WorldWideScience

Sample records for hfr ac impedance

  1. ac impedance of the carbon monofluoride electrode

    Science.gov (United States)

    Suchanski, M. R.

    1985-09-01

    The ac impedance of carbon monofluoride (CF) half-cells and Li/CF batteries that contain 1M LiBF4/4-butyrolactone electrolyte was measured as a function of state of charge. The nonfaradaic components of the CF half-cell impedance were resolved with the aid of a one-dimensional macroscopic treatment of a porous electrode. The values of the nonfaradaic components and their variation with charge withdrawn provide information concerning the nature of cathode discharge products, the degree of tortuosity in the cathode and separator matrices, and the cathode failure mechanism. The CF electrode capacitance, as measured by the low frequency quadrature impedance, can serve as a semiquantitative measure of battery state of charge under certain conditions.

  2. Microfabricated Thin Film Impedance Sensor & AC Impedance Measurements

    Directory of Open Access Journals (Sweden)

    Jinsong Yu

    2010-06-01

    Full Text Available Thin film microfabrication technique was employed to fabricate a platinum based parallel-electrode structured impedance sensor. Electrochemical impedance spectroscopy (EIS and equivalent circuit analysis of the small amplitude (±5 mV AC impedance measurements (frequency range: 1 MHz to 0.1 Hz at ambient temperature were carried out. Testing media include 0.001 M, 0.01 M, 0.1 M NaCl and KCl solutions, and alumina (~3 μm and sand (~300 μm particulate layers saturated with NaCl solutions with the thicknesses ranging from 0.6 mm to 8 mm in a testing cell, and the results were used to assess the effect of the thickness of the particulate layer on the conductivity of the testing solution. The calculated resistances were approximately around 20 MΩ, 4 MΩ, and 0.5 MΩ for 0.001 M, 0.01 M, and 0.1 M NaCl solutions, respectively. The presence of the sand particulates increased the impedance dramatically (6 times and 3 times for 0.001 M and 0.1 M NaCl solutions, respectively. A cell constant methodology was also developed to assess the measurement of the bulk conductivity of the electrolyte solution. The cell constant ranged from 1.2 to 0.8 and it decreased with the increase of the solution thickness.

  3. AC Impedance Behaviour of Black Diamond Films

    Institute of Scientific and Technical Information of China (English)

    Haitao YE; Olivier GAUDIN; Richard B.JACKMAN

    2005-01-01

    The first measurement of impedance on free-standing diamond films from 0.1 Hz to 10 MHz up to 300℃ were reported. A wide range of chemical vapour deposition (CVD) materials were investigated, but here we concentrate are well fitted to a RC parallel circuit model and the equivalent resistance and capacitance for the diamond films have been estimated using the Zview curve fitting. The results show only one single semicircle response at each temperature measured. It was found that the resistance decreases from 62 MΩ at room temperature to 4 kΩ at300℃, with an activation energy around 0.51 eV. The equivalent capacitance is maintained at the level of 100 pF up to 300℃ suggesting that the diamond grain boundaries are dominating the conduction. At 400℃, the impedance at low frequencies shows a linear tail, which can be explained that the AC polarization of diamond/Au interface occurs.

  4. Equivalent circuit models for ac impedance data analysis

    Science.gov (United States)

    Danford, M. D.

    1990-01-01

    A least-squares fitting routine has been developed for the analysis of ac impedance data. It has been determined that the checking of the derived equations for a particular circuit with a commercially available electronics circuit program is essential. As a result of the investigation described, three equivalent circuit models were selected for use in the analysis of ac impedance data.

  5. Equivalent Circuits For AC-Impedance Analysis Of Corrosion

    Science.gov (United States)

    Danford, M. D.

    1992-01-01

    Report presents investigation of equivalent circuits for ac-impedance analysis of corrosion. Impedance between specimen and electrolyte measured as function of frequency. Data used to characterize corrosion electrochemical system in terms of equivalent circuit. Eleven resistor/capacitor equivalent-circuit models were analyzed.

  6. Impedance Localization Measurements using AC Dipoles in the LHC

    CERN Document Server

    Biancacci, Nicolo; Papotti, Giulia; Persson, Tobias; Salvant, Benoit; Tomás, Rogelio

    2016-01-01

    The knowledge of the LHC impedance is of primary importance to predict the machine performance and allow for the HL-LHC upgrade. The developed impedance model can be benchmarked with beam measurements in order to assess its validity and limit. This is routinely done, for example, moving the LHC collimator jaws and measuring the induced tune shift. In order to localize possible unknown impedance sources, the variation of phase advance with intensity between beam position monitors can be measured. In this work we will present the impedance localization measurements performed at injection in the LHC using AC dipoles as exciter as well as the underlying theory.

  7. MD 349: Impedance Localization with AC-dipole

    CERN Document Server

    Biancacci, Nicolo; Metral, Elias; Salvant, Benoit; Papotti, Giulia; Persson, Tobias Hakan Bjorn; Tomas Garcia, Rogelio; CERN. Geneva. ATS Department

    2016-01-01

    The purpose of this MD is to measure the distribution of the transverse impedance of the LHC by observing the phase advance variation with intensity between the machine BPMs. Four injected bunches with different intensities are excited with an AC dipole and the turn by turn data is acquired from the BPM system. Through post-processing analysis the phase variation along the machine is depicted and, from this information, first conclusions of the impedance distribution can be drawn.

  8. AC impedance study of degradation of porous nickel battery electrodes

    Science.gov (United States)

    Lenhart, Stephen J.; Macdonald, D. D.; Pound, B. G.

    1987-01-01

    AC impedance spectra of porous nickel battery electrodes were recorded periodically during charge/discharge cycling in concentrated KOH solution at various temperatures. A transmission line model (TLM) was adopted to represent the impedance of the porous electrodes, and various model parameters were adjusted in a curve fitting routine to reproduce the experimental impedances. Degradation processes were deduced from changes in model parameters with electrode cycling time. In developing the TLM, impedance spectra of planar (nonporous) electrodes were used to represent the pore wall and backing plate interfacial impedances. These data were measured over a range of potentials and temperatures, and an equivalent circuit model was adopted to represent the planar electrode data. Cyclic voltammetry was used to study the characteristics of the oxygen evolution reaction on planar nickel electrodes during charging, since oxygen evolution can affect battery electrode charging efficiency and ultimately electrode cycle life if the overpotential for oxygen evolution is sufficiently low.

  9. Using ac dipoles to localize sources of beam coupling impedance

    Directory of Open Access Journals (Sweden)

    N. Biancacci

    2016-05-01

    Full Text Available The beam coupling impedance is one of the main sources of beam instabilities and emittance blow up in circular accelerators. A refined machine impedance evaluation is therefore required in order to understand and model intensity dependent effects and instabilities that may limit the machine performance. For this reason, many impedance source localization techniques have been developed. In this work we present the impedance localization technique based on the observation of phase advance versus intensity at the beam position monitors using ac dipoles to force betatron oscillations. We present analytical formulas for the interpretation of measurements together with simulations to benchmark and illustrate the equations. Studies on the method accuracy for different Fourier transform algorithms are presented as well as first exploratory measurements performed in the LHC.

  10. Alternating current(AC) corrosion analyzed by electrochemical impedance spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Ha, Tae Hyun; Kim, Dae Kyeong; Bae, Jeong Hyo; Lee, Hyun Goo; Lee, Sung Jin [Korea Electrotechnology Research Institute, Changwon (Korea, Republic of)

    2002-12-15

    So far, many research results on AC corrosion have been reported but each one is not consistent with another. In order to understand the characteristics and factors affecting on AC corrosion, Electrochemical impedance spectroscopy (E.I.S) was used and changes in kinetics and surface properties was analyzed. Generally, E.I.S. test has been used mainly for the diagnosis of the concrete corrosion and coating material. However, considering the outstanding functions of E.I.S. test, it can be adopted as a good method to study AC corrosion. Electrolyte resistance (R{sub sol}), double layer capacitance (C{sub dl}) and polarization resistance (R{sub p}) are the basic circuit elements. Using the model which is consist of these basic elements, various results of E.I.S. test can be interpreted. And through this method the mechanism and characteristics of AC corrosion can be explained

  11. Impedance, AC conductivity and dielectric behavior Adeninium Trichloromercurate (II)

    Science.gov (United States)

    Fersi, M. Amine; Chaabane, I.; Gargouri, M.

    2016-09-01

    In this work, we report the measurements impedance spectroscopy technique for the organic-inorganic hybrid compound (C5H6N5) HgCl3, 11/2H2O measured in the 209 Hz-5 MHz frequency range from 378 to 428 K. Besides, the Cole-Cole (Z″ versus Z‧) plots were well fitted to an equivalent circuit built up by a parallel combination of resistance (R), fractal capacitance (CPE) and capacitance (C). Furthermore, the AC conductivity was investigated as a function of temperature and frequency in the same range. The experiment results indicated that AC conductivity (σac) was proportional to σdc + A ωS . The obtained results are discussed in terms of the correlated barrier hopping (CBH) model. An agreement between the experimental and theoretical results suggests that the AC conductivity behavior of Adeninium Trichloromercurate (II) can be successfully explained by CBH model. The contribution of single polaron hopping to AC conductivity in a present alloy was also studied.

  12. HVDC-AC system interaction from AC harmonics. Volume 1. Harmonic impedance calculations. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Breuer, G D; Chow, J H; Lindh, C B; Miller, N W; Numrich, F H; Price, W W; Turner, A E; Whitney, R R

    1982-09-01

    Improved methods are needed to characterize ac system harmonic behavior for ac filter design for HVDC systems. The purpose of this General Electric Company RP1138 research is to evaluate the present filter design practice and to investigate methods for calculating system harmonic impedances. An overview of ac filter design for HVDC systems and a survey of literature related to filter design have been performed. Two methods for calculating system harmonic impedances have been investigated. In the measurement method, an instrumentation system for measuring system voltage and current has been assembled. Different schemes of using the measurements to calculate system harmonic impedances have been studied. In the analytical method, a procedure to include various operating conditions has been proposed. Computer programs for both methods have been prepared, and the results of the measurement and analytical methods analyzed. A conclusion of the project is that the measurement and analytical methods both provided reasonable results. There are correlations between the measured and analytical results for most harmonics, although there are discrepancies between the assumptions used in the two methods. A sensitivity approach has been proposed to further correlate the results. From the results of the analysis, it is recommended that both methods should be tested further. For the measurement method, more testing should be done to cover different system operating conditions. In the analytical method, more detailed models for representing system components should be studied. In addition, alternative statistical and sensitivity approaches should be attempted.

  13. HVDC-AC system interaction from AC harmonics. Volume 1. Harmonic impedance calculations. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Breuer, G D; Chow, J H; Lindh, C B; Miller, N W; Numrich, F H; Price, W W; Turner, A E; Whitney, R R

    1982-09-01

    Improved methods are needed to characterize ac system harmonic behavior for ac filter design for HVDC systems. The purpose of this General Electric Company RP1138 research is to evaluate the present filter design practice and to investigate methods for calculating system harmonic impedances. An overview of ac filter design for HVDC systems and a survey of literature related to filter design have been performed. Two methods for calculating system harmonic impedances have been investigated. In the measurement method, an instrumentation system for measuring system voltage and current has been assembled. Different schemes of using the measurements to calculate system harmonic impedances have been studied. In the analytical method, a procedure to include various operating conditions has been proposed. Computer programs for both methods have been prepared, and the results of the measurement and analytical methods analyzed. A conclusion of the project is that the measurement and analytical methods both provided reasonable results. There are correlations between the measured and analytical results for most harmonics, although there are discrepancies between the assumptions used in the two methods. A sensitivity approach has been proposed to further correlate the results. From the results of the analysis, it is recommended that both methods should be tested further. For the measurement method, more testing should be done to cover different system operating conditions. In the analytical method, more detailed models for representing system components should be studied. In addition, alternative statistical and sensitivity approaches should be attempted.

  14. AC impedance spectroscopy on copper phthalocyanine thin films

    Science.gov (United States)

    Robinson, Kyle P.

    Impedance spectroscopy is used to study copper phthalocyanine thin films in order to disentangle the contributions of the crystal and the unavoidable grain boundaries. The spectroscopy data is fit with an equivalent circuit model to determine resistance, capacitance, and activation energy for different grain morphologies. The copper phthalocyanine thin films are deposited via thermal evaporation on platinum interdigitated electrodes on glass substrates at different temperatures from 300 to 530 K with constant thickness of 22 nm. AC measurements, implementing a precision LCR meter are taken from 20Hz - 2 MHz, and at measurement temperatures from 25 - 90 °C. Stabilizing current by subjecting samples to 5 days in the dark, the impedance spectrum can be represented by Cole-Cole plots, which show either one or two peaks. The two maxima may be attributed to the crystalline bulk and grain boundaries of the film. We observe that the grain boundary resistance component changes by three orders of magnitude when varying the grain morphology, and the capacitance changes by one order of magnitude. The resistance of the grain boundary shows a minimum near the phase transition temperature of 450 K, followed by an increase in resistance for samples deposited at higher temperatures. The capacitance on the other hand, shows a maximum near the phase transition temperature. Similarly, the activation energy for the grain boundary peaks at 1.29 +/- 0.12 eV at the same phase-transition tempemture, whereas the crystalline bulk component has a constant activation energy of 0.36 +/- 0.08 eV for all sample of different grain sizes. Additional data taken using a perpendicular configuration for a 30 nm thick cobalt phthalocyanine thin film shows a double peak. The low temperature measurements for these samples are interpreted to have two contributions from micro-shorts and crystalline bulk.

  15. Power flow analysis for droop controlled LV hybrid AC-DC microgrids with virtual impedance

    DEFF Research Database (Denmark)

    Li, Chendan; Chaudhary, Sanjay; Vasquez, Juan Carlos

    2014-01-01

    The AC-DC hybrid microgrid is an effective form of utilizing different energy resources and the analysis of this system requires a proper power flow algorithm. This paper proposes a suitable power flow algorithm for LV hybrid AC-DC microgrid based on droop control and virtual impedance. Droop...... and virtual impedance concepts for AC network, DC network and interlinking converter are reviewed so as to model it in the power flow analysis. The validation of the algorithm is verified by comparing it with steady state results from detailed time domain simulation. The effectiveness of the proposed...

  16. Neutron metrology in the HFR

    Energy Technology Data Exchange (ETDEWEB)

    Voorbraak, W.P.; Freudenreich, W.E.; Stecher-Rasmussen, F.; Verhagen, H.W.

    1991-10-01

    Neutron fluence rate and gamma dose data are presented for the first series of experiments at the filtered HFR beam HB11 at full reactor power. Measurements were performed on two beagle dogs and one cylindrical phantom. The main results for thermal and epithermal fluence rates, physical neutron dose and gamma dose are presented in the tables 1 and 2. (author). 10 refs.; 9 figs.; 8 tabs.

  17. Neutron metrology in the HFR

    Energy Technology Data Exchange (ETDEWEB)

    Voorbraak, W.P.; Freudenreich, W.E.; Paardekooper, A.; Stecher-Rasmussen, F.; Verhagen, H.W.

    1991-11-01

    Results are presented of the ECN measurements at the filtered HFR beam HB11. The neutron measurements took place in the free beam at full power. Several gamma measurements were performed at full power under different conditions. The neutron spectrum was obtained by adjusting a calculated spectrum with experimental results from activation foils. The gamma data were obtained with thermoluminescent dosimeters. (author). 5 refs.; 4 figs.; 4 tabs.

  18. Current distribution effects in AC impedance spectroscopy of electroceramic point contact and thin film model electrodes

    DEFF Research Database (Denmark)

    Nielsen, Jimmi; Jacobsen, Torben

    2010-01-01

    The Finite-Element-Method (FEM) was used for the simulations of the effect of a changing current distribution during AC impedance spectrum recording on electroceramic point contact and thin film model electrodes. For pure electronic conducting point contact electrodes the transition from the prim......The Finite-Element-Method (FEM) was used for the simulations of the effect of a changing current distribution during AC impedance spectrum recording on electroceramic point contact and thin film model electrodes. For pure electronic conducting point contact electrodes the transition from...... regarding its significance is provided. The associated characteristic impedance spectrum shape change is simulated and its origin discussed. Furthermore, the characteristic shape of impedance spectra of thin electroceramic film electrodes with lateral ohmic resistance is studied as a function...

  19. An AC impedance study of the degradation of porous nickel battery electrodes

    Energy Technology Data Exchange (ETDEWEB)

    Lenhart, S.J.; Macdonald, D.D.; Pound, B.G.

    1988-05-01

    AC impedance spectra of porous nickel battery electrodes were recorded periodically during charge/discharge cycling in concentrated KOH solution at various temperatures. A transmission line model (TLM) was adopted to represent the impedance of the porous electrodes, and various model parameters were adjusted in a curve fitting routine to reproduce the experimental impedances. Degradation processes were deduced from changes in model parameters with electrode cycling time. In developing the TLM, impedance spectra of planar (nonporous) electrodes were used to represent the pore wall and backing plate interfacial impedances. These data were measured over a range of potentials and temperatures, and an equivalent circuit model was adopted to represent the planar electrode data. Cyclic voltammetry was used to study the characteristics of the oxygen evolution reaction on planar nickel electrodes during charging, since oxygen evolution can affect battery electrode charging efficiency and ultimately electrode cycle life if the overpotential for oxygen evolution is sufficiently low. Transmission line modeling results suggest that porous rolled and bonded nickel electrodes undergo restructuring during charge/discharge cycling prior to failure. The average pore length and the number of active pores decreases during cycling, while the average solid phase resistivity increases. The average solution phase resistivity remains relatively constant during cycling, and the total porous electrode impedance is relatively insensitive to the solution/backing plate interfacial impedance.

  20. AC Impedance Studies on Metal/Nanoporous Silicon/p-Silicon Structures

    Science.gov (United States)

    Mabrook, M. F.; Ray, A. K.

    2016-11-01

    Alternating current (AC) impedance measurements have been performed on 10- to 15-μm thick porous silicon layers on a (100) p-type silicon (p(+)Si) substrate with the aluminium (Al) top electrode in a sandwich configuration in the range of 20 Hz-1 MHz and in the temperature ranging between 152 K and 292 K. The ac conductivity σ ac was found to increase with frequency f according to the universal power law: σ_{ac} = Afs where the exponent s is a frequency and temperature-dependent quantity. A hopping process is found to be dominant at low temperatures and high frequencies, while a thermally activated free band process is responsible for conduction at higher temperatures. Capacitance is found to decrease with frequency but increase with temperature. Frequency dependence of the loss tangent is observed with a temperature-dependent minimum value.

  1. Laser Raman and ac impedance spectroscopic studies of PVA: NH4NO3 polymer electrolyte.

    Science.gov (United States)

    Hema, M; Selvasekarapandian, S; Hirankumar, G; Sakunthala, A; Arunkumar, D; Nithya, H

    2010-01-01

    Ion conducting polymer electrolyte PVA:NH(4)NO(3) has been prepared by solution casting technique and characterized using XRD, Raman and ac impedance spectroscopic analyses. The amorphous nature of the polymer films has been confirmed by XRD and Raman spectroscopy. An insight into the deconvoluted Raman peaks of upsilon(1) vibration of NO(3)(-) anion for the polymer electrolyte reveals the dominancy of ion aggregates at higher NH(4)NO(3) concentration. From the ac impedance studies, the highest ion conductivity at 303 K has been found to be 7.5x10(-3)Scm(-1) for 80PVA:20NH(4)NO(3). The conductivity of the polymer electrolytes has been found to depend on the degree of dissociation of the salt in the host polymer matrix. The combination of the above-mentioned analyses has proven worth while and in fact necessary in order to achieve better understanding of these complex systems.

  2. Effect of temperature on the AC impedance of protein and carbohydrate biopolymers

    Indian Academy of Sciences (India)

    S Muthulakshmi; S Iyyapushpam; D Pathinettam Padiyan

    2014-12-01

    The influence of temperature on the electrical behaviour of protein biopolymer papain and carbohydrate biopolymers like gum acacia, gum tragacanth and guar gum has been investigated using AC impedance technique. The observed semi-circles represent the material’s bulk electrical property that indicate the single relaxation process in the biopolymers. An increase in bulk electrical conductivity in the biopolymers with temperature is due to the hopping of charge carriers between the trapped sites. The depression parameter reveals the electrical equivalent circuit for the biopolymers. The AC electrical conductivity in the biopolymers follows the universal power law. From this, it is observed that the AC conductivity is frequency dependent and the biopolymer papain obeys large polaron tunnelling model, gum acacia and gum guar obey ion or electron tunnelling model, and gum tragacanth obeys the correlated barrier hopping model of conduction mechanisms.

  3. Poly Meta-Aminophenol: Chemical Synthesis, Characterization and Ac Impedance Study

    Directory of Open Access Journals (Sweden)

    Thenmozhi Gopalasamy

    2014-01-01

    Full Text Available The present work is an investigation of AC impedance behaviour of poly(meta-aminophenol. The polymer was prepared by oxidative chemical polymerization of meta-aminophenol in aqueous HCl using ammonium persulfate as an oxidant at 0–3°C. The synthesized polymer was characterized by GPC, Elemental analysis, UV-VIS-NIR, FT-IR, 1H NMR, XRD, SEM, and TGA-DTA. The AC conductivity and dielectric response were measured at a temperature range from 303 to 383 K in the frequency range of 20 Hz to 106 Hz. The AC conductivity data could be described by the relation σacω=AωS, where the parameter “S” and Rb values decrease in the entire range of study and hence follow Correlated Barrier Hopping conduction mechanism. Both dielectric constant and dielectric loss increase with the decrease of frequency exhibiting strong interfacial polarization at low frequency and the dissipation factor also decreases with frequency. Complex electric modulus and dissipation factor exhibit two relaxation peaks, indicating two-phase structure as indicated by a bimodal distribution of relaxation process. The activation energies corresponding to these two relaxation processes were found to be 0.07 and 0.1 eV.

  4. Low frequency and low temperature behavior of ZnO-based varistor by ac impedance measurements

    Science.gov (United States)

    Al Abdullah, K.; Bui, A.; Loubiere, A.

    1991-04-01

    This paper reports on an original work on the study of the behavior of ZnO-based varistor by ac impedance measurements. The measurements of complex impedance response to small ac signals applied to samples have been achieved in the frequency range 10-3-7×106 Hz and a temperature range -196-145 °C. In the temperature range below -120±10 °C, a complete semicircular relaxation phenomenon has been observed, which is in good agreement with the Debye model. In the temperature range above -120±10 °C, the appearance of the depression angle θ may arise from the heterogeneity of the barriers of the ceramic varistor. A Cole-Cole distribution function of the relaxation time constants was used to characterize the response of the ceramic device as a function of temperature. No observable influence in the response was introduced by either the space charge or the electrode. Using the leakage resistance measurements from the complex plane, two values of the activation energies were observed; 0.36±0.02 eV and 0.01±0.001 eV. Similarly, the boundary layer equivalent capacitance measurements detect two other energy levels: 0.06±0.005 eV and about 0 eV.

  5. Study of metal corrosion using ac impedance techniques in the STS launch environment

    Science.gov (United States)

    Calle, Luz M.

    1989-01-01

    AC impedance measurements were performed to investigate the corrosion resistance of 19 alloys under conditions similar to the STS launch environment. The alloys were: Zirconium 702, Hastelloy C-22, Inconel 625, Hastelloy C-276, Hastelloy C-4, Inconel 600, 7Mo + N, Ferralium 255, Inco Alloy G-3, 20Cb-3, SS 904L, Inconel 825, SS 304LN, SS 316L, SS 317L, ES 2205, SS 304L, Hastelloy B-2, and Monel 400. AC impedance data were gathered for each alloy after one hour immersion time in each of the following three electrolyte solutions: 3.55 percent NaCl, 3.55 percent NaCl-0.1N HCl, and 3.55 percent NaCl-1.0N HCl. The data were analyzed qualitatively using the Nyquist plot and quantitatively using the Bode plot. Polarization resistance, Rp, values were obtained using the Bode plot. Zirconium 702 was the most corrosion resistant alloy in the three electrolytes. The ordering of the other alloys according the their resistance to corrosion varied as the concentration of hydrochloric acid in the electrolyte increased. The corrosion resistance of Zirconium 702 and Ferralium 255 increased as the concentration of hydrochloric acid in the electrolyte increased. The corrosion resistance of the other 17 alloys decreased as the concentration of the hyrdochloric acid in the electrolyte increased.

  6. Examination of the role of molybdenum in passivation of stainless steels using ac impedance spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Jargelius-Pettersson, R.F.A. [Swedish Inst. for Metals Research, Stockholm (Sweden); Pound, B.G. [SRI International, Menlo Park, CA (United States). Materials Research Center

    1998-05-01

    The role of Mo in the passivation of stainless steels was investigated using ac impedance spectroscopy. Six steels were examined: two ferritic (Fe-20Cr) alloys containing 0 and 1% Mo and four austenitic (Fe-20Cr-25Ni) alloys containing 0, 1, 2, and 4.5% Mo. The experiments were performed in 1 M HCl and, in some cases, 0.5 M H{sub 2}SO{sub 4}, 1 M HCl + 3 M NaCl, and 4 M HCl. Quasi steady-state polarization curves were obtained and the impedance was measured at potentials in the active region and through the active-to-passive transition. The impedance spectra exhibited up to four arcs with well-resolved time constants. Equivalent circuit parameters were evaluated in each case to examine the effect of Mo on the dissolution of the alloys. Mo appears to influence virtually all of the principal reactions involved in the dissolution, intermediate formation, and passivation of stainless steels. Its effect is complex and extends beyond a single reaction step in the mechanism for the dissolution and passivation of these alloys.

  7. Power Flow Analysis for Low-Voltage AC and DC Microgrids Considering Droop Control and Virtual Impedance

    DEFF Research Database (Denmark)

    Li, Chendan; Chaudhary, Sanjay Kumar; Savaghebi, Mehdi

    2017-01-01

    adequate power flow studies. In this paper, power flow analyses for both AC and DC microgrids are formulated and implemented. The mathematical models for both types of microgrids considering the concept of virtual impedance are used to be in conformity with the practical control of the distributed...... generators. As a result, calculation accuracy is improved for both AC and DC microgrid power flow analyses, comparing with previous methods without considering virtual impedance. Case studies are conducted to verify the proposed power flow analyses in terms of convergence and accuracy. Investigation...

  8. Hybrid FSO Radio (HFR): Some Preliminary Results

    Science.gov (United States)

    Bloom, Scott H.; Hartley, W. Seth

    2002-12-01

    AirFiber's Hybrid Free Space Optics Radio (HFR) provides greater than 1 km range at 99.999% availability. The HFR does this by hitlessly combining the data streams from two data paths, one a free space optic (FSO), the other a 60 GHz millimeter wave system. FSO systems alone are limited in range to less than 500 meters in most cities in the world due to fog outages yet have modest attenuation in rain. Fog is transparent to 60 GHz systems yet they suffer from rain and clear air oxygen absorption. The HFR system uses the strengths of each of these very high bandwidth (up to 1.25 Gb/sec), unlicensed technologies, to provide 99.999% wireless availability at ranges greater than 1 km in all weather conditions. We present some range curves and data from the output of an AirFiber HFR system during a severe (300 dB/km) fog event of many hours duration.

  9. DC current and AC impedance measurements on boron-doped single crystalline diamond films

    Energy Technology Data Exchange (ETDEWEB)

    Ye, Haitao; Gaudin, O.; Jackman, R.B. [Department of Electronic and Electrical Engineering, University College London, Torrington Place, London WC1E 7JE (United Kingdom); Muret, P.; Gheeraert, E. [Laboratoire d' Etudes des Proprietes Electroniques des Solides, BP166, 38042 Grenoble Cedex 9 (France)

    2003-09-01

    In this paper, we report the first measurement of impedance on boron-doped single crystalline diamond films from 0.1 Hz to 10 MHz with the temperature ranging from -100 C up to 300 C. The Cole-Cole (Z' via Z{sup ''}) plots are well fitted to a RC parallel circuit model and the equivalent Resistance and Capacitance for the diamond films have been estimated using the Zview curve fitting. The results show only one single semicircle response at each temperature measured. It was found that the resistance decreases from 70 G{omega} at -100 C to 5 k{omega} at 300 C. The linear curve fitting from -100 C to 150 C shows the sample has an activation energy of 0.37 eV, which is consistent with the theoretical value published of this kind of material. The equivalent capacitance is maintained at the level of pF up to 300 C suggesting that no grain boundaries are being involved, as expected from a single crystal diamond. The activation energy from the dc current-temperature curves is 0.36 eV, which is consistent with the value from ac impedance. The potential of this under-used technique for diamond film analysis will be discussed. (copyright 2003 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  10. Asymmetrical magneto-impedance in a sandwich film with a transverse anisotropy using an AC bias

    CERN Document Server

    Makhnovskiy, D P; Mapps, D J

    2000-01-01

    A new method of obtaining asymmetrical magneto-impedance in a film system consisting of two outer magnetic layers and an inner conductive lead is proposed, which utilizes a high-frequency longitudinal bias field. For a certain magnetic structure, as in the case of antisymmetrical transverse magnetization in the outer layers, in the presence of a longitudinal DC magnetic field H sub e sub x the AC bias field induces a high-frequency circulatory magnetization which contributes to the voltage measured across the film. Depending on the sign of H sub e sub x , this voltage is in phase or counter-phase with that induced by the current flowing along the film layers. As a result, the total voltage does not respond in the same way to positive and negative H sub e sub x. This process is described in terms of the surface impedance tensor. The contribution to the voltage due to the current and the bias field is given by the diagonal and off-diagonal components of this tensor, respectively, which have a different symmetry...

  11. AC impedance spectroscopy and conductivity studies of Dy doped Bi4V2O11 ceramics

    Science.gov (United States)

    Bag, Sasmitarani; Das, Parthasarathi; Behera, Banarji

    2017-03-01

    The ac impedance and conductivity properties of Dy doped Bi4V2 - x Dy x O11 (x = 0.05, 0.10, 0.15 and 0.20) ceramics prepared by solid-state reaction technique, in a wide frequency range at different temperatures have been studied. All the samples exhibited β-type phase orthorhombic structure at room temperature. The Nyquist plot confirmed the presence of both grain and grain boundary effects for all Dy doped samples. Double relaxation behavior was also observed. The grain and grain boundary resistance decreases with rise in temperature for all the concentration and exhibits a typical negative temperature co-efficient of resistance (NTCR) behavior. An analysis of the electric modulus suggests the possible hopping mechanism for electrical transport processes of all the materials. The ac conductivity spectrum obeys Jonscher's universal power law. DC conductivity of the materials were also studied and values of the activation energy found to be 0.40, 0.49, 0.73 and 0.78 eV for the compositions x = 0.05, 0.10, 0.15 and 0.20, respectively, at different temperatures (150-375 °C).

  12. An electrochemical study of corrosion protection by primer-topcoat systems on 4130 steel with ac impedance and dc methods

    Science.gov (United States)

    Mendrek, M. J.; Higgins, R. H.; Danford, M. D.

    1988-01-01

    To investigate metal surface corrosion and the breakdown of metal protective coatings, the ac impedance method is applied to six systems of primer coated and primer topcoated 4130 steel. Two primers were used: a zinc-rich epoxy primer and a red lead oxide epoxy primer. The epoxy-polyamine topcoat was used in four of the systems. The EG and G-PARC Model 368 ac impedance measurement system, along with dc measurements with the same system using the polarization resistance method, were used to monitor changing properties of coated 4230 steel disks immersed in 3.5 percent NaCl solutions buffered at pH 5.4 over periods of 40 to 60 days. The corrosion system can be represented by an electronic analog called an equivalent circuit consisting of resistors and capacitors in specific arrangements. This equivalent circuit parallels the impedance behavior of the corrosion system during a frequency scan. Values for the resistors and capacitors, that can be assigned in the equivalent circuit following a least-squares analysis of the data, describe changes that occur on the corroding metal surface and in the protective coatings. Two equivalent circuits have been determined that predict the correct Bode phase and magnitude of the experimental sample at different immersion times. The dc corrosion current density data are related to equivalent circuit element parameters. Methods for determining corrosion rate with ac impedance parameters are verified by the dc method.

  13. The AC Impedance Characteristic of High Power Li4Ti5O12-based Battery Cells

    DEFF Research Database (Denmark)

    Stroe, Ana-Irina; Stroe, Daniel Loan; Swierczynski, Maciej Jozef

    2015-01-01

    This paper studies the impedance characteristics of a fresh 13 Ah high-power lithium titanate oxide (LTO) battery cell and analyses its dependence on the temperature and state-of-charge. The impedance of the battery cell was measured by means of the electrochemical impedance spectroscopy (EIS......) technique for the entire state-of-charge (SOC) interval and considering five temperatures between 5oC and 45oC. By analyzing the measured impedance spectra of the LTO-based battery cell, it was found out that the cell’s impedance is extremely dependent on the operating conditions. By further processing...

