERI) exposure at work and unsuccessfully treated hypertension among white-collar workers from a large cohort in Quebec City, Canada. The study used a repeated cross-sectional design involving 3 waves of data collection (2000-2009). The study sample was composed of 474 workers treated for hypertension, accounting for 739 observations. At each observation, ERI was measured using validated scales, and ambulatory blood pressure (BP) was measured every 15 minutes during the working day. Unsuccessfully treated hypertension was defined as daytime ambulatory BP of at least 135/85 mm Hg and was further divided into masked and sustained hypertension. Adjusted prevalence ratios and 95% confidence intervals were estimated. Participants in the highest tertile of ERI exposure had a higher prevalence of unsuccessfully treated hypertension (prevalence ratio = 1.45, 95% confidence interval: 1.16, 1.81) after adjustment for gender, age, education, family history of cardiovascular diseases, body mass index, diabetes, smoking, sedentary behaviors, and alcohol intake. The present study supports the effect of adverse psychosocial work factors from the ERI model on BP control in treated workers. Reducing these frequent exposures at work might lead to substantial benefits on BP control at the population level. © The Author(s) 2017. Published by Oxford University Press on behalf of the Johns Hopkins Bloomberg School of Public Health. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Directory of Open Access Journals (Sweden)
Nidhi Gupta
2016-02-01
Full Text Available Abstract Background Little is known about associations of temporal patterns of sitting (i.e., distribution of sitting across time with obesity. We aimed investigating the association between temporal patterns of sitting (long, moderate and brief uninterrupted bouts and obesity indicators (body mass index (BMI, waist circumference and fat percentage, independently from moderate-vigorous physical activity (MVPA and total sitting time among blue-collar workers. Methods Workers (n = 205 wore Actigraph GT3X+ accelerometers on the thigh and trunk for 1–4 working days. Using the validated Acti4 software, the total sitting time and time spent sitting in brief (≤5 mins, moderate (>5 and ≤30 mins, and long (>30mins bouts on working days were determined for the whole day, and for leisure and work separately. BMI (kg/m2, waist circumference (cm and fat percentage were objectively measured. Results Results of linear regression analysis adjusted for multiple confounders indicated that brief bouts of sitting was negatively associated with obesity for the whole day (BMI, P < 0.01; fat percentage, P < 0.01; waist circumference, P < 0.01 and work (BMI, P < 0.01; fat percentage, P < 0.01; waist circumference, P < 0.01, but not for leisure. Sitting time in long bouts was positively associated with obesity indicators for the whole day (waist circumference, P = 0.05 and work (waist circumference, P = 0.01; BMI, P = 0.04, but not leisure. Conclusions For the whole day as well as for work, brief bouts and long bouts of sitting showed opposite associations with obesity even after adjusting for MVPA and total sitting time, while sitting during leisure did not show these associations. Thus, the temporal distribution of sitting seems to influence the relationship between sitting and obesity.
Practical application of HgI2 detectors to a space-flight scanning electron microscope
Bradley, J. G.; Conley, J. M.; Albee, A. L.; Iwanczyk, J. S.; Dabrowski, A. J.
1989-01-01
Mercuric iodide X-ray detectors have been undergoing tests in a prototype scanning electron microscope system being developed for unmanned space flight. The detector program addresses the issues of geometric configuration in the SEM, compact packaging that includes separate thermoelectric coolers for the detector and FET, X-ray transparent hermetic encapsulation and electrical contacts, and a clean vacuum environment.
International Nuclear Information System (INIS)
Kaufman, L.; Hosier, K.E. Jr.
1979-01-01
The CdTe detector or a plate with several CdTe or HgI 2 detectors is suitable for use in computer controlled tomographic X-ray scanners. The detector is used in connection with a pulsed radiation source (Am 241) and a frequency filter technique for measuring the resulting electrical charge pulse of the detector. Merely a narrow frequency band is selected according to the measured duration of the incident radiation pulses. (DG) [de
Reviriego, Jesús; Vázquez, Luis Alberto; Goday, Albert; Cabrera, Martha; García-Margallo, María Teresa; Calvo, Eva
2016-04-01
To report the prevalence of impaired fasting glucose (IFG), undiagnosed and diagnosed diabetes, and their association to occupational categories in a representative sample of working population in Spain. A cross-sectional study of workers who attended routine medical check-ups from January 2007 to December 2007. A structured questionnaire was completed, and physical examinations and routine serum biochemical tests were performed. IFG was defined as fasting glucose levels ranging from 100 to 125 mg/dl with no diagnosis of T1DM or T2DM; T1DM was defined as previous diagnosis of T1DM; and T2DM as previous diagnosis of T2DM, treatment with oral antidiabetic drugs or insulin or fasting glucose levels ≥126 mg/dl, according to ADA criteria. Of the 371,997 participants (median age 35 [interquartile range 29-44] years), 72.4% were male. Raw prevalence rates (95% CI) of IFG, undiagnosed (UKDM), and previously known type 2 (KDM2) and type 1 (KDM1) diabetes were 10.4% (10.3-10.5%), 1.3% (1.2-1.3%), 1.1% (1.1-1.2%), and 0.3% (0.3-0.3%), respectively. With the exception of KDM1, prevalence of these conditions increased with age and was greater among manual/blue-collar workers (12.1%, 1.5%, 1.3% and 0.3%, respectively) as compared to non-manual/white-collar workers (7.3%, 0.8%, 0.8% and 0.3%, respectively). Age- and sex-adjusted prevalence rates of IFG, UKDM and KDM2 were 13.1%, 2.0% and 2.4%, respectively. In this sample of Spanish working population, impaired glycemic profiles were common. Prevalence rates of IFG and T2DM were high among blue-collar workers (except for T1DM). These data emphasize the need for earlier structured preventive schemes. Copyright © 2016 SEEN. Published by Elsevier España, S.L.U. All rights reserved.
Uthoff, Heiko; Peña, Constantino; West, James; Contreras, Francisco; Benenati, James F; Katzen, Barry T
2013-04-01
Radiation exposure to interventionalists is increasing. The currently available standard radiation protection devices are heavy and do not protect the head of the operator. The aim of this study was to evaluate the effectiveness and comfort of caps and thyroid collars made of a disposable, light-weight, lead-free material (XPF) for occupational radiation protection in a clinical setting. Up to two interventional operators were randomized to wear a XPF or standard 0.5-mm lead-equivalent thyroid collars in 60 consecutive endovascular procedures requiring fluoroscopy. Simultaneously a XPF cap was worn by all operators. Radiation doses were measured using dosimeters placed outside and underneath the caps and thyroid collars. Wearing comfort was assessed at the end of each procedure on a visual analog scale (0-100 [100 = optimal]). Patient and procedure data did not differ between the XPF and standard protection groups. The cumulative radiation dose measured outside the cap was 15,700 μSv and outside the thyroid collars 21,240 μSv. Measured radiation attenuation provided by the XPF caps (n = 70), XPF thyroid collars (n = 40), and standard thyroid collars (n = 38) was 85.4% ± 25.6%, 79.7% ± 25.8% and 71.9% ± 34.2%, respectively (mean difference XPF vs standard thyroid collars, 7.8% [95% CI, -5.9% to 21.6%]; p = 0.258). The median XPF cap weight was 144 g (interquartile range, 128-170 g), and the XPF thyroid collars were 27% lighter than the standard thyroid collars (p disposable caps and thyroid collars made of XPF were assessed as being comfortable to wear, and they provide radiation protection similar to that of standard 0.5-mm lead-equivalent thyroid collars.
Strategies of employees in the construction industry to increase their sustainable employability.
Tonnon, Susanne C; van der Veen, Rozan; de Kruif, Anja Th C M; Robroek, Suzan J W; van der Ploeg, Hidde P; Proper, Karin I; van der Beek, Allard J
2018-01-01
The aging work force makes sustainable employability (SE) of workers a priority. However, it is unknown to what extent employees use implemented SE measures. To determine the utilization of 1) SE measures offered by employers, 2) employee SE strategies, and 3) to identify barriers and facilitators of SE strategies. Survey data were collected among 731 blue collar and 879 white collar workers to determine the utilization of employer SE measures. Focus groups were held with 16 blue collar and 17 white collar workers to identify employee SE strategies and their barriers and facilitators. Utilization of employer SE measures was highest for personal development measures. Strategies applied by blue collar workers included using equipment, suggesting improvements of their working conditions, and seeking promotion to a less physically demanding job. White collar workers named engaging in leisure time physical activity and seeking an adequate work-life balance. Implementation of these strategies was influenced by employee awareness and self-efficacy, the accessibility and costs and benefits of the strategy, management support and company culture. Usage of employer SE measures was generally low and recommendations are given for both blue and white collar workers to improve SE strategies.
Comparison of detector materials for time-of-flight positron tomography
International Nuclear Information System (INIS)
Derenzo, S.E.
1982-06-01
Knowledge of detection efficiency and timing resolution is essential when comparing detector materials for time-of-flight positron tomography. We present results of Monte Carlo calculations of the detection efficiency of plastic, lead loaded plastic, NaI(T1), liquid xenon, bismuth germanate (BGO), CsF, BaF 2 , Ge, and HgI 2 for 511 keV photons. We also use recently published values of timing resolution for these detector materials to tabulate the quantity (efficiency) 2 /(time resolution) which is a measure of the relative sensitivity for time of flight positron tomography
Subdivision of arthropod cap-n-collar expression domains is restricted to Mandibulata
2014-01-01
Background The monophyly of Mandibulata - the division of arthropods uniting pancrustaceans and myriapods - is consistent with several morphological characters, such as the presence of sensory appendages called antennae and the eponymous biting appendage, the mandible. Functional studies have demonstrated that the patterning of the mandible requires the activity of the Hox gene Deformed and the transcription factor cap-n-collar (cnc) in at least two holometabolous insects: the fruit fly Drosophila melanogaster and the beetle Tribolium castaneum. Expression patterns of cnc from two non-holometabolous insects and a millipede have suggested conservation of the labral and mandibular domains within Mandibulata. However, the activity of cnc is unknown in crustaceans and chelicerates, precluding understanding of a complete scenario for the evolution of patterning of this appendage within arthropods. To redress these lacunae, here we investigate the gene expression of the ortholog of cnc in Parhyale hawaiensis, a malacostracan crustacean, and two chelicerates: the harvestman Phalangium opilio, and the scorpion Centruroides sculpturatus. Results In the crustacean P. hawaiensis, the segmental expression of Ph-cnc is the same as that reported previously in hexapods and myriapods, with two distinct head domains in the labrum and the mandibular segment. In contrast, Po-cnc and Cs-cnc expression is not enriched in the labrum of either chelicerate, but instead is expressed at comparable levels in all appendages. In further contrast to mandibulate orthologs, the expression domain of Po-cnc posterior to the labrum is not confined within the expression domain of Po-Dfd. Conclusions Expression data from two chelicerate outgroup taxa suggest that the signature two-domain head expression pattern of cnc evolved at the base of Mandibulata. The observation of the archetypal labral and mandibular segment domains in a crustacean exemplar supports the synapomorphic nature of mandibulate cnc
Oxidative demethylation of monomethylmercury in sediments
International Nuclear Information System (INIS)
Oremland, R.S.
1991-01-01
Previous studies suggested that demethylation of monomethylmercury proceeds in nature by a simple organo-mercury lyase reaction resulting in the production of CH 4 and Hg 2+ , which is further reduced to Hg 0 . Addition of 14 CH 3 HgI to sediments resulted in the production of mainly 14 CO 2 and some 14 CH 4 . In the case of estuarine sediments, production of both these gases was only observed under anaerobiosis, and was totally inhibited by MoO 4 2- , which indicated the involvement of sulfate-reducing bacteria. In the case of anaerobic freshwater sediments, results with inhibitors indicated that both methanogens and sulfate reducers were involved in this oxidative demethylation. Aerobic incubation of estuarine sediments resulted in the production of only 14 CH 4 , indicating the importance of the organo-mercurial lyase reaction under this condition. However, in freshwater sediments, this reaction was not observed, and the oxidative demethylation reaction was predominant either under aerobic or anaerobic conditions. A methylotrophic methanogen (GS-16) was able to form traces of 14 CH 4 and 14 CO 2 from 14 CH 3 HgI, and some strains of sulfate-reducers formed traces of 14 CH 4 . Addition of methanol to anaerobic freshwater sediments partially inhibited production of 14 CH 4 and 14 CO 2 , but not CH 4 . These results suggest that oxidative demethylation proceeds by an established pathway for C-1 metabolism
Magnetohydrodynamic cellular automata
Montgomery, David; Doolen, Gary D.