  14. AC impedance studies on LiFe{sub 5-x}Mn{sub x}O{sub 8} ferrites

    Energy Technology Data Exchange (ETDEWEB)

    Ramesh, B., E-mail: bramesh9@rediffmail.com [Department of Physics, Osmania University, Hyderabad, A.P. (India); Ramesh, S.; Kumar, R. Vijaya; Lakshmipathi Rao, M. [Department of Physics, Osmania University, Hyderabad, A.P. (India)

    2012-02-05

    Highlights: Black-Right-Pointing-Pointer The materials were prepared by sol-gel method and single phase formation was conformed. Black-Right-Pointing-Pointer Z Prime and Z Double-Prime magnitude decrease with increasing temperature. Black-Right-Pointing-Pointer Relaxation time of the prepared samples varies linearly with temperature Black-Right-Pointing-Pointer The cole-cole impedance plots of the present investigation clearly shows an interesting phenomenon involved in the conduction mechanism of the samples. - Abstract: A systematic investigation of AC impedance studies of Mn doped Lithium ferrites with composition formula, LiFe{sub 5-x}Mn{sub x}O{sub 8} (x = 0.0, 0.2, 0.4, and 0.6) has been undertaken. The materials were prepared by sol-gel method. Complex impedance data measured in the frequency range 200 Hz to 1 MHz at different temperatures was analyzed systematically. It has been observed that the magnitudes of real (Z Prime ) and imaginary (Z Double-Prime ) components of the impedance are found to decrease with increasing temperature. It is interesting to note that the relaxation time varies linearly with temperature. The Nyquist impedance plots of the present investigation clearly depicts the inherent phenomenon involved in conduction mechanism of Mn doped Lithium ferrites.

  15. Impedance Spectroscopy Study of the AC Conductivity and Dielectric properties of 3, 5-Dimethylpyridine-Iodine Charge Transfer Complex

    Directory of Open Access Journals (Sweden)

    Uttam Mohan

    2016-05-01

    Full Text Available Solid charge transfer complex of n-donor 3, 5-dimethylpyridine (3, 5-Lutidine with σ acceptor iodine was prepared and characterised by using elemental analysis, UV-Vis, FTIR, 1H NMR spectroscopy and powder XRD techniques. The electrical parameters of the prepared complex in the pellet form were studied at various temperatures and at wide frequency range by employing AC complex impedance spectroscopic technique. The Nyquist (cole-cole plots have been successfully explained by employing (RC(RC(RC equivalent circuit corresponding to grain , grain boundary and electrode contributions. The radii of the semicircular arc decrease with increase in temperature which suggests that the material exhibits negative temperature coefficient of resistance (NTCR behaviour like semiconductors. Dielectric constant, ɛ′ and dielectric loss, ɛ″ seems to decrease sharply with increase in frequency. The ac conductivity obeys the power law of frequency.

  16. Enhanced Absorption Performance of Carbon Nanostructure Based Metamaterials and Tuning Impedance Matching Behavior by an External AC Electric Field.

    Science.gov (United States)

    Gholipur, Reza; Khorshidi, Zahra; Bahari, Ali

    2017-04-12

    Metamaterials have surprisingly broadened the range of available practical applications in new devices such as shielding, microwave absorbing, and novel antennas. More research has been conducted related to tuning DNG frequency bands of ordered or disordered metamaterials, and far less research has focused on the importance of impedance matching behavior, with little effort and attention given to adjusting the magnitude of negative permittivity values. This is particularly important if devices deal with low-amplitude signals such as radio or TV antennas. The carbon/hafnium nickel oxide (C/Hf0.9Ni0.1Oy) nanocomposites with simultaneously negative permittivity and negative permeability, excellent metamaterial performance, and good impedance matching could become an efficient alternative for the ordered metamaterials in wave-transparent, microwave absorbing, and solar energy harvesting fields. In this study, we prepared C/Hf0.9Ni0.1Oy nanocomposites by the solvothermal method, and we clarified how the impedance matching and double-negative (DNG) behaviors of C/Hf0.9Ni0.1Oy can be tuned by an external AC electric field created by an electric quadrupole system. An external electric field allows for the alignment of the well-dispersed nanoparticles of carbon with long-range orientations order. We believe that this finding broadens our understanding of moderate conductive material-based random metamaterials (MCMRMs) and provides a novel strategy for replacing high-loss ordered or disordered metamaterials with MCMRMs.

  17. Grid impedance estimation based hybrid islanding detection method for AC microgrids

    DEFF Research Database (Denmark)

    Ghzaiel, Walid; Jebali-Ben Ghorbal, Manel; Slama-Belkhodja, Ilhem;

    2017-01-01

    This paper focuses on a hybrid islanding detection algorithm for parallel-inverters-based microgrids. The proposed algorithm is implemented on the unit ensuring the control of the intelligent bypass switch connecting or disconnecting the microgrid from the utility. This method employs a grid impe...... that the resonance excitation is canceled and the resistive and inductive grid impedance parts are estimated. Simulation results are carried out to illustrate the effectiveness of the proposed method....

  18. Virtual Impedance Based Fault Current Limiters for Inverter Dominated AC Microgrids

    DEFF Research Database (Denmark)

    Lu, Xiaonan; Wang, Jianhui; Guerrero, Josep M.

    2017-01-01

    In this paper, a virtual impedance based fault current limiter (VI-FCL) is proposed for islanded microgrids comprised of multiple inverter interfaced distributed generators (DGs). Considering the increased fault current capability induced by high penetration of renewable energy sources (RESs), FC......, and the stability analysis in consideration of VI-FCLs is thereby studied. MATLAB/Simulink model comprised of three inverter-interfaced DGs is implemented to verify the feasibility of the proposed method....

  19. Label-free whole blood cell differentiation based on multiple frequency AC impedance and light scattering analysis in a micro flow cytometer.

    Science.gov (United States)

    Simon, Peter; Frankowski, Marcin; Bock, Nicole; Neukammer, Jörg

    2016-06-21

    We developed a microfluidic sensor for label-free flow cytometric cell differentiation by combined multiple AC electrical impedance and light scattering analysis. The measured signals are correlated to cell volume, membrane capacity and optical properties of single cells. For an improved signal to noise ratio, the microfluidic sensor incorporates two electrode pairs for differential impedance detection. One-dimensional sheath flow focusing was implemented, which allows single particle analysis at kHz count rates. Various monodisperse particles and differentiation of leukocytes in haemolysed samples served to benchmark the microdevice applying combined AC impedance and side scatter analyses. In what follows, we demonstrate that AC impedance measurements at selected frequencies allow label-free discrimination of platelets, erythrocytes, monocytes, granulocytes and lymphocytes in whole blood samples involving dilution only. Immunofluorescence staining was applied to validate the results of the label-free cell analysis. Reliable differentiation and enumeration of cells in whole blood by AC impedance detection have the potential to support medical diagnosis for patients with haemolysis resistant erythrocytes or abnormally sensitive leucocytes, i.e. for patients suffering from anaemia or leukaemia.

  20. Diffusion and Gas Conversion Analysis of Solid Oxide Fuel Cells at Loads via AC Impedance

    Directory of Open Access Journals (Sweden)

    Robert U. Payne

    2011-01-01

    Full Text Available Impedance measurements were conducted under practical load conditions in solid oxide fuel cells of differing sizes. For a 2 cm2 button cell, impedance spectra data were separately measured for the anode, cathode, and total cell. Improved equivalent circuit models are proposed and applied to simulate each of measured impedance data. Circuit elements related to the chemical and physical processes have been added to the total-cell model to account for an extra relaxation process in the spectra not measured at either electrode. The processes to which elements are attributed have been deduced by varying cell temperature, load current, and hydrogen concentration. Spectra data were also obtained for a planar stack of five 61 cm2 cells and the individual cells therein, which were fitted to a simplified equivalent circuit model of the total button cell. Similar to the button cell, the planar cells and stack exhibit a pronounced low-frequency relaxation process, which has been attributed to concentration losses, that is, the combined effects of diffusion and gas conversion. The simplified total-cell model approximates well the dynamic behavior of the SOFC cells and the whole stack.

  1. Evaluation of the electrode performance for PAFC by using acid absorption, acceleration and ac-impedance measurement

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Chang-Soo; Song, Rak-Hyun; Choi, Byung-Woo [Korea Institute of Energy Research, Taejon (Korea, Republic of)] [and others

    1996-12-31

    In PAFC, the degradation on cathode electrode caused by carbon corrosion, platinum dissolution and growth is especially severe. An acceleration test is a good technique for evaluating the degradation of electrode performance, because it does not need long time. Coleman et al used thermal cycling and on-off cycling as an acceleration test. Song et al showed that hydrogen shortage decreased the electrode performance more rapidly than that of air shortage in gas shortage test. Honji et al reported that the rate of coarsening of Pt particle is rapid in open circuit potential and this is one of major causes on the performance degradation of electrode. The cathode performance has been studied by using acid absorption, acceleration and ac-impedance measurements as functions of the polytetrafluoroethylene (PTFE) contents and sintering temperatures of the electrode.

  2. Modelling carbon steels corrosion during a long period in soils: Contribution of A.C. impedance spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Pons, E.; Lemaitre, C.; Crusset, D.; David, D. [Laboratoire Roberval de Mecanique, UMR 6066 du CNRS, Universite de Technologie de Compiegne, BP 20529, F - 60205 Compiegne cedex (France)

    2004-07-01

    The corrosion of historical objects from World War I fields were studied by using two methods: characterization of the corrosion products by Raman Laser Spectroscopy, and behaviour of the corrosion layers by using electrochemical studies. The first technique, previously used, had shown that two layers are present on these objects, containing both different oxides and oxy-hydroxides of iron. In the present part of the work, the A.C. Impedance Spectroscopy was used to show the differences between the two layers concerning the corrosion of these objects. In order to observe the different behaviours, the specimens were studied in three surface states: with the two layers, with the internal layer only, and without oxide. The results have shown that the internal layer limits the corrosion kinetics. Then this layer was especially studied, particularly its porosity, by a comparison of the impedance results in two media with very different conductivity, and the evolution of these results with different immersion times. The buried objects had the behaviour of a porous electrode, due to the presence of the internal layer. Thus, this behaviour can be modelled with the simplified De Levie's theory, considering that each porosity is a semi-infinite hole. It appeared that the corrosion process at the oxidized interface corresponds to the transport in the electrolyte in the pores completed by a part of transport in the solid phase. These properties can be used to predict the long term corrosion behaviour of carbon steels in soils for long periods. (authors)

  3. AC impedance modelling study on porous electrodes of proton exchange membrane fuel cells using an agglomerate model

    Science.gov (United States)

    Gerteisen, Dietmar; Hakenjos, Alex; Schumacher, Jürgen O.

    A one-dimensional model of the PEM fuel cell cathode is developed to analyse ac impedance spectra and polarisation curves. The porous gas diffusion electrode is assumed to consist of a network of dispersed catalyst (Pt/C) forming spherically shaped agglomerated zones that are filled with electrolyte. The coupled differential equation system describes: ternary gas diffusion in the backing (O2 , N2 , water vapour), Fickian diffusion and Tafel kinetics for the oxygen reduction reaction (ORR) inside the agglomerates, proton migration with ohmic losses and double-layer charging in the electrode. Measurements are made of a temperature-controlled fuel cell with a geometric area of 1.4 cm × 1.4 cm. Lateral homogeneity is ensured by using a high stoichiometry of λmin . The model predicts the behaviour of measured polarisation curves and impedance spectra. It is found that a better humidification of the electrode leads to a higher volumetric double-layer capacity. The catalyst layer resistance shows the same behaviour depending on the humidification as the membrane resistance. Model parameters, e.g. Tafel slope, ionic resistance and agglomerate radius are varied. A sensitivity analysis of the model parameters is conducted.

  4. The Application of Electrochemical Impedance Techniques in Analyzing the AC Response of Some Two-electron Transfer Dye Systems

    Directory of Open Access Journals (Sweden)

    Farouk Rashwan

    2005-01-01

    Full Text Available The Electrochemical Impedance Spectroscopic techniques (EIS were used to investigate the behavior of some dye compounds (quinoid systems characterized with 2e-transfer processes. For this purpose, Alizarin Red S (ARS, Alizarin Cyanine (AC, Alizarin Viridin (AV and carminic acid were chosen for the measurements. The EIS experiments were performed using a small AC amplitude (10 mV p-p in addition to a relatively wide frequency range (0.01 Hz ≤ f ≤ 105 Hz. The investigations were carried out at room temperature in aqueous media (HClO4, NaClO4 and KNO3 on the Hanging Mercury Drop Electrode (HMDE and for comparison one experiment only was measured in aprotic solvent (DMF on the Pt-disc electrode. The EIS diagrams of these systems were characterized in the complex plane by two fundamental observations, the first of which is a straight line crossing the real axis at an angle of 45° (or at least nearly so and the second one is two semicircles beside each other corresponding to high-frequency and low-frequency regions, which are implying the presence of well-separated time constants. The EIS characteristic parameters for these dye systems were calculated and discussed.

  5. Insecticidal activity of wheat Hessian fly responsive proteins HFR-1 and HFR-3 towards a non-target wheat pest, cereal aphid (Sitobion avenae F.).

    Science.gov (United States)

    Pyati, Prashant; Chellamuthu, Anitha; Gatehouse, Angharad M R; Fitches, Elaine; Gatehouse, John A

    2012-07-01

    The interaction between Hessian fly (Mayetiola destructor) and wheat (Triticum aestivum) involves a gene-for-gene resistance mechanism. The incompatible interaction leading to resistance involves up-regulation of several Hfr (Hessian fly responsive) genes encoding proteins with potential insecticidal activity. The encoded proteins HFR-1, HFR-2 and HFR-3 all possess lectin-like domains. HFR-1 and HFR-3 were produced as recombinant proteins using Escherichia coli and Pichia pastoris, respectively as expression hosts. Purified recombinant proteins were assayed for insecticidal effects towards cereal aphid (Sitobion avenae), an insect to which wheat shows only tolerance. Both HFR-1 and HFR-3 were found to be insecticidal towards S. avenae when fed in artificial diet. Although HFR-3 has sequence similarity and similar chitin-binding activity to wheat germ agglutinin (WGA), the latter protein was almost non-toxic to S. avenae. HFR-3 binds strongly to aphid midguts after ingestion, whereas WGA binds but does not persist over a feed-chase period. Quantitative PCR showed that Hfr-3 mRNA does not increase in level after cereal aphid infestation. The results suggest that the lack of effective resistance to cereal aphid in wheat is not due to an absence of genes encoding suitable insecticidal proteins, but results from a failure to up-regulate gene expression in response to aphid attack.

  6. A critical experiment at HFR of 19 March 2008

    Energy Technology Data Exchange (ETDEWEB)

    Campioni, G. [Direction de l' Energie Nucleaire, Departement de Modelisation des Systemes et Structures, Service des Etudes de Reacteurs et de Mathematiques Appliquees, CEA, DEN, DM2S-SERMA, F-91191 Gif Sur Yvette (France)], E-mail: guillaume.campioni@cea.fr; Calzavara, Y. [Institut Laue-Langevin, 6 rue Jules Horowitz, 38000 Grenoble (France)], E-mail: calzavara@ill.fr; Mollier, M.; Atkins, D.; Veler, R.; Sebie, P.; Ferrandiz, L.; Micoud, E.; Deyres, J.-C.; Chirol, P.; Puygrenier, C.; Carriere, S.; Allemmoz, S.; Samuel, M.; Meynent, P.-Y.; Laurent, C.; Mannino, E.; Bonnet, G.; Rey, J.-P.; Barbe, C. [Institut Laue-Langevin, 6 rue Jules Horowitz, 38000 Grenoble (France)] (and others)

    2009-09-15

    In this paper, we present the critical experiment performed in March 2008 in the high-flux reactor (HFR) to reproduce physical conditions similar to the core light water introduction accident. We present the HFR, the context of the study and two Monte Carlo models: TRIPOLI4 - JEFF3.1 and MCNP - ENDF/BVII. All comparisons between calculations and experimental results show, within both models, that the safety rods efficiencies, in AIC alloy, are always underestimated in normal as well as in accidental configuration of the reactor.

  7. Corrosion behaviour of galvanized steel and electroplating steel in aqueous solution: AC impedance study and XPS

    Energy Technology Data Exchange (ETDEWEB)

    Lebrini, M.; Fontaine, G. [Laboratoire des Procedes d' Elaboration des Revetements Fonctionnels, LSPES UMR CNRS 8008, ENSCL, BP 90108, F-59652 Villeneuve d' Ascq Cedex (France); Gengembre, L. [Unite de Catalyse et Chimie du solide UMR 8181 Bat C3, USTL, F-59655 Villeneuve d' Ascq Cedex (France); Traisnel, M. [Laboratoire des Procedes d' Elaboration des Revetements Fonctionnels, LSPES UMR CNRS 8008, ENSCL, BP 90108, F-59652 Villeneuve d' Ascq Cedex (France)], E-mail: Michel.Traisnel@ensc-lille.fr; Lerasle, O.; Genet, N. [TOTAL France, Centre de Recherche de Solaize, Chemin du canal, BP 22, F-69360 Solaize (France)

    2008-08-30

    The efficiency of a new triazole derivative, namely, 2-{l_brace}(2-hydroxyethyl)[(4-methyl-1H-1,2,3-benzotriazol-1-yl)methyl]amino{r_brace} ethanol (TTA) has been studied for corrosion inhibition of galvanized steel and electroplating steel in aqueous solution. Corrosion inhibition was studied using electrochemical impedance spectroscopy (EIS). These studies have shown that TTA was a very good inhibitor. Data obtained from EIS show a frequency distribution and therefore a modelling element with frequency dispersion behaviour, a constant phase element (CPE) has been used. The corrosion behaviour of galvanized steel and electroplating steel in aqueous solution was also investigated in the presence of 4-methyl-1H-benzotriazole (TTA unsubstituted) by EIS. These studies have shown that the ability of the molecule to adsorb on the steel surface was dependent on the group in triazole ring substituent. X-ray photoelectron spectroscopy surface analysis with TTA shows that it chemisorbed on surface of galvanized steel and electroplating steel.

  8. Na+导电陶瓷的交流阻抗谱%AC Impedance Characteristics of Na+ Conductive Ceramic Electrodes

    Institute of Scientific and Technical Information of China (English)

    倪蕾蕾; 杨座国; 曾乐才; 刘宇; 祝铭

    2012-01-01

    以β″-Al2O3导电陶瓷为电解质,研究制备银/碳毡/低熔点钠盐电极(Ag/C/(NaNO3+NaNO2)),并选择银电极作为对比电极。测试条件为:温度275~400℃、频率12~105Hz。采用交流阻抗谱法(Ac)进行β″-Al2O3导电陶瓷与金属Na+界面兼容性和界面离子传导机理研究。结果表明:β″-Al2O3导电陶瓷的电导与温度关系服从于阿仑尼乌斯公式。比较两种电极可以发现,电极/电解质的界面接触对电极/电解质界面迁移阻抗和阻抗谱测试结果会有较大程度的影响。%Alumina conductive ceramic was used as solid electrolyte. Using the silver electrode as comparison one, a new electrode, silver / carbon felt / low melting sodium electrode (Ag/C/(NaNO3 + NaNO2)) as the test electrode was designed and prepared. The testing temperature ranged from 275 ℃ to 400℃ and frequency ranged from 12 Hz to 10^5Hz. The AC impedance spectroscopy was employed to study the compatibility and ion conduction mechanism between β″-Al2O3 ceramic and Na+. The results show that the conductivity of β″-Al2O3 ceramic and temperature obey the Arrhenius equation. In comparison of two electrodes, the contact between electrode and solid electrolyte plays an important role in electrode/ electrolyte interface transfer impedance and electrochemical impedance spectroscopy.

  9. Fuzzy-control-based five-step Li-ion battery charger by using AC impedance technique

    Science.gov (United States)

    Asadi, Houshyar; Aghay Kaboli, Seyed Hamidreza; Mohammadi, Arash; Oladazimi, Maysam

    2012-01-01

    In This paper the previous Li-Ion battery charger techniques are reviewed and compared and the new fuzzy logic battery charging method which is proposed to optimize and improve the battery charger efficiently. According to results of comparison, using the fuzzy control charging system can shorten the charging time with higher efficiency and lower temperature rise. Additionally, we have used optimal Li-ion battery charging frequency by using AC impedance technique which means if the battery is charged by the optimal charging frequency fZmin, that obtain from Bode Plot of the Li-ion battery, the charging time and charging efficiency will improve. Thus using the switching frequency (fZmin) of the battery charger and the fuzzy logic control on the same system can optimize the performance on the charging process. According to the experimental results, the proposed charger can charge the Li-ion batteries with higher efficiency 97.16%, lower temperature rise1.513degree celosias, fast charging period around 50.43 minute and long life cycle. The results in this paper are presented by using MATLAB and dsPIC30F2020 is used as controller applying designed fuzzy logic inside.

  10. Investigations on the Sensing Mechanism of Humidity Sensors Based on Poly(4-vinylpyridine)/carbon Black Composite by AC Impedance Spectra

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    1 Results Investigations on the sensing mechanism is important for understanding the electrical responses of humidity sensors to humidity change,and could provide guidelines for the design and synthesis of humidity sensitive materials with desirable properties.In this work,the sensing mechanism of humidity sensors based on quaternized poly(4-vinylpyridine) (PVP)/carbon black (CB) composite[1] was studied by measuring their AC impedance spectra at various humidities at room temperature.Under low humidity...

  11. Location of coating defects and assessment of level of cathodic protection on underground pipelines using AC impedance, deterministic and non-deterministic models

    Science.gov (United States)

    Castaneda-Lopez, Homero

    A methodology for detecting and locating defects or discontinuities on the outside covering of coated metal underground pipelines subjected to cathodic protection has been addressed. On the basis of wide range AC impedance signals for various frequencies applied to a steel-coated pipeline system and by measuring its corresponding transfer function under several laboratory simulation scenarios, a physical laboratory setup of an underground cathodic-protected, coated pipeline was built. This model included different variables and elements that exist under real conditions, such as soil resistivity, soil chemical composition, defect (holiday) location in the pipeline covering, defect area and geometry, and level of cathodic protection. The AC impedance data obtained under different working conditions were used to fit an electrical transmission line model. This model was then used as a tool to fit the impedance signal for different experimental conditions and to establish trends in the impedance behavior without the necessity of further experimental work. However, due to the chaotic nature of the transfer function response of this system under several conditions, it is believed that non-deterministic models based on pattern recognition algorithms are suitable for field condition analysis. A non-deterministic approach was used for experimental analysis by applying an artificial neural network (ANN) algorithm based on classification analysis capable of studying the pipeline system and differentiating the variables that can change impedance conditions. These variables include level of cathodic protection, location of discontinuities (holidays), and severity of corrosion. This work demonstrated a proof-of-concept for a well-known technique and a novel algorithm capable of classifying impedance data for experimental results to predict the exact location of the active holidays and defects on the buried pipelines. Laboratory findings from this procedure are promising, and

  12. Impedance-Based High Frequency Resonance Analysis of DFIG System in Weak Grids

    DEFF Research Database (Denmark)

    Song, Yipeng; Wang, Xiongfei; Blaabjerg, Frede

    2017-01-01

    The impedance-based model of Doubly Fed Induction Generator (DFIG) systems, including the rotor part (Rotor Side Converter (RSC) and induction machine), and the grid part (Grid Side Converter (GSC) and its output filter), has been developed for analysis and mitigation of the Sub- Synchronous...... Resonance (SSR). However, the High Frequency Resonance (HFR) of DFIG systems due to the impedance interaction between DFIG system and parallel compensated weak network is often overlooked. This paper thus investigates the impedance characteristics of DFIG systems for the analysis of HFR. The influences...... of the rotor speed variation, the machine mutual inductance and the digital control delay are evaluated. Two resonances phenomena are revealed, i.e., 1) the series HFR between the DFIG system and weak power grid; 2) the parallel HFR between the rotor part and the grid part of DFIG system. The impedance...

  13. A short tutorial contribution to impedance and AC-electrokinetic characterization and manipulation of cells and media: Are electric methods more versatile than acoustic and laser methods?

    Directory of Open Access Journals (Sweden)

    Jan Gimsa

    2014-11-01

    Full Text Available Lab-on-chip systems (LOCs can be used as in vitro systems for cell culture or manipulation in order to analyze or monitor physiological cell parameters. LOCs may combine microfluidic structures with integrated elements such as piezo-transducers, optical tweezers or electrodes for AC-electrokinetic cell and media manipulations. The wide frequency band (<1 kHz to >1 GHz usable for AC-electrokinetic manipulation and characterization permits avoiding electrochemical electrode processes, undesired cell damage, and provides a choice between different polarization effects that permit a high electric contrast between the cells and the external medium as well as the differentiation between cellular subpopulations according to a variety of parameters. It has been shown that structural polarization effects do not only determine the impedance of cell suspensions and the force effects in AC-electrokinetics but can also be used for the manipulation of media with inhomogeneous temperature distributions. This manuscript considers the interrelations of the impedance of suspensions of cells and AC-electrokinetic single cell effects, such as electroorientation, electrodeformation, dielectrophoresis, electrorotation, and travelling wave (TW dielectrophoresis. Unified models have allowed us to derive new characteristic equations for the impedance of a suspension of spherical cells, TW dielectrophoresis, and TW pumping. A critical review of the working principles of electro-osmotic, TW and electrothermal micropumps shows the superiority of the electrothermal pumps. Finally, examples are shown for LOC elements that can be produced as metallic structures on glass chips, which may form the bottom plate for self-sealing microfluidic systems. The structures can be used for cell characterization and manipulation but also to realize micropumps or sensors for pH, metabolites, cell-adhesion, etc.

  14. Impedance and a.c. conductivity studies of Ba(Pr1/2Nb1/2)O3 ceramic

    Indian Academy of Sciences (India)

    K Amar Nath; K Prasad; K P Chandra; A R Kulkarni

    2013-08-01

    Impedance and electrical conduction studies of Ba(Pr1/2Nb1/2)O3 ceramic prepared through conventional ceramic fabrication technique are presented. The crystal symmetry, space group and unit cell dimensions were estimated using Rietveld analysis. X-ray diffraction analysis indicated the formation of a single-phase cubic structure with space group, $\\bar{3}$. EDAX and SEM studies were carried out to study the quality and purity of compound. To find a correlation between the response of the real system and idealized model circuit composed of discrete electrical components, the model fittings were presented using impedance data. Complex impedance as well as electric modulus analyses suggested dielectric relaxation to be of non-Debye type and negative temperature coefficient of resistance character. The correlated barrier hopping model was employed to successfully explain the mechanism of charge transport in Ba(Pr1/2Nb1/2)O3. The a.c. conductivity data were used to evaluate density of states at Fermi level, minimum hopping length and apparent activation energy.

  15. Piezoelectric, impedance, electric modulus and AC conductivity studies on (Bi0.5Na0.50.95Ba0.05TiO3 ceramic

    Directory of Open Access Journals (Sweden)

    Ansu K. Roy

    2013-06-01

    Full Text Available Lead-free piezoelectric perovskite ceramic (Bi0.5Na0.50.95Ba0.05TiO3 (BNT-BT0.05, prepared by conventional high temperature solid state reaction technique at 1160 °C/3h in air atmosphere, is investigated by impedance and modulus spectroscopy in a temperature range 35–400 °C, over a frequency range 100 Hz–1 MHz. The crystal structure, microstructure, and piezoelectric properties as well as the AC conductivity of the sample were studied. Powder X-ray diffraction pattern derived from the resulting data at the room temperature subjected to Rietveld refinements and Williamson-Hall plot analysis confirmed the formation of phase pure compound with monoclinic unit cells having a crystallite-size ~33.8 nm. Observed SEM micrograph showed a uniform distribution of grains inside the sample having an average grain size ~3 mm. Longitudinal piezoelectric charge coefficient of the sample poled under a DC electric field of ~ 2.5 kV/mm at 80 °C in a silicone oil bath was found to be equal to 95 pC/N. The frequency and temperature dependent electrical data analysed in the framework of AC conductivity, complex impedance as well as electric modulus formalisms showed negative temperature coefficient of resistance (NTCR character of the material and the dielectric relaxation in the material to be of non-Debye type. Double power law for the frequency-dependence of AC conductivity and Jump Relaxation Model (JRM were found to explain successfully the mechanism of charge transport in BNT-BT0.05.

  16. AC Conductivity and Impedance Properties of 0.65Pb(Mg1/3Nb2/3O3-0.35PbTiO3 Ceramics

    Directory of Open Access Journals (Sweden)

    Banarji Behera

    2009-01-01

    impedance spectroscopy technique. The impedance and electric permittivity were strongly temperature and frequency dependent. The activation energy, calculated from the temperature dependence of AC conductivity of the ceramics was found to be ∼0.5 eV. The relaxation process in the ceramics was found to be of non-Debye type. The nature of Cole-Cole diagram reveals the contribution of grain (bulk and grain boundary permittivity in the ceramics.

  17. AC impedance and dielectric spectroscopic studies of Mg2+ ion conducting PVA–PEG blended polymer electrolytes

    Indian Academy of Sciences (India)

    Anji Reddy Polu; Ranveer Kumar

    2011-08-01

    Polyvinyl alcohol (PVA)–polyethylene glycol (PEG) based solid polymer blend electrolytes with magnesium nitrate have been prepared by the solution cast technique. Impedance spectroscopic technique has been used, to characterize these polymer electrolytes. Complex impedance analysis was used to calculate bulk resistance of the polymer electrolytes. The a.c.-impedance data reveal that the ionic conductivity of PVA–PEG–Mg(NO3)2 system is changed with the concentration of magnesium nitrate, maximum conductivity of 9.63 × 10-5 S/cm at room temperature was observed for the system of PVA–PEG–Mg(NO3)2 (35–35–30). However, ionic conductivity of the above system increased with the increase of temperature, and the highest conductivity of 1.71 × 10-3 S/cm was observed at 100°C. The effect of ionic conductivity of polymer blend electrolytes was measured by varying the temperature ranging from 303 to 373 K. The variation of imaginary and real parts of dielectric constant with frequency was studied.

  18. Doubly Fed Induction Generator System Resonance Active Damping through Stator Virtual Impedance

    DEFF Research Database (Denmark)

    Song, Yipeng; Wang, Xiongfei; Blaabjerg, Frede

    2017-01-01

    The penetration of wind power has been increasing in the past few decades all over the world. Under certain non-ideal situations where the wind power generation system is connected to the weak grid, the Doubly Fed Induction Generator (DFIG) based wind power generation system may suffer High...... Frequency Resonance (HFR) due to the impedance interaction between the DFIG system and the weak grid network whose impedance is comparative large. Thus, it is important to implement an active damping for the HFR in order to ensure a safe and reliable operation of both the DFIG system and the grid connected...... converters/loads. This paper analyzes and explains first the HFR phenomenon between the DFIG system and a parallel compensated weak network (series RL + shunt C). Then on the basis of the DFIG system impedance modeling, an active damping control strategy is introduced by inserting a virtual impedance...

  19. In Situ Determination of the Transport Properties of Near-Surface Concrete Using AC Impedance Spectroscopy Techniques

    Directory of Open Access Journals (Sweden)

    Lipeng Wu

    2016-01-01

    Full Text Available The durability of existing concrete structures has increasingly attracted widespread attention in recent years. The phenomenon of performance degradation is often associated with the intrusion of hazardous ions from outside. As the first barrier to external substances intrusion, the near-surface concrete plays an important role in durability. So the performance of in-service concrete structures often depends on the transport properties of the near-surface concrete. Accordingly, information on service conditions and life prediction can be obtained by testing these transport properties. In this paper, an in situ method for chloride ion diffusion coefficient determination is proposed based on the relationship between the alternating current impedance spectroscopy parameters and the chloride ion diffusion coefficient. By a rational design, the new method can synthetically reflect the transport properties of near-surface concrete and is not affected by the presence of the reinforcing bar. In addition, the experimental results show that the method is in good agreement with “PERMIT” migration test which has been widely used. The proposed method is less time consuming and nondestructive and has good reproducibility.

  20. Carbon Nanotube-Based Supercapacitors with Excellent ac Line Filtering and Rate Capability via Improved Interfacial Impedance.

    Science.gov (United States)

    Rangom, Yverick; Tang, Xiaowu Shirley; Nazar, Linda F

    2015-07-28

    We report the fabrication of high-performance, self-standing composite sp(2)-carbon supercapacitor electrodes using single-walled carbon nanotubes (CNTs) as conductive binder. The 3-D mesoporous mesh architecture of CNT-based composite electrodes grants unimpaired ionic transport throughout relatively thick films and allows superior performance compared to graphene-based devices at an ac line frequency of 120 Hz. Metrics of 601 μF/cm(2) with a -81° phase angle and a rate capability (RC) time constant of 199 μs are obtained for thin carbon films. The free-standing carbon films were obtained from a chlorosulfonic acid dispersion and interfaced to stainless steel current collectors with various surface treatments. CNT electrodes were able to cycle at 200 V/s and beyond, still showing a characteristic parallelepipedic cyclic votammetry shape at 1 kV/s. Current densities are measured in excess of 6400 A/g, and the electrodes retain more than 98% capacity after 1 million cycles. These promising results are attributed to a reduction of series resistance in the film through the CNT conductive network and especially to the surface treatment of the stainless steel current collector.