1987-01-01
A generalization of the hexagonal lattice gas model of Frisch, Hasslacher and Pomeau is shown to lead to two-dimensional magnetohydrodynamics. The method relies on the ideal point-wise conservation law for vector potential.
Buscemi, Silvio; Cosentino, Loretta; Rosafio, Giuseppe; Morgana, Manuela; Mattina, Alessandro; Sprini, Delia; Verga, Salvatore; Rini, Giovam Battista
2013-06-01
The role of glycemic index of the diet in glucose control and cardiovascular prevention is still not clear. The aim of this study was to determine the effects of hypocaloric diets with different glycemic indexes and glycemic loads on endothelial function and glycemic variability in nondiabetic participants at increased cardiovascular risk. Forty nondiabetic obese participants were randomly assigned to a three-month treatment with either a low glycemic index (LGI; n=19) or high glycemic index (HGI; n=21) hypocaloric diet with similar macronutrient and fiber content. Endothelial function was measured as flow-mediated dilatation (FMD) of the brachial artery before and after dieting. In addition, 48-h continuous subcutaneous glucose monitoring was done before and after dieting in a subgroup of 24 participants. The amount of weight loss after dieting was similar in both groups. The glycemic index of the diet significantly influenced the FMD (Pdiet, and -0.9±3.6% after the HGI diet (Pdiet on results was observed. The glycemic index of the diet significantly influenced the 48-h glycemic variability measured as coefficient of variability (CV%; Pdiet (from 23.5 to 20.0%) and increased after the HGI diet (from 23.6 to 26.6%). The change in percentage of FMD was inversely correlated with the change in the 48-h glycemic CV% (r=-0.45; Phypocaloric diet in nondiabetic obese persons. ISRCTN56834511. Copyright © 2012 Elsevier Ltd and European Society for Clinical Nutrition and Metabolism. All rights reserved.
Directory of Open Access Journals (Sweden)
Masoud Lotfizadeh
2016-01-01
Full Text Available Background and Aim: Possible associations between depressive symptoms and work-related parameters have frequently been discussed in the literature. The present study was aimed to evaluate the work-related depressive symptoms and their possible-related parameters among male employees of Esfahan Steel Company (ESCO as one of the most important industrial sites in Iran. Materials and Methods: With a cross-sectional design and a stratified random sampling method in 2010, a total of 400 male employees were enrolled from the operational parts of the ESCO. Results: Among 400 participated employees, 245 (61.3% were rotational duty employees and 358 (89.5% were reported making <$500. After applying the linear regression model, some variables including: economic difficulties (P = 0.022, odds ratio [OR] = 0.558, 95% confidence interval [CI] =0.339–0.919, family-related problems (P = 0.003, OR = 0.303, 95% CI = 0.138–0.669, and work environment (P < 0.001, OR = 0.244, 95% CI = 0.140–0.426 were found to be significantly associated with higher depressive symptoms among the participants. Conclusion: The present study brought to light the predictors of occupational depressive symptoms among blue-collar employees of ESCO. More research is needed to find the causal relations between mental health and work-related parameters among Iranian employees.
Laczi, Miklós; Hegyi, Gergely; Herényi, Márton; Kiss, Dorottya; Markó, Gábor; Nagy, Gergely; Rosivall, Balázs; Szöllősi, Eszter; Török, János
2013-10-01
The possible integration of different sexual ornaments into a composite system, and especially the information content of such ornament complexes, is poorly investigated. Many bird species display complex plumage coloration, but whether this represents one integrated or several independent sexual traits can be unclear. Collared flycatchers ( Ficedula albicollis) display melanised and depigmented plumage areas, and the spectral features (brightness and UV chroma) of these are correlated with each other across the plumage. In a 5-year dataset of male and female plumage reflectance, we examined some of the potential information content of integrated, plumage-level colour attributes by estimating their relationships to previous and current year body condition, laying date and clutch size. Females were in better condition the year before they became darker pigmented, and males in better current year condition were also darker pigmented. Female pigment-based brightness was positively, while male structurally based brightness was negatively related to current laying date. Finally, the overall UV chroma of white plumage areas in males was positively associated with current clutch size. Our results show that higher degree of pigmentation is related to better condition, while the structural colour component is associated with some aspects of reproductive investment. These results highlight the possibility that correlated aspects of a multiple plumage ornamentation system may reflect together some aspects of individual quality, thereby functioning as a composite signal.
Real-time multiparameter pulse processing with decision tables
International Nuclear Information System (INIS)
Hull, K.; Griffin, H.
1986-01-01
Decision tables offer several advantages over other real-time multiparameter, data processing techniques. These include very high collection rates, minimum number of computer instructions, rates independent of the number of conditions applied per parameter, ease of adding or removing conditions during a session, and simplicity of implementation. Decisions table processing is important in multiparameter nuclear spectroscopy, coincidence experiments, multiparameter pulse processing (HgI 2 resolution enhancement, pulse discrimination, timing spectroscopy), and other applications can be easily implemented. (orig.)
International Nuclear Information System (INIS)
Huth, G.C.; Dabrowski, A.J.
1985-01-01
Accomplishments are reported in the development of a compound semi-insulator mercuric iodide (HgI 2 ) for nuclear radiation detection and spectroscopy, early lung cancer detection and localization in the uranium miner/worker population, computer digital image processing and image reconstruction research, and a concept for multiple, filtered x-ray computed tomography scanning to reveal chemical compositional information. Another area of interest is the study of new advances in the area of silicon detectors with internal gain (''avalanche'')
Nakata, Akinori; Takahashi, Masaya; Irie, Masahiro; Swanson, Naomi G
2010-11-01
Although the association of job satisfaction with health has been well documented, little is known about the biological mechanisms underlying this relationship. This study investigates the association of job satisfaction with cell-mediated immunity among Japanese white-collar daytime workers. A total of 306 healthy full-time employees (141 women and 165 men), aged 22-69 (mean 36) years, provided a blood sample for the measurement of circulating immune (natural killer (NK), B, and total T) cells and NK cell cytotoxicity (NKCC) and completed a questionnaire survey during April to June 2002. Job satisfaction was measured by a 4-item scale from the Japanese version of the generic job stress questionnaire with higher scores indicating greater satisfaction. Analyses were done separately for women and men using a hierarchical multiple linear regression model controlling for multiple confounders. The results revealed that greater job satisfaction was positively correlated with NKCC (β = .207; p = .029) and the number of NK (CD3(-)CD56(+)) cells (β = .261; p = .008) in women. In men, job satisfaction was marginally correlated with NKCC (β = .165; p = .050) but was not correlated with the number of NK (CD3(-)CD56(+)) cells (β = .142; p = .107). Job satisfaction did not correlate with numbers of T (CD3(+)CD56(-)) and B (CD19(+)) cells in both women and men. Our findings suggest an independent association between job satisfaction and NK cells but the association seems to be stronger in women than in men. Although the results provide a support for the biological plausibility of the job satisfaction-health relationship, additional research is required to determine whether greater job satisfaction contributes to recovery/maintenance of NK cell immunity and host defense over time. Published by Elsevier Inc.
Silva, M A; Peixoto, G C X; Castelo, T S; Lima, G L; Silva, A M; Oliveira, M F; Silva, A R
2013-08-01
The objective of this study was to verify the effect of different freezing curves, straw sizes, and thawing rates on the cryopreservation of collared peccary semen. Twelve ejaculates were obtained from captive adult males by electroejaculation, and evaluated for sperm motility, kinetic rating, viability, morphology, and functional membrane integrity. The ejaculates were diluted in a coconut water extender (ACP-116c) with egg yolk and glycerol, packaged into 0.25 mL or 0.50 mL plastic straws and cryopreserved in liquid nitrogen following a slow (-10 °C/min) or a fast (-40 °C/min) freezing curve. After one week, samples were thawed at 37 °C/1 min or 70 °C/8s and evaluated as reported for fresh semen, and also for kinematic parameters (computerized analysis). A significant decrease in sperm motility and kinetic rating was observed after glycerol addition at 5 °C and also after thawing for all the treatments (Pstraw size and thawing rate were taken as reference (P>0.05). In general, values for sperm characteristics found after thawing at 37 °C were better preserved than at 70 °C (Pstraws, which were similar for semen packaging (P>0.05). The evaluation of the kinematic parameters of sperm motility confirmed these results at values varying from 20% to 30% motile sperm for the samples tha wed at 37 °C, and values fewer than 12% motile sperm for samples thawed at 70 °C (Pstraws, but the thawing should be conducted at 37 °C/1 min. Copyright © 2013 Elsevier Inc. All rights reserved.
Fatty acid composition of adipose tissue triglycerides after weight loss and weight maintenance
DEFF Research Database (Denmark)
Kunešová, M; Hlavatý, P; Tvrzická, E
2012-01-01
Fatty acid composition of adipose tissue changes with weight loss. Palmitoleic acid as a possible marker of endogenous lipogenesis or its functions as a lipokine are under debate. Objective was to assess the predictive role of adipose triglycerides fatty acids in weight maintenance in participants...... of the DIOGENES dietary intervention study. After an 8-week low calorie diet (LCD) subjects with > 8 % weight loss were randomized to 5 ad libitum weight maintenance diets for 6 months: low protein (P)/low glycemic index (GI) (LP/LGI), low P/high GI (LP/HGI), high P/low GI (HP/LGI), high P/high GI (HP....../HGI), and a control diet. Fatty acid composition in adipose tissue triglycerides was determined by gas chromatography in 195 subjects before the LCD (baseline), after LCD and weight maintenance. Weight change after the maintenance phase was positively correlated with baseline adipose palmitoleic (16:1n-7...
Directory of Open Access Journals (Sweden)
Natalia Sanchez-Aguadero
2017-07-01
Full Text Available This study aimed to evaluate the postprandial effects of high and low glycemic index (GI breakfasts on vascular function. It was a crossover trial that included 40 young healthy adults (50% women, aged 20–40 years, who were recruited at primary care settings. They consumed three experimental breakfasts in randomized order, each one separated by a 1-week washout period: (1 control conditions (only water; (2 low GI (LGI breakfast (29.4 GI and 1489 KJ energy; and (3 high GI (HGI breakfast (64.0 GI and 1318 KJ energy. Blood samples were collected at 60 and 120 min after each breakfast to determine glucose and insulin levels. Vascular parameters were measured at 15 min intervals. Augmentation index (AIx was studied as a primary outcome. Secondary outcomes comprised glucose, insulin, heart rate (HR and pulse pressures (PPs. We found a trend toward increased AIx, HR and PPs for the HGI versus the LGI breakfast. A significant interaction between the type of breakfast consumed and all measured parameters was identified (p < 0.05 except for central PP. Stratifying data by sex, this interaction remained significant for AIx and augmentation pressure only in males (p < 0.05. In conclusion, breakfast GI could affect postprandial vascular responses in young healthy adults.
Effect of Glycemic Index of a Pre-exercise Meal on Endurance Exercise Performance
Burdon, Catriona A.; Spronk, Inge; Cheng, Hoi Lun; O’Connor, Helen T.
2017-01-01
Background: Low glycemic index (GI) pre-exercise meals may enhance endurance performance by maintaining euglycemia and altering fuel utilization. However, evidence for performance benefits is equivocal. Objective: To evaluate the effect of a low GI (LGI) versus a high GI (HGI) pre-exercise meal on
Directory of Open Access Journals (Sweden)
Kiss Ádám
2017-06-01
Full Text Available The Collared Pratincole (Glareola pratincola, which was once a typical breeding species of the sodic grasslands of the Great Plain, has become threatened with extinction from Hungary. It disappeared from the traditional grassland breeding sites before the 2000 and is currently breeding only in three sites in agricultural environments in Hungary. The objectives of our research were to find links between the use of shallow wetlands and the breeding behaviour of the species and to identify the characteristics of its breeding on ploughed fields. Data were collected between 2008 and 2016 as part of preparations for the conservation of the largest population which is found in the Nagykunság. We found a positive correlation between colony size and the area of the nearby wetland. We calculated the proportion of habitat-types used for nesting, and found that cultivated fields and fallow lands were the most important. Additionally, we also found that colony sizes were substantially smaller during the research period than those found earlier in the traditional grassland habitats. Finally, we found a positive trend in the size of the population during the research period.