  1. Impedance and AC conductivity study of nano crystalline, fine grained multiferroic bismuth ferrite (BiFeO3, synthesized by microwave sintering

    Directory of Open Access Journals (Sweden)

    Jayant Kolte

    2015-09-01

    Full Text Available In this paper, major reduction in sintering time,temperautre and significant improvement over final density of sitnered sample is reported for the microwave sintered nanocrystalline BiFeO3 (BFO ceramic. Also, different sintering time and temperatures have been used to tailor the grain size and the final density of the resulting BFO ceramics synthesized from phase pure BFO nanoparticles ( d ̄   ≈ 10   n m . Microwave sintering resulted in reducing the sintering time substantially (by 1h, and has resulted in submicron sized grains and high resistivity ∼1.8 GΩ-cm. The AC conductivity is seen to follow the Jonscher’s power law behavior, suggesting correlated barrier hopping (CBH mechanism in the sample. The role of oxygen vacancies at high temperature, due to volatility of bismuth, in dielectric and conductivity behavior is also discussed. Further, the sample displayed dielectric anomaly near magnetic transition temperature (∼180 °C indicating bearing of magnetic moments on the dielectric properties. Using Impedance Spectroscopy (IS we have established, the electrical heterogeneity of the ceramic BFO reavealing semiconducting nature of grains and insulating nature of grain boundary. This, formation of network of insulating grain boundaries and semiconducting grains could lead to formation of internal barrier layer capacitance (IBLC leading to high dielectric constant in microwave sintered BFO.

  2. AC impedance behaviour and state-of-charge dependence of Zr0.5Ti0.5V0.6Cr0.2Ni1.2 metal-hydride electrodes

    Indian Academy of Sciences (India)

    S Rodrigues; N Munichandraiah; A K Shukla

    2001-10-01

    Metal-hydride electrodes made of an AB2 alloy of the composition Zr0.5Ti0.5V0.6Cr0.2Ni1.2 are studied for AC impedance behaviour at several of their state-of-charge values. Impedance data at any state-of-charge comprise two RC-time constants and accordingly are analysed by using a nonlinear-least-square-fitting procedure. Resistance of the electrode and frequency maximum (*) of the lowfrequency semicircle are found useful for predicting state-of-charge of the metalhydride electrodes.

  3. On the electric double-layer structure at carbon electrode/organic electrolyte solution interface analyzed by ac impedance and electrochemical quartz-crystal microbalance responses

    Energy Technology Data Exchange (ETDEWEB)

    Kim, In-Tae; Egashira, Minato; Yoshimoto, Nobuko [Department of Applied Chemistry, Graduate School of Science and Engineering, Yamaguchi University, 2-16-1, Tokiwadai, Ube 755-8611 (Japan); Morita, Masayuki, E-mail: morita@yamaguchi-u.ac.jp [Department of Applied Chemistry, Graduate School of Science and Engineering, Yamaguchi University, 2-16-1, Tokiwadai, Ube 755-8611 (Japan)

    2011-08-30

    Highlights: {center_dot} We monitored resonance frequency change of smooth surface carbon electrode to determine mass changes during electrochemical polarization.{center_dot} This was done from viewpoints of ensuring the electric double-layer structure in organic electrolytes.{center_dot} Clear difference was observed in the mass changes among the electrolyte composition.{center_dot} It were related with differences in the double-layer capacitance at carbon. - Abstract: ac impedance and electrochemical quartz crystal microbalance (EQCM) techniques have been applied to analyze the structure of electric double-layer formed at carbon/organic electrolyte solution interface using a sputtered carbon electrode. The mass changes caused by electrochemical adsorption (accumulation) of ions have been estimated in the solutions of propylene carbonate (PC) dissolving tetrafluoroborate (BF{sub 4}{sup -}) salts of lithium (Li{sup +}), tetraethylammonium (TEA{sup +}) and tetra-n-butylammonium (TBA{sup +}) cations. The observed mass changes during the cathodic polarization in the solutions containing TEA{sup +} and TBA{sup +} were well consistent with those expected by the calculation based on mono-layer adsorption of the cations with giving the consideration to the surface roughness. On the other hand, the mass change observed in the solution containing Li{sup +} salt showed that the solvation of Li{sup +} with three or four molecules of PC would be the charge compensation species at the interface. Comparison of the quantity of the electricity passed during the EQCM measurements with that from theoretical calculation with simple Helmholtz-layer model revealed that the major part of the double-layer capacitance would be based on the electrostatic polarization of the solvent molecule directly adsorbed at the carbon surface.

  4. HFR1 is crucial for transcriptome regulation in the cryptochrome 1-mediated early response to blue light in Arabidopsis thaliana.

    Directory of Open Access Journals (Sweden)

    Xiao-Ning Zhang

    Full Text Available Cryptochromes are blue light photoreceptors involved in development and circadian clock regulation. They are found in both eukaryotes and prokaryotes as light sensors. Long Hypocotyl in Far-Red 1 (HFR1 has been identified as a positive regulator and a possible transcription factor in both blue and far-red light signaling in plants. However, the gene targets that are regulated by HFR1 in cryptochrome 1 (cry1-mediated blue light signaling have not been globally addressed. We examined the transcriptome profiles in a cry1- and HFR1-dependent manner in response to 1 hour of blue light. Strikingly, more than 70% of the genes induced by blue light in an HFR1-dependent manner were dependent on cry1, and vice versa. High overrepresentation of W-boxes and OCS elements were found in these genes, indicating that this strong cry1 and HFR1 co-regulation on gene expression is possibly through these two cis-elements. We also found that cry1 was required for maintaining the HFR1 protein level in blue light, and that the HFR1 protein level is strongly correlated with the global gene expression pattern. In summary, HFR1, which is fine-tuned by cry1, is crucial for regulating global gene expression in cry1-mediated early blue light signaling, especially for the function of genes containing W-boxes and OCS elements.

  5. On the impedance of galvanic cells XVIII. The potential dependence of the faradaic impedance in the case of an irreversible electrode reaction, and its application to A.C. polarography

    NARCIS (Netherlands)

    Timmer, B.; Sluyters-Rehbach, M.; Sluyters, J.H.

    1967-01-01

    A theoretical treatment for the potential dependence of the faradaic impedance, in the case that the electrode reaction behaves irreversibly with respect to the direct current, using the steady-state concept, is presented. An analysis of the expressions obtained in the complex impedance plane is giv

  6. Uncertainty analysis of numerical model simulations and HFR measurements during high energy events

    Science.gov (United States)

    Donncha, Fearghal O.; Ragnoli, Emanuele; Suits, Frank; Updyke, Teresa; Roarty, Hugh

    2013-04-01

    The identification and decomposition of sensor and model shortcomings is a fundamental component of any coastal monitoring and predictive system. In this research, numerical model simulations are combined with high-frequency radar (HFR) measurements to provide insights into the statistical accuracy of the remote sensing unit. A combination of classical tidal analysis and quantitative measures of correlation evaluate the performance of both across the bay. A network of high frequency radars is deployed within the Chesapeake study site, on the East coast of the United States, as a backbone component of the Integrated Ocean Observing System (IOOS). This system provides real-time synoptic measurements of surface currents in the zonal and meridional direction at hourly intervals in areas where at least two stations overlap, and radial components elsewhere. In conjunction with this numerical simulations using EFDC (Environmental Fluid Dynamics Code), an advanced three-dimensional model, provide additional details on flows, encompassing both surface dynamics and volumetric transports, while eliminating certain fundamental error inherent in the HFR system such as geometric dilution of precision (GDOP) and range dependencies. The aim of this research is an uncertainty estimate of both these datasets allowing for a degree of inaccuracy in both. The analysis focuses on comparisons between both the vector and radial component of flows returned by the HFR relative to numerical predictions. The analysis provides insight into the reported accuracy of both the raw radial data and the post-processed vector current data computed from combining the radial data. Of interest is any loss of accuracy due to this post-processing. Linear regression techniques decompose the surface currents based on dominant flow processes (tide and wind); statistical analysis and cross-correlation techniques measure agreement between the processed signal and dominant forcing parameters. The tidal signal

  7. Impedance-Based High Frequency Resonance Analysis of DFIG System in Weak Grids

    OpenAIRE

    Song, Yipeng; Wang, Xiongfei; Blaabjerg, Frede

    2017-01-01

    The impedance-based model of Doubly Fed Induction Generator (DFIG) systems, including the rotor part (Rotor Side Converter (RSC) and induction machine), and the grid part (Grid Side Converter (GSC) and its output filter), has been developed for analysis and mitigation of the Sub- Synchronous Resonance (SSR). However, the High Frequency Resonance (HFR) of DFIG systems due to the impedance interaction between DFIG system and parallel compensated weak network is often overlooked. This paper thus...

  8. Neutron metrology in the HFR. Neutron and gamma metrology in two beagles and one cylindrical phantom

    Energy Technology Data Exchange (ETDEWEB)

    Voorbraak, W.P.; Freudenreich, W.E.; Stecher-Rasmussen, F.; Verhagen, H.W.

    1991-10-01

    Neutron fluence rate and gamma dose data are presented for the first series of experiments at the filtered HFR beam HB11 at full reactor power. Measurements were performed on two beagle dogs and one cylindrical phantom. The main results for thermal and epithermal fluence rates, physical neutron dose and gamma dose are presented in the tables 1 and 2. (author). 10 refs.; 9 figs.; 8 tabs.

  9. Neutron metrology in the HFR. Neutron and gamma metrology in the free beam of HB 11

    Energy Technology Data Exchange (ETDEWEB)

    Voorbraak, W.P.; Freudenreich, W.E.; Paardekooper, A.; Stecher-Rasmussen, F.; Verhagen, H.W.

    1991-11-01

    Results are presented of the ECN measurements at the filtered HFR beam HB11. The neutron measurements took place in the free beam at full power. Several gamma measurements were performed at full power under different conditions. The neutron spectrum was obtained by adjusting a calculated spectrum with experimental results from activation foils. The gamma data were obtained with thermoluminescent dosimeters. (author). 5 refs.; 4 figs.; 4 tabs.

  10. The investigation of dielectric properties and ac conductivity of new ceramic diphosphate Ag0.6Na0.4FeP2O7 using impedance spectroscopy method

    Science.gov (United States)

    Nasri, S.; Megdiche, M.; Gargouri, M.

    2016-10-01

    In this paper, Ag0.6Na0.4FeP2O7 has been synthesized by solid state reaction method. The ceramic compound was characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), vibrational spectroscopy and impedance measurements. In fact, the investigated sample has shown single phase type monoclinic structure with P21/C space group. The frequency-dependent electrical data are analyzed in the frame-work of conductivity and electric modulus formalisms. The real and imaginary parts of complex impedance are well fitted to equivalent circuit model based on the Z-View-software. Besides, the observed frequency dependence of conductivity is found to obey Jonscher's universal law. The temperature dependence of both ac conductivity and the parameter s is reasonably well interpreted by the correlated barrier hopping (CBH). The theoretical fitting between the proposed model and the experimental data showed good agreement. The contribution of single polaron and bipolaron hopping to a.c. conductivity in present compound is also studied. The ionic conductivity is discussed on the basis of the structural characteristics of the sample.

  11. Impedance and AC conductivity studies of Sm3+ substituted 0.8Ba0.2(Bi0.5K0.5)TiO3 lead free ceramics

    Science.gov (United States)

    Sastry, C. V. S. S.; Ramesh, M. N. V.; Ramesh, K. V.

    2017-07-01

    Samarium substituted 0.8Ba0.2(Bi0.5K0.5)TiO3 (here after abbreviated as BTBKT-20) lead free ceramics with composition 0.8Ba0.2(Bi0.5(1-x)Sm0.5xK0.5)TiO3 (where x=0.01,0.03,0.05) lead free ceramics have been prepared by solid state reaction and followed by high energy ball milling process. The present paper focuses the impedance and ac conductivity studies of Sm substituted BTBKT-20 lead free ceramics. Impedance spectroscopic studies revealthat temperature dependent relaxation process. Single depressed semi circle was observed in Cole-Cole plots, indicates non-Debye kind of relaxation process. Maximum grain resistance was observed for x=0.03 Sm substituted BTBKT-20 sample. Frequency and temperature dependent AC conductivity was calculated and it found to obey the universal Jonscher's power law and the values of activation energies suggest that conduction is ionic in nature.

  12. HFR1 sequesters PIF1 to govern the transcriptional network underlying light-initiated seed germination in Arabidopsis.

    Science.gov (United States)

    Shi, Hui; Zhong, Shangwei; Mo, Xiaorong; Liu, Na; Nezames, Cynthia D; Deng, Xing Wang

    2013-10-01

    Seed germination is the first step for seed plants to initiate a new life cycle. Light plays a predominant role in promoting seed germination, where the initial phase is mediated by photoreceptor phytochrome B (phyB). Previous studies showed that phytochrome-interacting factor1 (PIF1) represses seed germination downstream of phyB. Here, we identify a positive regulator of phyB-dependent seed germination, long hypocotyl in far-red1 (HFR1). HFR1 blocks PIF1 transcriptional activity by forming a heterodimer with PIF1 that prevents PIF1 from binding to DNA. Our whole-genomic analysis shows that HFR1 and PIF1 oppositely mediate the light-regulated transcriptome in imbibed seeds. Through the HFR1-PIF1 module, light regulates expression of numerous genes involved in cell wall loosening, cell division, and hormone pathways to initiate seed germination. The functionally antagonistic HFR1-PIF1 pair constructs a fail-safe mechanism for fine-tuning seed germination during low-level illumination, ensuring a rapid response to favorable environmental changes. This study identifies the HFR1-PIF1 pair as a central module directing the whole genomic transcriptional network to rapidly initiate light-induced seed germination.

  13. 交流阻抗技术在牛奶质量安全检测中的应用%The Application of AC Impedance Technology in the Detection of Milk Quality and Safety

    Institute of Scientific and Technical Information of China (English)

    姜洪喆; 赵昕; 褚璇; 王伟; 刘声泉

    2016-01-01

    牛奶的质量和安全是食品安全的重要组成部分,关系到老百姓的身体健康和生命安全。保障牛奶质量能确保消费者从牛奶中获得足够的期望营养物质,而保障牛奶安全能避免对消费者造成危害。交流阻抗技术是一种具有潜力的检测方法,最早应用在电化学检测,在食品检测方面应用时间较短。国内外学者针对交流阻抗技术在牛奶质量安全方面的检测做了一些研究,发现其是一种快速、有效的检测方法。本文对交流阻抗技术应用在牛奶乳脂含量、含水量、酸败和货架期等质量方面的检测以及体细胞数、抗生素残留、细菌总数和掺假等安全方面的检测进行了综述,以供我国相关方面的研究学者、产品开发者和奶牛养殖者借鉴和参考。%Milk quality and safety is an important part of food safety, which relates to people's health and life safety. Guaranteeing milk quality could ensure consumers get enough nutrients expected from milk whereas milk safety for avoiding damages. AC impedance technology is a kind of potential detection measurement which was earliest applied in electrochemical detection however, it has been short time using in food detection if eld. Based on AC impedance technology, domestic and foreign scholars do some research which shows it is a fast and eff ective detection method. This paper reviews the application of AC impedance technology in the detection of milk quality (milk fat content, moisture content, rancidity and shelf life) and milk safety (somatic cell count, the total number of bacteria, antibiotic residues and adulteration) to provide certain references for our related research scholars, product developers and dairy farmers.

  14. Arabidopsis DET1 degrades HFR1 but stabilizes PIF1 to precisely regulate seed germination

    Science.gov (United States)

    Shi, Hui; Wang, Xin; Mo, Xiaorong; Tang, Chao; Zhong, Shangwei; Deng, Xing Wang

    2015-01-01

    Seed is an essential propagation organ and a critical strategy adopted by terrestrial flowering plants to colonize the land. The ability of seeds to accurately respond to light is vital for plant survival. However, the underlying mechanism is largely unknown. In this study, we reveal a circuit of triple feed-forward loops adopted by Arabidopsis seeds to exclusively repress germination in dark conditions and precisely initiate germination under diverse light conditions. We identify that de-etiolated 1 (DET1), an evolutionarily conserved protein, is a central repressor of light-induced seed germination. Genetic analysis demonstrates that DET1 functions upstream of long hypocotyl in far-red 1 (HFR1) and phytochrome interacting factor 1 (PIF1), the key positive and negative transcription regulators in seed germination. We further find that DET1 and constitutive photomorphogenic 10 (COP10) target HFR1 for protein degradation by assembling a COP10–DET1–damaged DNA binding protein 1–cullin4 E3 ligase complex. Moreover, DET1 and COP10 directly interact with and promote the protein stability of PIF1. Computational modeling reveals that phytochrome B (phyB)–DET1–HFR1–PIF1 and phyB–DET1–Protease–PIF1 are new signaling pathways, independent of the previously identified phyB-PIF1 pathway, respectively mediating the rapid and time-lapse responses to light irradiation. The model-simulated results are highly consistent with their experimental validations, suggesting that our mathematical model captures the essence of Arabidopsis seed germination networks. Taken together, this study provides a comprehensive molecular framework for light-regulated seed germination, improving our understanding of how plants respond to changeable environments. PMID:25775589

  15. Arabidopsis DET1 degrades HFR1 but stabilizes PIF1 to precisely regulate seed germination.

    Science.gov (United States)

    Shi, Hui; Wang, Xin; Mo, Xiaorong; Tang, Chao; Zhong, Shangwei; Deng, Xing Wang

    2015-03-24

    Seed is an essential propagation organ and a critical strategy adopted by terrestrial flowering plants to colonize the land. The ability of seeds to accurately respond to light is vital for plant survival. However, the underlying mechanism is largely unknown. In this study, we reveal a circuit of triple feed-forward loops adopted by Arabidopsis seeds to exclusively repress germination in dark conditions and precisely initiate germination under diverse light conditions. We identify that de-etiolated 1 (DET1), an evolutionarily conserved protein, is a central repressor of light-induced seed germination. Genetic analysis demonstrates that DET1 functions upstream of long hypocotyl in far-red 1 (HFR1) and phytochrome interacting factor 1 (PIF1), the key positive and negative transcription regulators in seed germination. We further find that DET1 and constitutive photomorphogenic 10 (COP10) target HFR1 for protein degradation by assembling a COP10-DET1-damaged DNA binding protein 1-cullin4 E3 ligase complex. Moreover, DET1 and COP10 directly interact with and promote the protein stability of PIF1. Computational modeling reveals that phytochrome B (phyB)-DET1-HFR1-PIF1 and phyB-DET1-Protease-PIF1 are new signaling pathways, independent of the previously identified phyB-PIF1 pathway, respectively mediating the rapid and time-lapse responses to light irradiation. The model-simulated results are highly consistent with their experimental validations, suggesting that our mathematical model captures the essence of Arabidopsis seed germination networks. Taken together, this study provides a comprehensive molecular framework for light-regulated seed germination, improving our understanding of how plants respond to changeable environments.

  16. Impedance and a.c. conductivity studies on Ba(Nd0.2Ti0.6Nb0.2)O3 ceramic prepared through conventional and microwave sintering route

    Indian Academy of Sciences (India)

    Syed Mahboob; G Prasad; G S Kumar

    2006-08-01

    Electrical conduction studies on Ba(Nd0.2Ti0.6Nb0.2)O3 ceramic samples prepared through conventional and microwave sintering route are presented in this paper. D.C. and a.c. conductivities of these samples as a function of temperature from 300–900 K have been studied. Two types of conduction processes are evident from the frequency dependant conductivity plots, i.e. low-frequency conduction due to short-range hopping and high-frequency conduction due to the localized relaxation (reorientational) hopping mechanism. Grain and grain boundary contributions to the conductivity in these samples are obtained from impedance/admittance measurements via equivalent circuit modelling.

  17. Neutronic feasibility studies for LEU conversion of the HFR Petten Reactor.

    Energy Technology Data Exchange (ETDEWEB)

    Hanan, N. A.; Deen, J. R.; Matos, J. E.

    2000-09-26

    Design and safety analyses to determine an optimum LEU fuel assembly design using U{sub 3}Si{sub 2}-Al fuel with up to 4.8 g/cm{sup 3} for conversion of the HFR Petten reactor were performed by the RERTR program in cooperation with the Joint Research Centre and NRG. Credibility of the calculational methods and models were established by comparing calculations with recent measurements by NRG for a core configuration setup for this purpose. This model and methodology were then used to study various LEU fissile loading and burnable poison options that would satisfy specific design criteria.

  18. [HFR aequilibrium can be an answer to malnutrition and hypotension in dialisys: case report].

    Science.gov (United States)

    Corino, Isabella; Ria, Paolo; Pertica, Nicoletta; Zaza, Gianluigi; Lupo, Antonio

    2016-01-01

    The interdialytic hypotension is still the most frequent complication during the hemodialysis. A-HFR has dynamic profiles of ultrafiltration and conductivity of the dialysate that ensure a better refilling and reduce compliance during the dialysis treatment, furthermore reduce the amino acid loss and has a lower inflammatory effect. In our Center, we wanted to analyze the impact of this kind of dialysis on intradialytic tolerance and nutritional status in two malnourished patients with encouraging data on the use of AHFR in malnutrition and disequilibrium syndromes.

  19. A comparative study of the inhibition effects of benzotriazole and 6-aniline-1,3,5-triazine-2,4-dithiol monosodium salt on the corrosion of copper by potentiodynamic polarization, AC impedance and surface-enhanced Raman spectroscopic techniques

    Science.gov (United States)

    Zhou, Guoding; Cai, Shengmin; Song, Liqun; Yang, Huaquan; Fujishima, A.; Ibrahim, A.; Lee, Y. G.; Loo, B. H.

    1991-11-01

    The inhibition effects of benzotriazole (BTA) and 6-aniline-1,3,5-triazine-2,4-dithiol (ATD) monosodium salt on copper corrosion have been studied by the potentiodynamic polarization, AC impedance and surface-enhanced Raman spectroscopic techniques. The polarization resistance Rp increases with the concentration of either BTA or ATD. From the plots of the phase shift θ versus logarithm of the frequency, it is found that θ is close to 90° after the copper electrode is immersed for a long period of time in BTA-containing solution which indicates the behavior of an ideal capacitor. In ATD-containing solutions, θ is close to 45 ° which shows the appearance of a Warburg impedance for a diffusion process. Surface-enhanced Raman spectroscopic studies of the competitive adsorption of BTA and ATD on copper surfaces indicate that BTA adsorbs better than ATD. Based on these results, it is concluded that the inhibition action of BTA is better than that of ATD.

  20. Detection of electrical properties of soybean milk based on AC impedance method%基于交流阻抗法的豆浆电特性检测

    Institute of Scientific and Technical Information of China (English)

    宋华鲁; 闫银发; 宋占华; 陈晨; 李法德

    2015-01-01

    In order to rapidly detect soybean milk quality and to optimize the frequency of power for ohmic heating device, the electrical impedance characteristics of soybean milk with different solid contents (ranging from 1.01%to 9.58%) at different temperatures (ranging from 30 °C to 85 °C with 5 °C interval) were measured with an impedance analyzer at a frequency ranging from 20 Hz to 12 MHz. The impedance analyzer equipped with a commercial conductivity electrode (DJS-10) was operated at a measurement voltage of 50 mV. The temperature of the soybean milk contained in a jacket beaker was controlled with water flowing through the jacket at a constant temperature. The results showed that the impedance amplitude of the soybean milk decreased with the increase in frequency at a low frequency (f300 kHz). The impedance phase angle decreased with the increase in frequency at the low frequency range, and it tended to be zero in the middle-frequency range, while it showed the trend of increase in the high frequencies range. The results showed that the electrical impedance of soybean milk was significantly influenced by the temperature and solid content of soybean milk. There were clear distinctions among the Nyquist plot of electrical impedance for soybean milk with different solid contents at different temperatures. The electrical impedance amplitude of the soybean milk decreased with the increase in temperature and solid content in full frequency range. The impedance phase angle of the soybean milk increased with the increase in temperature and solid content in the low frequency range, while it showed the trend of decrease in the high frequency range. An equivalent electrical circuit of soybean milk which consisted of a resistor a capacitor and a constant phase element (CPE) was built for simulating the impedance data acquired during experiments. The electrical parameters of the equivalent electrical circuit were acquired with the ZSimpWin software. By analyzing the change

  1. 三相交流异步电动机阻抗参数计算%Impedance Parameter Calculation of Three-phase AC Asynchronous Motor

    Institute of Scientific and Technical Information of China (English)

    姚家祎

    2016-01-01

    结合电动机产品样本数据,分别采用计算法、 GB/T 21066-2007《船舶和移动式及固定式近海设施的电气装置三相交流短路电流计算方法》给出的推荐值和试验法3种方法进行计算,分析比较其计算结果的准确性,建议尽量按电动机容量相应的技术数据,用计算方法求电动机阻抗参数;并建议电动机厂商在样本中给出阻抗值,方便工程设计人员计算电动机短路电流。%Based on the sample data of motor, three methods, i. e. calculation method, recommended value and test method, of which the recommended value is recorded in the Electrical Installations of Ships and Mobile and Fixed Offshore Units—Procedures for Calculating Short-circuit Currents in Three-phase A. C. (GB/T 21066-2007), are adopted respectively, so as to analyze and compare the accuracy of computations. It is suggested that the motor impedance parameter is determined by the calculation method according to the technical data of motor capacity, and that the impedance is available for the sample of motor manufacturer so that the engineering designer can calculate the short-circuit current of motor more easily.

  2. Vanadium Pentoxide Nanobelt-Reduced Graphene Oxide Nanosheet Composites as High-Performance Pseudocapacitive Electrodes: ac Impedance Spectroscopy Data Modeling and Theoretical Calculations

    Directory of Open Access Journals (Sweden)

    Sanju Gupta

    2016-07-01

    Full Text Available Graphene nanosheets and graphene nanoribbons, G combined with vanadium pentoxide (VO nanobelts (VNBs and VNBs forming GVNB composites with varying compositions were synthesized via a one-step low temperature facile hydrothermal decomposition method as high-performance electrochemical pseudocapacitive electrodes. VNBs from vanadium pentoxides (VO are formed in the presence of graphene oxide (GO, a mild oxidant, which transforms into reduced GO (rGOHT, assisting in enhancing the electronic conductivity coupled with the mechanical robustness of VNBs. From electron microscopy, surface sensitive spectroscopy and other complementary structural characterization, hydrothermally-produced rGO nanosheets/nanoribbons are decorated with and inserted within the VNBs’ layered crystal structure, which further confirmed the enhanced electronic conductivity of VNBs. Following the electrochemical properties of GVNBs being investigated, the specific capacitance Csp is determined from cyclic voltammetry (CV with a varying scan rate and galvanostatic charging-discharging (V–t profiles with varying current density. The rGO-rich composite V1G3 (i.e., VO/GO = 1:3 showed superior specific capacitance followed by VO-rich composite V3G1 (VO/GO = 3:1, as compared to V1G1 (VO/GO = 1:1 composite, besides the constituents, i.e., rGO, rGOHT and VNBs. Composites V1G3 and V3G1 also showed excellent cyclic stability and a capacitance retention of >80% after 500 cycles at the highest specific current density. Furthermore, by performing extensive simulations and modeling of electrochemical impedance spectroscopy data, we determined various circuit parameters, including charge transfer and solution resistance, double layer and low frequency capacitance, Warburg impedance and the constant phase element. The detailed analyses provided greater insights into physical-chemical processes occurring at the electrode-electrolyte interface and highlighted the comparative performance of

  3. Neutron spectra measurement and comparison of the HFR and THOR BNCT beams.

    Science.gov (United States)

    Liu, Yuan-Hao; Nievaart, Sander; Tsai, Pi-En; Liu, Hong-Ming; Moss, Ray; Jiang, Shiang-Huei

    2009-07-01

    This paper aims to measure the spectra of HB11 (high flux reactor, HFR) and the Tsing Hua open-pool reactor (THOR) boron neutron capture therapy (BNCT) beams by multiple activation foils. The self-shielding corrections were made with the aid of MCNP calculations. The initial spectra were adjusted by a sophisticated process named coarse-scaling adjustment using SAND-EX, which can adjust a given coarse-group spectrum into a fine-group structure, i.e. 640 groups, with excellent continuity. The epithermal neutron flux of the THOR beam is about three times of HB11. The thermal neutron flux, boron and gold reaction rates along the central axis of a PMMA phantom are calculated for both adjusted spectra for comparison.

  4. Mechanistic insights into UV-induced electron transfer from PCBM to titanium oxide in inverted-type organic thin film solar cells using AC impedance spectroscopy.

    Science.gov (United States)

    Kuwabara, Takayuki; Iwata, Chiaki; Yamaguchi, Takahiro; Takahashi, Kohshin

    2010-08-01

    An inverted organic bulk-heterojunction solar cell containing amorphous titanium oxide (TiOx) as an electron collection electrode with the structure ITO/TiO(x)/[6,6]-phenyl C(61) butyric acid methyl ester (PCBM): regioregular poly(3-hexylthiophene) (P3HT)/poly(3,4-ethylenedioxylenethiophene):poly(4-styrene sulfonic acid)/Au (TiO(x) cell) was fabricated. Its complicated photovoltaic properties were investigated by photocurrent-voltage and alternating current impedance spectroscopy measurements. The TiO(x) cell required a significant amount of time (approximately 60 min) to reach its maximum power conversion efficiency (PCE) of 2.6%. To investigate the reason for this slow photoresponse, we investigated the influences of UV light and water molecules adsorbed on the TiO(x) layer. Surface treatment of the TiO(x) cell with water induced a rapid photoresponse and enhanced the performance, giving a PCE of 2.97%. However, the durability of the treated cell was considerably inferior that of the untreated cell because of UV-induced photodegradation. The cause of the rapid photoresponse of the treated cell was attributed to the formation of hydrogen bonds between adsorbed water molecules and carbonyl oxygen atoms in PCBM close to the TiO(x) surface. When the TiO(x) surface was positively charged by UV-induced holes, the carbonyl oxygen in PCBM close to the TiO(x) surface can quickly join to the TiO(x) surface, rapidly transporting photogenerated electrons from PCBM to TiO(x) in competition with the photocatalyzed degradation. The experimental results suggested that the slow photoresponse of the untreated TiO(x) cell was because the morphology of the photoactive organic layer changed gradually upon irradiation to improve the transport of photocarriers at the TiO(x)/PCBM:P3HT interface.

  5. Impedance Scaling and Impedance Control

    Energy Technology Data Exchange (ETDEWEB)

    Chou, W.; Griffin, J.

    1997-06-01

    When a machine becomes really large, such as the Very Large Hadron Collider (VLHC), of which the circumference could reach the order of megameters, beam instability could be an essential bottleneck. This paper studies the scaling of the instability threshold vs. machine size when the coupling impedance scales in a ``normal`` way. It is shown that the beam would be intrinsically unstable for the VLHC. As a possible solution to this problem, it is proposed to introduce local impedance inserts for controlling the machine impedance. In the longitudinal plane, this could be done by using a heavily detuned rf cavity (e.g., a biconical structure), which could provide large imaginary impedance with the right sign (i.e., inductive or capacitive) while keeping the real part small. In the transverse direction, a carefully designed variation of the cross section of a beam pipe could generate negative impedance that would partially compensate the transverse impedance in one plane.

  6. Microstructure, AC impedance and DC electrical conductivity characteristics of NiFe2-xGdxO4 (x = 0, 0.05 and 0.075

    Directory of Open Access Journals (Sweden)

    K. Kamala Bharathi

    2012-03-01

    Full Text Available The structure and electrical characteristics of Gd doped Ni ferrite materials, namely NiFe1.95Gd0.05O4 and NiFe1.925Gd0.075O4, are reported to demonstrate their improved electrical properties compared to that of pure NiFe2O4. NiFe1.95Gd0.05O4 and NiFe1.925Gd0.075O4 compounds crystallize in the cubic inverse spinel phase with a very small amount of GdFeO3 additional phase while pure NiFe2O4 crystallize in inverse spinel phase without any impurity phase. The back scattered electron imaging analysis indicate the primary and secondary formation in NiFe1.95Gd0.05O4 and NiFe1.925Gd0.075O4 compounds. Atomic force microscopy measurements indicate that the bulk grains are ∼2-5 micron size while the grain boundaries are thin compared to bulk grains. Impedance spectroscopic analysis at different temperature indicates the different relaxation mechanisms and their variation with temperature, bulk grain and grain-boundary contributions to the electrical conductivity (Rg and capacitance (Cg of these materials. The conductivity in pure NiFeO4 is found to be predominantly due to intrinsic bulk contribution (Rg=213 kΩ and Cg=4.5 x 10-8 F. In the case of NiFe1.95Gd0.05O4 and NiFe1.925Gd0.075O4 compounds, grain and grain-boundary contributions to the conductivity are clearly observed. The DC conductivity values (at 300 K of NiFe2O4, NiFe1.95Gd0.05O4 and NiFe1.925Gd0.075O4 compounds are found to be 1.06 x 10-7 Ω-1 cm-1, 5.73 x 10-8 Ω-1 cm-1 and 1.28 x 10-8 Ω-1 cm-1 respectively.

  7. 基于BPA数据的交流系统谐波阻抗等值方法研究与应用%Harmonic impedance equivalent calculation based on BPA data for AC system and its application

    Institute of Scientific and Technical Information of China (English)

    吴方劼; 史梦梦; 胡志坚; 王小飞; 陈彬; 汤鹏; 邱骁奇

    2016-01-01

    ,flood season small power flow,dry season large power flow and dry season small power flow,by which,the impedance-frequency chart and the fan-shaped envelope diagram are obtained for the AC filter parameter design of that UHVDC transmission system.

  8. The influence of some new 2,5-disubstituted 1,3,4-thiadiazoles on the corrosion behaviour of mild steel in 1 M HCl solution: AC impedance study and theoretical approach

    Energy Technology Data Exchange (ETDEWEB)

    Bentiss, F. [Laboratoire de Chimie de Coordination et d' Analytique, Faculte des Sciences, Universite Chouaib Doukkali, B.P. 20, M-24000 El Jadida (Morocco)]. E-mail: f.bentiss@pop.ensc-lille.fr; Lebrini, M. [Laboratoire des Procedes d' Elaboration des Revetements Fonctionnels, PERF-LSPES UMR-CNRS 8008, ENSCL, BP 90108, F-59652 Villeneuve d' Ascq Cedex (France); Lagrenee, M. [Unite de Catalyse et de Chimie du Solide, UMR-CNRS 8181, ENSCL, BP 90108, F-59652 Villeneuve d' Ascq Cedex (France); Traisnel, M. [Laboratoire des Procedes d' Elaboration des Revetements Fonctionnels, PERF-LSPES UMR-CNRS 8008, ENSCL, BP 90108, F-59652 Villeneuve d' Ascq Cedex (France); Elfarouk, A. [Laboratoire de Mathematiques Pures et Appliquees, Universite du Littoral-Cote d' Opale, C.U. de la Mi-Voix, 50 Rue F. Buisson, BP 699, F-62228 Calais Cedex (France); Vezin, H. [Laboratoire de Chimie Organique et Macromoleculaire, UMR-CNRS 8009, USTL Bat C4, F-59655 Villeneuve d' Ascq Cedex (France)

    2007-08-01

    The new 2,5-disubstituted 1,3,4-thiadiazoles were investigated as corrosion inhibitors of mild steel in 1 M HCl using AC impedance technique. Four of these compounds exhibit good inhibition properties, while two of them, 2,5-bis(4-nitrophenyl)-1,3,4-thiadiazole and 2,5-bis(4-chlorophenyl)-1,3,4-thiadiazole, stimulate the corrosion process especially at low concentrations. The experimental data obtained from this method show a frequency distribution and therefore a modelling element with frequency dispersion behaviour, a constant phase element (CPE) has been used. Possible correlations between experimental inhibition efficiencies and quantum chemical parameters such as dipole moment ({mu}), highest occupied (E {sub HOMO}) and lowest unoccupied (E {sub LUMO}) molecular orbitals were investigated. The models of the inhibitors were optimised with the Density Functional Theory formalism (DFT) using hybrid B3LYP/6-31G (2d,2p) as a higher level of theory. The Quantitative Structure Activity Relationship (QSAR) approach has been used and composite index of some quantum chemical parameters were constructed in order to characterize the inhibition performance of the tested molecules.

  9. 海水侵蚀下钢筋混凝土耐久性的交流阻抗谱%Study of the Durability of Reinforced Concrete under the Long-term Intrusion of Seawater by AC Impedance Spectroscopy

    Institute of Scientific and Technical Information of China (English)

    贺鸿珠; 陈志源; 史美伦

    2000-01-01

    Reinforced concrete under the long-term intrusion of seawater has been studied by the K-Ktransform of AC impedance spectroscopy. The stability and durability of the reinforced concrete can bemeasured by the relative deviation of the values measured from that calculated by K-K transform. Withthe increase of the time of the intrusion, the concrete and the rebar is less and less stable and durable.Under the same condition, concrete with fly ash is more stable than ordinary concrete.%应用交流阻抗谱中的Kramers-Kronig变换对受海水长期侵蚀的混凝土和钢筋分别进行了研究.混凝土和钢筋的稳定性可用K-K变换值与实测值之间相对偏差的大小来进行衡量.随着海水侵蚀时间的增加,混凝土和钢筋的稳定性越来越差.在同样条件下,掺粉煤灰混凝土的稳定性优于普通混凝土.

  10. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  11. The dose comparison between the THOR and HFR epithermal neutron beams

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Yi-Chun [Biomedical Engineering and Environmental Sciences Department, National Tsing Hua University, Hsinchu, Taiwan (China); Roca, Antoaneta [Institute for Energy, Joint Research Centre, European Commission (Netherlands); Faculty of Physics, University of Bucharest, Bucuresti-Magurele (Romania); Liu, Yuan-Hao, E-mail: yhl.taiwan@gmail.co [Health Physics Division, Nuclear Science and Technology Development Center, National Tsing Hua University, No. 101, Section 2, Kuang-Fu Road, Hsinchu 30013, Taiwan (China); Tsai, Pi-En [Health Physics Division, Nuclear Science and Technology Development Center, National Tsing Hua University, No. 101, Section 2, Kuang-Fu Road, Hsinchu 30013, Taiwan (China); Nievaart, Sander [Institute for Energy, Joint Research Centre, European Commission (Netherlands); Liu, Hong-Ming [Health Physics Division, Nuclear Science and Technology Development Center, National Tsing Hua University, No. 101, Section 2, Kuang-Fu Road, Hsinchu 30013, Taiwan (China); Moss, Ray [Institute for Energy, Joint Research Centre, European Commission (Netherlands); Chou, Wen-Tsae [Biomedical Engineering and Environmental Sciences Department, National Tsing Hua University, Hsinchu, Taiwan (China); Jiang, Shiang-Huei [Institute of Nuclear Engineering and Science, National Tsing Hua University, Hsinchu, Taiwan (China)

    2010-12-15

    This study is a part of the beam comparison campaign, inter-center dose comparison, between boron neutron capture therapy facilities at the Tsing Hua Open-pool Reactor and the High Flux Reactor. The clinical information exchange can improve the dosimetry uncertainty for medical physics in a mixed field. The method of paired Mg(Ar) and TE(TE) ionization chambers was used to determine the gamma-ray and neutron dose rates. Furthermore, activation foils, including gold, copper, and manganese, were employed to estimate the thermal and epithermal neutron fluxes. Measurements were performed free in air and also in a PMMA phantom. All the chambers were calibrated using a {sup 60}Co primary standard source at the Institute of Nuclear Energy Research, Taiwan. Spectrum dependent neutron sensitivity of TE(TE) chamber is one of the important parameters to evaluate dose components. The requested neutron spectra were calculated by the Monte Carlo code MCNP. The measured thermal neutron fluxes, gamma-ray and neutron dose rates of the THOR beam in the phantom were 2.6, 2.2, and 2.1 times of the HFR beam at 2.5-cm depth, respectively. The higher thermal neutron flux and neutron and gamma-ray dose rates are due to the higher epithermal neutron beam intensity of the THOR.

  12. Arabidopsis HFR1 is a potential nuclear substrate regulated by the Xanthomonas type III effector XopD(Xcc8004).

    Science.gov (United States)

    Tan, Choon Meng; Li, Meng-Ying; Yang, Pei-Yun; Chang, Shu Heng; Ho, Yi-Ping; Lin, Hong; Deng, Wen-Ling; Yang, Jun-Yi

    2015-01-01

    XopDXcc8004, a type III effector of Xanthomonas campestris pv. campestris (Xcc) 8004, is considered a shorter version of the XopD, which lacks the N-terminal domain. To understand the functions of XopDXcc8004, in planta, a transgenic approach combined with inducible promoter to analyze the effects of XopDXcc8004 in Arabidopsis was done. Here, the expression of XopDXcc8004, in Arabidopsis elicited the accumulation of host defense-response genes. These molecular changes were dependent on salicylic acid and correlated with lesion-mimic phenotypes observed in XVE::XopDXcc8004 transgenic plants. Moreover, XopDXcc8004 was able to desumoylate HFR1, a basic helix-loop-helix transcription factor involved in photomorphogenesis, through SUMO protease activity. Interestingly, the hfr1-201 mutant increased the expression of host defense-response genes and displayed a resistance phenotype to Xcc8004. These data suggest that HFR1 is involved in plant innate immunity and is potentially regulated by XopDXcc8004.

  13. Arabidopsis HFR1 Is a Potential Nuclear Substrate Regulated by the Xanthomonas Type III Effector XopDXcc8004

    Science.gov (United States)

    Tan, Choon Meng; Li, Meng-Ying; Yang, Pei-Yun; Chang, Shu Heng; Ho, Yi-Ping; Lin, Hong; Deng, Wen-Ling; Yang, Jun-Yi

    2015-01-01

    XopDXcc8004, a type III effector of Xanthomonas campestris pv. campestris (Xcc) 8004, is considered a shorter version of the XopD, which lacks the N-terminal domain. To understand the functions of XopDXcc8004, in planta, a transgenic approach combined with inducible promoter to analyze the effects of XopDXcc8004 in Arabidopsis was done. Here, the expression of XopDXcc8004, in Arabidopsis elicited the accumulation of host defense-response genes. These molecular changes were dependent on salicylic acid and correlated with lesion-mimic phenotypes observed in XVE::XopDXcc8004 transgenic plants. Moreover, XopDXcc8004 was able to desumoylate HFR1, a basic helix-loop-helix transcription factor involved in photomorphogenesis, through SUMO protease activity. Interestingly, the hfr1-201 mutant increased the expression of host defense-response genes and displayed a resistance phenotype to Xcc8004. These data suggest that HFR1 is involved in plant innate immunity and is potentially regulated by XopDXcc8004. PMID:25647296

  14. Arabidopsis HFR1 is a potential nuclear substrate regulated by the Xanthomonas type III effector XopD(Xcc8004.

    Directory of Open Access Journals (Sweden)

    Choon Meng Tan

    Full Text Available XopDXcc8004, a type III effector of Xanthomonas campestris pv. campestris (Xcc 8004, is considered a shorter version of the XopD, which lacks the N-terminal domain. To understand the functions of XopDXcc8004, in planta, a transgenic approach combined with inducible promoter to analyze the effects of XopDXcc8004 in Arabidopsis was done. Here, the expression of XopDXcc8004, in Arabidopsis elicited the accumulation of host defense-response genes. These molecular changes were dependent on salicylic acid and correlated with lesion-mimic phenotypes observed in XVE::XopDXcc8004 transgenic plants. Moreover, XopDXcc8004 was able to desumoylate HFR1, a basic helix-loop-helix transcription factor involved in photomorphogenesis, through SUMO protease activity. Interestingly, the hfr1-201 mutant increased the expression of host defense-response genes and displayed a resistance phenotype to Xcc8004. These data suggest that HFR1 is involved in plant innate immunity and is potentially regulated by XopDXcc8004.

  15. 基于交流阻抗法的离子交换膜电阻研究%Study on conductivity of ion exchange membranes with AC impedance method

    Institute of Scientific and Technical Information of China (English)

    范永生; 陈晓; 王保国

    2011-01-01

    Using AC impedance measurement, this study proposed a method to investigate ion exchange membrane area resistances; a two-polar cell holds membrane immersed in electrolyte solution, area resistance was determined by the difference of electricity resistance measured with or without a membrane The error can be minimized by using a parallel electricity resistance.This method was proofed reliable and effective by measuring area resistances of a cation or an anion exchange membranes in electrolyte solution,including aqueous sulfuric acid, sodium chloride, and the real electrolyte used in vanadium redox flow battery(VRB).The measured results revealed the various adsorption behaviors of cation and anion exchange membranes, and showed membrane area resistance dependence upon electrolyte solution concentration.This study will facilitate the development of ion exchange membranes and its application in renewable energy technology.%利用交流阻抗谱测定技术,建立一种离子交换膜导电性能评价方法;使用两极室槽电解池,分别测得电解质溶液,以及膜和电解质溶液之和的电阻值,相减后得到离子交换膜在该电解液中的电阻值.通过并联电阻形成完整的半圆弧形交流阻抗谱,能够有效减小测量误差.利用硫酸水溶液体系、氯化钠水溶液体系,以及全钒液流电池的钒电解液体系验证基于交流阻抗谱的膜电阻测定技术准确性、实用性.在此基础上揭示阳离子交换膜、阴离子交换膜对离子的不同吸附特性,以及膜面电阻对电解质溶液浓度依存特性.研究结果对于发展离子交换膜快速表征技术,以及开发新能源领域的离子交换膜具有重要价值.

  16. Irradiation programme HFR phase 1b. Results of impact tests with the irradiated materials (2.4 dpa); Bestrahlungsprogramm HFR Phase 1b. Ergebnisse der Kerbschlagbiegeversuche mit den bis 2,4 dpa bestrahlten Werkstoffen

    Energy Technology Data Exchange (ETDEWEB)

    Schneider, H.C.; Dafferner, B.; Ries, H.; Lautensack, S.; Romer, O.

    2004-04-01

    The irradiation project HFR phase 1b was planned and carried out in the frame of the European Long-term Fusion Materials Development Programme. It represents the continuation of the former High-Flux-Reactor irradiation programmes which are documented in detail in former FZK-reports. The problem of the irradiation induced embrittlement of possible martensitic alloy candidates is still not finally solved. After evaluation of sub-size Charpy tests with the 2.4 dpa irradiated specimens, the low activation 7-10%-Cr-W(Ge)VTa alloys showed outstandingly better characteristics compared to the modified commercial 10-11%-Cr-NiMoVNb steels. The emphasis of the phase 1b project is now on the investigation of low activating OPTIFER-alloys, which exhibit in contrast to the previously irradiated OPTIFER-steels a clearly reduced boron content in order to reduce the irradiation embrittlement. In the present report the results of instrumented impact tests within the phase 1b programme (irradiation dose 2.4 dpa, irradiation temperatures 250, 300, 350, 400, and 450 C) are analysed and assessed in comparison to the results of the MANITU- and HFR phase 1a- irradiation programmes. Herein, the OPTIFER-V steel, which is nearly identical to the industrial heat EUROFER97 (which became available after the irradiation), supplied the best results. (orig.)

  17. Impedance-Source Networks for Electric Power Conversion Part II

    DEFF Research Database (Denmark)

    Siwakoti, Yam P.; Peng, Fang Zheng; Blaabjerg, Frede

    2015-01-01

    Impedance-source networks cover the entire spectrum of electric power conversion applications (dc-dc, dc-ac, ac-dc, ac-ac) controlled and modulated by different modulation strategies to generate the desired dc or ac voltage and current at the output. A comprehensive review of various impedance-source......-network-based power converters has been covered in a previous paper and main topologies were discussed from an application point of view. Now Part II provides a comprehensive review of the most popular control and modulation strategies for impedance-source network-based power converters/inverters. These methods...... topology at a certain power level, switching frequency and demanded dynamic response....

  18. Differential Responses of Post-Exercise Recovery of Leg Blood Flow and Oxygen Uptake Kinetics in HFpEF versus HFrEF.

    Science.gov (United States)

    Thompson, Richard B; Pagano, Joseph J; Mathewson, Kory W; Paterson, Ian; Dyck, Jason R; Kitzman, Dalane W; Haykowsky, Mark J

    2016-01-01

    The goals of the current study were to compare leg blood flow, oxygen extraction and oxygen uptake (VO2) after constant load sub-maximal unilateral knee extension (ULKE) exercise in patients with heart failure with reduced ejection fraction (HFrEF) compared to those with preserved ejection fraction (HFpEF). Previously, it has been shown that prolonged whole body VO2 recovery kinetics are directly related to disease severity and all-cause mortality in HFrEF patients. To date, no study has simultaneously measured muscle-specific blood flow and oxygen extraction post exercise recovery kinetics in HFrEF or HFpEF patients; therefore it is unknown if muscle VO2 recovery kinetics, and more specifically, the recovery kinetics of blood flow and oxygen extraction at the level of the muscle, differ between HF phenotypes. Ten older (68±10yrs) HFrEF (n = 5) and HFpEF (n = 5) patients performed sub-maximal (85% of maximal weight lifted during an incremental test) ULKE exercise for 4 minutes. Femoral venous blood flow and venous O2 saturation were measured continuously from the onset of end-exercise, using a novel MRI method, to determine off-kinetics (mean response times, MRT) for leg VO2 and its determinants. HFpEF and HFrEF patients had similar end-exercise leg blood flow (1.1±0.6 vs. 1.2±0.6 L/min, p>0.05), venous saturation (42±12 vs. 41±11%, p>0.05) and VO2 (0.13±0.08 vs. 0.11±0.05 L/min, p>0.05); however HFrEF had significantly delayed recovery MRT for flow (292±135sec. vs 105±63sec., p = 0.004) and VO2 (95±37sec. vs. 47±15sec., p = 0.005) compared to HFpEF. Impaired muscle VO2 recovery kinetics following ULKE exercise differentiated HFrEF from HFpEF patients and suggests distinct underlying pathology and potential therapeutic approaches in these populations.

  19. Electrochemical Impedance of Ethanol Oxidation in Alkaline Media

    Institute of Scientific and Technical Information of China (English)

    DANAEE Iman; JAFARIAN Majid; GOBAL Fereydoon; SHARAFI Mahboobeh; MAHJANI Mohammad-ghasem

    2012-01-01

    Nickel modified NiOOH electrodes were used for the electrocatalytic oxidation of ethanol in alkaline solutions.The electro-oxidation of ethanol in a 1 mol/L NaOH solution at different concentrations of ethanol was studied by ac impedance spectroscopy.Electrooxidation of ethanol on Ni shows negative resistance on impedance plots.The impedance shows different patterns at different applied anodic potential.The influence of the electrode potential on impedance was studied and a quantitative explanation for the impedance of ethanol oxidation was given by means of a proposed mathematical model.At potentials higher than 0.52 V(vs.Ag/AgCl),a pseudoinductive behavior was observed,but at those higher than 0.57 V,impedance patterns were reversed to the second and third quadrants.The conditions required for the reversing of impedance pattern were delineated with the impedance model.

  20. AC conductivity, dielectric and impedance studies of Cd{sub 0.8−x}Pb{sub x}Zn{sub 0.2}S mixed semiconductor compounds

    Energy Technology Data Exchange (ETDEWEB)

    Shekharam, T., E-mail: tshekharam@gmail.com; Laxminarasimha Rao, V.; Yellaiah, G.; Mohan Kumar, T.; Nagabhushanam, M., E-mail: mamidala_nb@yahoo.com

    2014-12-25

    Graphical abstract: A plot of 1−s versus T (K) for Cd{sub 0.8−x}Pb{sub x}Zn{sub 0.2}S (x = 0, 0.1–0.8), inset: plot of s versus T (K) for x = 0. - Highlights: • Activation energy of relaxation process of Cd{sub 0.8−x}Pb{sub x}Zn{sub 0.2}S (x = 0, 0.1–0.8) compounds has been determined. • Grain resistances and grain capacitances of the compounds were estimated at different temperatures. • Relaxation time for all the compounds has been determined at different temperatures. - Abstract: The samples of Cd{sub 0.8−x}Pb{sub x}Zn{sub 0.2}S (x = 0, 0.1–0.8) are prepared by Controlled Co-Precipitation Method. X-ray diffraction studies have confirmed the polycrystalline nature of the samples with Hexagonal and Cubic phases of Wurtzite structure. AC conductivity (σ{sub ac}) measurements of Cd{sub 0.8−x}Pb{sub x}Zn{sub 0.2}S samples at different temperatures (between 40 and 300 °C), in the frequency range 5 kHz–20 MHz were made. The results showed that σ{sub ac} obeys the relation σ{sub ac}(ω) = Aω{sup s}. The exponent “s” was found to decrease with increase in temperature. Further analysis revealed that, the AC conductivity of the samples follow correlated barrier hopping (CBH) model. The dielectric constant (∊′) and dielectric loss (Tan δ) were observed to (i) increase with the increase in temperature and the increase is higher at lower frequencies and (ii) decrease rapidly at low frequencies and remains almost constant at higher frequencies. The cole–cole plot showed a single semicircle, indicating an equivalent circuit with a single parallel resistor R{sub g} and capacitance C{sub g} network with a series resistance R{sub s}. The plots also show the grain contribution toward AC conductivity. The relaxation frequencies, determined from these plots are used to calculate the activation energies E{sub a} of relaxation process using Log τ versus 10{sup 3}/T plots. The values of E{sub a} for all the studied compounds range from 0.05 to 0

  1. Plasmonic-Based Electrochemical Impedance Spectroscopy: Application to Molecular Binding

    Science.gov (United States)

    Lu, Jin; Wang, Wei; Wang, Shaopeng; Shan, Xiaonan; Li, Jinghong; Tao, Nongjian

    2012-01-01

    Plasmonic-based electrochemical impedance spectroscopy (P-EIS) is developed to investigate molecular binding on surfaces. Its basic principle relies on the sensitive dependence of surface plasmon resonance (SPR) signal on surface charge density, which is modulated by applying an AC potential to a SPR chip surface. The AC component of the SPR response gives the electrochemical impedance, and the DC component provides the conventional SPR detection. The plasmonic-based impedance measured over a range of frequency is in quantitative agreement with the conventional electrochemical impedance. Compared to the conventional SPR detection, P-EIS is sensitive to molecular binding taking place on the chip surface, and less sensitive to bulk refractive index changes or non-specific binding. Moreover, this new approach allows for simultaneous SPR and surface impedance analysis of molecular binding processes. PMID:22122514

  2. Gel dosimetry in the BNCT facility for extra-corporeal treatment of liver cancer at the HFR Petten.

    Science.gov (United States)

    Gambarini, G; Daquino, G G; Moss, R L; Carrara, M; Nievaart, V A; Vanossi, E

    2007-01-01

    A thorough evaluation of the dose inside a specially designed and built facility for extra-corporeal treatment of liver cancer by boron neutron capture therapy (BNCT) at the High Flux Reactor (HFR) Petten (The Netherlands) is the necessary step before animal studies can start. The absorbed doses are measured by means of gel dosemeters, which help to validate the Monte Carlo simulations of the spheroidal liver holder that will contain the human liver for irradiation with an epithermal neutron beam. These dosemeters allow imaging of the dose due to gammas and to the charged particles produced by the (10)B reaction. The thermal neutron flux is extrapolated from the boron dose images and compared to that obtained by the calculations. As an additional reference, Au, Cu and Mn foil measurements are performed. All results appear consistent with the calculations and confirm that the BNCT liver facility is able to provide an almost homogeneous thermal neutron distribution in the liver, which is a requirement for a successful treatment of liver metastases.

  3. ac impedance, X-ray photoelectron spectroscopy and density functional theory studies of 3,5-bis(n-pyridyl)-1,2,4-oxadiazoles as efficient corrosion inhibitors for carbon steel surface in hydrochloric acid solution

    Energy Technology Data Exchange (ETDEWEB)

    Outirite, Moha; Lagrenee, Michel; Lebrini, Mounim [Unite de Catalyse et de Chimie du Solide, UMR-CNRS 8181, ENSCL, B.P. 90108, F-59652 Villeneuve d' Ascq Cedex (France); Traisnel, Michel; Jama, Charafeddine [Laboratoire des Procedes d' Elaboration des Revetements Fonctionnels, PERF UMR-CNRS 8008, ENSCL, B.P. 90108, F-59652 Villeneuve d' Ascq Cedex (France); Vezin, Herve [Laboratoire de Chimie Organique et Macromoleculaire, UMR-CNRS 8009, USTL Bat C4, F-59655 Villeneuve d' Ascq Cedex (France); Bentiss, Fouad, E-mail: fbentiss@enscl.f [Laboratoire de Chimie de Coordination et d' Analytique, Faculte des Sciences, Universite Chouaib Doukkali, B.P. 20, M-24000 El Jadida (Morocco)

    2010-02-01

    The corrosion inhibition properties of a new class of oxadiazole derivatives, namely 3,5-bis(n-pyridyl)-1,2,4-oxadiazoles (n-DPOX) for C38 carbon steel corrosion in 1 M HCl medium were analysed by electrochemical impedance spectroscopy (EIS). An adequate structural model of the interface was used and the values of the corresponding parameters were calculated and discussed. The experimental results showed that these compounds are excellent inhibitors for the C38 steel corrosion in acid solution and that the protection efficiency increased with increasing the inhibitors concentration. Electrochemical impedance data demonstrate that the addition of the n-DPOX derivatives in the corrosive solution decreases the charge capacitance and simultaneously increases the function of the charge/discharge of the interface, facilitating the formation of an adsorbed layer over the steel surface. Adsorption of these inhibitors on the steel surface obeys to the Langmuir adsorption isotherm. X-ray photoelectron spectroscopy (XPS) and the thermodynamic data of adsorption showed that inhibition of steel corrosion in normal hydrochloric solution by n-DPOX is due to the formation of a chemisorbed film on the steel surface. Quantum chemical calculations using the Density Functional Theory (DFT) and the Quantitative Structure Activity Relationship (QSAR) approach were performed on n-DPOX derivatives to determine the relationship between molecular structure and their inhibition efficiencies. The results of the quantum chemical calculations and experimental inhibition efficiency were subjected to correlation analysis and indicate that their inhibition effect is closely related to E{sub HOMO}, E{sub LUMO}, and dipole moment (mu).

  4. Enhanced corrosion resistance of carbon steel in normal sulfuric acid medium by some macrocyclic polyether compounds containing a 1,3,4-thiadiazole moiety: AC impedance and computational studies

    Energy Technology Data Exchange (ETDEWEB)

    Bentiss, F. [Laboratoire de Chimie de Coordination et d' Analytique, Faculte des Sciences, Universite Chouaib Doukkali, B.P. 20, M-24000 El Jadida (Morocco)], E-mail: fbentiss@enscl.fr; Lebrini, M. [Unite de Catalyse et de Chimie du Solide, UMR-CNRS 8181, ENSCL, BP. 90108, F-59652 Villeneuve d' Ascq Cedex (France); Vezin, H. [Laboratoire de Chimie Organique et Macromoleculaire, UMR-CNRS 8009, USTL Bat C4, F-59655 Villeneuve d' Ascq Cedex (France); Chai, F. [Groupe de Recherche sur les biomateriaux, Laboratoire de Biophysique, UPRES EA 1049, Faculte de Medecine, F-59045 Lille Cedex (France); Traisnel, M.; Lagrene, M. [Laboratoire des Procedes d' Elaboration des Revetements Fonctionnels, PERF UMR-CNRS 8008, ENSCL, B.P. 90108, F-59652 Villeneuve d' Ascq Cedex (France)

    2009-09-15

    We report here the use of macrocyclic polyether compounds containing a 1,3,4-thiadiazole moiety (n-MCTH) in the corrosion inhibition of C38 carbon steel in 0.5 M H{sub 2}SO{sub 4} acid medium. The aim of this work is devoted to study the inhibition characteristics of these compounds for acid corrosion of C38 steel using electrochemical impedance spectroscopy (EIS). Data obtained from EIS show a frequency distribution and therefore a modeling element with frequency dispersion behaviour, a constant phase element (CPE) has been used. The experimental results obtained revealed that these compounds inhibited the steel corrosion in acid solution and the protection efficiency increased with increasing inhibitors concentration. The difference in their inhibitive action can be explained on the basis of the number of oxygen atoms present in the polyether ring which contribute to the chemisorption strength through the donor acceptor bond between the non bonding electron pair and the vacant orbital of metal surface. Adsorption of n-MCTH was found to follow the Langmuir's adsorption isotherm. The thermodynamic functions of adsorption process were calculated and the interpretation of the results is given. These results are complemented with quantum chemical study in order to provide an explanation of the differences between the probed inhibitors. Correlation between the inhibition efficiency and the structure of these compounds are presented.

  5. AC Impedance Behavior of LaNi3.55Mn0.4Al0.3Co0.6Fe0.15 Hydrogen-Storage Alloy: Effect of Surface Area

    Science.gov (United States)

    Tliha, M.; Khaldi, C.; Lamloumi, J.

    2016-04-01

    The decrease of Cobalt content in alloy is very beneficial to reduce the production cost of the alloy, whereas the effect of Co on cycle life of the AB5-type hydrogen-storage alloys is extremely important. Therefore, it is interesting to investigate low-Co and/or Co-free AB5-type alloys in which Co was substituted by other elements. Iron is a key element in the development of low-Co AB5-type alloys. The aim of this work is to systematically investigate the effect of the real surface area on the all kinetic properties of a low-Co LaNi3.55Mn0.4Al0.3Co0.6Fe0.15 alloy under cycling using electrochemical impedance spectroscopy (EIS) technique. All kinetic properties of the electrode, such as exchange density, limiting current density, high-rate charge/discharge ability, cycle life time, electrocatalytic activity, and diffusion rate are related to the real surface area. During the EIS analysis, interestingly, we found that with increasing number of charge/discharge cycles, the metal hydride alloy powders undergo micro-cracking into smaller particles, and thus the real surface area of the alloy increases, which then influences the kinetic properties of the electrode reactions.

  6. 5{sup th} international geothermal conference. Conference volume. Risk management, financing, power plant technology, EGS/HFR

    Energy Technology Data Exchange (ETDEWEB)

    Schneider, Jochen; Hoffmann, Nadine; Brian, Marcus (eds.)

    2009-07-01

    Within the 5th International Geothermal Conference at 27th to 28th April, 2009, in Freiburg (Federal Republic of Germany) the following lectures were held: (a) Worldwide development of geothermal energy (Ladislaus Rypach); (b) Geothermal developments and applications in Turkey (Orhan Mertoglu); (c) Guermat Elektrik: Turkish experiences in geothermal financings (John F. Wolfe); (d) Geothermal exploration success: Using data and best practices from the oil and gas industry (Jan-Diederik van Wees); (e) Implementing geothermal power projects - risk management and financing from the investor's point of view (Christian Jokiel); (f) Risks and risk mitigation in the Upper Rhine Graben geothermal province (Christian Hecht); (g) The Soultz geothermal plant: from the concept to the first geothermal kWh (Albert Genter); (h) Binary power plant technologies for geothermal power generation (Kathrin Rohloff); (i) Kalina power plants - 10 years of operational experience (Gestur R. Bardarson); (j) 1,200 MW experience with innovative geothermal power plants (Hilel Legmann); (k) Challenges of managing geothermal power plant projects (Norbert Hartlieb); (l) Requirements for geothermal power plants (Athanasios Tsoubaklis); (m) Credit programme on productivity risk in deep geothermal projects (Karin Freier, Peter Hasenbein, Stephan Jacob); (n) Geothermal projects in the light of the financial crisis (Thomas G. Engelmann); (o) Insurability of geothermal projects (Matthias Kliesch); (p) Requirements for equity investors to finance a geothermal project (Thoma G. Engelmann); (q) Aspects of project development from an investor's perspective (Bernhard Gubo); (r) Project requirements and challenges in geothermal projects (Olaf Heil); (s) The 'quest' for appropriate locations for HFR projects in Southern Germany (Wolfgang Bauer); (t) Status of the Soultz geothermal power plant and the deep reservoir after some months of circulation (Albert Genter); (u) Hot

  7. On the relationship between corrosion inhibiting effect and molecular structure of 2,5-bis(n-pyridyl)-1,3,4-thiadiazole derivatives in acidic media: Ac impedance and DFT studies

    Energy Technology Data Exchange (ETDEWEB)

    Bentiss, F., E-mail: fbentiss@enscl.f [Laboratoire de Chimie de Coordination et d' Analytique (LCCA), Faculte des Sciences, Universite Chouaib Doukkali, B.P. 20, M-24000 El Jadida (Morocco); Mernari, B. [Laboratoire de Chimie de Coordination et d' Analytique (LCCA), Faculte des Sciences, Universite Chouaib Doukkali, B.P. 20, M-24000 El Jadida (Morocco); Traisnel, M. [Unite Materiaux et Transformations (UMET), Ingenierie des Systemes Polymeres, CNRS UMR 8207, ENSCL, B.P. 90108, F-59652 Villeneuve d' Ascq Cedex (France); Vezin, H. [Laboratoire de Spectrochimie Infrarouge et Raman (LASIR), UMR-CNRS 8516, Universite des Sciences et Technologies de Lille, Batiment C5, F-59655 Villeneuve d' Ascq Cedex (France); Lagrenee, M., E-mail: michel.lagrenee@ensc-lille.f [Unite de Catalyse et de Chimie du Solide (UCCS), UMR-CNRS 8181, ENSCL, B.P. 90108, F-59652 Villeneuve d' Ascq Cedex (France)

    2011-01-15

    Research highlights: {yields}2,5-Bis(n-pyridyl)-1,3,4-thiadiazoles (n-PTH) act as good inhibitors for the mild steel in acidic media. {yields}The inhibiting protection depends on the position of the nitrogen on the pyridinium substituent according to order 3-PTH > 2-PTH > 4-PTH. {yields}The adsorption of n-PTH is found to follow the Langmuir's adsorption isotherm. {yields}Data obtained from quantum chemical calculations using DFT method were correlated to the experimentally obtained inhibition efficiencies. - Abstract: The inhibition properties of 2,5-bis(n-pyridyl)-1,3,4-thiadiazoles (n-PTH) on corrosion of mild steel in different acidic media (1 M HCl, 0.5 M H{sub 2}SO{sub 4} and 1 M HClO{sub 4}) were analyzed by electrochemical impedance spectroscopy (EIS). The n-PTH derivatives exhibit good inhibition properties in different acidic solutions and the calculated values of {Delta}G{sub ads}{sup 0} revealed that the adsorption mechanism of n-PTH on steel surface is mainly due to chemisorption. While in 1 M HClO{sub 4}, both 2-PTH and 4-PTH isomers stimulate the corrosion process especially at low concentrations. Quantum chemical calculations using the density functional theory (DFT) were performed on n-PTH derivatives to determine the relationship between molecular structure and their inhibition efficiencies. The results of the quantum chemical calculations and experimental inhibition efficiency were subjected to correlation analysis and indicate that the inhibition effects of n-PTH may be explained in terms of electronic properties.