Stoute, Simone T; Cooper, George L; Bickford, Arthur A; Carnaccini, Silvia; Shivaprasad, H L; Sentíes-Cué, C Gabriel
2016-03-01
In February 2015, two Eurasian collared doves (Streptopelia decaocto) were submitted dead to the California Animal Health and Food Safety (CAHFS) Laboratory, Turlock branch, from a private aviary experiencing sudden, high mortality (4/9) in adult doves. In both doves, the gross and histologic lesions were indicative of acute, fatal septicemia. Grossly, there were numerous pale yellow foci, 1 to 2 mm in diameter, in the liver and spleen. Microscopically, these foci were composed of acute severe multifocal coagulative necrosis of hepatocytes and splenic pulp with infiltration of heterophils mixed with fibrin and dense colonies of gram-negative bacteria. Yersinia pseudotuberculosis was isolated from the lung, liver, spleen, heart, ovary, kidney, and trachea. The organism was susceptible to most antibiotics it was tested against, except erythromycin. Based on a retrospective study of necropsy submissions to CAHFS between 1990 and 2015, there were 77 avian case submissions of Y. pseudotuberculosis. There were 75/77 cases identified from a wide range of captive avian species from both zoo and private facilities and 2/77 cases from two backyard turkeys submitted from one premise. The largest number of cases originated from psittacine species (31/77). The lesions most commonly described were hepatitis (63/77), splenitis (49/77), pneumonia (30/77), nephritis (16/77), and enteritis (12/77). From 1990 to 2015, there was an average of three cases of avian pseudotuberculosis per year at CAHFS. Although there were no cases diagnosed in 1993 and 1994, in all other years, there were between one and eight cases of Y. pseudotuberculosis detected from avian diagnostic submissions.
Tovesson, F.; Duke, D.; Geppert-Kleinrath, V.; Manning, B.; Mayorov, D.; Mosby, S.; Schmitt, K.
2018-03-01
Different aspects of the nuclear fission process have been studied at Los Alamos Neutron Science Center (LANSCE) using various instruments and experimental techniques. Properties of the fragments emitted in fission have been investigated using Frisch-grid ionization chambers, a Time Projection Chamber (TPC), and the SPIDER instrument which employs the 2v-2E method. These instruments and experimental techniques have been used to determine fission product mass yields, the energy dependent total kinetic energy (TKE) release, and anisotropy in neutron-induced fission of U-235, U-238 and Pu-239.
2010-01-01
... business to inspect animals and records for the purpose of seeking animals that are missing, under the... these regulations. (g) Identification of dogs and cats. (1) All live dogs or cats, including those from... by this section; or (ii) By a tag, tattoo, or collar, applied to the live dog or cat by the research...
Frisch, Mathias
2014-01-01
Much has been written on the role of causal notions and causal reasoning in the so-called 'special sciences' and in common sense. But does causal reasoning also play a role in physics? Mathias Frisch argues that, contrary to what influential philosophical arguments purport to show, the answer is yes. Time-asymmetric causal structures are as integral a part of the representational toolkit of physics as a theory's dynamical equations. Frisch develops his argument partly through a critique of anti-causal arguments and partly through a detailed examination of actual examples of causal notions in physics, including causal principles invoked in linear response theory and in representations of radiation phenomena. Offering a new perspective on the nature of scientific theories and causal reasoning, this book will be of interest to professional philosophers, graduate students, and anyone interested in the role of causal thinking in science.
Maximum solid concentrations of coal water slurries predicted by neural network models
Energy Technology Data Exchange (ETDEWEB)
Cheng, Jun; Li, Yanchang; Zhou, Junhu; Liu, Jianzhong; Cen, Kefa
2010-12-15
The nonlinear back-propagation (BP) neural network models were developed to predict the maximum solid concentration of coal water slurry (CWS) which is a substitute for oil fuel, based on physicochemical properties of 37 typical Chinese coals. The Levenberg-Marquardt algorithm was used to train five BP neural network models with different input factors. The data pretreatment method, learning rate and hidden neuron number were optimized by training models. It is found that the Hardgrove grindability index (HGI), moisture and coalification degree of parent coal are 3 indispensable factors for the prediction of CWS maximum solid concentration. Each BP neural network model gives a more accurate prediction result than the traditional polynomial regression equation. The BP neural network model with 3 input factors of HGI, moisture and oxygen/carbon ratio gives the smallest mean absolute error of 0.40%, which is much lower than that of 1.15% given by the traditional polynomial regression equation. (author)
Biomass Gasification Technology Assessment: Consolidated Report
Energy Technology Data Exchange (ETDEWEB)
Worley, M.; Yale, J.
2012-11-01
Harris Group Inc. (HGI) was commissioned by the National Renewable Energy Laboratory to assess gasification and tar reforming technologies. Specifically, the assessments focused on gasification and tar reforming technologies that are capable of producing a syngas suitable for further treatment and conversion to liquid fuels. HGI gathered sufficient information to analyze three gasification and tar reforming systems. This report summarizes the equipment, general arrangement of the equipment, operating characteristics, and operating severity for each technology. The order of magnitude capital cost estimates are supported by a basis-of-estimate write-up, which is also included in this report. The report also includes Microsoft Excel workbook models, which can be used to design and price the systems. The models can be used to analyze various operating capacities and pressures. Each model produces a material balance, equipment list, capital cost estimate, equipment drawings and preliminary general arrangement drawings. Example outputs of each model are included in the Appendices.
International Nuclear Information System (INIS)
Huth, G.C.; Dabrowski, A.J.
1986-04-01
This report covers the period from December 1984 through November 1985 for this research project sponsored by the Office of Health and Environmental Research of the Dept. of Energy. This work has two primary research objectives. The first is continuing development of the material mercuric iodide (HgI 2 ) and its applications to energy dispersive x-ray analysis and gamma ray spectrometry. The second task involves investigation of silicon ''avalanche'' (internal electron gain) radiation detector structures fabricated from new neutron transmutation doped (NTD) silicon single crystal
Universal intermittent properties of particle trajectories in highly turbulent flows
DEFF Research Database (Denmark)
Arnèodo, A.; Benzi, R.; Berg, Jacob
2008-01-01
all data sets are found to collapse onto each other on a wide range of time lags, pointing towards the existence of a universal behavior, within present statistical convergence, and calling for a unified theoretical description. Parisi-Frisch multifractal theory, suitably extended to the dissipative...
Luxuries are Easier to Postpone
DEFF Research Database (Denmark)
Browning, Martin; Crossley, Thomas
2000-01-01
We show that (Marshallian) income elasticities are proportional to (Frisch) own price elasticities if all goods are additively separable. This implies that luxuries are likely to be easier to postpone. It also implies that preferences over "consumption" are unlikely to display a constant elasticity...
199Hg Moessbauer measurements on mercury, alloys and Hg-fluorides
International Nuclear Information System (INIS)
Wurtinger, W.; Kankeleit, E.
1979-01-01
The Moessbauer effect on the 158 keV 5/2 - -1/2 - transition in 199 Hg, of the order of 10 ppm, has been studied using the current integration technique. The isomer shift between the Hg(I)- and Hg(II)-fluorides as well as the quadrupole splitting in Hg 2 Pt and Hg 2 F 2 are interpreted in terms of relativistic Hartree-Fock-Slater and Molecular Orbital calculations. The following nuclear parameters could be derived: Δ[r 2 ] = (3.2+-1.1) 10 -3 fm 2 and Q(5/2 - ) = (-0.8+-0.4)b. Evidence for an oblate triaxially deformed 199 Hg nucleus is derived from particle plus rotor calculations. (orig.)
Roosmaa, Eve-Liis; Saar, Ellu
2010-01-01
We concentrate on the following research questions: (1) Do the structure of the educational system and its interaction with the labour market affect the training gap between low-skilled blue collar workers and high-skilled white collar workers? and (2) Do the ways that institutional systems shape opportunities for lifelong learning differ between…
Energy Technology Data Exchange (ETDEWEB)
Bolotnikov, Aleksey [Brookhaven National Lab. (BNL), Upton, NY (United States); Cui, Yonggang [Brookhaven National Lab. (BNL), Upton, NY (United States); Vernon, Emerson [Brookhaven National Lab. (BNL), Upton, NY (United States); De Geronimo, Gianluigi [Brookhaven National Lab. (BNL), Upton, NY (United States)
2016-06-01
This document presents motivations, goals and the current status of this project; development (fabrication, performance) of position-sensitive virtual Frisch-grid detectors proposed for nanoRaider, an instrument commonly used by nuclear inspectors; ASIC developments for CZT detectors; and the electronics development for the detector prototype..
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 22; Issue 3. Disintegration of Uranium by Neutrons: a New Type of Nuclear Reaction. Lise Meitner O R Frisch. Classics Volume 22 Issue 3 March 2017 pp 323-325. Fulltext. Click here to view fulltext PDF. Permanent link:
A Comparative Study of Two Decision Models: Frisch’s model and a simple Dutch planning model
J. Tinbergen (Jan)
1951-01-01
textabstractThe significance of Frisch's notion of decision models is, in the first place, that they draw full attention upon "inverted problems" which economic policy puts before us. In these problems the data are no longer those in the traditional economic problems, but partly the political
Solid-state photo-detectors for both CT and PET applications
Moraes, Danielle; Jarron, Pierre
2007-01-01
New semiconductor detectors have recently gained a lot of attention for medical applications in general. Advances in CdZnTe-detector arrays might improve both energy resolution and spatial resolution of clinical X-ray systems. Alternative system designs based on TFA technology combining photo-detector arrays with CMOS electronics open a possibility for compact imaging cameras. This scenario allows for the use of alternative materials such as a-Si:H and HgI2 that can be applied alone or integrated with scintillators. Results obtained with such materials are presented.
Uthoff, Heiko; Benenati, Matthew J; Katzen, Barry T; Peña, Constantino; Gandhi, Ripal; Staub, Daniel; Schernthaner, Melanie
2014-02-01
To test whether newer bilayer barium sulfate-bismuth oxide composite (XPF) thyroid collars (TCs) provide superior radiation protection and comfort during fluoroscopy-guided interventions compared with standard 0.5-mm lead-equivalent TCs. Institutional review board approval and written informed consent were obtained for this HIPAA-compliant study, and 144 fluoroscopy-guided vascular interventions were included at one center between October 2011 and July 2012, with up to two operators randomly assigned to wear XPF (n = 135) or standard 0.5-mm lead-equivalent (n = 121) TCs. Radiation doses were measured by using dosimeters placed outside and underneath the TCs. Wearing comfort was assessed at the end of each procedure on a visual analog scale (0-100, with 100 indicating optimal comfort). Adjusted differences in comfort and radiation dose reductions were calculated by using a mixed logistic regression model and the common method of inverse variance weighting, respectively. Patient (height, weight, and body mass index) and procedure (type and duration of intervention, operator, fluoroscopy time, dose-area product, and air kerma) data did not differ between the XPF and standard groups. Comfort was assessed in all 256 measurements. On average, the XPF TCs were 47.6% lighter than the standard TCs (mean weight ± standard deviation, 133 g ± 14 vs 254 g ± 44; P 90; odds ratio, 7.6; 95% confidence interval: 3.0, 19.2; P standard group). The mean radiation dose reductions (ie, radiation protection) provided by XPF and standard TCs were 90.7% and 72.4%, with an adjusted mean difference of 17.9% (95% confidence interval: 7.7%, 28.1%; P standard 0.5-mm lead-equivalent TCs and provide superior radiation protection during fluoroscopy-guided interventions. © RSNA, 2013.
A Canadian perspective on anterior cervical discectomies: practice patterns and preferences
Bennardo, Michael; Farrokhyar, Forough; Martyniuk, Amanda; Reddy, Kesava
2018-01-01
Background The purpose of this study is to elucidate the current practice patterns of Canadian neurosurgeons with regards to anterior cervical discectomy (ACD). Methods A one-page questionnaire was sent out using SurveyMonkey to all neurosurgeon members of the Canadian Neurological Sciences Federation (CNSF). End points were surgeon preference for ACD surgical method, graft source, the length of collar usage and the recommended time before returning to work. Results Response rate was 74.0%. Of the responders, 75.0% performed single level ACD and 18.3% had completed spine fellowships. The majority (68.2%) chose ACD with fusion and plating (ACDFP) as their preferred method with allograft being the most popular choice of fusion material (44.3%). Most of the respondents did not prescribe collars (60.9%) and when they did, hard collar was prescribed most often (76.9%) and AspenTM collar was the most popular choice (67.7%). The majority of surgeons chose ‘other’ as their response for length of time for collar use (40.0%) while allowing them to take their collars off at night (78.1%). Most of the surgeons recommended physiotherapy post-operatively (58.1%) and time to physiotherapy was 6–8 weeks. Recommended back to work time was 6 weeks for 44.9% of respondents. In the cross analysis, surgeons who performed ACDF were more likely to prescribe collars (50%, P=0.01) versus surgeons who performed ACDFP (21.7%, P=0.01). Conclusions Our survey is an up to date description of current practice patterns for ACD amongst Canadian neurosurgeons. PMID:29732425
Björklund, M; Gustafsson, L
2017-07-01
Understanding the magnitude and long-term patterns of selection in natural populations is of importance, for example, when analysing the evolutionary impact of climate change. We estimated univariate and multivariate directional, quadratic and correlational selection on four morphological traits (adult wing, tarsus and tail length, body mass) over a time period of 33 years (≈ 19 000 observations) in a nest-box breeding population of collared flycatchers (Ficedula albicollis). In general, selection was weak in both males and females over the years regardless of fitness measure (fledged young, recruits and survival) with only few cases with statistically significant selection. When data were analysed in a multivariate context and as time series, a number of patterns emerged; there was a consistent, but weak, selection for longer wings in both sexes, selection was stronger on females when the number of fledged young was used as a fitness measure, there were no indications of sexually antagonistic selection, and we found a negative correlation between selection on tarsus and wing length in both sexes but using different fitness measures. Uni- and multivariate selection gradients were correlated only for wing length and mass. Multivariate selection gradient vectors were longer than corresponding vector of univariate gradients and had more constrained direction. Correlational selection had little importance. Overall, the fitness surface was more or less flat with few cases of significant curvature, indicating that the adaptive peak with regard to body size in this species is broader than the phenotypic distribution, which has resulted in weak estimates of selection. © 2017 European Society For Evolutionary Biology. Journal of Evolutionary Biology © 2017 European Society For Evolutionary Biology.
The Perceived Quality of Life among School District Superintendents in Illinois Public Schools
Heffernan, Debra J.
2012-01-01
The purpose of this study was to determine the perception of quality of life among Illinois male and female superintendents, and to determine demographic differences. Frisch's Quality of Life Inventory (QOLI) was used, which measured perceived levels of importance, satisfaction and weighted satisfaction (importance and satisfaction) in sixteen…
Bit-coded regular expression parsing
DEFF Research Database (Denmark)
Nielsen, Lasse; Henglein, Fritz
2011-01-01
the DFA-based parsing algorithm due to Dub ´e and Feeley to emit the bits of the bit representation without explicitly materializing the parse tree itself. We furthermore show that Frisch and Cardelli’s greedy regular expression parsing algorithm can be straightforwardly modified to produce bit codings...
Interstellar Dust in the Heliosheath: Tentative Discovery of the Magnetic Wall of the Heliosphere
Frisch, P. C.
2005-12-01
The evident identification of interstellar dust grains entrained in the magnetic wall of the heliosphere is reported. It is shown that the distribution of dust grains causing the weak polarization of light from nearby stars is consistent with polarization by small charged interstellar dust grains captured in the heliosphere magnetic wall (Tinbergen 1982, Frisch 2005). There is an offset between the deflected small charged polarizing dust grains, radius less than 0.2 microns, and the undeflected large grain population, radius larger than 0.2 microns. The region of maximum polarization is towards ecliptic coordinates lambda,beta = 295,0 deg, which is offset along the ecliptic longitude by about 35 deg from the heliosphere nose and extends to low ecliptic latitudes where the heliosphere magnetic wall is expected. An offset is also found between the best aligned dust grains, near lambda=281 deg to 220 deg, and the upwind direction of the undeflected inflow of large grains seen by Ulysses and Galileo. In the aligned-grain region, the polarization strength anti-correlates with ecliptic latitude, indicating that the magnetic wall was predominantly at negative ecliptic latitudes when these data were acquired. These data are consistent with model predictions for an interstellar magnetic field which is tilted by 60 deg with respect to the ecliptic plane, and parallel to the galactic plane. References: Tinbergen, 1982: AA, v105, p53; Frisch, 2005: to appear in ApJL.
Energy Technology Data Exchange (ETDEWEB)
Forney, M.; Ramaley, D. [Westinghouse Electric Company, Cranberry Township, PA (United States); Bryant, W. [Luminant Energy, Comanche Peak Nuclear Power Plant, Dallas, TX (United States)
2015-07-01
Advance Scale Conditioning Agent (ASCA) technology has been applied more than forty times worldwide since its inception in 2000. This technology has continually grown in popularity since its development due to the combination of several process benefits and minimal outage impacts. Comanche Peak Unit 2 applied a Top of Tubesheet (TTS) ASCA in 2014 for partial dissolution and softening of consolidated TTS collars. In addition to the ASCA application, a Consolidated Deposit Extraction (CODE) step was applied to the TTS. CODE is a chemical treatment technology that effectively targets and dissolves 'binding species' such as those containing aluminum and silicon from steam generator deposits. Since magnetite dissolution technologies are not wholly effective in removing consolidated TTS 'collars' CODE technology was developed to address this need in the industry. This paper will discuss both the Westinghouse and utility perspective on TTS ASCA/CODE application planning, site execution, and process results. (author)
Gupta, Nidhi; Heiden, Marina; Aadahl, Mette; Korshøj, Mette; Jørgensen, Marie Birk; Holtermann, Andreas
2016-01-01
The aim of the study was to investigate if (a) substituting total sedentary time or long sedentary bouts with standing or various types of physical activity and (b) substituting long sedentary bouts with brief sedentary bouts; is associated with obesity indicators using a cross sectional isotemporal substitution approach among blue-collar workers. A total of 692 workers from transportation, manufacturing and cleaning sectors wore an Actigraph GT3X+ accelerometer on the thigh for 1-4 working days. The sedentary (sit and lie), standing, walking, and moderate to vigorous physical activity (MVPA) time on working days was computed using validated Acti4 software. The total sedentary time and uninterrupted sedentary time spent in brief (≤5 mins), moderate (>5 and ≤30 mins), and long (>30mins) bouts, were determined for the whole day and during work and non-work time separately. The obesity indicators, BMI (kg/m2), waist circumference (cm) and fat percentage were objectively measured. Isotemporal substitution modelling was utilized to determine the linear association with obesity indicators of replacing 30 min of total sedentary time or long sedentary bouts with standing, walking or MVPA and separately replacing 30 min of long sedentary bouts with brief sedentary bouts. Workers [mean (standard deviation, SD); age = 45.1 (9.9) years, BMI = 27.5 (4.9) kg/m2, %BF = 29.6 (9.5), waist circumference = 94.4 (13.0) cm] sat for 2.4 hours (~32% of the measured time, SD = 1.8 hours) across the day during work period and 5.5 hours (~62% of the measured time, SD = 1.5 hours) during non-work period. Most of the sedentary time was accrued in moderate bouts [work = 1.40 (SD = 1.09) hours] during work and in long bouts during non-work [2.7 (SD = 1.4) hours], while least in long sedentary bouts during work [work = 0.5 (SD = 0.9)] and in brief sedentary bouts [0.5 hours (SD = 0.3)] during non-work. Significant associations with all obesity indicators were found when 30 min of total
Improvement in photoconductor film properties by changing dielectric layer structures
International Nuclear Information System (INIS)
Kim, S; Oh, K; Lee, Y; Jung, J; Cho, G; Jang, G; Cha, B; Nam, S; Park, J
2011-01-01
In recent times, digital X-ray detectors have been actively applied to the medical field; for example, digital radiography offers the potential of improved image quality and provides opportunities for advances in medical image management, computer-aided diagnosis and teleradiology. In this study, two candidate materials (HgI 2 and PbI 2 ) have been employed to study the influence of the dielectric structure on the performance of fabricated X-ray photoconducting films. Parylene C with high permittivity was deposited as a dielectric layer using a parylene deposition system (PDS 2060). The structural and morphological properties of the samples were evaluated field emission scanning electron microscopy and X-ray diffraction. Further, to investigate improvements in the electrical characteristics, a dark current in the dark room and sensitivity to X-ray exposure in the energy range of general radiography diagnosis were measured across the range of the operating voltage. The electric signals varied with the dielectric layer structure of the X-ray films. The PbI 2 film with a bottom dielectric layer showed optimized electric properties. On the other hand, in the case of HgI 2 , the film with a top dielectric layer showed superior electric characteristics. Further, although the sensitivity of the film decreased, the total electrical efficiency of the film improved as a result of the decrease in dark current. When a dielectric layer is deposited on a photoconductor, the properties of the photoconductor, such as hole-electron mobility, should be considered to improve the image quality in digital medical imaging application. In this study, we have thus demonstrated that the use of dielectric layer structures improves the performance of photoconductors.
Determining large deflections in rectangular combined loaded ...
Indian Academy of Sciences (India)
(Bisshopp & Drucker 1945; Scott et al 1955; Lau 1982; Rao & Rao 1986; Baker 1993; Lee et al 1993; Frisch-Fay 1962; Fertis 1999). Prathap and Varadan (1976) had calculated large deflections in cantilever beams made of non-linear Ramberg–Osgood type material on which concentrated load effected on the free end.
Directory of Open Access Journals (Sweden)
D. Borges
2014-08-01
Full Text Available In order to evaluate the weight changes, level of hematocrit and serum total protein to supplement the diet of collared peccaries (Pecari tajacu with a silage mixture of grass Taiwan (Pennisetum purpureum and Ramon (Brosimum alicastrum a voluntary consumption test was performed for five weeks. Using eleven non-pregnant adult females, with mean age of 4.5 years and weighing 19.15 kg (± 0.5 kg, two groups were formed: one of five animals which offered squash (Cucurbita pepo and corn (Zea mays, and another of six animals on a diet of squash, corn and silage at 50%. Were taken blood samples and record weight every seven days. T-student test were used to compare means of two independent samples. There were no differences between the means of the weights and blood proteins levels of individuals. The use of a silage mixture of grass and fodder cutting is a viable option to supplement the diet of nonpregnant adult females.
Bilodeau, Angèle; Filion, Gilbert; Labrie, Louise; Bouteiller, Dominique; Perreault, Michel
2005-01-01
Sustained health promotion programmes in the workplace (HPPW) continues to be a public health challenge. This article presents an evaluation of the implementation and sustainability of such programmes in private blue-collar companies in Quebec to shed light on issues specific to this type of setting. A multiple case (4 sites), longitudinal (7 years) and interpretive study method was used. The interpretation framework considered that the implementation and sustainability of HPPW in companies are the result of organizational learning in health promotion, determined by the strategies of individuals in a position of control who shape the decisional processes related to these programmes. After seven years of observation, two of the four sites had continued their HPPW, although these programmes were no longer applied within these companies. The health promotion organizational learning processes in both sites were defined according to targeted organizational purposes set by the decision-makers who supported HPPW. However, these gains were largely lost when HPPW were no longer retained as a component of their organizational development strategy. The organizational conditions that are conducive to HPPW are difficult to put together and sustain in companies like those in our study. Businesses implement these programmes mainly for the organizational benefits they expect to reap in the short term, whereas improvement in the health of workers in the longer term is not a priority.
D. Paul Jackson; R. Kasten Dumroese; James P. Barnett; William B. Patterson
2010-01-01
Of a range of fertilization rates (0.5, 1.0, 2.0, 3.0, and 4.0 mg nitrogen (N) per seedling per week) applied for 20 weeks, the 2.0-N and 3.0-N seedlings produced good root collar diameter (RCD) growth (6.9 and 7.1 mm, respectively) and needle length ⤠30 cm. Root collar development did not differ significantly in seedlings receiving the 4.0-mg-N treatment from those...
Fossorial snake genus Apostolepis from South America (Serpentes: Colubridae: Elapomorphinae
Directory of Open Access Journals (Sweden)
De Lema, Thales
2001-07-01
Full Text Available An update commented list of the snake genus Apostolepis from South America, with keys for identification of the species. They are fossorial snakes that present different coloration according their distribution: (a 7 to 3 dark stripes coloration, without light nuchal collar (if present, vestigial, with snout not projected beyond jaws - in Amazonian and enclaves within Caatinga domain; (b 5 dark striped dorsal pattern, snout projected, usually without white nuchal collars — from region of contact between Cerrado and Chaco domains; (c dorsal pattern coloration uniformly red, with nucho-cervical collars, snout usually projected — in Cerrado with dispersion to Chaco and Caatinga; (d 2 or none dark stripes dorsally, venter immaculate or with black blotches, snout projecting: (e an aberrant pattern with oblique black dorsal stripes, without collars, head black and snout projecting — one species in an enclave within Caatinga, with 17 rows of scales instead of 15.
International Nuclear Information System (INIS)
Birn, J.; Hones, E.W. Jr.; Craven, J.D.; Frank, L.A.; Elphinstone, R.D.; Stern, D.P.