  8. Impedance-Source Networks for Electric Power Conversion Part I

    DEFF Research Database (Denmark)

    Siwakoti, Yam P.; Peng, Fang Zheng; Blaabjerg, Frede;

    2015-01-01

    Impedance networks cover the entire of electric power conversion from dc (converter, rectifier), ac (inverter), to phase and frequency conversion (ac-ac) in a wide range of applications. Various converter topologies have been reported in the literature to overcome the limitations and problems...... of the traditional voltage source, current source as well as various classical buck-boost, unidirectional, and bidirectional converter topologies. Proper implementation of the impedance-source network with appropriate switching configurations and topologies reduces the number of power conversion stages in the system...... power chain, which may improve the reliability and performance of the power system. The first part of this paper provides a comprehensive review of the various impedance-source-networks-based power converters and discusses the main topologies from an application point of view. This review paper...

  9. Wakefields and coupling impedances

    Energy Technology Data Exchange (ETDEWEB)

    Kurennoy, S. (Superconducting Super Collider Laboratory, 2550 Beckleymeade Ave., Dallas, Texas 75237 (United States))

    1995-02-01

    After a short introduction of the wake potentials and coupling impedances, a few new results in impedance calculations are discussed. The first example is a new analytical method for calculating impedances of axisymmetric structures in the low frequency range, below the cutoff frequency of the vacuum chamber. The second example demonstrates that even very small discontinuities on a smooth waveguide can result in appearance of trapped modes, with frequencies slightly below the waveguide cutoff frequency. The high-frequency (above the cutoff) behavior of the coupling impedance of many small discontinuities is discussed in the third example. [copyright] 1995 [ital American] [ital Institute] [ital of] [ital Physics

  10. Wakefields and coupling impedances

    Science.gov (United States)

    Kurennoy, Sergey

    1995-02-01

    After a short introduction of the wake potentials and coupling impedances, a few new results in impedance calculations are discussed. The first example is a new analytical method for calculating impedances of axisymmetric structures in the low frequency range, below the cutoff frequency of the vacuum chamber. The second example demonstrates that even very small discontinuities on a smooth waveguide can result in appearance of trapped modes, with frequencies slightly below the waveguide cutoff frequency. The high-frequency (above the cutoff) behavior of the coupling impedance of many small discontinuities is discussed in the third example.

  11. Impedance plethysmography of thoracic region: impedance cardiography.

    Directory of Open Access Journals (Sweden)

    Deshpande A

    1990-10-01

    Full Text Available Impedance plethysmograms were recorded from thoracic region in 254 normal subjects, 183 patients with coronary artery disease, 391 patients with valvular heart disease and 107 patients with congenital septal disorder. The data in 18 normal subjects and 55 patients showed that basal impedance decreases markedly during exercise in patients with ischaemic heart disease. Estimation of cardiac index by this technique in a group of 99 normal subjects has been observed to be more consistent than that of the stroke volume. Estimation of systolic time index from impedance plethysmograms in 34 normal subjects has been shown to be as reliable as that from electrocardiogram, phonocardiogram and carotid pulse tracing. Changes in the shape of plethysmographic waveform produced by valvular and congenital heart diseases are briefly described and the role of this technique in screening cardiac patients has been highlighted.

  12. An impedance grasping strategy

    NARCIS (Netherlands)

    Muñoz Arias, Mauricio; Scherpen, Jacqueline M.A.; Macchelli, Alessandro

    2014-01-01

    This work is devoted to an impedance grasping strategy for a class of standard mechanical systems in the port- Hamiltonian framework. The presented control strategy re- quires a set of coordinate transformations, since the impedance control in the port-Hamiltonian framework with structure preservati

  13. Impedance and Collective Effects

    CERN Document Server

    Metral, E; Rumolo, R; Herr, W

    2013-01-01

    This document is part of Subvolume C 'Accelerators and Colliders' of Volume 21 'Elementary Particles' of Landolt-Börnstein - Group I 'Elementary Particles, Nuclei and Atoms'. It contains the Chapter '4 Impedance and Collective Effects' with the content: 4 Impedance and Collective Effects Introduction 4.1 Space Charge 4.2 Wake Fields and Impedances 4.3 Coherent Instabilities 4.4 Landau Damping 4.5 Two-Stream Effects (Electron Cloud and Ions) 4.6 Beam-Beam Effects 4.7 Numerical Modelling

  14. Impedance of goat eye lens at different DC voltages.

    Science.gov (United States)

    Kohli, K S; Rai, D V; Jindal, V K; Goyal, N

    1998-09-01

    A computer assisted AC impedance system is used to measure the DC voltage-current (V-I) characteristics and AC impedance of a goat eye lens using a two-probe Ag-AgCl electrode system. The measurement of the V-I characteristics shows that when a DC voltage from 0 mV to 30 mV is applied, the resultant current decreases from an initial value of 0.58 microA to 0.006 microA. However, when the voltage is increases beyond 30 mV, the current increases and reaches a value of 0.9 microA at 100 mV. The data on the frequency response (0.01-10 Hz) of the impedance of lens tissue show an inverse relationship with frequency. The effect of various DC voltages, namely 0, 30, 50, 100 and 200 mV, on the impedance of the eye lens is also investigated over a frequency range of 0.01-10 Hz. The measurement results for both V-I characteristics and AC impedance further suggest the presence of a 30 mV voltage compartment in the goat eye lens.

  15. Impedance and component heating

    CERN Document Server

    Métral, E; Mounet, N; Pieloni, T; Salvant, B

    2015-01-01

    The impedance is a complex function of frequency, which represents, for the plane under consideration (longitudinal, horizontal or vertical), the force integrated over the length of an element, from a “source” to a “test” wave, normalized by their charges. In general, the impedance in a given plane is a nonlinear function of the test and source transverse coordinates, but it is most of the time sufficient to consider only the first few linear terms. Impedances can influence the motion of trailing particles, in the longitudinal and in one or both transverse directions, leading to energy loss, beam instabilities, or producing undesirable secondary effects such as excessive heating of sensitive components at or near the chamber wall, called beam-induced RF heating. The LHC performance limitations linked to impedances encountered during the 2010-2012 run are reviewed and the currently expected situation during the HL-LHC era is discussed.

  16. The LEP impedance model

    Energy Technology Data Exchange (ETDEWEB)

    Zotter, B. [European Organization for Nuclear Research, Geneva (Switzerland)

    1996-08-01

    This report describes a number of measurements and computations of the impedance of the Large Electron Positron collider LEP at CERN. The work has been performed over several years, together with D. Brandt, K. Cornelis, A. Hofmann, G. Sabbi and many others. The agreement between measurements of single bunch instabilities on the machine and computer simulations is in general excellent and gives confidence in the impedance model used. (author)

  17. Microwave impedance imaging on semiconductor memory devices

    Science.gov (United States)

    Kundhikanjana, Worasom; Lai, Keji; Yang, Yongliang; Kelly, Michael; Shen, Zhi-Xun

    2011-03-01

    Microwave impedance microscopy (MIM) maps out the real and imaginary components of the tip-sample impedance, from which the local conductivity and dielectric constant distribution can be derived. The stray field contribution is minimized in our shielded cantilever design, enabling quantitative analysis of nano-materials and device structures. We demonstrate here that the MIM can spatially resolve the conductivity variation in a dynamic random access memory (DRAM) sample. With DC or low-frequency AC bias applied to the tip, contrast between n-doped and p-doped regions in the dC/dV images is observed, and p-n junctions are highlighted in the dR/dV images. The results can be directly compared with data taken by scanning capacitance microscope (SCM), which uses unshielded cantilevers and resonant electronics, and the MIM reveals more information of the local dopant concentration than SCM.

  18. The electrochemical impedance of metal hydride electrodes

    DEFF Research Database (Denmark)

    Valøen, Lars Ole; Lasia, Andrzej; Jensen, Jens Oluf

    2002-01-01

    The electrochemical impedance responses for different laboratory type metal hydride electrodes were successfully modeled and fitted to experimental data for AB5 type hydrogen storage alloys as well as one MgNi type electrode. The models fitted the experimental data remarkably well. Several AC......, explaining the experimental impedances in a wide frequency range for electrodes of hydride forming materials mixed with copper powder, were obtained. Both charge transfer and spherical diffusion of hydrogen in the particles are important sub processes that govern the total rate of the electrochemical...... hydrogen absorption/desorption reaction. To approximate the experimental data, equations describing the current distribution in porous electrodes were needed. Indications of one or more parallel reduction/oxidation processes competing with the electrochemical hydrogen absorption/desorption reaction were...

  19. Finemet cavity impedance studies

    CERN Document Server

    Persichelli, S; Migliorati, M; Salvant, B

    2013-01-01

    The aim of the study is to evaluate the impedance of the Finemet kicker cavity to be installed in the PS straight section 02 during LS1, under realistic assumptions of bunch length. Time domain simulations with CST Particle Studio have been performed in order to get the impedance of the cavity and make a comparison with the longitudinal impedance measured for a single cell prototype. The study has been performed on simplified 3D geometries imported from a mechanical CATIA drawing, assuming that the simplications have small impact on the nal results. Simulations confirmed that the longitudinal impedance observed with measurements can be excited by bunches circulating in the PS. In the six-cells Finemet cavity, PS bunches circulating in the center can excite a longitudinal impedance, the real part of which has a maximum of 2 kOhm at 4 MHz. This mode does not seem to have any transverse component. All the eigenmodes of the cavity are strongly damped by the Finemet rings: we predict to have no issues regarding tr...

  20. Impact of Exhaled Breath Acetone in the Prognosis of Patients with Heart Failure with Reduced Ejection Fraction (HFrEF). One Year of Clinical Follow-up

    Science.gov (United States)

    Saldiva, Paulo H. N.; Mangini, Sandrigo; Issa, Victor S.; Ayub-Ferreira, Silvia M.; Bocchi, Edimar A.

    2016-01-01

    Background The identification of new biomarkers of heart failure (HF) could help in its treatment. Previously, our group studied 89 patients with HF and showed that exhaled breath acetone (EBA) is a new noninvasive biomarker of HF diagnosis. However, there is no data about the relevance of EBA as a biomarker of prognosis. Objectives To evaluate whether EBA could give prognostic information in patients with heart failure with reduced ejection fraction (HFrEF). Methods After breath collection and analysis by gas chromatography-mass spectrometry and by spectrophotometry, the 89 patients referred before were followed by one year. Study physicians, blind to the results of cardiac biomarker testing, ascertained vital status of each study participant at 12 months. Results The composite endpoint death and heart transplantation (HT) were observed in 35 patients (39.3%): 29 patients (32.6%) died and 6 (6.7%) were submitted to HT within 12 months after study enrollment. High levels of EBA (≥3.7μg/L, 50th percentile) were associated with a progressively worse prognosis in 12-month follow-up (log-rank = 11.06, p = 0.001). Concentrations of EBA above 3.7μg/L increased the risk of death or HT in 3.26 times (HR = 3.26, 95%CI = 1.56–6.80, p = 0.002) within 12 months. In a multivariable cox regression model, the independent predictors of all-cause mortality were systolic blood pressure, respiratory rate and EBA levels. Conclusions High EBA levels could be associated to poor prognosis in HFrEF patients. PMID:28030609

  1. Measurement of Phase Dependent Impedance for 3-phase Diode Rectifier

    DEFF Research Database (Denmark)

    Kwon, Jun Bum; Wang, Xiongfei; Bak, Claus Leth

    2016-01-01

    This paper presents a new method to measure the phase dependent impedance from an experimental set up. Though most of power electronics based system is gradually migrating to IGBT based voltage source converter due to their controllability, the rectifier composed of diode or thyristor components...... are still widely used in AC-DC applications because of their cost effectiveness and reliability. However, these topologies generate harmonic problems in their network due to their switching instant variation caused by the frequency and phase of grid voltage. Hence, a lot of solutions have been proposed...... application. It is found that the phase dependent impedance shows different properties with the impedance profiles, which have been proposed in the research. This paper explains a method to measure the phase dependent impedance profile from an experimental set up. Furthermore, the results are compared...

  2. Impedance modelling of pipes

    Science.gov (United States)

    Creasy, M. Austin

    2016-03-01

    Impedance models of pipes can be used to estimate resonant frequencies of standing waves and model acoustic pressure of closed and open ended pipes. Modelling a pipe with impedance methods allows additional variations to the pipe to be included in the overall model as a system. Therefore an actuator can be attached and used to drive the system and the impedance model is able to include the dynamics of the actuator. Exciting the pipe system with a chirp signal allows resonant frequencies to be measured in both the time and frequency domain. The measurements in the time domain are beneficial for introducing undergraduates to resonances without needing an understanding of fast Fourier transforms. This paper also discusses resonant frequencies in open ended pipes and how numerous texts incorrectly approximate the resonant frequencies for this specific pipe system.

  3. Impeded Dark Matter

    CERN Document Server

    Kopp, Joachim; Slatyer, Tracy R; Wang, Xiao-Ping; Xue, Wei

    2016-01-01

    We consider a new class of thermal dark matter models, dubbed "Impeded Dark Matter", in which the mass splitting between the dark matter particles and their annihilation products is tiny. Compared to the previously proposed Forbidden Dark Matter scenario, the mass splittings we consider are much smaller, and are allowed to be either positive or negative. We demonstrate that either case can be easily realized without requiring tuning of model parameters. For negative mass splitting, we demonstrate that the annihilation cross-section for Impeded Dark Matter depends linearly on the dark matter velocity or may even be kinematically forbidden, making this scenario almost insensitive to constraints from the cosmic microwave background and from observations of dwarf galaxies. Accordingly, it may be possible for Impeded Dark Matter to yield observable signals in clusters or the Galactic center, with no corresponding signal in dwarfs. For positive mass splitting, we show that the annihilation cross-section is suppress...

  4. Negative transverse impedance

    Energy Technology Data Exchange (ETDEWEB)

    Chou, W.

    1989-06-12

    Recently, measurements in the SPS show that the coherent tune shift in the horizontal direction has positive values whereas that in the vertical direction has negative ones. Thus the existence of negative transverse impedance gets confirmed in a real machine. This stimulates us to start a new round of systematic studies on this interesting phenomenon. The results obtained from our computer simulations are presented in this note. Our simulations demonstrate that the negative transverse impedance may appear when the rotational symmetry embedded in a discontinuity is broken, and that the geometries that we have studies may be the source of the positive horizontal tune shift measured in the SPS.

  5. Impedance of accelerator components

    Energy Technology Data Exchange (ETDEWEB)

    Corlett, J.N. [Center for Beam Physics, Lawrence Berkeley National Laboratory, I Cyclotron Road, Berkeley, California 94720 (United States)

    1997-01-01

    As demands for high luminosity and low emittance particle beams increase, an understanding of the electromagnetic interaction of these beams with their vacuum chamber environment becomes more important in order to maintain the quality of the beam. This interaction is described in terms of the wake field in time domain, and the beam impedance in frequency domain. These concepts are introduced, and related quantities such as the loss factor are presented. The broadband Q=1 resonator impedance model is discussed. Perturbation and coaxial wire methods of measurement of real components are reviewed. {copyright} {ital 1997 American Institute of Physics.}

  6. Impedance spectroscopy for the detection and identification of unknown toxins

    Science.gov (United States)

    Riggs, B. C.; Plopper, G. E.; Paluh, J. L.; Phamduy, T. B.; Corr, D. T.; Chrisey, D. B.

    2012-06-01

    Advancements in biological and chemical warfare has allowed for the creation of novel toxins necessitating a universal, real-time sensor. We have used a function-based biosensor employing impedance spectroscopy using a low current density AC signal over a range of frequencies (62.5 Hz-64 kHz) to measure the electrical impedance of a confluent epithelial cell monolayer at 120 sec intervals. Madin Darby canine kidney (MDCK) epithelial cells were grown to confluence on thin film interdigitated gold electrodes. A stable impedance measurement of 2200 Ω was found after 24 hrs of growth. After exposure to cytotoxins anthrax lethal toxin and etoposide, the impedance decreased in a linear fashion resulting in a 50% drop in impedance over 50hrs showing significant difference from the control sample (~20% decrease). Immunofluorescent imaging showed that apoptosis was induced through the addition of toxins. Similarities of the impedance signal shows that the mechanism of cellular death was the same between ALT and etoposide. A revised equivalent circuit model was employed in order to quantify morphological changes in the cell monolayer such as tight junction integrity and cell surface area coverage. This model showed a faster response to cytotoxin (2 hrs) compared to raw measurements (20 hrs). We demonstrate that herein that impedance spectroscopy of epithelial monolayers serves as a real-time non-destructive sensor for unknown pathogens.

  7. Longitudinal impedance of RHIC

    Energy Technology Data Exchange (ETDEWEB)

    Blaskiewicz, M. [Brookhaven National Lab. (BNL), Upton, NY (United States); Brennan, J. M. [Brookhaven National Lab. (BNL), Upton, NY (United States); Mernick, K. [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2015-05-03

    The longitudinal impedance of the two RHIC rings has been measured using the effect of potential well distortion on longitudinal Schottky measurements. For the blue RHIC ring Im(Z/n) = 1.5±0.2Ω. For the yellow ring Im(Z/n) = 5.4±1Ω.

  8. Impedance plethysmography: basic principles.

    Directory of Open Access Journals (Sweden)

    Babu J

    1990-04-01

    Full Text Available Impedance Plethysmography technique has been discussed with explanation of two compartment model and parallel conductor theory for the estimation of peripheral blood flow and stroke volume. Various methods for signal enhancement to facilitate computation of blood flow are briefly described. Source of error in the estimation of peripheral blood flow is identified and the correction has been suggested.

  9. Implantable Impedance Plethysmography

    OpenAIRE

    2014-01-01

    We demonstrate by theory, as well as by ex vivo and in vivo measurements that impedance plethysmography, applied extravascularly directly on large arteries, is a viable method for monitoring various cardiovascular parameters, such as blood pressure, with high accuracy. The sensor is designed as an implant to monitor cardiac events and arteriosclerotic progression over the long term.

  10. Implantable Impedance Plethysmography

    Directory of Open Access Journals (Sweden)

    Michael Theodor

    2014-08-01

    Full Text Available We demonstrate by theory, as well as by ex vivo and in vivo measurements that impedance plethysmography, applied extravascularly directly on large arteries, is a viable method for monitoring various cardiovascular parameters, such as blood pressure, with high accuracy. The sensor is designed as an implant to monitor cardiac events and arteriosclerotic progression over the long term.

  11. AC 410 AC410 AC410 Unit 7 Homework Assignment

    OpenAIRE

    Laynebaril1

    2017-01-01

    AC 410 AC410 AC410 Unit 7 Homework Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-7-homework-assignment/    Questions Requiring Analysis 14-30   Early in your first audit of Star Corporation, you notice that sales and year-end inventory are almost unchanged from the prior year. However, cost of goods sold is less than in the preceding year, and accounts payable also are down substantially. Gross profit has increased, but this increase has not c...

  12. A new monitoring method for electrochemical aggregates by impedance spectroscopy

    Science.gov (United States)

    Kurzweil, P.; Fischle, H.-J.

    A variant of ac impedance spectroscopy is applied to monitor and control electrochemical cells and appliances without need for reference values and knowledge of control points in advance. Electrolyzers, fuels cells, energy stores, sensors and electrochemical reactors are steered to an optimum operating state by continuous evaluation of capacitance and the derivatives thereof. Dry and humid electrode-electrolyte interfaces are distinguished with the aid of the low-frequency impedance. The problem is solved in order to determine electrolyte concentrations unambiguously from electrolyte resistance, although the conductivity of the solution has a maximum and changes nonlinearly with the concentration.

  13. Impedance calculation for ferrite inserts

    Energy Technology Data Exchange (ETDEWEB)

    Breitzmann, S.C.; Lee, S.Y.; /Indiana U.; Ng, K.Y.; /Fermilab

    2005-01-01

    Passive ferrite inserts were used to compensate the space charge impedance in high intensity space charge dominated accelerators. They study the narrowband longitudinal impedance of these ferrite inserts. they find that the shunt impedance and the quality factor for ferrite inserts are inversely proportional to the imaginary part of the permeability of ferrite materials. They also provide a recipe for attaining a truly passive space charge impedance compensation and avoiding narrowband microwave instabilities.

  14. Acoustic ground impedance meter

    Science.gov (United States)

    Zuckerwar, A. J. (Inventor)

    1984-01-01

    A method and apparatus are presented for measuring the acoustic impedance of a surface in which the surface is used to enclose one end of the chamber of a Helmholz resonator. Acoustic waves are generated in the neck of the resonator by a piston driven by a variable speed motor through a cam assembly. The acoustic waves are measured in the chamber and the frequency of the generated acoustic waves is measured by an optical device. These measurements are used to compute the compliance and conductance of the chamber and surface combined. The same procedure is followed with a calibration plate having infinite acoustic impedance enclosing the chamber of the resonator to compute the compliance and conductance of the chamber alone. Then by subtracting, the compliance and conductance for the surface is obtained.

  15. Tensor Impedance Surfaces

    Science.gov (United States)

    2010-11-30

    ELECTROMAGNEETIC SURFACE IMPEDANCE PROPERTIES FA9550-09-C-0198 DR. ADOUR KABAKIAN HUGHES RESEARCH LABS AFOSR / RSE 875 North Randolph Street, Suit...325 Room 3112 Arlington, Virginia 22203-1768 AFOSR / RSE AFRL-OSR-VA-TR-2012-0770 Distribution A We have investigated and determined how the tensor...the case of a TM wave, which favors propagation along the shorter principal axis. Standard terms apply U U U UU Arje Nachman RSE (Program Manager

  16. Impeded Dark Matter

    OpenAIRE

    Kopp, Joachim; Liu, Jia; Slatyer, Tracy R.; Wang, Xiao-Ping; Xue, Wei

    2016-01-01

    We consider a new class of thermal dark matter models, dubbed "Impeded Dark Matter", in which the mass splitting between the dark matter particles and their annihilation products is tiny. Compared to the previously proposed Forbidden Dark Matter scenario, the mass splittings we consider are much smaller, and are allowed to be either positive or negative. We demonstrate that either case can be easily realized without requiring tuning of model parameters. For negative mass splitting, we demonst...

  17. Acoustic impedances of ear canals measured by impedance tube

    DEFF Research Database (Denmark)

    Ciric, Dejan; Hammershøi, Dorte

    2007-01-01

    During hearing sensitivity tests, the sound field is commonly generated by an earphone placed on a subject ear. One of the factors that can affect the sound transmission in the ear is the acoustic impedance of the ear canal. Its importance is related to the contribution of other elements involved...... in the transmission such as the earphone impedance. In order to determine the acoustic impedances of human ear canals, the standardized method for measurement of complex impedances used for the measurement of the audiometric earphone impedances is applied. It is based on the transfer function between two microphone...... locations in an impedance tube. The end of the tube representing the measurement plane is placed at the ear canal entrance. Thus, the impedance seen from the entrance inward is measured on 25 subjects. Most subjects participated in the previous measurement of the ratio between the pressures at the open...

  18. IMPEDANCE SPECTROSCOPY OF POLYCRYSTALLINE TIN DIOXIDE FILMS

    Directory of Open Access Journals (Sweden)

    D. V. Adamchuck

    2016-01-01

    Full Text Available The aim of this work is the analysis of the influence of annealing in an inert atmosphere on the electrical properties and structure of non-stoichiometric tin dioxide films by means of impedance spectroscopy method. Non-stoichiometric tin dioxide films were fabricated by two-step oxidation of metallic tin deposited on the polycrystalline Al2O3 substrates by DC magnetron sputtering. In order to modify the structure and stoichiometric composition, the films were subjected to the high temperature annealing in argon atmosphere in temperature range 300–800 °С. AC-conductivity measurements of the films in the frequency range 20 Hz – 2 MHz were carried out. Variation in the frequency dependencies of the real and imaginary parts of the impedance of tin dioxide films was found to occur as a result of high-temperature annealing. Equivalent circuits for describing the properties of films with various structure and stoichiometric composition were proposed. Possibility of conductivity variation of the polycrystalline tin dioxide films as a result of аnnealing in an inert atmosphere was demonstrated by utilizing impedance spectroscopy. Annealing induces the recrystallization of the films, changing in their stoichiometry as well as increase of the sizes of SnO2 crystallites. Variation of electrical conductivity and structure of tin dioxide films as a result of annealing in inert atmosphere was confirmed by X-ray diffraction analysis. Analysis of the impedance diagrams of tin dioxide films was found to be a powerful tool to study their electrical properties. 

  19. Observations involving broadband impedance modelling

    Energy Technology Data Exchange (ETDEWEB)

    Berg, J.S. [Stanford Linear Accelerator Center, Menlo Park, CA (United States)

    1996-08-01

    Results for single- and multi-bunch instabilities can be significantly affected by the precise model that is used for the broadband impedance. This paper discusses three aspects of broadband impedance modelling. The first is an observation of the effect that a seemingly minor change in an impedance model has on the single-bunch mode coupling threshold. The second is a successful attempt to construct a model for the high-frequency tails of an r.f. cavity. The last is a discussion of requirements for the mathematical form of an impedance which follow from the general properties of impedances. (author)

  20. Characterization of electro-acoustics impedance and its application to active noise control

    Institute of Scientific and Technical Information of China (English)

    HOU Hong; YANG Jianhua

    2004-01-01

    Characteristics of radiation impedance and its inducing variation of electrical impedance for a controllable source have been investigated. An impedance-based error criterion has been proposed and its application to Active Noise Control is demonstrated through a coil driven loudspeaker. A general formula of radiation impedance is derived for two control strategies, according to the criterion of total acoustic power output. The radiation impedances of some commonly used sound sources are calculated. We discuss in detail the relation between variation of the input electrical impedance and radiation impedance for the two control strategies. The measured data of the input electrical impedance from a loudspeaker agree fairly well with theoretical analysis. An AC- bridge circuit is designed in order to measure the weak variation of electrical impedance resulted from radiation impedance. The bridge relative output is unique for a certain control strategy, from which an impedance-based error criterion is then proposed and the implementation of its application to an active control system is analyzed.Numerical results of such criterion are presented. An analogue control system is set up and experiments are carried out in a semi-anechoic chamber to verify the new control approach.

  1. An Impedance-Based Stability Analysis Method for Paralleled Voltage Source Converters

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Blaabjerg, Frede; Loh, Poh Chiang

    2014-01-01

    This paper analyses the stability of paralleled voltage source converters in AC distributed power systems. An impedance-based stability analysis method is presented based on the Nyquist criterion for multiloop system. Instead of deriving the impedance ratio as usual, the system stability...... is assessed based on a series of Nyquist diagrams drawn for the terminal impedance of each converter. Thus, the effect of the right half-plane zeros of terminal impedances in the derivation of impedance ratio for paralleled source-source converters is avoided. The interaction between the terminal impedance...... of converter and the passive network can also be predicted by the Nyquist diagrams. This method is applied to evaluate the current and voltage controller interactions of converters in both grid-connected and islanded operations. Simulations and experimental results verify the effectiveness of theoretical...

  2. A MoS2-based AC impedance aptasensor for adenosine triphosphate determination%基于二硫化钼交流阻抗适体传感器对三磷酸腺苷的无标记检测

    Institute of Scientific and Technical Information of China (English)

    曹文芳; 孙浩帆; 苏邵

    2015-01-01

    An AC impedance aptasensor has been developed for label-free adenosine triphosphate (ATP) determination based on gold nanoparticles-decorated MoS2 (AuNPs@ MoS2 ) nanocomposite .AuNPs@ MoS2 nanocomposite has been synthesized by using MoS2 self-reduction ability .The ATP aptamer (ATPA) was immobilized on the surface of AuNPs@ MoS2 modified electrode via Au-S ,which can selectively detect ATP by using K3 Fe(CN)6 and K4 Fe(CN)6 as the electrochemical indicator .The structure of ATPA is switched with the ATP addition ,resulting in the electron transfer is blocked and the resistance value increases .The ex-perimental results show that the linear range of the MoS2-based sensor is 10 nmol/L-1 mmol/L with a detection limit of 1 nmol/L .Moreover ,the sensor can efficiently distinguish ATP ,CTP ,GTP and UTP ,suggesting the sensor has high sensitivity and good selectivity .This proposed biosensor can offer a potential application for other biomolecules detection .%为了实现对三磷酸腺苷(ATP)无标记、高灵敏地检测,构建了基于二硫化钼的交流阻抗适体传感器。利用二硫化钼自身的还原性成功合成了金纳米颗粒功能化二硫化钼(AuNPs@ MoS2)纳米复合材料,并通过Au-S键将ATP核酸适体组装到AuNPs@ MoS2修饰电极表面。当核酸适体与ATP结合后,其构型发生变化,将会阻碍电化学信号分子K3Fe(CN)6和K4Fe (CN)6与修饰电极间的电子传递,使该适体传感器的电阻变大。在最优条件下,该传感器检测ATP的线性范围为10 nmol/L~1 mmol/L ,检出限为1 nmol/L ,并能很好地区分ATP与CTP、GTP和UTP ,表明该传感器具有较高的检测灵敏度和良好的特异性。该传感器的成功构建,为其他生物分子的检测提供了新的思路。

  3. Impedance group summary

    Science.gov (United States)

    Blaskiewicz, M.; Dooling, J.; Dyachkov, M.; Fedotov, A.; Gluckstern, R.; Hahn, H.; Huang, H.; Kurennoy, S.; Linnecar, T.; Shaposhnikova, E.; Stupakov, G.; Toyama, T.; Wang, J. G.; Weng, W. T.; Zhang, S. Y.; Zotter, B.

    1999-12-01

    The impedance working group was charged to reply to the following 8 questions relevant to the design of high-intensity proton machines such as the SNS or the FNAL driver. These questions were first discussed one by one in the whole group, then each ne of them assigned to one member to summarize. On the lst morning these contributions were publicly read, re-discussed and re-written where required—hence they are not the opinion of a particular person, but rather the averaged opinion of all members of the working group. (AIP)

  4. Tailoring Giant Magneto-impedance Effect in Ultrasoft Ferromagnetic Microwires

    Science.gov (United States)

    Chaturvedi, A.; Ruiz, A.; Mukherjee, P.; Srikanth, H.; Phan, M. H.; Larin, V. S.

    2012-02-01

    Research on soft ferromagnetic microwires exhibiting giant magneto-impedance (GMI) effect, which is a large change of the ac impedance of a ferromagnetic conductor in a static magnetic field, for advanced magnetic sensor applications is an area of topical interest. In this study we show how the GMI effect and its field sensitivity are optimized in Co-B-Si-Mn microwires by varying the magnetic core to glass shell diameter ratio (d). The microwires have been fabricated by the glass-coated melt spinning method. The largest values of GMI (245%) and its field sensitivity 25%/Oe are achieved at f = 13MHz for the microwires with d = 0.86. The d dependence of the magneto-impedance has been analyzed based on those of the magneto-resistance and magneto-reactance. Our studies indicate that the microwires with optimized GMI response are attractive candidate materials for structural health self-monitoring and magnetic biosensing applications.

  5. Impedance spectroscopy study of polycrystalline Bi6Fe2Ti3O18

    Indian Academy of Sciences (India)

    K Srinivas; P Sarah; S V Suryanarayana

    2003-02-01

    The electrical properties of polycrystalline Bi6Fe2Ti3O18 are investigated by impedance spectroscopy in the temperature range 30–550°C. The imaginary part of impedance as a function of frequency shows Debye like relaxation. Impedance data are presented in the Nyquist plot which is used to identify an equivalent circuit and the fundamental circuit parameters are determined at different temperatures. The grain and grain-boundary contributions are estimated. The results of bulk a.c. conductivity as a function of temperature and frequency are presented. The activation energies for the a.c. conductivity are calculated. The polaron hopping frequencies are estimated from the a.c. conductivity data.

  6. Dissection of the Mechanical Impedance Components of the Outer Hair Cell Using a Chloride-Channel Blocker

    Science.gov (United States)

    Harasztosi, Csaba; Gummer, Anthony W.