1991-01-01
Using the empirical Tsyganenko (1987) long model as a prime example of a megnetospheric field model, the authors have attempted to identify the boundary between open and closed field lines. They define as closed all field lines that are connested with the Earth at both ends and cross the equatorial plane earthward of x = -70 R E , the tailward validity limit of the Tsyganenko model. They find that the form of the open/closed boundary at the Earth's surface, identified with the polar cap boundary, can exhibit the arrowhead shape, pointed toward the Sun, observed in horse collar auroras (Hones et al., 1989). The polar cap size in the Tsyganenko model increases with increasing K p values, and it becomes rounder and less pointed. The superposition of a net B y field, which is the expected consequence of an IMF B y , rotates the polar cap pattern and, for larger values, degrades the arrowhead shape, resulting in polar cap configurations consistent with known asymmetries in the aurora. The pointedness of the polar cap shape also diminishes or even completely disappears if the low-latitude magnetopause is assumed open and located considerably inside of the outermost magnetic flux surface in the Tsyganenko model. The arrowhead shape of the polar cap is found to be associated with a strong increase of B z from midnight toward the tail flanks, which is observed independently, and is possibly related to the NBZ field-aligned current system, observed during quiet times and strongly northward IMF B z . The larger B z values near the flanks of the tail cause more magnetic flux to close through these regions than through the midnight equatorial region
Mortality and morbidity study of petrochemical employees in a polluted site
Directory of Open Access Journals (Sweden)
Pasetto Roberto
2012-05-01
Full Text Available Abstract Background The area of Gela was included among the 57 Italian polluted sites of national interest for environmental remediation because of its widespread contamination from a petrochemical complex. The present study investigates mortality and morbidity of the cohort of Gela petrochemical workers with the aim of disentangling occupational from residential risk. Methods Mortality was assessed for 5,627 men hired from 1960, year of the plant start-up, to 1993; it was followed up for vital status in the period 1960–2002. Morbidity was analysed for 5,431 workers neither dead nor lost to follow-up from 1960 to 2001 and was based on Hospital Discharge Records in the period 2001–2006. The work experience was classified in terms of job categories such as blue collars, white collars, and both – workers who shifted from blue to white collar (95% or vice versa. An ad hoc mobility model was applied to define qualitative categories of residence in Gela, as residents and commuters. Standardized Mortality Ratios (SMRs and Mortality Rate Ratios (MRRs were computed, the latter by using a Poisson regression model. Morbidity was analyzed in terms of Hospital Discharge Odds Ratios (HDORs through a logistic regression model. While performing the internal comparisons, white collars was the reference category for the job analysis, and commuters was the reference category for the residential analysis. Results In the light of epidemiological evidence about health risk from petrochemical industries in both occupational and environmental settings, and/or on the basis of information about occupational and residential contamination and health risk in the area of Gela, noteworthy results are shown for lung cancer [MRR: 2.11 (CI 90%; 0.96-4.63 in blue collars; 1.71 (1.09-2.69 in residents], respiratory diseases [HDOR: 2.0 (1.0-3.0 in blue collars; 1.4 (0.96-2.06 in residents] and genitourinary diseases [HDOR: 1.34 (1.06-1.68 in blue collars; 1.23 (1.04-1.45 in
Fresh heat is in demand; Frische Waerme ist beliebt
Energy Technology Data Exchange (ETDEWEB)
Augsten, Eva
2012-10-22
Increasingly, solar heat customers are getting their hot water fresh from the flow-through station, even in single-family dwellings. Stations are getting more compact, more intelligent, and also more efficient. So-called legionella filters should be used with caution.
Experiences with large-area frisch grid chambers in low-level alpha spectrometry
Energy Technology Data Exchange (ETDEWEB)
Hoetzl, H.; Winkler, R. (Gesellschaft fuer Strahlen- und Umweltforschung m.b.H. Muenchen, Neuherberg (Germany, F.R.). Inst. fuer Strahlenschutz)
1984-06-15
The properties of parallel-plate gridded ionization chambers with areas of 300 cm/sup 2/, developed by us for alpha spectrometry of samples with low specific alpha activity are reported. Several practical hints for optimum operating conditions are presented. The chambers can be operated routinely at atmospheric pressure for several days, without the need for purification of the gas filling (P10). The minimum detectable activity at 5 MeV is 0.01 pCi, based on 4.65 standard deviations of background and 1000 min counting time. At the GSF Research Center ionization chambers of this type are used for the analysis of natural alpha emitters, as well as of transuranium nuclides in environmental samples by: a) direct alpha spectrometry without any previous treatment of the sample, b) semi-direct spectrometry after removal of organic matter by low-temperature ashing and c) spectrometry after chemical separation. Some typical example of application are given. Furthermore the range of application of the chambers in comparison to semiconductor detectors in the field of low-level alpha spectrometry is discussed.
Experiences with large-area frisch grid chambers in low-level alpha spectrometry
International Nuclear Information System (INIS)
Hoetzl, H.; Winkler, R.
1984-01-01
The properties of parallel-plate gridded ionization chambers with areas of 300 cm 2 , developed by us for alpha spectrometry of samples with low specific alpha activity are reported. Several practical hints for optimum operating conditions are presented. The chambers can be operated routinely at atmospheric pressure for several days, without the need for purification of the gas filling (P10). The minimum detectable activity at 5 MeV is 0.01 pCi, based on 4.65 standard deviations of background and 1000 min counting time. At the GSF Research Center ionization chambers of this type are used for the analysis of natural alpha emitters, as well as of transuranium nuclides in environmental samples by: a) direct alpha spectrometry without any previous treatment of the sample, b) semi-direct spectrometry after removal of organic matter by low-temperature ashing and c) spectrometry after chemical separation. Some typical example of application are given. Furthermore the range of application of the chambers in comparison to semiconductor detectors in the field of low-level alpha spectrometry is discussed. (orig.)
Removable top nozzle and tool for a nuclear reactor fuel assembly
International Nuclear Information System (INIS)
Wilson, J.F.; Cerni, S.; Gjertsen, R.K.
1987-01-01
A tool is described used in a nuclear reactor fuel assembly for connecting and disconnecting an internally threaded collar threadably engagable with an externally threaded upper end of a control rod guide thimble. The tool consists of: (a) rotation means engagable with the collar and operable to apply a torque in one direction to threadably connect the internally threaded collar on the thimble's externally threaded upper end and in an opposite direction to disconnect the collar from its threaded connection with the thimble; and (b) gripper means adapted to be inserted into the upper end of the guide thimble and operable to prevent the thimble from rotating about its longitudinal axis as the rotation means applies torque to the collar in connecting and disconnecting the collar on and off the guide thimble; (c) the gripper means being disposed within the rotation means and having a portion thereof projecting outwardly beyond the rotation means for insertion into the thimble when the rotation means is engaged with the collar
DEFF Research Database (Denmark)
2009-01-01
Introduktion og redaktion af tematillæg om dagbøger og dagbogslitteratur, med bidrag af Karsten Sand Iversen, Søren Mogensen Larsen, Steen Klitgård Povlsen, Jacob Lund, Jens Blendstrup, Pablo Llambías og optryk af en samtale fra 1972 mellem Walter Höllerer, Uwe Johnson, Max Frisch, Elias Canetti og...
Caring for the Caregiver: The Use of Music and Music Therapy in Grief and Trauma
Loewy, Joanne V., Ed.; Hara, Andrea Frisch, Ed.
2002-01-01
A collection of reflections on music therapy interventions provided as a part of the New York City Music Therapy Relief Project, sponsored by AMTA and the Recording Academy after September 11th, 2001. Edited by Joanne V. Loewy and Andrea Frisch Hara. Each chapter is written by a different therapist involved in the project.
Indian Academy of Sciences (India)
Lise Meitner was the first to rec- ognize that 'uranium atom had been split' in this reaction. The idea germinated when Meitner and Frisch were spending Christmas vacation together in 1938. Discussing about the recent results during a long walk in the snow, considering Bohr's suggestion of nucleus as a liquid drop, they ...
Lattice gas simulations of dynamical geometry in two dimensions.
Klales, Anna; Cianci, Donato; Needell, Zachary; Meyer, David A; Love, Peter J
2010-10-01
We present a hydrodynamic lattice gas model for two-dimensional flows on curved surfaces with dynamical geometry. This model is an extension to two dimensions of the dynamical geometry lattice gas model previously studied in one dimension. We expand upon a variation of the two-dimensional flat space Frisch-Hasslacher-Pomeau (FHP) model created by Frisch [Phys. Rev. Lett. 56, 1505 (1986)] and independently by Wolfram, and modified by Boghosian [Philos. Trans. R. Soc. London, Ser. A 360, 333 (2002)]. We define a hydrodynamic lattice gas model on an arbitrary triangulation whose flat space limit is the FHP model. Rules that change the geometry are constructed using the Pachner moves, which alter the triangulation but not the topology. We present results on the growth of the number of triangles as a function of time. Simulations show that the number of triangles grows with time as t(1/3), in agreement with a mean-field prediction. We also present preliminary results on the distribution of curvature for a typical triangulation in these simulations.
The Medium and the Message: Oral History, New Media, and a Grassroots History of Working Women
Meyerowitz, Ruth; Zinni, Christine F.
2009-01-01
In the Spring of 2000, Ruth Meyerowitz and Christine Zinni began collaborative efforts--inside and outside of academia--to enhance a course on The History of Working Women at SUNY Buffalo. Videotaping the oral histories of women labor leaders, they later teamed up with Michael Frisch and Randforce Associates--a research group at SUNY at Buffalo's…
Advances in semiconductor photodetectors for scintillators
International Nuclear Information System (INIS)
Farrell, R.; Olschner, F.; Shah, K.; Squillante, M.R.
1997-01-01
Semiconductors photodetectors have long seemed an attractive alternative for scintillation detection, but only recently have semiconductor photodiodes been proven suitable for some room temperature applications. There are many applications, however for which the performance of standard silicon p-i-n photodiodes is not satisfactory. This article reviews recent progress in two different families of novel semiconductor photodetectors: (1) wide bandgap compound semiconductors and (2) silicon photodetectors with enhanced signal-to-noise ratio. The compounds discussed and compared in this paper are HgI 2 , PbI 2 , InI, TlBr, TlBr 1-x I x and HgBr 1-x I x . The paper will also examine unity gain silicon drift diodes and avalanche photodiodes with maximum room temperature gain greater than 10000. (orig.)
System for bearing a nuclear reactor vessel cooled by liquid metal
International Nuclear Information System (INIS)
Mahe, A.; Jullien, G.
1976-01-01
The invention relates to a bearing system for supporting a nuclear reactor vessel of the kind which is suspended from the reactor closure slab. The bearing system comprises a ring connected at one end to a collar and at the other end to two collars. The collar connected to the bottom end of the ring forms the top part of the vessel to be supported while the other two collars fit into the slab at two separate places. The ring and collars are disposed in an annular space formed in the slab and dividing it into two parts, i.e., a central part and a peripheral part surrounding the central part of the slab
Expected long-term outcome after a tibial shaft fracture
DEFF Research Database (Denmark)
Faergemann, C; Frandsen, P A; Röck, N D
1999-01-01
OBJECTIVE: A prospective study of 207 laymen and professionals answered a questionnaire regarding the expectations of the long-term outcome 6 months after a unilateral tibial shaft fracture. The aim was (1) to disclose the expected outcome after unilateral tibial shaft fracture, and (2) to compare...... these expectations with the outcome measured in patients. METHODS: There were five groups of nonpatients: (1) 42 orthopedic surgeons, (2) 36 physiotherapists, (3) 42 students, (4) 49 white collar workers, and (5) 38 blue collar workers. Outcome was measured by Sickness Impact Profile (SIP). The SIP scores were...
[Effects of carbon and nitrogen sources on 5-keto-gluconic acid production].
Tan, Zhilei; Wang, Hongcui; Wei, Yuqiao; Li, Yanyan; Zhong, Cheng; Jia, Shiru
2014-01-01
Gluconobacter oxydans is known to oxidize glucose to gluconic acid (GA), and subsequently, to 2-keto-gluconic acid (2KGA) and 5-keto-gluconic acid (5KGA), while 5KGA can be converted to L-(+)-tartaric acid. In order to increase the production of 5KGA, Gluconobacter oxydans HGI-1 that converts GA to 5KGA exclusively was chosen in this study, and effects of carbon sources (lactose, maltose, sucrose, amylum and glucose) and nitrogen sources (yeast extract, fish meal, corn steep liquor, soybean meal and cotton-seed meal) on 5KGA production were investigated. Results of experiment in 500 mL shake-flask show that the highest yield of 5KGA (98.20 g/L) was obtained using 100 g/L glucose as carbon source. 5KGA reached 100.20 g/L, 109.10 g/L, 99.83 g/L with yeast extract, fish meal and corn steep liquor as nitrogen source respectively, among which the optimal nitrogen source was fish meal. The yield of 5KGA by corn steep liquor is slightly lower than that by yeast extract. For the economic reason, corn steep liquor was selected as nitrogen source and scaled up to 5 L stirred-tank fermentor, and the final concentration of 5KGA reached 93.80 g/L, with its maximum volumetric productivity of 3.48 g/(L x h) and average volumetric productivity of 1.56 g/(L x h). The result obtained in this study showed that carbon and nitrogen sourses for large-scale production of 5KGA by Gluconobacter oxydans HGI-1 were glucose and corn steep liquor, respectively, and the available glucose almost completely (85.93%) into 5KGA.