    2011-11-01

    The voltage-dependent chloride-channel blocker anthracene-9-carboxylic acid (9AC) has been found to reduce the imaginary but not the real part of the mechanical impedance of the organ of Corti, suggesting that the effective stiffness of outer hair cells (OHCs) is reduced by 9AC. To examine whether 9AC interacts directly with the motor protein prestin to reduce the membrane component of the impedance, the patch-clamp technique in whole-cell configuration was used to measure the nonlinear capacitance (NLC) of isolated OHCs and, as control, prestin-transfected human embryonic kidney 293 (HEK293) cells. Extracellular application of 9AC significantly reduced the NLC of both OHCs and HEK293 cells. Intracellular 9AC did not influence the blocking effect of the extracellular applied drug. These results suggest that 9AC interacts directly with prestin, reducing the effective stiffness of the motor, and that the interaction is extracellular.

  7. A simple technique for a.c. conductivity measurements

    Indian Academy of Sciences (India)

    R Padma Suvarna; K Raghavendra Rao; K Subbarangaiah

    2002-12-01

    An inexpensive, indigenous and a simple electronic instrument based on voltage follower, current–to–voltage converter, zero crossing detector and a phase detector has been developed for measurement of a.c. conductivity. Real and imaginary parts of complex impedance are determined for a given sample as a function of frequency and the given sample is represented by a pure electronic model.

  8. Outdoor ground impedance models.

    Science.gov (United States)

    Attenborough, Keith; Bashir, Imran; Taherzadeh, Shahram

    2011-05-01

    Many models for the acoustical properties of rigid-porous media require knowledge of parameter values that are not available for outdoor ground surfaces. The relationship used between tortuosity and porosity for stacked spheres results in five characteristic impedance models that require not more than two adjustable parameters. These models and hard-backed-layer versions are considered further through numerical fitting of 42 short range level difference spectra measured over various ground surfaces. For all but eight sites, slit-pore, phenomenological and variable porosity models yield lower fitting errors than those given by the widely used one-parameter semi-empirical model. Data for 12 of 26 grassland sites and for three beech wood sites are fitted better by hard-backed-layer models. Parameter values obtained by fitting slit-pore and phenomenological models to data for relatively low flow resistivity grounds, such as forest floors, porous asphalt, and gravel, are consistent with values that have been obtained non-acoustically. Three impedance models yield reasonable fits to a narrow band excess attenuation spectrum measured at short range over railway ballast but, if extended reaction is taken into account, the hard-backed-layer version of the slit-pore model gives the most reasonable parameter values.

  9. How the Inductive Voltage Adder (IVA) output impedance affects impedance dynamics of a Self-Magnetic Pinch (SMP) diode

    Science.gov (United States)

    Renk, Timothy; Simpson, Sean; Webb, Timothy; Mazarakis, Michael; Kiefer, Mark

    2016-10-01

    The SMP diode, fielded on the RITS-6 (3.5-8.5 MV) IVA accelerator at Sandia National Laboratories, produces a focused electron beam (IVA flow impedance has on ZDIODE. A preliminary conclusion is that ZDIODE should be at least 1.5 times the flow impedance before ZDIODE is a parameter independent of flow impedance. This has implications for SMP as a load for a IVA, since ZDIODE >100 ohms has not been consistently demonstrated. Data analysis is ongoing, and latest results will be reported. Sandia National Laboratories is a multi-program laboratory managed and operated by Sandia Corporation, a wholly owned subsidiary of Lockheed Martin Corporation, for the U.S. Department of Energy's National Nuclear Security Administration under contract DE-AC04-94AL85000.

  10. Bio-impedance detector for Staphylococcus aureus exposed to magnetic fields

    Science.gov (United States)

    Younis Yacoob Aldosky, Haval; Barwari, Waleed Jameel Omar; Salih Al-mlaly, Janan M.

    2012-12-01

    Rapid detection of viability and growth of pathogenic microorganisms is very important in many applications such as food and drug production, health care, and national defense. Measurements on the electrical characteristics of cells have been used successfully in the past to detect many different physiological events. The effect of electromagnetic fields on the growth of bacteria (Staphylococcus aureus) was studied with the bio-impedance technique. The growth situations of bacteria in the absence and presence of different intensities of static and alternative magnetic fields were examined and analyzed. The results show that the impedance of bacteria fell in the presence of DC magnetic fields. In contrast the impedance increased when the bacteria were exposed to AC magnetic fields. Based on these results the bacterial growth indicated by the change in the impedance is inhibited under DC magnetic fields and enhanced under AC fields.

  11. Peltier ac calorimeter

    OpenAIRE

    Jung, D. H.; Moon, I. K.; Jeong, Y. H.

    2001-01-01

    A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

  12. A-Source Impedance Network

    DEFF Research Database (Denmark)

    Siwakoti, Yam Prasad; Blaabjerg, Frede; Galigekere, Veda Prakash;

    2016-01-01

    A novel A-source impedance network is proposed in this letter. The A-source impedance network uses an autotransformer for realizing converters for any application that demand a very high dc voltage gain. The network utilizes a minimal turns ratio compared to other Magnetically Coupled Impedance S...... with an example single-switch 400 W dc-dc converter. For the closed-loop control design and stability assessment, a small signal model and its analysis of the proposed network are also presented in brief.......A novel A-source impedance network is proposed in this letter. The A-source impedance network uses an autotransformer for realizing converters for any application that demand a very high dc voltage gain. The network utilizes a minimal turns ratio compared to other Magnetically Coupled Impedance...

  13. Microwave Impedance Measurement for Nanoelectronics

    Directory of Open Access Journals (Sweden)

    M. Randus

    2011-04-01

    Full Text Available The rapid progress in nanoelectronics showed an urgent need for microwave measurement of impedances extremely different from the 50Ω reference impedance of measurement instruments. In commonly used methods input impedance or admittance of a device under test (DUT is derived from measured value of its reflection coefficient causing serious accuracy problems for very high and very low impedances due to insufficient sensitivity of the reflection coefficient to impedance of the DUT. This paper brings theoretical description and experimental verification of a method developed especially for measurement of extreme impedances. The method can significantly improve measurement sensitivity and reduce errors caused by the VNA. It is based on subtraction (or addition of a reference reflection coefficient and the reflection coefficient of the DUT by a passive network, amplifying the resulting signal by an amplifier and measuring the amplified signal as a transmission coefficient by a common vector network analyzer (VNA. A suitable calibration technique is also presented.

  14. Optically stimulated differential impedance spectroscopy

    Science.gov (United States)

    Maxey, Lonnie C; Parks, II, James E; Lewis, Sr., Samuel A; Partridge, Jr., William P

    2014-02-18

    Methods and apparatuses for evaluating a material are described. Embodiments typically involve use of an impedance measurement sensor to measure the impedance of a sample of the material under at least two different states of illumination. The states of illumination may include (a) substantially no optical stimulation, (b) substantial optical stimulation, (c) optical stimulation at a first wavelength of light, (d) optical stimulation at a second wavelength of light, (e) a first level of light intensity, and (f) a second level of light intensity. Typically a difference in impedance between the impedance of the sample at the two states of illumination is measured to determine a characteristic of the material.

  15. IMPEDANCE OF FINITE LENGTH RESISTOR

    Energy Technology Data Exchange (ETDEWEB)

    KRINSKY, S.; PODOBEDOV, B.; GLUCKSTERN, R.L.

    2005-05-15

    We determine the impedance of a cylindrical metal tube (resistor) of radius a, length g, and conductivity {sigma}, attached at each end to perfect conductors of semi-infinite length. Our main interest is in the asymptotic behavior of the impedance at high frequency, k >> 1/a. In the equilibrium regime, , the impedance per unit length is accurately described by the well-known result for an infinite length tube with conductivity {sigma}. In the transient regime, ka{sup 2} >> g, we derive analytic expressions for the impedance and wakefield.

  16. Analyzing Impedance Spectroscopy Results

    Institute of Scientific and Technical Information of China (English)

    Yoed Tsur; Sioma Baltianski

    2006-01-01

    In this contribution we briefly discuss several analysis techniques for impedance spectroscopy experiments. A number of different approaches, which differ even by the definition of the problem, are used in the literature. Some aimed towards finding an equivalent circuit. Others aimed towards finding directly dielectric properties of the material under an assumed model. Others towards finding distribution of relaxation times, either parametric or point-by point. No matter what the approach is, this will always be an ill-posed problem in the sense that there exist a large number of possible solutions that solve the problem (mathematically) equally well. Therefore some a-priori knowledge about the system must be used. In addition, we should remember that the ultimate goal is to get physical insight about the system.

  17. Fission-product behaviour in irradiated TRISO-coated particles: Results of the HFR-EU1bis experiment and their interpretation

    Energy Technology Data Exchange (ETDEWEB)

    Barrachin, M., E-mail: marc.barrachin@irsn.fr [Institut de Radioprotection et de Surete Nucleaire (IRSN), BP3, 13115 Saint Paul Lez Durance (France); Dubourg, R. [Institut de Radioprotection et de Surete Nucleaire (IRSN), BP3, 13115 Saint Paul Lez Durance (France); Groot, S. de [Nuclear Research and Consultancy Group (NRG), P.O. Box 25, 1755 ZG Petten (Netherlands); Kissane, M.P. [Institut de Radioprotection et de Surete Nucleaire (IRSN), BP3, 13115 Saint Paul Lez Durance (France); Bakker, K. [Nuclear Research and Consultancy Group (NRG), P.O. Box 25, 1755 ZG Petten (Netherlands)

    2011-08-01

    Highlights: > The microstructure and FPs in UO{sub 2} TRISO particles (10% FIMA, 1573 K) were studied. > Very large porosities (>10 {mu}m) were observed in the high temperature particles. > Significant Xe and Cs releases from the kernel were observed. > Mo and Ru are mainly present in the metallic precipitates in the kernel. - Abstract: It is important to understand fission-product (FP) and kernel micro-structure evolution in TRISO-coated fuel particles. FP behaviour, while central to severe-accident evaluation, impacts: evolution of the kernel oxygen potential governing in turn carbon oxidation (amoeba effect and pressurization); particle pressurization through fission-gas release from the kernel; and coating mechanical resistance via reaction with some FPs (Pd, Cs, Sr). The HFR-Eu1bis experiment irradiated five HTR fuel pebbles containing TRISO-coated UO{sub 2} particles and went beyond current HTR specifications (e.g., central temperature of 1523 K). This study presents ceramographic and EPMA examinations of irradiated urania kernels and coatings. Significant evolutions of the kernel (grain structure, porosity, metallic-inclusion size, intergranular bubbles) as a function of temperature are shown. Results concerning FP migration are presented, e.g., significant xenon, caesium and palladium release from the kernel, molybdenum and ruthenium mainly present in metallic precipitates. The observed FP and micro-structural evolutions are interpreted and explanations proposed. The effect of high flux rate and high temperature on fission-gas behaviour, grain-size evolution and kernel swelling is discussed. Furthermore, Cs, Mo and Zr behaviour is interpreted in connection with oxygen-potential. This paper shows that combining state-of-the-art post-irradiation examination and state-of-the-art modelling fundamentally improves understanding of HTR fuel behaviour.

  18. ACAC Converters for UPS

    Directory of Open Access Journals (Sweden)

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  19. Short-circuit impedance measurement

    DEFF Research Database (Denmark)

    Pedersen, Knud Ole Helgesen; Nielsen, Arne Hejde; Poulsen, Niels Kjølstad

    2003-01-01

    Methods for estimating the short-circuit impedance in the power grid are investigated for various voltage levels and situations. The short-circuit impedance is measured, preferably from naturally occurring load changes in the grid, and it is shown that such a measurement system faces different...

  20. Impedance of Finite Length Resistor

    CERN Document Server

    Krinsky, Samuel; Podobedov, Boris

    2005-01-01

    We determine the impedance of a cylindrical metal tube (resistor) of radius a and length g, attached at each end to perfect conductors of semi-infinite length. Our main interest is in the behavior of the impedance at high frequency (k>>1/a). In the equilibrium regime, ka2

  1. Impedance source power electronic converters

    CERN Document Server

    Liu, Yushan; Ge, Baoming; Blaabjerg, Frede; Ellabban, Omar; Loh, Poh Chiang

    2016-01-01

    Impedance Source Power Electronic Converters brings together state of the art knowledge and cutting edge techniques in various stages of research related to the ever more popular impedance source converters/inverters. Significant research efforts are underway to develop commercially viable and technically feasible, efficient and reliable power converters for renewable energy, electric transportation and for various industrial applications. This book provides a detailed understanding of the concepts, designs, controls, and application demonstrations of the impedance source converters/inverters. Key features: Comprehensive analysis of the impedance source converter/inverter topologies, including typical topologies and derived topologies. Fully explains the design and control techniques of impedance source converters/inverters, including hardware design and control parameter design for corresponding control methods. Presents the latest power conversion solutions that aim to advance the role of pow...

  2. Impedance analysis of porous carbon electrodes to predict rate capability of electric double-layer capacitors

    Science.gov (United States)

    Yoo, Hyun Deog; Jang, Jong Hyun; Ryu, Ji Heon; Park, Yuwon; Oh, Seung M.

    2014-12-01

    Electrochemical impedance analysis is performed to predict the rate capability of two commercial activated carbon electrodes (RP20 and MSP20) for electric double-layer capacitor. To this end, ac impedance data are fitted with an equivalent circuit that comprises ohmic resistance and impedance of intra-particle pores. To characterize the latter, ionic accessibility into intra-particle pores is profiled by using the fitted impedance parameters, and the profiles are transformed into utilizable capacitance plots as a function of charge-discharge rate. The rate capability that is predicted from the impedance analysis is well-matched with that observed from a charge-discharge rate test. It is found that rate capability is determined by ionic accessibility as well as ohmic voltage drop. A lower value in ionic accessibility for MSP20 is attributed to smaller pore diameter, longer length, and higher degree of complexity in pore structure.

  3. ACS: ALMA Common Software

    Science.gov (United States)

    Chiozzi, Gianluca; Šekoranja, Matej

    2013-02-01

    ALMA Common Software (ACS) provides a software infrastructure common to all ALMA partners and consists of a documented collection of common patterns and components which implement those patterns. The heart of ACS is based on a distributed Component-Container model, with ACS Components implemented as CORBA objects in any of the supported programming languages. ACS provides common CORBA-based services such as logging, error and alarm management, configuration database and lifecycle management. Although designed for ALMA, ACS can and is being used in other control systems and distributed software projects, since it implements proven design patterns using state of the art, reliable technology. It also allows, through the use of well-known standard constructs and components, that other team members whom are not authors of ACS easily understand the architecture of software modules, making maintenance affordable even on a very large project.

  4. Caracterización acústica de productos reciclados a partir del "FLUFF" procedente del triturado de NFUS

    OpenAIRE

    2009-01-01

    [EN] In this work, we show the obtained results when characterizing tiles for sound insulation, elaborated by means of Fluff obtained from crushed out of life tires. The acoustic study has been carried out by means of an impedance tube where the coefficient of absorption and the acoustic impedance of different samples are obtained. [ES] En este trabajo se muestran los resultados obtenidos al caracterizar acústicamente losetas para aislamiento acústico, elaboradas mediante Fluff proveniente...

  5. Impedance-estimation methods, modeling methods, articles of manufacture, impedance-modeling devices, and estimated-impedance monitoring systems

    Science.gov (United States)

    Richardson, John G.

    2009-11-17

    An impedance estimation method includes measuring three or more impedances of an object having a periphery using three or more probes coupled to the periphery. The three or more impedance measurements are made at a first frequency. Three or more additional impedance measurements of the object are made using the three or more probes. The three or more additional impedance measurements are made at a second frequency different from the first frequency. An impedance of the object at a point within the periphery is estimated based on the impedance measurements and the additional impedance measurements.

  6. Scattering patterns of dihedral corner reflectors with impedance surface impedances

    Science.gov (United States)

    Balanis, Constantine A.; Griesser, Timothy; Liu, Kefeng

    The radar cross section patterns of lossy dihedral corner reflectors are calculated using a uniform geometrical theory of diffraction for impedance surfaces. All terms of up to third order reflections are considered for patterns in the principal plane. The surface waves are included whenever they exist for reactive surface impedances. The dihedral corner reflectors examined have right, obtuse, and acute interior angles, and patterns over the entire 360 deg azimuthal plane are calculated. The surface impedances can be different on the four faces of the dihedral corner reflector; however, the surface impedance must be uniform over each face. Computed cross sections are compared with a moment method technique for a dielectric/ferrite absorber coating on a metallic corner reflector. The analysis of the dihedral corner reflector is important because it demonstrates many of the important scattering contributors of complex targets including both interior and exterior wedge diffraction, half-plane diffraction, and dominant multiple reflections and diffractions.

  7. GB-R impedances: new approach to impedance simulation

    Science.gov (United States)

    Serrano, L.; Carlosena, A.

    1995-04-01

    A new design procedure is presented for obtaining simulated inductors and large capacitors from classical opamp circuits. Such impedances exploit almost all of the available bandwidth of the operational amplifier.

  8. HDR reservoir flow impedance and potentials for impedance reduction

    Energy Technology Data Exchange (ETDEWEB)

    DuTeau, R.; Brown, D.

    1993-06-01

    The data from flow tests which employed two different production zones in a well at Fenton Hill indicates the flow impedance of a wellbore zone damaged by rapid depressurization was altered, possibly by pressure spallation, which appears to have mechanically propped the joint apertures of outlet flow paths intersecting the altered wellbore. The rapid depressurization and subsequent flow test data derived from the damaged well has led to the hypothesis that pressure spallation and the resultant mechanical propping of outlet flow paths reduced the outlet flow impedance of the damaged wellbore. Furthermore, transient pressure data shows the largest pressure drop between the injection and production wellheads occurs near the production wellbore, so lowering the outlet impedance by increasing the apertures of outlet flow paths will have the greatest effect on reducing the overall reservoir impedance. Fenton Hill data also reveals that increasing the overall reservoir pressure dilates the apertures of flow paths, which likewise serves to reduce the reservoir impedance. Data suggests that either pressure dilating the wellbore connected joints with high production wellhead pressure, or mechanically propping open the outlet flow paths will increase the near-wellbore permeability. Finally, a new method for calculating and comparing near-wellbore outlet impedances has been developed. Further modeling, experimentation, and engineered reservoir modifications, such as pressure dilation and mechanical propping, hold considerable potential for significantly improving the productivity of HDR reservoirs.

  9. Validation of a 3D decoupled magnetodynamic – electric model by determining the impedance of microcoils

    OpenAIRE

    Pham Quang, Phuong; Guérin, Christophe; Meunier, Gérard; Lembeye, Yves

    2009-01-01

    International audience; This paper presents a model for calculating a posteriori electric field in non conducting regions in steady state AC magnetic application. The computation method used is the finite elements method in 3 dimensions. The approach is validated by calculating the equivalent impedance of a coil on which the resolution of the full Maxwell's equations can be performed.

  10. Impedance Source Power Electronic Converters

    DEFF Research Database (Denmark)

    Liu, Yushan; Abu-Rub, Haitham; Ge, Baoming

    Impedance Source Power Electronic Converters brings together state of the art knowledge and cutting edge techniques in various stages of research related to the ever more popular impedance source converters/inverters. Significant research efforts are underway to develop commercially viable...... and technically feasible, efficient and reliable power converters for renewable energy, electric transportation and for various industrial applications. This book provides a detailed understanding of the concepts, designs, controls, and application demonstrations of the impedance source converters/inverters. Key...... control methods. Presents the latest power conversion solutions that aim to advance the role of power electronics into industries and sustainable energy conversion systems. Compares impedance source converter/inverter applications in renewable energy power generation and electric vehicles as well...

  11. IMPEDANCE CHARACTERISTICS OF POLYFURAN FILMS

    Institute of Scientific and Technical Information of China (English)

    Liang Li; Xiao-bo Wan; Gi Xue

    2002-01-01

    Electrochemical impedance spectroscopy (EIS) was first used for the characterization of polyfuran (PFu) films that had been formed electrochemically on an Au electrode. The polyfuran was measured in high oxidation state, intermediate oxidation state and reduction state, respectively. As the oxidation level is increased, the ionic conductivity of PFu/BF4-increases. And impedance studies on PFu show that the anion BF4- appears to be mobile with a high diffusion coefficient of approximately 10-8 cm2 @ s-1.

  12. Study of AC/RF properties of SRF ingot niobium

    Energy Technology Data Exchange (ETDEWEB)

    Dhakal, Pashupati; Tsindlekht, Menachem I; Genkin, Valery M; Ciovati, Gianluigi; Myneni, Ganapati Rao

    2013-09-01

    In an attempt to correlate the performance of superconducting radiofrequency cavities made of niobium with the superconducting properties, we present the results of the magnetization and ac susceptibility of the niobium used in the superconducting radiofrequency cavity fabrication. The samples were subjected to buffer chemical polishing (BCP) surface and high temperature heat treatments, typically applied to the cavities fabrications. The analysis of the results show the different surface and bulk ac conductivity for the samples subjected to BCP and heat treatment. Furthermore, the RF surface impedance is measured on the sample using a TE011 microwave cavity for a comparison to the low frequency measurements.

  13. AC and Phase Sensing of Nanowires for Biosensing.

    Science.gov (United States)

    Crescentini, Marco; Rossi, Michele; Ashburn, Peter; Lombardini, Marta; Sangiorgi, Enrico; Morgan, Hywel; Tartagni, Marco

    2016-04-19

    Silicon nanowires are label-free sensors that allow real-time measurements. They are economical and pave the road for point-of-care applications but require complex readout and skilled personnel. We propose a new model and technique for sensing nanowire sensors using alternating currents (AC) to capture both magnitude and phase information from the sensor. This approach combines the advantages of complex impedance spectroscopy with the noise reduction performances of lock-in techniques. Experimental results show how modifications of the sensors with different surface chemistries lead to the same direct-current (DC) response but can be discerned using the AC approach.

  14. Ionic conductivity measurements of zirconia under pressure using impedance spectroscopy

    CERN Document Server

    Takebe, H; Ohtaka, O; Fukui, H; Yoshiasa, A; Yamanaka, T; Ota, K; Kikegawa, T

    2002-01-01

    We have set up an electrical conductivity measurement system under high-pressure and high-temperature conditions with a multi-anvil high-pressure apparatus using an AC complex impedance method. With this system, we have successfully measured the electrical conductivity of stabilized ZrO sub 2 (Y sub 2 O sub 3 -ZrO sub 2 solid solution) under pressures up to 5 GPa in the temperature range from 300 to 1200 K. The electrical conductivities obtained under pressure are compatible with those of previous results measured at ambient pressure.

  15. Report of the SSC impedance workshop

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1985-10-28

    This workshop focused attention on the transverse, single-bunch instability and the detailed analysis of the broadband impedance which would drive it. Issues discussed included: (1) single bunch stability -- impact of impedance frequency shape, coupled-mode vs. fast blowup regimes, possible stopband structure; (2) numerical estimates of transverse impedance of inner bellows and sliding contact shielded bellows; (3) analytic estimates of pickup and kicker impedance contributions; and (4) feasibility studies of wire and beam measurements of component impedance.

  16. Electrical impedance along connective tissue planes associated with acupuncture meridians

    Directory of Open Access Journals (Sweden)

    Hammerschlag Richard

    2005-05-01

    Full Text Available Abstract Background Acupuncture points and meridians are commonly believed to possess unique electrical properties. The experimental support for this claim is limited given the technical and methodological shortcomings of prior studies. Recent studies indicate a correspondence between acupuncture meridians and connective tissue planes. We hypothesized that segments of acupuncture meridians that are associated with loose connective tissue planes (between muscles or between muscle and bone visible by ultrasound have greater electrical conductance (less electrical impedance than non-meridian, parallel control segments. Methods We used a four-electrode method to measure the electrical impedance along segments of the Pericardium and Spleen meridians and corresponding parallel control segments in 23 human subjects. Meridian segments were determined by palpation and proportional measurements. Connective tissue planes underlying those segments were imaged with an ultrasound scanner. Along each meridian segment, four gold-plated needles were inserted along a straight line and used as electrodes. A parallel series of four control needles were placed 0.8 cm medial to the meridian needles. For each set of four needles, a 3.3 kHz alternating (AC constant amplitude current was introduced at three different amplitudes (20, 40, and 80 μAmps to the outer two needles, while the voltage was measured between the inner two needles. Tissue impedance between the two inner needles was calculated based on Ohm's law (ratio of voltage to current intensity. Results At the Pericardium location, mean tissue impedance was significantly lower at meridian segments (70.4 ± 5.7 Ω compared with control segments (75.0 ± 5.9 Ω (p = 0.0003. At the Spleen location, mean impedance for meridian (67.8 ± 6.8 Ω and control segments (68.5 ± 7.5 Ω were not significantly different (p = 0.70. Conclusion Tissue impedance was on average lower along the Pericardium meridian, but not

  17. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    DEFF Research Database (Denmark)

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin;

    2007-01-01

    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can accurately produce...... the correct volt-sec average at its output, while simultaneously achieving inductive voltage boosting. More interestingly, these performance features are achieved with no increase in the number of semiconductor commutations, and hence no increase in switching losses. The proposed converter therefore offers...

  18. AcEST: DK950971 [AcEST

    Lifescience Database Archive (English)

    Full Text Available GN=... 37 0.66 tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis ... 37 0.66 tr|B1ACS3|B1ACS3...todon GN=DM... 37 1.1 tr|B1ACT4|B1ACT4_LISBO DMP1 (Fragment) OS=Lissodelphis borealis ... 37 1.1 tr|B1ACS2|B...SSSEEEIQSKNTEMESRRLTVDAY 160 >tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis GN=DMP1 PE=4 S

  19. Definition of the characteristic impedance

    Institute of Scientific and Technical Information of China (English)

    徐云生; Abbas Sayed OMAR

    1996-01-01

    Currently available definitions of the characteristic impedance are ambiguous andior inaccurate.A general definition,based on the description of discontinuities between adjacent waveguides,is given.This definition is accurate and independent of the structure concerned.So it can be applied to the design of passive components in any type of transmission lines.Using this definition,a given structure can be uniquely characterized,but the absolute value of the characteristic impedance has no sense any more.As an example,the design of a microstrip impedance transformer using this new definition is presented.Numerical results using the mode-matching method prove the accuracy of the theory.

  20. Transverse Impedance of LHC Collimators

    CERN Document Server

    Métral, E; Assmann, Ralph Wolfgang; Boccardi, A; Bracco, C; Bohl, T; Caspers, Friedhelm; Gasior, M; Jones, O R; Kasinski, K; Kroyer, T; Redaelli, S; Robert-Demolaize, R; Roncarolo, F; Rumolo, G; Salvant, B; Steinhagen, R; Weiler, T; Zimmermann, F

    2007-01-01

    The transverse impedance in the LHC is expected to be dominated by the numerous collimators, most of which are made of Fibre-Reinforced-Carbon to withstand the impacts of high intensity proton beams in case of failures, and which will be moved very close to the beam, with full gaps of few millimetres, in order to protect surrounding super-conducting equipments. We present an estimate of the transverse resistive-wall impedance of the LHC collimators, the total impedance in the LHC at injection and top energy, the induced coupled-bunch growth rates and tune shifts, and finally the result of the comparison of the theoretical predictions with measurements performed in 2004 and 2006 on a prototype collimator installed in the SPS.

  1. Impedances of Laminated Vacuum Chambers

    Energy Technology Data Exchange (ETDEWEB)

    Burov, A.; Lebedev, V.; /Fermilab

    2011-06-22

    First publications on impedance of laminated vacuum chambers are related to early 70s: those are of S. C. Snowdon [1] and of A. G. Ruggiero [2]; fifteen years later, a revision paper of R. Gluckstern appeared [3]. All the publications were presented as Fermilab preprints, and there is no surprise in that: the Fermilab Booster has its laminated magnets open to the beam. Being in a reasonable mutual agreement, these publications were all devoted to the longitudinal impedance of round vacuum chambers. The transverse impedance and the flat geometry case were addressed in more recent paper of K. Y. Ng [4]. The latest calculations of A. Macridin et al. [5] revealed some disagreement with Ref. [4]; this fact stimulated us to get our own results on that matter. Longitudinal and transverse impendances are derived for round and flat laminated vacuum chambers. Results of this paper agree with Ref. [5].

  2. Isolation of sequences flanking Ac insertion sites by Ac casting.

    Science.gov (United States)

    Wang, Dafang; Peterson, Thomas

    2013-01-01

    Localizing Ac insertions is a fundamental task in studying Ac-induced mutation and chromosomal rearrangements involving Ac elements. Researchers may sometimes be faced with the situation in which the sequence flanking one side of an Ac/Ds element is known, but the other flank is unknown. Or, a researcher may have a small sequence surrounding the Ac/Ds insertion site and needs to obtain additional flanking genomic sequences. One way to rapidly clone unknown Ac/Ds flanking sequences is via a PCR-based method termed Ac casting. This approach utilizes the somatic transposition activity of Ac during plant development, and provides an efficient means for short-range genome walking. Here we describe the principle of Ac casting, and show how it can be applied to isolate Ac macrotransposon insertion sites.

  3. Effect of HIPing on conductivity and impedance measurements of DyBi5Fe2Ti3O18 ceramics

    Indian Academy of Sciences (India)

    N V Prasad; G Prasad; Mahendra Kumar; S V Suryanarayana; T Bhimasankaram; G S Kumar

    2000-12-01

    X-ray diffraction, a.c. impedance and conductivity (a.c. and d.c.) have been used to characterize DyBi5Fe2Ti3O18. Samples were prepared by solid state double sintering method. A few samples were also subjected to hot isostatic pressing (HIP) at 800°C for 2 h at 100 MPa pressure. The data on XRD, impedance and conductivity of two sets of samples are compared to understand study of effect of HIPing on the properties of DyBi5Fe2Ti3O18.

  4. Hybrid-Source Impedance Networks

    DEFF Research Database (Denmark)

    Li, Ding; Gao, Feng; Loh, Poh Chiang;

    2010-01-01

    the cascaded networks would have a higher output voltage gain and other unique advantages that currently have not been investigated yet. It is anticipated that these advantages would help the formed inverters find applications in photovoltaic and other renewable systems, where a high voltage gain is usually......Hybrid-source impedance networks have attracted attention among researchers because of their flexibility in performing buck-boost energy conversion. To date, three distinct types of impedance networks can be summarized for implementing voltage-type inverters with another three types summarized...

  5. Y-Source Impedance Network

    DEFF Research Database (Denmark)

    Siwakoti, Yam Prasad; Loh, Poh Chiang; Blaabjerg, Frede;

    2014-01-01

    This letter introduces a new versatile Y-shaped impedance network for realizing converters that demand a very high-voltage gain, while using a small duty ratio. To achieve that, the proposed network uses a tightly coupled transformer with three windings, whose obtained gain is presently not matched...... by existing networks operated at the same duty ratio. The proposed impedance network also has more degrees of freedom for varying its gain, and hence, more design freedom for meeting requirements demanded from it. This capability has been demonstrated by mathematical derivation, and proven in experiment...

  6. Input impedance characteristics of microstrip structures

    Directory of Open Access Journals (Sweden)

    A. I. Nazarko

    2015-06-01

    Full Text Available Introduction. Electromagnetic crystals (EC and EC-inhomogeneities are one of the main directions of microstrip devices development. In the article the input impedance characteristics of EC- and traditional microstrip inhomogeneities and filter based on EC-inhomogeneities are investigated. Transmission coefficient characteristics. Transmission coefficient characteristics of low impedance EC- and traditional inhomogeneities are considered. Characteristics are calculated in the software package Microwave Studio. It is shown that the efficiency of EC-inhomogeneity is much higher. Input impedance characteristics of low impedance inhomogeneities. Dependences of input impedance active and reactive parts of EC- and traditional inhomogeneities are given. Dependences of the active part illustrate significant low impedance transformation of nominal impedance. The conditions of impedance matching of structure and input medium are set. Input impedance characteristics of high impedance inhomogeneities. Input impedance characteristics of high impedance EC- and traditional inhomogeneities are considered. It was shown that the band of transformation by high impedance inhomogeneities is much narrower than one by low impedance inhomogeneities. Characteristics of the reflection coefficient of inhomogeneities are presented. Input impedance characteristics of narrowband filter. The structure of narrowband filter based on the scheme of Fabry-Perot resonator is presented. The structure of the filter is fulfilled by high impedance EC-inhomogeneities as a reflectors. Experimental and theoretical amplitude-frequency characteristics of the filter are presented. Input impedance characteristics of the filter are shown. Conclusions. Input impedance characteristics of the structure allow to analyse its wave properties, especially resonant. EC-inhomogeneity compared with traditional microstrip provide substantially more significant transformation of the the input impedance.