Gans, Kim M.; Salkeld, Judith; Risica, Patricia Markham; Lenz, Erin; Burton, Deborah; Mello, Jennifer; Bell, Johanna P.
2015-01-01
Objective To examine the relationship between job type, weight status and lifestyle factors that are potential contributors to obesity including, diet, physical activity and perceived stress among employees enrolled in the Working on Wellness (WOW) project. Methods Randomly selected employees at 24 worksites completed a baseline survey (n=1700); some also an in-person survey and anthropometric measures (n=1568). Employees were classified by US Labor standards as: white collar (n=1297), blue collar (n=303), or service worker (n=92), 8 unknown. Associations were analyzed using Chi-Square, GLM procedures, and adjusted for demographics using Logistic Regression. Results In unadjusted models, BMI of service workers was higher than white collar workers; F&V intake was higher for service and blue collar than white collar; white collar workers reported highest stress levels in job and life. However, in models adjusted for demographics, the only significant difference was to physical activity (i.e., MET/min per week), with blue collar workers reporting higher levels of physical activity than service workers, who reported higher levels than the white collar workers. Conclusions Future research should further examine the relationship between health and job status to corroborate the results of the current study and to consider designing future worksite health promotion interventions that are tailored by job category. PMID:26461872
DEFF Research Database (Denmark)
Thilsing, Trine; Rasmussen, Jesper; Lange, Bibi
2012-01-01
self-reported symptoms of CRS, asthma, and nasal allergy, along with information on smoking habits and occupation. RESULTS: A total of 3,099 returned completed questionnaires (response rate 68.1%). The overall CRS prevalence was 7.8% with no significant differences related to age or gender. Risk ratio...... estimates revealed an increased risk of CRS among female blue collar workers compared to female white collar workers. Among men the effect of occupation depended on smoking status. Occupational exposure to gasses, fumes, dust, or smoke increased the overall risk of CRS. CRS was reported approximately four...... or smoking) increased the CRS prevalence. Studies on larger cohorts are needed to fully assess these tendencies, for example, by more extensive use of Job Exposure Matrix models. Am. J. Ind. Med. © 2012 Wiley Periodicals, Inc....
DEFF Research Database (Denmark)
2009-01-01
In, red.), Max Frisch havde udgivet andet bind af sine meget populære dagbøger, »Tagebuch 1966-71«, Uwe Johnsons andet bind i »Jahrestage«-romanserien var netop udkommet, og Lars Gustafsson havde i 1971 fået publiceret den stærkt selvbiografiske og dagbogsagtige roman »Herr Gustafsson själv«. Under...
Indian Academy of Sciences (India)
sanjeev
14 M. J. Frisch, G.W. Trucks, H. B. Schlegel, G. E. Scuseria, M. A. Robb, J. R. Cheeseman, G. Scalmani, V. Barone, B. Mennucci, G. A. Petersson, H. Nakatsuji, M. Caricato, X. Li, H. P. Hratchian, A. F. Izmaylov, J. Bloino, G. Zheng, J.L. Sonnenberg, M. Hada, M. Ehara, K. Toyota, R. Fukuda, J. Hasegawa, M. Ishida, ...
Indian Academy of Sciences (India)
Frisch M J, Trucks G W, Schlegel H B, Scuseria G E,. Robb M A, Cheeseman J R, Scalmani G, Barone V,. Mennucci B, Petersson G A, Nakatsuji H, Caricato M,. Li X, Hratchian H P, Izmaylov A F, Bloino J, Zheng G,. Sonnenberg J L, Hada M, Ehara M, Toyota K, Fukuda. R, Hasegawa J, Ishida M, Nakajima T, Honda Y, Kitao.
Directory of Open Access Journals (Sweden)
L. Lazure
Full Text Available We studied the role of white-lipped and collared peccaries (Tayassu pecari and Pecari tajacu as seed predators and dispersers in the Atlantic rainforest of Brazil. The Atlantic rainforest ecosystem is highly threatened and has experienced dramatic declines in its populations of large mammals. Local extinctions can disrupt essential plant-animal interactions such as seed dispersion and seed predation. We tracked seeds from time of consumption to germination to assess the direct impact peccaries have on seed survival. We offered fruits of 20 species found in the Atlantic rainforest to the peccaries. Seeds were categorised as intact, scarified, ingested or defecated, and germination tests were performed. The overall impact by both peccary species was similar. Seeds were sometime scarified by mastication, always with fatal consequences. Most seeds that were consumed were destroyed during ingestion and digestion. Only small seeds (<10 mm were found in the feces and germination tests suggest a positive effect from the passage through the guts. Peccaries clearly have a double role as both seed predators and as small seeds dispersers, which is a specialised role within the granivore/frugivore community of the Atlantic rainforest.
Detection methods of pulsed X-rays for transmission tomography with a linear accelerator
International Nuclear Information System (INIS)
Glasser, F.
1988-07-01
Appropriate detection methods are studied for the development of a high energy tomograph using a linear accelerator for nondestructive testing of bulky objects. The aim is the selection of detectors adapted to a pulsed X-ray source and with a good behavior under X-ray radiations of several MeV. Performance of semiconductors (HgI 2 , Cl doped CdTe, GaAs, Bi 12 Ge0 20 ) and a scintillator (Bi 4 Ge 3 0 12 ) are examined. A prototype tomograph gave images that show the validity of detectors for analysis of medium size equipment such as a concrete drum of 60 cm in diameter [fr
Seismic behavior of conxl connections in concrete filled steel Tube ...
African Journals Online (AJOL)
This connection consists of collar flange, collar corner, and collar web extension. In this paper, the seismic behavior of these types of connections is investigated using the numerical method. For this purpose, three samples of ConXL connections without concrete filler, with concrete filler and with concrete filler and stiffener ...
The method of attachment influences accelerometer-based activity data in dogs.
Martin, Kyle W; Olsen, Anastasia M; Duncan, Colleen G; Duerr, Felix M
2017-02-10
Accelerometer-based activity monitoring is a promising new tool in veterinary medicine used to objectively assess activity levels in dogs. To date, it is unknown how device orientation, attachment method, and attachment of a leash to the collar holding an accelerometer affect canine activity data. It was our goal to evaluate whether attachment methods of accelerometers affect activity counts. Eight healthy, client-owned dogs were fitted with two identical neck collars to which two identical activity monitors were attached using six different methods of attachment. These methods of attachment evaluated the use of a protective case, positioning of the activity monitor and the tightness of attachment of the accelerometer. Lastly, the effect of leash attachment to the collar was evaluated. For trials where the effect of leash attachment to the collar was not being studied, the leash was attached to a harness. Activity data obtained from separate monitors within a given experiment were compared using Pearson correlation coefficients and across all experiments using the Kruskal-Wallis Test. There was excellent correlation and low variability between activity monitors on separate collars when the leash was attached to a harness, regardless of their relative positions. There was good correlation when activity monitors were placed on the same collar regardless of orientation. There were poor correlations between activity monitors in three experiments: when the leash was fastened to the collar that held an activity monitor, when one activity monitor was housed in the protective casing, and when one activity monitor was loosely zip-tied to the collar rather than threaded on using the provided metal loop. Follow-up, pair-wise comparisons identified the correlation associated with these three methods of attachment to be statistically different from the level of correlation when monitors were placed on separate collars. While accelerometer-based activity monitors are useful
Directory of Open Access Journals (Sweden)
Hongdeok Seok
Full Text Available Osteoarthritis (OA is a considerable health problem worldwide. It is known to be associated with certain occupational risk factors. We examined the prevalence rate of OA by occupational cluster. Data were collected from the Korea National Health and Nutrition Examination Surveys (2010-2013. The total number of unweighted sample size was 9,905 participants: 4,460 men and 5,445 women, and OA prevalence was 5.3% and 18.4% respectively. OA patients were defined as participants with knee/hip joint pain and radiographic change of knee/hip joint. Occupational type was classified as either white, pink, blue, or green collar based on the occupational characteristics following physical demand: white for manager and professionals; pink for clerks and service/sales workers; blue for craft/trade workers, machine operators and assemblers, and elementary manual workers; and green for agricultural/fishery workers. We calculated the odds ratios (ORs and 95% confidence intervals (95% CI for the odds of a participant's having OA according to the occupational cluster, with gender stratification. The multiple logistic regression model showed that, compared to the white collar group, the ORs of the pink, blue, and green collar workers were 1.23 (95% CI 0.64-2.36, 1.85 (95% CI 1.18-2.88, and 2.91 (95% CI 1.86-4.54, respectively, in males, and 2.53 (95% CI 1.71-3.73, 2.86 (95% CI 1.94-4.21, and 3.90 (95% CI 2.60-5.83, respectively in females. The prevalence rate of OA was associated with the occupational cluster, in order from highest to lowest: green, blue, pink, and white collar.
Directory of Open Access Journals (Sweden)
Elisabeth Rydwik
Full Text Available OBJECTIVES: Leisure-time physical activity (PA has been established to be related to more years lived without disability. However, less is known about the relationship between occupational PA and disability in old age. The aim of the study was 1 to investigate whether midlife occupational PA is related to late-life disability, and 2 to test the hypothesis that the association differs according to the occupational categories of blue and white collar work. METHODS: The study population was derived from the Swedish National Study on Aging and Care, and consisted of a random sample of 1804 subjects aged 72 and above. The association of occupational PA during the longest held occupation with disability in old age was determined using logistic regression. RESULTS: There was no significant relationship between occupational PA and disability in personal or instrumental activities of daily living (ADL after controlling for demographic and health-related factors. However, in stratified analyses moderate levels of occupational PA was associated with a lower odds ratio of dependency in personal ADL amongst white collar workers, compared to low level of occupational PA (OR = 0.34 95% C1 0.12-0.98. CONCLUSIONS: Moderate levels of midlife occupational PA were associated with a decreased risk of personal ADL disability in old age among white collar workers, but not among blue collar workers. Our results highlight the importance of encouraging white collar workers to engage in physical activity during or outside work hours.
DEFF Research Database (Denmark)
Sanden, Guro Refsum
.g. Barner-Rasmussen & Aarnio, 2011), and by drawing on interview and document data from the companies’ communication departments, this study investigates whether headquarters staff make any particular considerations in their blue-collar communication. The findings – which are discussed on the basis......The present study examines how two Danish manufacturing companies – Grundfos and ECCO – communicate corporate information to blue-collar employees located in foreign production units. Blue-collar employees have been found to have lower foreign language skills than white-collar employees (e...... of communication accommodation theory (CAT) (Giles & Wiemann, 1987) – reveal that communication professionals at headquarters converge towards blue-collar employees in three distinct ways: in the form of stylistic, linguistic, and modal convergence. The findings also suggest that the need for convergence arises...