  7. Impedance Analysis of Silicon Nanowire Lithium Ion Battery Anodes

    KAUST Repository

    Ruffo, Riccardo

    2009-07-02

    The impedance behavior of silicon nanowire electrodes has been investigated to understand the electrochemical process kinetics that influences the performance when used as a high-capacity anode in a lithium ion battery. The ac response was measured by using impedance spectroscopy in equilibrium conditions at different lithium compositions and during several cycles of charge and discharge in a half cell vs. metallic lithium. The impedance analysis shows the contribution of both surface resistance and solid state diffusion through the bulk of the nanowires. The surface process is dominated by a solid electrolyte layer (SEI) consisting of an inner, inorganic insoluble part and several organic compounds at the outer interface, as seen by XPS analysis. The surface resistivity, which seems to be correlated with the Coulombic efficiency of the electrode, grows at very high lithium contents due to an increase in the inorganic SEI thickness. We estimate the diffusion coefficient of about 2 × 10 -10 cm 2/s for lithium diffusion in silicon. A large increase in the electrode impedance was observed at very low lithium compositions, probably due to a different mechanism for lithium diffusion inside the wires. Restricting the discharge voltage to 0.7 V prevents this large impedance and improves the electrode lifetime. Cells cycled between 0.07 and 0.70 V vs. metallic lithium at a current density of 0.84 A/g (C/5) showed good Coulombic efficiency (about 99%) and maintained a capacity of about 2000 mAh/g after 80 cycles. © 2009 American Chemical Society.

  8. Electrochemical Performance and Stability of the Cathode for Solid Oxide Fuel Cells. I. Cross Validation of Polarization Measurements by Impedance Spectroscopy and Current-Potential Sweep

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Xiao Dong; Pederson, Larry R.; Templeton, Jared W.; Stevenson, Jeffry W.

    2009-12-09

    The aim of this paper is to address three issues in solid oxide fuel cells: (1) cross-validation of the polarization of a single cell measured using both dc and ac approaches, (2) the precise determination of the total areal specific resistance (ASR), and (3) understanding cathode polarization with LSCF cathodes. The ASR of a solid oxide fuel cell is a dynamic property, meaning that it changes with current density. The ASR measured using ac impedance spectroscopy (low frequency interception with real Z´ axis of ac impedance spectrum) matches with that measured from a dc IV sweep (the tangent of dc i-V curve). Due to the dynamic nature of ASR, we found that an ac impedance spectrum measured under open circuit voltage or on a half cell may not represent cathode performance under real operating conditions, particularly at high current density. In this work, the electrode polarization was governed by the cathode activation polarization; the anode contribution was negligible.

  9. Electrochemical impedance studies of methanol oxidation on GC/Ni and GC/NiCu electrode

    Energy Technology Data Exchange (ETDEWEB)

    Danaee, I.; Jafarian, M.; Forouzandeh, F.; Mahjani, M.G. [Department of Chemistry, K.N. Toosi University of Technology, PO Box 15875-4416, Tehran (Iran); Gobal, F. [Department of Chemistry, Sharif University of Technology, PO Box 11365-9516, Tehran (Iran)

    2009-01-15

    The electro-oxidation of methanol on nickel and nickel-copper alloy modified glassy carbon electrodes (GC/Ni and GC/NiCu) in a 1 M NaOH solution at different concentrations of methanol was studied by the method of ac-impedance spectroscopy. Two semicircles in the first quadrant of a Nyquist diagram were observed for electro-oxidation of methanol on GC/Ni corresponding to charge transfer resistance and adsorption of intermediates. Electro-oxidation of methanol on GC/NiCu shows negative resistance in impedance plots as signified by semi-circles terminating in the second quadrant. The impedance behavior shows different patterns at different applied anodic potential. The influence of the electrode potential on impedance pattern is studied and a mathematical model was put forward to quantitatively account for the impedance behavior of methanol oxidation. At potentials higher than 0.49 V vs. Ag/AgCl, a pseudoinductive behavior is observed but at higher than 0.58 V, impedance patterns terminate in the second quadrant. The conditions required for this behavior are delineated with the use of the impedance model. (author)

  10. Acoustic Ground-Impedance Meter

    Science.gov (United States)

    Zuckerwar, A. J.

    1983-01-01

    Helmoltz resonator used in compact, portable meter measures acoustic impedance of ground or other surfaces. Earth's surface is subject of increasing acoustical investigations because of its importance in aircraft noise prediction and measurment. Meter offers several advantages. Is compact and portable and set up at any test site, irrespective of landscape features, weather or other environmental condition.

  11. Small Signal Loudspeaker Impedance Emulator

    DEFF Research Database (Denmark)

    Iversen, Niels Elkjær; Knott, Arnold

    2014-01-01

    Specifying the performance of audio amplifiers is typically done by playing sine waves into a pure ohmic load. However real loudspeaker impedances are not purely ohmic but characterized by the mechanical resonance between the mass of the diaphragm and the compliance of its suspension which vary...

  12. Superconducting shielded core reactor with reduced AC losses

    Energy Technology Data Exchange (ETDEWEB)

    Cha, Yung S.; Hull, John R.

    2006-04-04

    A superconducting shielded core reactor (SSCR) operates as a passive device for limiting excessive AC current in a circuit operating at a high power level under a fault condition such as shorting. The SSCR includes a ferromagnetic core which may be either closed or open (with an air gap) and extends into and through a superconducting tube or superconducting rings arranged in a stacked array. First and second series connected copper coils each disposed about a portion of the iron core are connected to the circuit to be protected and are respectively wound inside and outside of the superconducting tube or rings. A large impedance is inserted into the circuit by the core when the shielding capability of the superconducting arrangement is exceeded by the applied magnetic field generated by the two coils under a fault condition to limit the AC current in the circuit. The proposed SSCR also affords reduced AC loss compared to conventional SSCRs under continuous normal operation.

  13. AC-3 audio coder

    Science.gov (United States)

    Todd, Craig

    1995-12-01

    AC-3 is a system for coding up to 5.1 channels of audio into a low bit-rate data stream. High quality may be obtained with compression ratios approaching 12-1 for multichannel audio programs. The high compression ratio is achieved by methods which do not increase decoder memory, and thus cost. The methods employed include: the transmission of a high frequency resolution spectral envelope; and a novel forward/backward adaptive bit allocation algorithm. In order to satisfy practical requirements of an emissions coder, the AC-3 syntax includes a number of features useful to broadcasters and consumers. These features include: loudness uniformity between programs; dynamic range control; and broadcaster control of downmix coefficients. The AC-3 coder has been formally selected for inclusion of the U.S. HDTV broadcast standard, and has been informally selected for several additional applications.

  14. Tevatron AC dipole system

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, R.; Kopp, S.E.; /Texas U.; Jansson, A.; Syphers, M.J.; /Fermilab

    2007-06-01

    The AC dipole is an oscillating dipole magnet which can induce large amplitude oscillations without the emittance growth and decoherence. These properties make it a good tool to measure optics of a hadron synchrotron. The vertical AC dipole for the Tevatron is powered by an inexpensive high power audio amplifier since its operating frequency is approximately 20 kHz. The magnet is incorporated into a parallel resonant system to maximize the current. The use of a vertical pinger magnet which has been installed in the Tevatron made the cost relatively inexpensive. Recently, the initial system was upgraded with a more powerful amplifier and oscillation amplitudes up to 2-3{sigma} were achieved with the 980 GeV proton beam. This paper discusses details of the Tevatron AC dipole system and also shows its test results.

  15. Dielectric and impedance spectroscopic studies of neodymium gallate

    Energy Technology Data Exchange (ETDEWEB)

    Sakhya, Anup Pradhan, E-mail: npshakya31@gmail.com [Department of Physics, Bose Institute, 93/1 Acharya Prafulla Chandra Road, Kolkata 700009 (India); Dutta, Alo [Department of Condensed Matter Physics and Material Sciences, S. N. Bose National Centre for Basic Sciences, Block-JD, Sector-III, Salt Lake, Kolkata 700098 (India); Sinha, T.P. [Department of Physics, Bose Institute, 93/1 Acharya Prafulla Chandra Road, Kolkata 700009 (India)

    2016-05-01

    The AC electrical properties of a polycrystalline neodymium gallate, NdGaO{sub 3} (NGO), synthesized by the sol–gel method have been investigated by employing impedance spectroscopy in the frequency range from 42 Hz to 5 MHz and in the temperature range from 323 K to 593 K. The X-ray diffraction analysis shows that the compound crystallizes in the orthorhombic phase with Pbnm space group at room temperature. Two relaxation processes with different relaxation times are observed from the impedance as well as modulus spectroscopic measurements, which have been attributed to the grain and the grain boundary effects at different temperatures in NGO. The complex impedance data are analyzed by an electrical equivalent circuit consisting of a resistance and a constant phase element in parallel. It has been observed that the value of the capacitance and the resistance associated with the grain boundary is higher than those associated with the grain. The temperature dependent electrical conductivity shows the negative temperature coefficient of resistance. The frequency dependent conductivity spectra are found to follow the power law.

  16. Dielectric and impedance spectroscopic studies of neodymium gallate

    Science.gov (United States)

    Sakhya, Anup Pradhan; Dutta, Alo; Sinha, T. P.

    2016-05-01

    The AC electrical properties of a polycrystalline neodymium gallate, NdGaO3 (NGO), synthesized by the sol-gel method have been investigated by employing impedance spectroscopy in the frequency range from 42 Hz to 5 MHz and in the temperature range from 323 K to 593 K. The X-ray diffraction analysis shows that the compound crystallizes in the orthorhombic phase with Pbnm space group at room temperature. Two relaxation processes with different relaxation times are observed from the impedance as well as modulus spectroscopic measurements, which have been attributed to the grain and the grain boundary effects at different temperatures in NGO. The complex impedance data are analyzed by an electrical equivalent circuit consisting of a resistance and a constant phase element in parallel. It has been observed that the value of the capacitance and the resistance associated with the grain boundary is higher than those associated with the grain. The temperature dependent electrical conductivity shows the negative temperature coefficient of resistance. The frequency dependent conductivity spectra are found to follow the power law.

  17. Copper Phthalocyanine Thin Film Morphology Impact on Impedance Spectrum

    Science.gov (United States)

    Robinson, Kyle; Gredig, Thomas

    2012-11-01

    Copper phthlacyanine thin films play an important role as the active layer in gas sensors, organic solar cells, and organic field-effect transistors. The surface morphology of such thin films can be controlled via modification of thermal deposition parameters. Thin films were deposited onto platinum interdigitated electrodes for impedance measurements to study the effect of structure on charge transport. The average grain size increases and changes from α- and β-phase for samples deposited in the temperature range of 295-534 K. AC measurements in the temperature range of 295-385 K reveal relaxation peaks in the impedance spectra. From this spectrum, essential properties are retrieved, such as relaxation times and effective capacities, and correlated with the film morphology. Subject to both photo- and 5-day-dark current trials, photodecay rates are extracted via effective impedance circuit analysis using a phenomenological model that includes contributions from the grain boundary and the bulk part of the grain. Results indicate that the resistance contribution of low frequency relaxation peaks decrease while approaching the phase transition temperature, and vice versa for capacitance. We attribute the low-frequency peaks to grain boundaries, which are reduced in high temperature deposited samples. Hyper β-phase deposition temperatures show a sudden rise in resistance and lower capacitance due to increased roughness of samples.

  18. Beam Coupling Impedances of Small Discontinuities

    CERN Document Server

    Kurennoy, S S

    2000-01-01

    A general derivation of the beam coupling impedances produced by small discontinuities on the wall of the vacuum chamber of an accelerator is reviewed. A collection of analytical formulas for the impedances of small obstacles is presented.

  19. Tapping mode microwave impedance microscopy

    KAUST Repository

    Lai, K.

    2009-01-01

    We report tapping mode microwave impedance imaging based on atomic force microscope platforms. The shielded cantilever probe is critical to localize the tip-sample interaction near the tip apex. The modulated tip-sample impedance can be accurately simulated by the finite-element analysis and the result agrees quantitatively to the experimental data on a series of thin-film dielectric samples. The tapping mode microwave imaging is also superior to the contact mode in that the thermal drift in a long time scale is totally eliminated and an absolute measurement on the dielectric properties is possible. We demonstrated tapping images on working nanodevices, and the data are consistent with the transport results. © 2009 American Institute of Physics.

  20. Impedance analysis of acupuncture points and pathways

    Science.gov (United States)

    Teplan, Michal; Kukučka, Marek; Ondrejkovičová, Alena

    2011-12-01

    Investigation of impedance characteristics of acupuncture points from acoustic to radio frequency range is addressed. Discernment and localization of acupuncture points in initial single subject study was unsuccessfully attempted by impedance map technique. Vector impedance analyses determined possible resonant zones in MHz region.

  1. A spatial impedance controller for robotic manipulation

    NARCIS (Netherlands)

    Fasse, Ernest D.; Broenink, Jan F.

    1997-01-01

    Mechanical impedance is the dynamic generalization of stiffness, and determines interactive behavior by definition. Although the argument for explicitly controlling impedance is strong, impedance control has had only a modest impact on robotic manipulator control practice. This is due in part to the

  2. Impedance-matched Marx generators

    Directory of Open Access Journals (Sweden)

    W. A. Stygar

    2017-04-01

    Full Text Available We have conceived a new class of prime-power sources for pulsed-power accelerators: impedance-matched Marx generators (IMGs. The fundamental building block of an IMG is a brick, which consists of two capacitors connected electrically in series with a single switch. An IMG comprises a single stage or several stages distributed axially and connected in series. Each stage is powered by a single brick or several bricks distributed azimuthally within the stage and connected in parallel. The stages of a multistage IMG drive an impedance-matched coaxial transmission line with a conical center conductor. When the stages are triggered sequentially to launch a coherent traveling wave along the coaxial line, the IMG achieves electromagnetic-power amplification by triggered emission of radiation. Hence a multistage IMG is a pulsed-power analogue of a laser. To illustrate the IMG approach to prime power, we have developed conceptual designs of two ten-stage IMGs with LC time constants on the order of 100 ns. One design includes 20 bricks per stage, and delivers a peak electrical power of 1.05 TW to a matched-impedance 1.22-Ω load. The design generates 113 kV per stage and has a maximum energy efficiency of 89%. The other design includes a single brick per stage, delivers 68 GW to a matched-impedance 19-Ω load, generates 113 kV per stage, and has a maximum energy efficiency of 90%. For a given electrical-power-output time history, an IMG is less expensive and slightly more efficient than a linear transformer driver, since an IMG does not use ferromagnetic cores.

  3. Modeling and Analysis of Harmonic Stability in an AC Power-Electronics-Based Power System

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Blaabjerg, Frede; Wu, Weimin

    2014-01-01

    This paper addresses the harmonic stability caused by the interactions among the wideband control of power converters and passive components in an AC power-electronicsbased power system. The impedance-based analytical approach is employed and expanded to a meshed and balanced threephase network...

  4. An improvement to the data processing course of electrochemical impedance technique

    Institute of Scientific and Technical Information of China (English)

    Yinglv Jiang; Yinshun Wu; Hong Chu

    2003-01-01

    For some electrochemical systems the traditional data processing methods can not be met, so it is necessary to develop a new method to deal with these problems. When processing the electrochemical AC impedance data of titanium alloy TA12 in 3% NaC1 solution (at free corrosion potential, room temperature) a new method is developed which can detach the information of the interface resistance demonstrably from the interface capacitance. The results show that the interface resistance and capacitance are all functions of frequency. And the AC impedance of the resistance and capacitance obey the following relations: C(f) = 104.01982 f-0.9292,R(f) =104.80011 (f+0.008)-0.90897, which is completely different from the traditional conception that the interface resistance and capacitance are constants. And this phenomenon is ubiquitous in titanium alloys according to the study. So perhaps it is an innate characteristic of interface.

  5. An integrated microfluidic analysis microsystems with bacterial capture enrichment and in-situ impedance detection

    Science.gov (United States)

    Liu, Hai-Tao; Wen, Zhi-Yu; Xu, Yi; Shang, Zheng-Guo; Peng, Jin-Lan; Tian, Peng

    2017-09-01

    In this paper, an integrated microfluidic analysis microsystems with bacterial capture enrichment and in-situ impedance detection was purposed based on microfluidic chips dielectrophoresis technique and electrochemical impedance detection principle. The microsystems include microfluidic chip, main control module, and drive and control module, and signal detection and processing modulet and result display unit. The main control module produce the work sequence of impedance detection system parts and achieve data communication functions, the drive and control circuit generate AC signal which amplitude and frequency adjustable, and it was applied on the foodborne pathogens impedance analysis microsystems to realize the capture enrichment and impedance detection. The signal detection and processing circuit translate the current signal into impendence of bacteria, and transfer to computer, the last detection result is displayed on the computer. The experiment sample was prepared by adding Escherichia coli standard sample into chicken sample solution, and the samples were tested on the dielectrophoresis chip capture enrichment and in-situ impedance detection microsystems with micro-array electrode microfluidic chips. The experiments show that the Escherichia coli detection limit of microsystems is 5 × 104 CFU/mL and the detection time is within 6 min in the optimization of voltage detection 10 V and detection frequency 500 KHz operating conditions. The integrated microfluidic analysis microsystems laid the solid foundation for rapid real-time in-situ detection of bacteria.

  6. Local impedance imaging of boron-doped polycrystalline diamond thin films

    Energy Technology Data Exchange (ETDEWEB)

    Zieliński, A.; Ryl, J.; Burczyk, L.; Darowicki, K. [Department of Electrochemistry, Corrosion and Material Engineering, Gdansk University of Technology, 11/12 Narutowicza St., 80-233 Gdansk (Poland); Bogdanowicz, R., E-mail: rbogdan@eti.pg.gda.pl [Department of Metrology and Optoelectronics, Faculty of Electronics, Telecommunications and Informatics, Gdansk University of Technology, 11/12 G. Narutowicza St., 80-233 Gdansk (Poland)

    2014-09-29

    Local impedance imaging (LII) was used to visualise surficial deviations of AC impedances in polycrystalline boron-doped diamond (BDD). The BDD thin film electrodes were deposited onto the highly doped silicon substrates via microwave plasma-enhanced CVD. The studied boron dopant concentrations, controlled by the [B]/[C] ratio in plasma, ranged from 1 × 10{sup 16} to 2 × 10{sup 21} atoms cm{sup −3}. The BDD films displayed microcrystalline structure, while the average size of crystallites decreased from 1 to 0.7 μm with increasing [B]/[C] ratios. The application of LII enabled a direct and high-resolution investigation of local distribution of impedance characteristics within the individual grains of BDD. Such an approach resulted in greater understanding of the microstructural control of properties at the grain level. We propose that the obtained surficial variation of impedance is correlated to the areas of high conductance which have been observed at the grain boundaries by using LII. We also postulate that the origin of high conductivity is due to either preferential boron accumulation, the presence of defects, or sp{sup 2} regions in the intragrain regions. The impedance modulus recorded by LII was in full agreement with the bulk impedance measurements. Both variables showed a decreasing trend with increasing [B]/[C] ratios, which is consistent with higher boron incorporation into BDD film.

  7. A compact broadband nonsynchronous noncommensurate impedance transformer

    DEFF Research Database (Denmark)

    Zhurbenko, Vitaliy; Kim, Kseniya; Narenda, Kumar

    2012-01-01

    Nonsynchronous noncommensurate impedance transformers consist of a combination of high‐ and low‐impedance transmission lines. High‐impedance lines have narrow tracks in strip and microstrip technology, which allows for high flexibility and miniaturization of the layout in comparison to the tradit......Nonsynchronous noncommensurate impedance transformers consist of a combination of high‐ and low‐impedance transmission lines. High‐impedance lines have narrow tracks in strip and microstrip technology, which allows for high flexibility and miniaturization of the layout in comparison...... to the traditional tapered line transformers. This flexibility of the broadband nonsynchronous noncommensurate impedance transformers is experimentally demonstrated in this article allowing the length reduction by almost three times. © 2012 Wiley Periodicals, Inc. Microwave Opt Technol Lett 54:1832–1835, 2012; View...

  8. Synthesis, impedance and dielectric properties of LaBi5Fe2Ti3O18

    Indian Academy of Sciences (India)

    N V Prasad; G Prasad; T Bhimasankaram; S V Suryanarayana; G S Kumar

    2001-10-01

    The compound, LaBi5Fe2Ti3O18, is a five-layered material belonging to the family of bismuth layered structure ferroelectromagnetics. D.c. and a.c. conductivity measurements were performed on the samples. Dielectric measurements were also performed on these samples. Combined impedance and modulus plots were used as tools to analyse the sample behaviour as a function of frequency. Cole–Cole plots showed non-Debye relaxation.

  9. Potentiodynamic electrochemical impedance spectroscopy of silver on platinum in underpotential and overpotential deposition

    Science.gov (United States)

    Ragoisha, Genady A.; Bondarenko, Alexander S.

    2004-09-01

    Simultaneous monitoring of ac and dc responses of the electrode-electrolyte interface with potentiodynamic electrochemical impedance spectroscopy (PDEIS) in silver underpotential and overpotential deposition on platinum has confirmed the role of intrinsic Pt surface changes in the irreversibility of Ag underpotential deposition and disclosed exceptionally high stability of Ag monolayer on Pt. PDEIS has been demonstrated to be a convenient means for wet surface chemistry monitoring.

  10. Potentiodynamic Electrochemical Impedance Spectroscopy of Silver on Platinum in Underpotential and Overpotential Deposition

    OpenAIRE

    Ragoisha, Genady; Bondarenko, Alexander

    2003-01-01

    Simultaneous monitoring of ac and dc responses of the electrode-electrolyte interface with potentiodynamic electrochemical impedance spectroscopy (PDEIS) in silver underpotential and overpotential deposition on platinum has confirmed the role of intrinsic Pt surface changes in the irreversibility of Ag underpotential deposition and disclosed exceptionally high stability of Ag monolayer on Pt. PDEIS has been demonstrated to be a convenient means for wet surface chemistry monitoring.

  11. AC Zeeman potentials for atom chip-based ultracold atoms

    Science.gov (United States)

    Fancher, Charles; Pyle, Andrew; Ziltz, Austin; Aubin, Seth

    2015-05-01

    We present experimental and theoretical progress on using the AC Zeeman force produced by microwave magnetic near-fields from an atom chip to manipulate and eventually trap ultracold atoms. These AC Zeeman potentials are inherently spin-dependent and can be used to apply qualitatively different potentials to different spin states simultaneously. Furthermore, AC Zeeman traps are compatible with the large DC magnetic fields necessary for accessing Feshbach resonances. Applications include spin-dependent trapped atom interferometry and experiments in 1D many-body physics. Initial experiments and results are geared towards observing the bipolar detuning-dependent nature of the AC Zeeman force at 6.8 GHz with ultracold 87Rb atoms trapped in the vicinity of an atom chip. Experimental work is also underway towards working with potassium isotopes at frequencies of 1 GHz and below. Theoretical work is focused on atom chip designs for AC Zeeman traps produced by magnetic near-fields, while also incorporating the effect of the related electric near-fields. Electromagnetic simulations of atom chip circuits are used for mapping microwave propagation in on-chip transmission line structures, accounting for the skin effect, and guiding impedance matching.

  12. DIFFERENTIAL SOIL IMPEDANCE OBSTACLE DETECTION

    Energy Technology Data Exchange (ETDEWEB)

    Maximillian J. Kieba; Christopher J. Ziolkowski

    2004-06-30

    This project develops a new and unique obstacle detection sensor for horizontal directional drilling (HDD) equipment. The development of this new technology will greatly improve the reliability and safety of natural gas HDD construction practices. This sensor utilizes a differential soil impedance measurement technique that will be sensitive to the presence of plastic and ceramic, as well as metallic obstacles. The use of HDD equipment has risen significantly in the gas industry because HDD provides a much more cost-effective and less disruptive method for gas pipe installation than older, trenching methods. However, there have been isolated strikes of underground utilities by HDD equipment, which may have been avoided if methods were available to detect other underground obstacles when using HDD systems. GTI advisors from the gas industry have ranked the value of solving the obstacle detection problem as the most important research and development project for GTI to pursue using Federal Energy Regulatory Commission (FERC) funds available through its industry partner, GRI. GTI proposes to develop a prototype down-hole sensor system that is simple and compact. The sensor utilizes an impedance measurement technique that is sensitive to the presence of metallic or nonmetallic objects in the proximity of the HDD head. The system will use a simple sensor incorporated into the drill head. The impedance of the soil will be measured with a low frequency signal injected through the drill head itself. A pair of bridge type impedance sensors, mounted orthogonal to one another, is coupled to the soil. Inclusions in the soil will cause changes to the sensor balance distinguishable from homogeneous soil. The sensor will provide range and direction data for obstacles near the HDD head. The goal is to provide a simple, robust system that provides the information required to avoid obstacles. This must be done within the size and ruggedness constraints of the HDD equipment. Imaging

  13. DIFFERENTIAL SOIL IMPEDANCE OBSTACLE DETECTION

    Energy Technology Data Exchange (ETDEWEB)

    Maximillian J. Kieba

    2003-10-01

    This project develops a new and unique obstacle detection sensor for horizontal directional drilling (HDD) equipment. The development of this new technology will greatly improve the reliability and safety of natural gas HDD construction practices. This sensor utilizes a differential soil impedance measurement technique that will be sensitive to the presence of plastic and ceramic, as well as metallic obstacles. The use of HDD equipment has risen significantly in the gas industry because HDD provides a much more cost-effective and less disruptive method for gas pipe installation than older, trenching methods. However, there have been isolated strikes of underground utilities by HDD equipment, which may have been avoided if methods were available to detect other underground obstacles when using HDD systems. GTI advisors from the gas industry have ranked the value of solving the obstacle detection problem as the most important research and development project for GTI to pursue using Federal Energy Regulatory Commission (FERC) funds available through its industry partner, GRI. GTI proposes to develop a prototype down-hole sensor system that is simple and compact. The sensor utilizes an impedance measurement technique that is sensitive to the presence of metallic or nonmetallic objects in the proximity of the HDD head. The system will use a simple sensor incorporated into the drill head. The impedance of the soil will be measured with a low frequency signal injected through the drill head itself. A pair of bridge type impedance sensors, mounted orthogonal to one another, is coupled to the soil. Inclusions in the soil will cause changes to the sensor balance distinguishable from homogeneous soil. The sensor will provide range and direction data for obstacles near the HDD head. The goal is to provide a simple, robust system that provides the information required to avoid obstacles. This must be done within the size and ruggedness constraints of the HDD equipment. Imaging

  14. DIFFERENTIAL SOIL IMPEDANCE OBSTACLE DETECTION

    Energy Technology Data Exchange (ETDEWEB)

    Maximillian J. Kieba

    2003-04-01

    This project develops a new and unique obstacle detection sensor for horizontal directional drilling (HDD) equipment. The development of this new technology will greatly improve the reliability and safety of natural gas HDD construction practices. This sensor utilizes a differential soil impedance measurement technique that will be sensitive to the presence of plastic and ceramic, as well as metallic obstacles. The use of HDD equipment has risen significantly in the gas industry because HDD provides a much more cost-effective and less disruptive method for gas pipe installation than older, trenching methods. However, there have been isolated strikes of underground utilities by HDD equipment, which may have been avoided if methods were available to detect other underground obstacles when using HDD systems. GTI advisors from the gas industry have ranked the value of solving the obstacle detection problem as the most important research and development project for GTI to pursue using Federal Energy Regulatory Commission (FERC) funds available through its industry partner, GRI. GTI proposes to develop a prototype down-hole sensor system that is simple and compact. The sensor utilizes an impedance measurement technique that is sensitive to the presence of metallic or nonmetallic objects in the proximity of the HDD head. The system will use a thin film sensor conformal with the drill head. The impedance of the soil will be measured with a low frequency signal injected through the drill head itself. A pair of bridge type impedance sensors, mounted orthogonal to one another, is capacitively coupled to the soil. Inclusions in the soil will cause changes to the sensor balance distinguishable from homogeneous soil. The sensor will provide range and direction data for obstacles near the HDD head. The goal is to provide a simple, robust system that provides the information required to avoid obstacles. This must be done within the size and ruggedness constraints of the HDD

  15. DIFFERENTIAL SOIL IMPEDANCE OBSTACLE DETECTION

    Energy Technology Data Exchange (ETDEWEB)

    Maximillian J. Kieba; Christopher J. Ziolkowski

    2005-01-17

    This project aimed at developing a new and unique obstacle detection sensor for horizontal directional drilling (HDD) equipment. The development of this new technology will greatly improve the reliability and safety of natural gas HDD construction practices. This sensor utilizes a differential soil impedance measurement technique that will be sensitive to the presence of plastic and ceramic, as well as metallic obstacles. The use of HDD equipment has risen significantly in the gas industry because HDD provides a much more cost-effective and less disruptive method for gas pipe installation than older, trenching methods. However, there have been isolated strikes of underground utilities by HDD equipment, which may have been avoided if methods were available to detect other underground obstacles when using HDD systems. GTI advisors from the gas industry ranked the value of solving the obstacle detection problem as the most important research and development project for GTI to pursue using Federal Energy Regulatory Commission (FERC) funds available through its industry partner, GTI. GTI proposed to develop a prototype down-hole sensor system that is simple and compact. The sensor utilizes an impedance measurement technique that is sensitive to the presence of metallic or non-metallic objects in the proximity of the HDD head. The system will use a simple sensor incorporated into the drill head. The impedance of the soil will be measured with a low frequency signal injected through the drill head itself. A pair of bridge type impedance sensors, mounted orthogonal to one another, is coupled to the soil. Inclusions in the soil will cause changes to the sensor balance distinguishable from homogeneous soil. The sensor will provide range and direction data for obstacles near the HDD head. The goal is to provide a simple, robust system that provides the information required to avoid obstacles. This must be done within the size and ruggedness constraints of the HDD equipment

  16. DIFFERENTIAL SOIL IMPEDANCE OBSTACLE DETECTION

    Energy Technology Data Exchange (ETDEWEB)

    Maximillian J. Kieba

    2003-01-30

    This project develops a new and unique obstacle detection sensor for horizontal directional drilling (HDD) equipment. The development of this new technology will greatly improve the reliability and safety of natural gas HDD construction practices. This sensor utilizes a differential soil impedance measurement technique that will be sensitive to the presence of plastic and ceramic, as well as metallic obstacles. The use of HDD equipment has risen significantly in the gas industry because HDD provides a much more cost-effective and less disruptive method for gas pipe installation than older, trenching methods. However, there have been isolated strikes of underground utilities by HDD equipment, which may have been avoided if methods were available to detect other underground obstacles when using HDD systems. GTI advisors from the gas industry have ranked the value of solving the obstacle detection problem as the most important research and development project for GTI to pursue using Federal Energy Regulatory Commission (FERC) funds available through its industry partner, GRI. GTI proposes to develop a prototype down-hole sensor system that is simple and compact. The sensor utilizes an impedance measurement technique that is sensitive to the presence of metallic or nonmetallic objects in the proximity of the HDD head. The system will use a thin film sensor conformal with the drill head. The impedance of the soil will be measured with a low frequency signal injected through the drill head itself. A pair of bridge type impedance sensors, mounted orthogonal to one another, is capacitively coupled to the soil. Inclusions in the soil will cause changes to the sensor balance distinguishable from homogeneous soil. The sensor will provide range and direction data for obstacles near the HDD head. The goal is to provide a simple, robust system that provides the information required to avoid obstacles. This must be done within the size and ruggedness constraints of the HDD

  17. DIFFERENTIAL SOIL IMPEDANCE OBSTACLE DETECTION

    Energy Technology Data Exchange (ETDEWEB)

    Maximillian J. Kieba; Christopher J. Ziolkowski

    2004-10-29

    This project develops a new and unique obstacle detection sensor for horizontal directional drilling (HDD) equipment. The development of this new technology will greatly improve the reliability and safety of natural gas HDD construction practices. This sensor utilizes a differential soil impedance measurement technique that will be sensitive to the presence of plastic and ceramic, as well as metallic obstacles. The use of HDD equipment has risen significantly in the gas industry because HDD provides a much more cost-effective and less disruptive method for gas pipe installation than older, trenching methods. However, there have been isolated strikes of underground utilities by HDD equipment, which may have been avoided if methods were available to detect other underground obstacles when using HDD systems. GTI advisors from the gas industry have ranked the value of solving the obstacle detection problem as the most important research and development project for GTI to pursue using Federal Energy Regulatory Commission (FERC) funds available through its industry partner, GRI. GTI proposes to develop a prototype down-hole sensor system that is simple and compact. The sensor utilizes an impedance measurement technique that is sensitive to the presence of metallic or non-metallic objects in the proximity of the HDD head. The system will use a simple sensor incorporated into the drill head. The impedance of the soil will be measured with a low frequency signal injected through the drill head itself. A pair of bridge type impedance sensors, mounted orthogonal to one another, is coupled to the soil. Inclusions in the soil will cause changes to the sensor balance distinguishable from homogeneous soil. The sensor will provide range and direction data for obstacles near the HDD head. The goal is to provide a simple, robust system that provides the information required to avoid obstacles. This must be done within the size and ruggedness constraints of the HDD equipment. Imaging

  18. DIFFERENTIAL SOIL IMPEDANCE OBSTACLE DETECTION

    Energy Technology Data Exchange (ETDEWEB)