Directory of Open Access Journals (Sweden)
Priscila Reis Kahwage
2010-12-01
Full Text Available Estudos relacionados à obtenção e avaliação de sêmen de Tayassu tajacu são escassos, sendo necessárias pesquisas a respeito. Os objetivos do estudo foram avaliar a biometria testicular de caititus adultos cativos, testar a eficiência da eletroejaculação para obtenção de sêmen e avaliar suas características seminais ao longo do ano. Procedeu-se à eletroejaculação em oito animais adultos e as amostras de sêmen colhidas foram avaliadas quanto às características físicas e morfológicas. Os animais tinham testículo esquerdo com 3,8 ± 0,4 cm X 2,6 ± 0,3 cm e 2,3 ± 0,2 de consistência, e testículo direito com 3,8 ± 0,5 cm X 2,7 ± 0,3 cm e 2,3 ± 0,2 de consistência. A taxa de sucesso nas colheitas foi de 75,21%. O sêmen possuiu: volume 0,81 ± 0,86 mL, concentração 137,44 ± 153 x 106 sptz mL-1, pH 7,92 ± 0,73, motilidade 52,66 ± 28,79%, vigor 2,2 ± 0,8, integridade de membrana plasmática 55,84 ± 28,55%, defeitos maiores 22,87 ± 12,93%, defeitos menores 9,11 ± 5,88% e defeitos totais 31,52 ± 13,81%. Os animais apresentaram simetria testicular, a eletroejaculação se mostrou eficiente para a obtenção de ejaculados em caititus e as flutuações observadas na produção seminal não foram suficientes para caracterizá-los como animais de reprodução sazonal.Research development in semen collection and sperm evaluation of Tayassu tajacu are necessary. The aims of this research were to evaluate testicular biometry of captive collared peccaries, test electroejaculation for semen collection and evaluate seminal characteristics during the year. Eight animals were submitted to electroejaculation and semen samples were evaluated according their physical and morphological characteristics. Left testicles measured 3.8 ± 0.4 cm X 2.6 ± 0.3 cm and presented 2.3 ± 0.2 of consistence, while right testicles were 3.8 ± 0.5 cm X 2.7 ± 0.3 cm and presented 2.3 ± 0.2 of consistence. Success rate on semen collections
2013-07-31
... ATP Holders. \\9\\ If the Exchange announces by Trader Update that the Trading Collars are being... will publish a Trader Update that advises ATP Holders when the Trading Collars will return to the bid... displayed price of the collared order.\\10\\ As set forth in proposed Rule 967NY(a)(4)(C)(iii), should market...
India - Gulf Cooperation Council Relations: Raj Version 2.0?
2013-04-01
protectionist relative to the GCC. Customs rates are relatively higher, administrative requirements are extensive, and a culture of "red-tapism" continues to...Bollywood movies and other Indian cultural phenomena that one finds in the Gulf are in large part popular because of the presence of the expatriate...textiles, spices , food products, and even electrical goods, the information technology and other white collar sectors have far more transformational
Directory of Open Access Journals (Sweden)
Bhupinder Kaur
2016-06-01
Conclusions: Consumption of LGI meals was capable of attenuating 24-hour blood glucose profiles and decreasing postprandial glucose excursions in healthy Asian males. Additionally, LGI mixed meals were able to promote fat oxidation over carbohydrate oxidation when compared to HGI mixed meals. The consumption of low GI meals may be a strategic approach in improving overall glycaemia and increasing fat oxidation in Asians consuming a high carbohydrate diet.
Directory of Open Access Journals (Sweden)
Anna Albisetti
2017-11-01
Full Text Available Trypanosoma brucei belongs to a group of unicellular, flagellated parasites that are responsible for human African trypanosomiasis. An essential aspect of parasite pathogenicity is cytoskeleton remodelling, which occurs during the life cycle of the parasite and is accompanied by major changes in morphology and organelle positioning. The flagellum originates from the basal bodies and exits the cell body through the flagellar pocket (FP but remains attached to the cell body via the flagellum attachment zone (FAZ. The FP is an invagination of the pellicular membrane and is the sole site for endo- and exocytosis. The FAZ is a large complex of cytoskeletal proteins, plus an intracellular set of four specialised microtubules (MtQ that elongate from the basal bodies to the anterior end of the cell. At the distal end of the FP, an essential, intracellular, cytoskeletal structure called the flagellar pocket collar (FPC circumvents the flagellum. Overlapping the FPC is the hook complex (HC (a sub-structure of the previously named bilobe that is also essential and is thought to be involved in protein FP entry. BILBO1 is the only functionally characterised FPC protein and is necessary for FPC and FP biogenesis. Here, we used a combination of in vitro and in vivo approaches to identify and characterize a new BILBO1 partner protein-FPC4. We demonstrate that FPC4 localises to the FPC, the HC, and possibly to a proximal portion of the MtQ. We found that the C-terminal domain of FPC4 interacts with the BILBO1 N-terminal domain, and we identified the key amino acids required for this interaction. Interestingly, the FPC4 N-terminal domain was found to bind microtubules. Over-expression studies highlight the role of FPC4 in its association with the FPC, HC and FPC segregation. Our data suggest a tripartite association between the FPC, the HC and the MtQ.
Investigation of the far asymmetric region in 252Cf(sf)
International Nuclear Information System (INIS)
Hambsch, F.-J.; Oberstedt, S.
1997-01-01
A twin Frisch-gridded ionization chamber has been used to measure the fission fragment mass, kinetic-energy and angular correlations for 252 Cf(sf). In total 2.5 x 10 8 events were collected. The focus was in the far asymmetric mass region, where enhancements in the yield had been found earlier. It could be shown, that these findings are due to false events, coming from either close geometries not properly taking into account the angular-dependent energy loss in the sample and backing, from a too large angular cone selected in case of studies employing ionization chambers, or even from poor target qualities. (orig.)
International Nuclear Information System (INIS)
Hoetzl, H.; Winkler, R.
1977-01-01
A high-resolution, parallel plate Frisch grid ionization chamber with an efficient area of 3000 cm 2 , and a large area electrostatic precipitator were developed and applied to direct alpha spectrometry of air dust. Using an argon-methane mixture (P-10 gas) at atmospheric pressure the resolution of the detector system is 22 keV FWHM at 5 MeV. After sampling for one week and decay of short-lived natural activity, the sensitivity of the procedure for long-lived alpha emitters is about 0.1 fCi/m 3 taking 3 Σσ of background as the detection limit with 1000 min counting time. (author)
Indian Academy of Sciences (India)
Frisch M J, Trucks G W, Schlegel H B, Scuseria G E, Robb M A, Cheeseman J R, Scalmani G, Barone V, Mennucci B, Petersson G A, Nakatsuji H, Caricato M, Li X, Hratchian H P, Izmaylov A F, Bloino J, Zheng G, Sonnenberg J L, Hada M, Ehara M, Toyota K, Fukuda R, Hasegawa J, Ishida M, Nakajima T, Honda Y, Kitao O, ...
Mathematical Optimiation in Economics
De Finetti, Bruno
2011-01-01
Preface by B. de Finetti.- G.Th. Guilbaud: Les equilibres dans les modeles economiques.-H.W. Kuhn: Locational problems and mathematical programming.- M. Morishima: The multi-sectoral theory of economic growth.- B. Martos, J. Kornai: Experiments in Hungary with industry-wide and economy wide programming.- A. Prekopa: Probability distribution problems concerning stochastic programming problems.- R. Frisch: General principles and mathematical techniques of macroeconomic programming.
Crespo-Pérez, Verónica; Pinto, C Miguel; Carrión, Juan Manuel; Jarrín-E, Rubén D; Poveda, Cristian; de Vries, Tjitte
2016-01-01
The Shiny Cowbird, Molothrus bonariensis Gmelin, 1789, is a brood parasite of hundreds of small-bodied birds that is native to South American lowlands. Within the last 100 years this species has been expanding its range throughout the Caribbean, towards North America, but has rarely been seen above 2,000 m asl. Here, we present records of Shiny Cowbirds in Quito, a city located 2,800 m above sea level that harbors a bird community typical of the Andean valleys. We found two juvenile individuals parasitizing two different pairs of Rufous-collared Sparrow (Zonotrichia capensis Müller, 1776). This report constitutes an altitudinal range expansion of reproductive populations of ca. 500m, which may have beenprompted by anthropogenic disturbance.
Multi-fold correlations between 252Cf (sf) fragments and fission neutrons/γ-rays
International Nuclear Information System (INIS)
Duering, I.; Jahnke, U.
1993-01-01
Direction-sensitive spectroscopy of fission fragments (twin ionization chamber with Frisch grids) was combined with the measurement of neutron multiplicity distribution (P(ν), average total γ-ray energy (2x2 π Gd-loaded scintillator) as well as energy and angular distribution of neutrons and γ-rays. Based on the careful account for necessary corrections, scission configurations given by mass asymmetry, elongation (total kinetic energy of fragments), and shape asymmetry (ν 1 /ν 2 ) can be studied exclusively in correlation with differential distributions of emission products. The scheme for correcting the neutron multiplicity distribution including its separation into the contributions from the complementary fragments is presented in detail. The mass yield for extreme anti ν 1 / anti ν 2 ratios show fine structures indicating the cold shape-asymmetric fission. (orig.)
Article of Clothing for Storing and Deploying a Scarf
Romero, Robert (Inventor)
2015-01-01
A clothing article surrounds a wearer's upper torso. The article includes connected front portion, a collar. A sleeve is formed in the front portion. A jacket, and coat with an attachable/detachable scarf will be folded and stored in the inter portion of the front side of the collar area with elastic at each end and Velcro onto the inner portion of your collar, therefore eliminating the lost of them by any consumers, and especially children. A sleeve like collar attached to the coat and jacket for storing a scarf and making it easily deployable while in use.
Mental ill-health and the differential effect of employee type on absenteeism and presenteeism.
Hilton, Michael F; Scuffham, Paul A; Sheridan, Judith; Cleary, Catherine M; Whiteford, Harvey A
2008-11-01
Mental ill-health results in substantial reductions in employee productivity (absenteeism and presenteeism). This paper examines the relationship between employee psychological distress, employee type and productivity. Utilizing the Health and Performance at Work Questionnaire, in a sample of 60,556 full-time employees, the impact that psychological distress (Kessler 6) imposes on employee productivity by occupation type is examined. Comparison of white-collar workers absenteeism rates by low and high psychological distress reveals no statistically significant difference. Nevertheless, the same comparison for blue-collar workers reveals that high psychological distress results in an 18% increase in absenteeism rates. High K6 score resulted in a presenteeism increase of 6% in both blue and white-collar employees. The novel finding is that mental ill-health produces little to no absenteeism in white-collar workers yet a profound absenteeism increase in the blue-collar sector.
International Nuclear Information System (INIS)
Li Yingjie; Hu Bin
2007-01-01
A novel nonchromatographic speciation technique for the speciation of mercury by sequential cloud point extraction (CPE) combined with inductively coupled plasma optical emission spectrometry (ICP-OES) was developed. The method based on Hg 2+ was complexed with I - to form HgI 4 2- , and the HgI 4 2- reacted with the methyl green (MG) cation to form hydrophobic ion-associated complex, and the ion-associated complex was then extracted into the surfactant-rich phase of the non-ionic surfactant octylphenoxypolyethoxyethanol (Triton X-114), which are subsequently separated from methylmercury (MeHg + ) in the initial solution by centrifugation. The surfactant-rich phase containing Hg(II) was diluted with 0.5 mol L -1 HNO 3 for ICP-OES determination. The supernatant is also subjected to the similar CPE procedure for the preconcentration of MeHg + by the addition of a chelating agent, ammonium pyrrolidine dithiocarbamate (APDC), in order to form water-insolvable complex with MeHg + . The MeHg + in the micelles was directly analyzed after disposal as describe above. Under the optimized conditions, the extraction efficiency was 93.5% for Hg(II) and 51.5% for MeHg + with the enrichment factor of 18.7 for Hg(II) and 10.3 for MeHg + , respectively. The limits of detection (LODs) were 56.3 ng L -1 for Hg(II) and 94.6 ng L -1 for MeHg + (as Hg) with the relative standard deviations (RSDs) of 3.6% for Hg(II) and 4.5% for MeHg + (C = 10 μg L -1 , n = 7), respectively. The developed technique was applied to the speciation of mercury in real seafood samples and the recoveries for spiked samples were found to be in the range of 93.2-108.7%. For validation, a certified reference material of DORM-2 (dogfish muscle) was analyzed and the determined values are in good agreement with the certified values
Directory of Open Access Journals (Sweden)
Jacob RUB
2015-11-01
Full Text Available Money laundering is a leading factor in white-collar criminality, with a big effect upon Gross National Product of the Israeli and Moldova economies. Israel and Moldova have made the first steps In order to cope with money laundering phenomenon. The model of handling the phenomenon in the USA has been studied that constitutes a role model of fighting money laundering. The vast majority (77% of all frauds were committed by individuals working in one of six departments: accounting, operations, sales, executive/upper management, customer service and purchasing. In Moldova, money laundering for the most part is connected to traditional forms and activities sources of illegal proceeds .Moldova is a transit country for money laundering. A money-laundering scandal is casting Moldova’s judiciary in an unfavorable light and is raising concerns about the government’s commitment to reforms needed to keep European Union integration on track. It is a need to address corruption as a national priority, and the priority of the relations between the EU and Moldova. The money laundering scandal indicates that Moldova is reluctant to wade deeply into judicial reform. In fact, the laundered of $20 billion, is an amount more than twice the size of Moldova’s GDP in 2013, and may be that it is just the tip of the iceberg, probably. White-collar criminality in Israel and Moldova means success of coping of the enforcement and judicial systems. In order to cope with this phenomenon, Israel makes its first steps. Anyway, the message must pave the way through a creation of a new model for dealing with reduction the isolated phenomenon of money laundering in both states.SPĂLAREA DE BANI, UN FENOMEN IZOLAT ŞI UN FACTOR IMPORTANT ÎN CRIMINALITATEA GULERELOR ALBE, PUNE PRACTICA JUDICIARĂ DIN REPUBLICA MOLDOVA INTR-O SITUAŢIE DIFICILĂSpălarea de bani este un factor important în criminalitatea gulerelor albe, având un efect semnificativ asupra produ-sului na
Neck-cooling improves repeated sprint performance in the heat
Directory of Open Access Journals (Sweden)
Caroline eSunderland
2015-11-01
Full Text Available The present study evaluated the effect of neck-cooling during exercise on repeated sprint ability in a hot environment. Seven team-sport playing males completed two experimental trials involving repeated sprint exercise (5 x 6 s before and after two 45 min bouts of a football specific intermittent treadmill protocol in the heat (33.0 0.2 ºC; 53 ± 2% relative humidity. Participants wore a neck-cooling collar in one of the trials (CC. Mean power output and peak power output declined over time in both trials but were higher in CC (540 ± 99 v 507 ± 122W, d = 0.32; 719 ± 158 v 680 ± 182 W, d = 0.24 respectively. The improved power output was particularly pronounced (d = 0.51 – 0.88 after the 2nd 45 min bout but the CC had no effect on % fatigue. The collar lowered neck temperature and the thermal sensation of the neck (P 0.05. There were no trial differences but interaction effects were demonstrated for prolactin concentration and rating of perceived exertion (RPE. Prolactin concentration was initially higher in the collar cold trial and then was lower from 45 minutes onwards (interaction trial x time P=0.04. RPE was lower during the football intermittent treadmill protocol in the collar cold trial (interaction trial x time P = 0.01. Neck-cooling during exercise improves repeated sprint performance in a hot environment without altering physiological or neuroendocrinological responses. RPE is reduced and may partially explain the performance improvement.
Measurement of the neutron-induced fission cross-section of 240,242Pu
International Nuclear Information System (INIS)
Salvador-Castineira, P.; Hambsch, F.J.; Brys, T.; Oberstedt, S.; Vidali, M.; Pretel, C.
2014-01-01
Fast spectrum neutron-induced fission cross-section data for transuranic isotopes are in high demand in the nuclear data community. In particular, highly accurate data are needed for the new Generation-IV nuclear applications. The aim is to obtain precise neutron-induced fission cross-sections for 240 Pu and 242 Pu. In this context accurate data on spontaneous fission half-lives have also been measured. To minimise the total uncertainty on the fission cross-sections the detector efficiency has been studied in detail. Both isotopes have been measured using a twin Frisch-grid ionisation chamber (TFGIC) due to its superiority compared to other detector systems in view of radiation hardness, 2 x 2π solid angle coverage and very good energy resolution. (authors)
Application of activity sensors for estimating behavioral patterns
Roberts, Caleb P.; Cain, James W.; Cox, Robert D.
2016-01-01
The increasing use of Global Positioning System (GPS) collars in habitat selection studies provides large numbers of precise location data points with reduced field effort. However, inclusion of activity sensors in many GPS collars also grants the potential to remotely estimate behavioral state. Thus, only using GPS collars to collect location data belies their full capabilities. Coupling behavioral state with location data would allow researchers and managers to refine habitat selection models by using diel behavioral state changes to partition fine-scale temporal shifts in habitat selection. We tested the capability of relatively unsophisticated GPS-collar activity sensors to estimate behavior throughout diel periods using free-ranging female elk (Cervus canadensis) in the Jemez Mountains of north-central New Mexico, USA, 2013–2014. Collars recorded cumulative number of movements (hits) per 15-min recording period immediately preceding GPS fixes at 0000, 0600, 1200, and 1800 hr. We measured diel behavioral patterns of focal elk, categorizing active (i.e., foraging, traveling, vigilant, grooming) and inactive (i.e., resting) states. Active behaviors (foraging, traveling) produced more average hits (0.87 ± 0.69 hits/min, 4.0 ± 2.2 hits/min, respectively; 95% CI) and inactive (resting) behavior fewer hits (−1.1 ± 0.61 95% CI). We differentiated active and inactive behavioral states with a bootstrapped threshold of 5.9 ± 3.9 hits/15-min recording period. Mean cumulative activity-sensor hits corresponded with observed diel behavioral patterns: hits increased during crepuscular (0600, 1800 hr) observations when elk were most active (0000–0600 hr: d = 0.19; 1200–1800 hr: d = 0.64) and decreased during midday and night (0000 hr, 1200 hr) when elk were least active (1800–0000 hr: d = −0.39; 0600–1200 hr: d = −0.43). Even using relatively unsophisticated GPS-collar activity sensors, managers can
Characterization of deep energy levels in mercury iodide. Application to nuclear detection
International Nuclear Information System (INIS)
Mohammed Brahim, Tayeb.
1982-07-01
The last few years have seen an increasing interest in HgI 2 detectors for room temperature gamma and X-ray spectrometry. Performance and effective thickness of these detectors are presently limited by carrier trapping which results in incomplete charge collection. Characterization of the trapping levels has been performed by several photoelectronic methods (photoconductivity, thermal and optical quenching of the photoconductivity, TSC, lifetime measurement). A model is proposed taking into account the results obtained by these techniques and the polarization phenomena observed in nuclear detection in both vapor phase and solution grown crystals. For the latter, polarization can be eliminated or notably reduced by illumination of the positive electrode or by using a MIS positively biased structure [fr
Analysis of Mexican archaeological specimens by x-ray fluorescence spectrometry
International Nuclear Information System (INIS)
Avila Perez, P.; Zarazua Ortega, G.; Guerrero Carbajal, C.
1992-01-01
Several archaeological specimens pertaining to the museums of Anthropology and History and Mexico City's Major Temple were analyzed. To perform this analysis a HgI 2 (mercury iodine) detector property of Xsirius Inc. of United States which still is in experimental stage, a Norland multichannel, two Am-241 sources a P.C. Sillicon Valley, property of the University of Rome were used. Depending on culture type, the elements Au, Ag, Cu, Zn and Mo were analyzed. Mexica, Mixteca, Western or Michoacana and Mayan were the cultures in study. This work was undertaken with the cooperation of National Museum of Anthropology and History, University of Rome, Xsirius Inc. International Atomic Energy Agency and National Institute of Nuclear Research. (Author)
International Nuclear Information System (INIS)
Jugelt, P.; Schieckel, M.
1983-01-01
Problems and possibilities of applying semiconductor detector spectrometers in radiometric analyses are described. A summary of the state of the art and tendencies of device engineering and spectra evaluation is given. Liquid-nitrogen cooled Li-drifted Si-detectors and high-purity Ge-detectors are compared. Semiconductor detectors working at room temperature are under development. In this connection CdTe and HgI 2 semiconductor detectors are compared. The use of small efficient computers in the spectrometer systems stimulates the development of algorithms for spectra analyses and for determining the concentration. Fields of application of energy dispersive X-ray spectrometers are X-ray diffraction and X-ray macroanalysis in investigating the structure of extensive surface regions
Clearance of the cervical spine in clinically unevaluable trauma patients.
Halpern, Casey H; Milby, Andrew H; Guo, Wensheng; Schuster, James M; Gracias, Vicente H; Stein, Sherman C
2010-08-15
Meta-analytic costeffectiveness analysis. Our goal was to compare the results of different management strategies for trauma patients in whom the cervical spine was not clinically evaluable due to impaired consciousness, endotracheal intubation, or painful distracting injuries. We performed a structured literature review related to cervical spine trauma, radiographic clearance techniques (plain radiography, flexion/extension, CT, and MRI), and complications associated with semirigid collar use. Meta-analytic techniques were used to pool data from multiple sources to calculate pooled mean estimates of sensitivities and specificities of imaging techniques for cervical spinal clearance, rates of complications from various clearance strategies and from empirical use of semirigid collars. A decision analysis model was used to compare outcomes and costs among these strategies. Slightly more than 7.5% of patients who are clinically unevaluable have cervical spine injuries, and 42% of these injuries are associated with spinal instability. Sensitivity of plain radiography or fluoroscopy for spinal clearance was 57% (95% CI: 57%-60%). Sensitivities for CT and MRI alone were 83% (82%-84%) and 87% (84%-89%), respectively. Complications associated with collar use ranged from 1.3% (2 days) to 7.1% (10 days) but were usually minor and short-lived. Quadriplegia resulting from spinal instability missed by a clearance test had enormous impacts on longevity, quality of life, and costs. These impacts overshadowed the effects of prolonged collar application, even when the incidence of quadriplegia was extremely low. As currently used, neuroimaging studies for cervical spinal clearance in clinically unevaluable patients are not cost-effective compared with empirical immobilization in a semirigid collar.
Effects of tree species, water and nitrogen on mycorrhizal C flux
Menyailo, O.; Matvienko, A.
2012-12-01
Mycorrhiza plays an important role in global carbon cycle, especially, in forest soils, yet the effect of tree species on the amount and timing of C transfer through roots to myccorhiza is largely unknown. We studied the C transport to mycorrhiza under 6 most commonly dominant in boreal forests tree species using the mesh collars installed at the Siberian afforestation experiment. The CO2 flux from mycorrhizal and non-mycorrhizal mesh collars indicated the mycorrhizal C flux. Tree species strongly differed in C flux to mycorrhiza: more C was transferred by deciduous species than by conifers. The mycorrhizal CO2 flux was not linked to soil temperature but rather to trees phenology and to photosynthetic activity. All tree species transfered more carbon to mycorrhiza during the second half of summer and in September, this is because all the carbon photosynthesized earlier is used for building the tree biomass. Seasonal variation in C transfer to mycorrhiza was much larger than hourly variation (within a day). Nitrogen application (50 kg/ha) increased mycorrhizal C flux only under Scots pine, but not under larch, thus the effect of N application is tree species dependent. We found under most tree species that more C was transferred by trees to mycorrhiza in root-free collars, where the soil moisture was higher than in collars with roots. This suggests that trees preferentially support those parts of mycorrhiza, which can gain extra-resources.
Ribeiro-Lima, J; Carstensen, M; Cornicelli, L; Forester, J D; Wells, S J
2017-10-01
The main objective of this study was to characterize spatial patterns of white-tailed deer (Odocoileus virginianus) movement related to bovine tuberculosis (bTB) transmission risk to cattle in north-western Minnesota. Twenty-one adult deer (16 females and 5 males) were captured during winter (January-March) 2011 in areas adjacent to where an outbreak (2005-2009) of bTB occurred in deer and cattle. Deer were fitted with GPS collars programmed to collect deer location information every 90 min over a 15-month period. The exact locations of cattle, cattle feeding areas, and stored forage that were available to collared deer were assessed seasonally. In total, 47% (n = 9) of collared deer survived to the end of the study. Causes of mortality included wolves (n = 6), hunters (n = 1) and unknown (n = 2); additionally, 2 deer were censored due to collar malfunctions. Our results indicated that 5 deer (25%) had home ranges that included 6 cattle farms (20%). Most (77%) of the deer visits occurred in areas where cattle were present, with most visits (60%) from 00:00 to 06:00. March to May revealed the most farm visitations by deer (37%). This study provided baseline information regarding cattle-deer interactions critical to transmission of bTB in this region and suggested that risk mitigation practices should be implemented to separate wildlife and domestic livestock when feasible. © 2016 Blackwell Verlag GmbH.
Fateful discovery almost forgotten
International Nuclear Information System (INIS)
Anon.
1989-01-01
The paper reviews the discovery of the fission of uranium, which took place fifty years ago. A description is given of the work of Meitner and Frisch in interpreting the Fermi data on the bombardment of uranium nuclei with neutrons, i.e. proposing fission. The historical events associated with the development and exploitation of uranium fission are described, including the Manhattan Project, Hiroshima and Nagasaki, Shippingport, and Chernobyl. (U.K.)
Raj Chetty; Adam Guren; Day Manoli; Andrea Weber
2011-01-01
We evaluate whether state-of-the-art macro models featuring indivisible labor are consistent with modern quasi-experimental micro evidence by synthesizing evidence on both the intensive and extensive margins. We find that micro estimates are consistent with macro estimates of the steady-state (Hicksian) elasticities relevant for cross-country comparisons on both the extensive and intensive margins. However, micro estimates of intertemporal substitution (Frisch) elasticities are an order of ...