    Maximillian J. Kieba

    2002-08-30

    This project develops a new and unique obstacle detection sensor for horizontal directional drilling (HDD) equipment. The development of this new technology will greatly improve the reliability and safety of natural gas HDD construction practices. This sensor utilizes a differential soil impedance measurement technique that will be sensitive to the presence of plastic and ceramic, as well as metallic obstacles. The use of HDD equipment has risen significantly in the gas industry because HDD provides a much more cost-effective and less disruptive method for gas pipe installation than older, trenching methods. However, there have been isolated strikes of underground utilities by HDD equipment, which may have been avoided if methods were available to detect other underground obstacles when using HDD systems. GTI advisors from the gas industry have ranked the value of solving the obstacle detection problem as the most important research and development project for GTI to pursue using Federal Energy Regulatory Commission (FERC) funds available through its industry partner, GRI. GTI proposes to develop a prototype down-hole sensor system that is simple and compact. The sensor utilizes an impedance measurement technique that is sensitive to the presence of metallic or nonmetallic objects in the proximity of the HDD head. The system will use a thin film sensor conformal with the drill head. The impedance of the soil will be measured with a low frequency signal injected through the drill head itself. A pair of bridge type impedance sensors, mounted orthogonal to one another, is capacitively coupled to the soil. Inclusions in the soil will cause changes to the sensor balance distinguishable from homogeneous soil. The sensor will provide range and direction data for obstacles near the HDD head. The goal is to provide a simple, robust system that provides the information required to avoid obstacles. This must be done within the size and ruggedness constraints of the HDD

  19. DIFFERENTIAL SOIL IMPEDANCE OBSTACLE DETECTION

    Energy Technology Data Exchange (ETDEWEB)

    Maximillian J. Kieba

    2004-02-01

    This project develops a new and unique obstacle detection sensor for horizontal directional drilling (HDD) equipment. The development of this new technology will greatly improve the reliability and safety of natural gas HDD construction practices. This sensor utilizes a differential soil impedance measurement technique that will be sensitive to the presence of plastic and ceramic, as well as metallic obstacles. The use of HDD equipment has risen significantly in the gas industry because HDD provides a much more cost-effective and less disruptive method for gas pipe installation than older, trenching methods. However, there have been isolated strikes of underground utilities by HDD equipment, which may have been avoided if methods were available to detect other underground obstacles when using HDD systems. GTI advisors from the gas industry have ranked the value of solving the obstacle detection problem as the most important research and development project for GTI to pursue using Federal Energy Regulatory Commission (FERC) funds available through its industry partner, GRI. GTI proposes to develop a prototype down-hole sensor system that is simple and compact. The sensor utilizes an impedance measurement technique that is sensitive to the presence of metallic or nonmetallic objects in the proximity of the HDD head. The system will use a simple sensor incorporated into the drill head. The impedance of the soil will be measured with a low frequency signal injected through the drill head itself. A pair of bridge type impedance sensors, mounted orthogonal to one another, is coupled to the soil. Inclusions in the soil will cause changes to the sensor balance distinguishable from homogeneous soil. The sensor will provide range and direction data for obstacles near the HDD head. The goal is to provide a simple, robust system that provides the information required to avoid obstacles. This must be done within the size and ruggedness constraints of the HDD equipment. Imaging

  20. DIFFERENTIAL SOIL IMPEDANCE OBSTACLE DETECTION

    Energy Technology Data Exchange (ETDEWEB)

    Maximillian J. Kieba

    2002-11-27

    This project develops a new and unique obstacle detection sensor for horizontal directional drilling (HDD) equipment. The development of this new technology will greatly improve the reliability and safety of natural gas HDD construction practices. This sensor utilizes a differential soil impedance measurement technique that will be sensitive to the presence of plastic and ceramic, as well as metallic obstacles. The use of HDD equipment has risen significantly in the gas industry because HDD provides a much more cost-effective and less disruptive method for gas pipe installation than older, trenching methods. However, there have been isolated strikes of underground utilities by HDD equipment, which may have been avoided if methods were available to detect other underground obstacles when using HDD systems. GTI advisors from the gas industry have ranked the value of solving the obstacle detection problem as the most important research and development project for GTI to pursue using Federal Energy Regulatory Commission (FERC) funds available through its industry partner, GRI. GTI proposes to develop a prototype down-hole sensor system that is simple and compact. The sensor utilizes an impedance measurement technique that is sensitive to the presence of metallic or nonmetallic objects in the proximity of the HDD head. The system will use a thin film sensor conformal with the drill head. The impedance of the soil will be measured with a low frequency signal injected through the drill head itself. A pair of bridge type impedance sensors, mounted orthogonal to one another, is capacitively coupled to the soil. Inclusions in the soil will cause changes to the sensor balance distinguishable from homogeneous soil. The sensor will provide range and direction data for obstacles near the HDD head. The goal is to provide a simple, robust system that provides the information required to avoid obstacles. This must be done within the size and ruggedness constraints of the HDD

  1. DIFFERENTIAL SOIL IMPEDANCE OBSTACLE DETECTION

    Energy Technology Data Exchange (ETDEWEB)

    Maximillian J. Kieba

    2004-05-03

    This project develops a new and unique obstacle detection sensor for horizontal directional drilling (HDD) equipment. The development of this new technology will greatly improve the reliability and safety of natural gas HDD construction practices. This sensor utilizes a differential soil impedance measurement technique that will be sensitive to the presence of plastic and ceramic, as well as metallic obstacles. The use of HDD equipment has risen significantly in the gas industry because HDD provides a much more cost-effective and less disruptive method for gas pipe installation than older, trenching methods. However, there have been isolated strikes of underground utilities by HDD equipment, which may have been avoided if methods were available to detect other underground obstacles when using HDD systems. GTI advisors from the gas industry have ranked the value of solving the obstacle detection problem as the most important research and development project for GTI to pursue using Federal Energy Regulatory Commission (FERC) funds available through its industry partner, GRI. GTI proposes to develop a prototype down-hole sensor system that is simple and compact. The sensor utilizes an impedance measurement technique that is sensitive to the presence of metallic or nonmetallic objects in the proximity of the HDD head. The system will use a simple sensor incorporated into the drill head. The impedance of the soil will be measured with a low frequency signal injected through the drill head itself. A pair of bridge type impedance sensors, mounted orthogonal to one another, is coupled to the soil. Inclusions in the soil will cause changes to the sensor balance distinguishable from homogeneous soil. The sensor will provide range and direction data for obstacles near the HDD head. The goal is to provide a simple, robust system that provides the information required to avoid obstacles. This must be done within the size and ruggedness constraints of the HDD equipment. Imaging

  2. Impedance spectroscopy of food mycotoxins

    Science.gov (United States)

    Bilyy, Oleksandr I.; Yaremyk, Roman Ya.; Kotsyumbas, Ihor Ya.; Kotsyumbas, Halyna I.

    2012-01-01

    A new analytical method of high-selective detection of mycotoxins in food and feed are considered. A method is based on optical registration the changes of conduct of the electric polarized bacterial agents in solution at the action of the external gradient electric fields. Measuring are conducted in integrated electrode-optical cuvette of the special construction, which provides the photometric analysis of forward motion of the objects registration in liquid solution under act of the enclosed electric field and simultaneous registration of kinetics of change of electrical impedance parameters solution and electrode system.

  3. Observations involving broadband impedance modelling

    Energy Technology Data Exchange (ETDEWEB)

    Berg, J.S.

    1995-08-01

    Results for single- and multi-bunch instabilities can be significantly affected by the precise model that is used for the broadband impendance. This paper discusses three aspects of broadband impendance modeling. The first is an observation of the effect that a seemingly minor change in an impedance model has on the single-bunch mode coupling threshold. The second is a successful attempt to construct a model for the high-frequency tails of an r.f cavity. The last is a discussion of requirements for the mathematical form of an impendance which follow from the general properties of impendances.

  4. Impedance Spectroscopic Studies of BiFeO3-Pb(ZrTi)O3 Nanocomposites

    Science.gov (United States)

    Choudhary, R. N. P.; Barik, Subrat K.; Katiyar, R. S.

    BiFeO3-Pb(ZrTi)O3 [i.e., (Bi1-xPbx)(Fe1-xZr0.6xTi0.4x)O3 (x = 0.15, 0.25, 0.40, 0.50)] nanocomposites were synthesized using mechanical activation followed by a solid-state reaction technique. The dielectric parameters (capacitance, dissipation factor D, impedance Z and phase angle Φ) of all the samples were measured in a wide range of frequencies (1 kHz-1 MHz) and temperatures (300-630 K) in air atmosphere using an impedance analyzer with low signal amplitude of 500 mV. Electrical properties of the compounds were studied using a complex impedance spectroscopy (CIS) technique. The frequency dependence of electrical data was analyzed in the framework of conductivity and modulus formalisms. AC conductivity spectrum obeys Jonscher's universal power law.

  5. Electrochemical impedance spectroscopy of metal alloys in the space transportation system launch environment

    Science.gov (United States)

    Calle, Luz

    1990-01-01

    AC impedance measurements were performed to investigate the corrosion resistance of 18 alloys under conditions similar to the Space Transportation System (STS) launch environment. The alloys were: (1) zirconium 702; (2) Hastelloy C-22, C-276, C-4, and B-2; (3) Inconel 600 and 825; (4) Ferralium 255; (5) Inco Alloy G-3; (6) 20Cb-3; (7) SS 904L, 304LN, 316L, 317L, and 304L; (8) ES 2205; and (9) Monel 400. AC impedance data were gathered for each alloy at various immersion times in 3.55 percent NaCl-0.1N HCl. Polarization resistance values were obtained for the Nyguist plots at each immersion time using the EQUIVALENT CIRCUIT software package available with the 388 electrochemical impedance software. Hastelloy C-22 showed the highest overall values for polarization resistance while Monel 400 and Inconel 600 had the lowest overall values. There was good general correlation between the corrosion performance of the alloys at the beach corrosion testing site, and the expected rate of corrosion as predicted based on the polarization resistance values obtained. The data indicate that electrochemical impedance spectroscopy can be used to predict the corrosion performance of metal alloys.

  6. Journal bearing impedance descriptions for rotordynamic applications

    Science.gov (United States)

    Childs, D.; Moes, H.; Van Leeuwen, H.

    1976-01-01

    The paper deals with the development of analytic descriptions for plain circumferentially-symmetric fluid journal bearings, which are suitable for use in rotor dynamic analysis. The bearing impedance vector is introduced, which defines the bearing reaction force components as a function of the bearing motion. Impedances are derived directly for the Ocvirk (short) and Sommerfeld (long) bearings, and the relationships between the impedance vector and the more familiar mobility vector are developed and used to derive analytic impedance for finite-length bearings. The static correctness of the finite-length cavitating impedance is verified. Analytic stiffness and damping coefficient definitions are derived in terms of an impedance vector for small motion around an equilibrium position and demonstrated for the finite-length cavitating impedance. Nonlinear transient rotordynamic simulations are presented for the short pi and 2-pi impedances and the finite-length cavitating impedance. It is shown that finite-length impedance yields more accurate results for substantially less computer time than the short-bearing numerical-pressure-integration approach.

  7. Spheromak Impedance and Current Amplification

    Energy Technology Data Exchange (ETDEWEB)

    Fowler, T K; Hua, D D; Stallard, B W

    2002-01-31

    It is shown that high current amplification can be achieved only by injecting helicity on the timescale for reconnection, {tau}{sub REC}, which determines the effective impedance of the spheromak. An approximate equation for current amplification is: dI{sub TOR}{sup 2}/dt {approx} I{sup 2}/{tau}{sub REC} - I{sub TOR}{sup 2}/{tau}{sub closed} where I is the gun current, I{sub TOR} is the spheromak toroidal current and {tau}{sub CLOSED} is the ohmic decay time of the spheromak. Achieving high current amplification, I{sub TOR} >> I, requires {tau}{sub REC} <<{tau}{sub CLOSED}. For resistive reconnection, this requires reconnection in a cold zone feeding helicity into a hot zone. Here we propose an impedance model based on these ideas in a form that can be implemented in the Corsica-based helicity transport code. The most important feature of the model is the possibility that {tau}{sub REC} actually increases as the spheromak temperature increases, perhaps accounting for the ''voltage sag'' observed in some experiments, and a tendency toward a constant ratio of field to current, B {proportional_to} I, or I{sub TOR} {approx} I. Program implications are discussed.

  8. Torsional impedance effect in Fe-rich amorphous wires

    Energy Technology Data Exchange (ETDEWEB)

    Prida, V.M. E-mail: vmpp@pinon.ccu.uniovi.es; Hernando, B.; Sanchez, M.L.; Li, Y.-F.; Tejedor, M.; Vazquez, M

    2003-03-01

    An amorphous ferromagnetic wire with a highly positive saturation magnetostriction constant, made of Fe{sub 73.5}Si{sub 13.5}B{sub 9}Nb{sub 3}Cu{sub 1}, was simultaneously submitted to both, an AC current flowing through it and a torsional stress, in order to induce a helical magnetic anisotropy that modifies the magnetic domain structure and therefore the magnetic response of the sample. We study the torsion-impedance effect in an Fe-rich amorphous wire when it is submitted to different applied torsional stresses in both senses, up to 0.8{pi} rad/cm, as a function of the drive current frequency, in the range of 10 Hz-2 MHz. The experimental results are explained on the basis of the core-shell magnetic structure model combined with the skin effect.

  9. Amperometric and impedance monitoring systems for biomedical applications

    CERN Document Server

    Punter-Villagrasa, Jaime; del Campo, Francisco J; Miribel, Pere

    2017-01-01

    The book presents the conception and realization of a pervasive electronic architecture for electrochemical applications, focusing on electronic instrumentation design and device development, particularly in electrochemical Point-of-Care and Lab-on-a-Chip devices, covering examples based on amperometric (DC) and impedance detection (AC) techniques. The presented electronics combine tailored front-end instrumentation and back-end data post-processing, enabling applications in different areas, and across a variety of techniques, analytes, transducers and environments. It addresses how the electronics are designed and implemented with special interest in the flow process: starting from electronic circuits and electrochemical biosensor design to a final validation and implementation for specific applications. Similarly, other important aspects are discussed throughout the book, such as electrochemical techniques, different analytes, targets, electronics reliability and robustness. The book also describes the use ...

  10. Pumping slots: impedances and power losses

    Energy Technology Data Exchange (ETDEWEB)

    Kurennoy, S. [Maryland Univ., College Park, MD (United States). Dept. of Physics

    1996-08-01

    Contributions of pumping slots to the beam coupling impedances and power losses in a B-factory ring are considered. While their leading contribution is to the inductive impedance, for high-intensity machines with short bunches like e{sup +}e{sup -} B-factories the real part of the impedance and related loss factors are also important. Using an analytical approach we calculate the coupling impedances and loss factors due to slots in a ring with an arbitrary cross section of the vacuum chamber. Effects of the slot tilt on the beam impedance are also considered, and restrictions on the tilt angle are derived from limitations on the impedance increase. The power leakage through the slots is discussed briefly. The results are applied to the KEK B-factory. (author)

  11. Electrical test methods for on-line fuel cell ohmic resistance measurement

    Science.gov (United States)

    Cooper, K. R.; Smith, M.

    The principles and trade-offs of four electrical test methods suitable for on-line measurement of the ohmic resistance (R Ω) of fuel cells is presented: current interrupt, AC resistance, high frequency resistance (HFR), and electrochemical impedance spectroscopy (EIS). The internal resistance of a proton exchange membrane (PEM) fuel cell determined with the current interrupt, HFR and EIS techniques is compared. The influence of the AC amplitude and frequency of the HFR measurement on the observed ohmic resistance is examined, as is the ohmic resistance extracted from the EIS data by modeling the spectra with a transmission line model for porous electrodes. The ohmic resistance of a H 2/O 2 PEM fuel cell determined via the three methods was within 10-30% of each other. The current interrupt technique consistently produced measured cell resistances that exceeded those of the other two techniques. For the HFR technique, the frequency at which the measurement was conducted influenced the measured resistance (i.e., higher frequency providing smaller R Ω), whereas the AC amplitude did not effect the observed value. The difference in measured ohmic resistance between these techniques exceeds that reasonably accounted for by measurement error. The source of the discrepancy between current interrupt and impedance-based methods is attributed to the difference in the response of a non-uniformly polarized electrode, such as a porous electrode with non-negligible ohmic resistance, to a large perturbation (current interrupt event) as compared to a small perturbation (impedance measurement).

  12. Optimal multisine excitation design for broadband electrical impedance spectroscopy

    Science.gov (United States)

    Sanchez, B.; Vandersteen, G.; Bragos, R.; Schoukens, J.

    2011-11-01

    exciting with the optimal and flat multisine signals and compared to a single frequency ac impedance analyzer when characterizing an RC circuit. In vivo healthy myocardium tissue electrical impedance measurements show that broadband EIS based on multisine excitations enable the characterization of dynamic biological systems.

  13. High performance AC drives

    CERN Document Server

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  14. Cartesian impedance control of dexterous robot hand

    Institute of Scientific and Technical Information of China (English)

    JIANG Li; LIU Hong; CAI He-gao

    2005-01-01

    Presents a novel compliant motion control for a robot hand using the Cartesian impedance approach based on fingertip force measurements. The fingertip can accurately track desired motion in free space and appear as mechanical impedance in constrained space. In the position based impedance control strategy, any switching mode in contact transition phase is not needed. The impedance parameters can be adjusted in a certain range according to various tasks. In this paper, the analysis of the finger's kinematics and dynamics is given. Experimental results have shown the effectiveness of this control strategy.

  15. Impedance Spectroscopy of Human Blood

    Science.gov (United States)

    Mesa, Francisco; Bernal, José J.; Sosa, Modesto A.; Villagómez, Julio C.; Palomares, Pascual

    2004-09-01

    The blood is one of the corporal fluids more used with analytical purposes. When the blood is extracted, immediately it is affected by agents that act on it, producing transformations in its elements. Among the effects of these transformations the hemolysis phenomenon stands out, which consists of the membrane rupture and possible death of the red blood cells. The main purpose of this investigation was the quantification of this phenomenon. A Solartron SI-1260 Impedance Spectrometer was used, which covers a frequency range of work from 1 μHz to 10 MHz, and its accuracy has been tested in the accomplishment of several applications. Measurements were performed on 3 mL human blood samples, from healthy donors. Reactive strips for sugar test of 2 μL, from Bayer, were used as electrodes, which allow gathering a portion of the sample, to be analyzed by the spectrometer. Preliminary results of these measurements are presented.

  16. Lorentz Force Electrical Impedance Tomography

    CERN Document Server

    Grasland-Mongrain, Pol; Chapelon, Jean-Yves; Lafon, Cyril

    2014-01-01

    This article describes a method called Lorentz Force Electrical Impedance Tomography. The electrical conductivity of biological tissues can be measured through their sonication in a magnetic field: the vibration of the tissues inside the field induces an electrical current by Lorentz force. This current, detected by electrodes placed around the sample, is proportional to the ultrasonic pressure, to the strength of the magnetic field and to the electrical conductivity gradient along the acoustic axis. By focusing at different places inside the sample, a map of the electrical conductivity gradient can be established. In this study experiments were conducted on a gelatin phantom and on a beef sample, successively placed in a 300 mT magnetic field and sonicated with an ultrasonic transducer focused at 21 cm emitting 500 kHz bursts. Although all interfaces are not visible, in this exploratory study a good correlation is observed between the electrical conductivity image and the ultrasonic image. This method offers...

  17. Electrical impedance tomography of electrolysis.

    Science.gov (United States)

    Meir, Arie; Rubinsky, Boris

    2015-01-01

    The primary goal of this study is to explore the hypothesis that changes in pH during electrolysis can be detected with Electrical Impedance Tomography (EIT). The study has relevance to real time control of minimally invasive surgery with electrolytic ablation. To investigate the hypothesis, we compare EIT reconstructed images to optical images acquired using pH-sensitive dyes embedded in a physiological saline agar gel phantom treated with electrolysis. We further demonstrate the biological relevance of our work using a bacterial E.Coli model, grown on the phantom. The results demonstrate the ability of EIT to image pH changes in a physiological saline phantom and show that these changes correlate with cell death in the E.coli model. The results are promising, and invite further experimental explorations.

  18. Electrical impedance tomography of electrolysis.

    Directory of Open Access Journals (Sweden)

    Arie Meir

    Full Text Available The primary goal of this study is to explore the hypothesis that changes in pH during electrolysis can be detected with Electrical Impedance Tomography (EIT. The study has relevance to real time control of minimally invasive surgery with electrolytic ablation. To investigate the hypothesis, we compare EIT reconstructed images to optical images acquired using pH-sensitive dyes embedded in a physiological saline agar gel phantom treated with electrolysis. We further demonstrate the biological relevance of our work using a bacterial E.Coli model, grown on the phantom. The results demonstrate the ability of EIT to image pH changes in a physiological saline phantom and show that these changes correlate with cell death in the E.coli model. The results are promising, and invite further experimental explorations.

  19. Dielectric and impedance behavior of neodymium substituted strontium hexaferrite

    Science.gov (United States)

    Bhat, Bilal Hamid; Samad, Rubiya; Want, Basharat

    2016-09-01

    In this study, dielectric behavior and complex impedance of neodymium (Nd) substituted strontium hexaferrite system: Sr1- x Nd x Fe12O19 ( x = 0.0, 0.05, 0.1, 0.15, 0. 20), synthesized by citrate precursor technique, have been evaluated as a function of applied frequency and temperature. Variation of dielectric constant and dielectric loss with frequency shows the identical behavior for all the compositions. The value of dielectric constant increases with Nd doping. Relaxation process is observed in the composition x = 0.20, and the peaks in this composition shift toward the higher-frequency region as the temperature increases. The dielectric constants show temperature-independent behavior at low temperature, whereas at higher temperatures it increases for all the frequencies. The AC conductivity follows Jonscher's power law, showing that conduction mechanism is due to polaron hopping. Complex impedance as a function of composition and temperature is used to examine the role of grain and grain boundary in the prepared material. Cole-cole plot shows only one semicircle up to x = 0.15, while as for x = 0.20 two semicircles are observed. The conduction mechanism is explained on the basis of both grain and grain boundary.

  20. Dielectric and impedance behavior of neodymium substituted strontium hexaferrite

    Energy Technology Data Exchange (ETDEWEB)

    Bhat, Bilal Hamid; Samad, Rubiya; Want, Basharat [University of Kashmir, Solid State Research Lab., Department of Physics, Srinagar (India)

    2016-09-15

    In this study, dielectric behavior and complex impedance of neodymium (Nd) substituted strontium hexaferrite system: Sr{sub 1-x}Nd{sub x}Fe{sub 12}O{sub 19} (x = 0.0, 0.05, 0.1, 0.15, 0.20), synthesized by citrate precursor technique, have been evaluated as a function of applied frequency and temperature. Variation of dielectric constant and dielectric loss with frequency shows the identical behavior for all the compositions. The value of dielectric constant increases with Nd doping. Relaxation process is observed in the composition x = 0.20, and the peaks in this composition shift toward the higher-frequency region as the temperature increases. The dielectric constants show temperature-independent behavior at low temperature, whereas at higher temperatures it increases for all the frequencies. The AC conductivity follows Jonscher's power law, showing that conduction mechanism is due to polaron hopping. Complex impedance as a function of composition and temperature is used to examine the role of grain and grain boundary in the prepared material. Cole-cole plot shows only one semicircle up to x = 0.15, while as for x = 0.20 two semicircles are observed. The conduction mechanism is explained on the basis of both grain and grain boundary. (orig.)

  1. Electrical conduction in polycrystalline CVD diamond: Temperature dependent impedance measurements

    Energy Technology Data Exchange (ETDEWEB)

    Ye, H.; Williams, O.A.; Jackman, R.B. [Electronic and Electrical Engineering, University College London, Torrington Place, London WC1E 7JE (United Kingdom); Rudkin, R.; Atkinson, A. [Department of Materials, Imperial College London, South Kensington, London SW7 2AZ (United Kingdom)

    2002-10-16

    In this paper, we report the first measurement of impedance on freestanding diamond films from 0.1 Hz to 10 MHz up to 300 C. A wide range of CVD materials have been investigated, but here we concentrate on 'black' diamond grown by MWPECVD. The Cole-Cole (Z' via Z{sup ''}) plots are well fitted to a RC parallel circuit model and the equivalent resistance and capacitance for the diamond films have been estimated using the Zview curve fitting. The results show only one single semicircle response at each temperature measured. It was found that the resistance decreases from 62 M{omega} at room temperature to 4 k{omega} at 300 C, with an activation energy around 0.51 eV. The equivalent capacitance is maintained at the level of 10{sup 2} pF up to 300 C, suggesting that the diamond grain boundaries are dominating the conduction. At 400 C, the impedance at low frequencies shows a linear tail, which can be explained that the ac polarization of diamond/Au interface occurs. (Abstract Copyright [2002], Wiley Periodicals, Inc.)

  2. AC Optimal Power Flow

    Energy Technology Data Exchange (ETDEWEB)

    2016-10-04

    In this work, we have implemented and developed the simulation software to implement the mathematical model of an AC Optimal Power Flow (OPF) problem. The objective function is to minimize the total cost of generation subject to constraints of node power balance (both real and reactive) and line power flow limits (MW, MVAr, and MVA). We have currently implemented the polar coordinate version of the problem. In the present work, we have used the optimization solver, Knitro (proprietary and not included in this software) to solve the problem and we have kept option for both the native numerical derivative evaluation (working satisfactorily now) as well as for analytical formulas corresponding to the derivatives being provided to Knitro (currently, in the debugging stage). Since the AC OPF is a highly non-convex optimization problem, we have also kept the option for a multistart solution. All of these can be decided by the user during run-time in an interactive manner. The software has been developed in C++ programming language, running with GCC compiler on a Linux machine. We have tested for satisfactory results against Matpower for the IEEE 14 bus system.

  3. Silicon (BSFR) solar cell AC parameters at different temperatures

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, R Anil; Suresh, M.S. [ISRO Satellite Center, Bangalore- 560 017 (India); Nagaraju, J. [Solar Energy and Thermodynamic Laboratory, Department of Instrumentation, Indian Institute of Science, Bangalore- 560 012 (India)

    2005-01-31

    The AC parameters of back surface field reflected (BSFR) silicon solar cell are measured at different cell temperatures (198-348K) both in forward and reverse bias under dark condition using impedance spectroscopy technique. It is found that cell capacitance increases with temperature whereas cell resistance decreases, in forward bias voltage. Beyond maximum power point voltage, the cell inductance (0.28{mu}H) is measured, as the inductive reactance is comparable with cell series resistance. The measured cell parameters (cell capacitance, dynamic resistance, etc) are used to calculate the mean carrier lifetime and diode factor at different cell temperatures.

  4. GaAs/Ge solar cell AC parameters under illumination

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, R.A.; Suresh, M.S. [ISRO Satellite Center, Bangalore (India); Nagaraju, J. [Indian Institute of Science, Bangalore (India). Department of Instrumentation, Solar Energy Laboratory

    2004-04-01

    The ac parameters of GaAs/Ge solar cell were measured under illumination at different cell temperatures using impedance spectroscopy technique. They are compared with the dark measurements. It is found that the cell capacitance is higher and cell resistance is lower under illumination than in dark for all cell terminal voltages. The cell capacitances at the corresponding maximum power point voltage (terminal) do not vary with temperature where as the cell resistance decreases. The cell capacitance under illumination is estimated from the dark cell capacitance and it is in good agreement with the measured illumination data. (author)

  5. Impedance spectroscopy of manganite films prepared by metalorganic chemical vapor deposition.

    Science.gov (United States)

    Nakamura, Toshihiro; Homma, Kohei; Tachibana, Kunihide

    2011-09-01

    Polycrystalline Pr(1-x)CaxMnO3 (PCMO) films were prepared by liquid source metalorganic chemical vapor deposition using in situ infrared spectroscopic monitoring. The electric properties of the PCMO-based devices with Ni and Al electrodes (Ni-PCMO-Ni and Al-PCMO-Al devices) were studied by dc current-voltage (I-V) measurements and ac impedance spectroscopy. The current varied linearly with the applied voltage in Ni-PCMO-Ni devices, while nonlinear behavior was observed in I-V curves for Al-PCMO-Al devices. Impedance spectra were also different between Ni-PCMO-Ni and Al-PCMO-Al devices. The Cole-Cole plots for the Ni-PCMO-Ni devices showed only a single semicircular arc, which was assigned to the PCMO bulk impedance. Impedance spectra for the Al-PCMO-Al devices had two distinct components, which could be attributed to the PCMO bulk and to the interface between the PCMO film and the Al electrode, respectively. The bias dependence of the impedance spectra suggested that the resistance switching in the Al-PCMO-Al devices was mainly due to the resistance change in the interface between the film and the electrode. The metal electrode plays an important role in the resistance switching in the PCMO-based devices. The choice of the optimum metal electrodes is essential to the ReRAM application of the manganite-based devices.

  6. Impedance adaptation methods of the piezoelectric energy harvesting

    Science.gov (United States)

    Kim, Hyeoungwoo

    In this study, the important issues of energy recovery were addressed and a comprehensive investigation was performed on harvesting electrical power from an ambient mechanical vibration source. Also discussed are the impedance matching methods used to increase the efficiency of energy transfer from the environment to the application. Initially, the mechanical impedance matching method was investigated to increase mechanical energy transferred to the transducer from the environment. This was done by reducing the mechanical impedance such as damping factor and energy reflection ratio. The vibration source and the transducer were modeled by a two-degree-of-freedom dynamic system with mass, spring constant, and damper. The transmissibility employed to show how much mechanical energy that was transferred in this system was affected by the damping ratio and the stiffness of elastic materials. The mechanical impedance of the system was described by electrical system using analogy between the two systems in order to simply the total mechanical impedance. Secondly, the transduction rate of mechanical energy to electrical energy was improved by using a PZT material which has a high figure of merit and a high electromechanical coupling factor for electrical power generation, and a piezoelectric transducer which has a high transduction rate was designed and fabricated. The high g material (g33 = 40 [10-3Vm/N]) was developed to improve the figure of merit of the PZT ceramics. The cymbal composite transducer has been found as a promising structure for piezoelectric energy harvesting under high force at cyclic conditions (10--200 Hz), because it has almost 40 times higher effective strain coefficient than PZT ceramics. The endcap of cymbal also enhances the endurance of the ceramic to sustain ac load along with stress amplification. In addition, a macro fiber composite (MFC) was employed as a strain component because of its flexibility and the high electromechanical coupling

  7. Dielectric and Impedance Spectroscopy of Barium Bismuth Vanadate Ferroelectrics

    Science.gov (United States)

    Sutar, B. C.; Choudhary, R. N. P.; Das, Piyush R.

    2014-07-01

    Structural, micro-structural and electrical properties of barium bismuth vanadate Ba(Bi0.5V0.5)O3 ceramics were investigated. X-ray diffraction (XRD) analysis of the prepared material confirmed the formation of the compound with monoclinic crystal system. Scanning electron microscopy (SEM) of the compound exhibits well-defined grains that are uniformly distributed throughout the surface of the sample. Dielectric properties of the compound were studied as a function of temperature at different frequencies. An observation of dielectric anomaly at 295 °C is due to ferroelectric phase transition that was later confirmed by the appearance of hysteresis loop. Detailed studies of complex impedance spectroscopy have provided a better understanding of the relaxation process and correlations between the microstructure-electrical properties of the materials. The nature of frequency dependence of ac conductivity obeys the Debye power law. The dc conductivity, calculated from the ac conductivity spectrum, shows the negative temperature coefficient of resistance behavior similar to that of a semiconductor.

  8. Effect of 60Co gamma irradiation on dielectric and complex impedance properties of Dy3+ substituted Ni-Zn nanoferrites

    Science.gov (United States)

    Veena, M.; Somashekarappa, A.; Shankaramurthy, G. J.; Jayanna, H. S.; Somashekarappa, H. M.

    2016-12-01

    Nanocrystalline Ni1-xZnxFe2-yDyyO4 (x=0.0, 0.2, 0.4, 0.6, 0.8, 1.0; y=0.0 and 0.1) ferrites were synthesized by combustion method. Ni-Zn-Dy nanoferrites were investigated by X-ray diffraction, scanning electron microscopy, dielectric and impedance properties, before and after γ-irradiation process by 60Co γ-radiation with a dose rate of 310 kGy. The lattice parameter of irradiated samples increased attributed to the conversion of smaller size Fe3+ ions to larger size Fe2+ ions on ionizing effect of gamma radiation. Experimental results reveal that reduction in dielectric constant (ε‧), loss tangent (tan δ), real (Z‧) and imaginary (Z‧‧) impedance and increase in ac conductivity (σac) have been increased with increasing in frequency. It was found that ε‧, tan δ, σac increase, Z‧‧ and Z‧‧ reach a maximum value and thereafter decrease with further Zn ion substitution. The values of ε‧, tan δ and σac decrease with Dy3+ substitution and enhanced after irradiation. The complex impedance analysis suggesting predominant contribution to conduction was through the grain boundary.

  9. Single-Phase Direct AC-AC Boost Converter

    Directory of Open Access Journals (Sweden)

    LUCANU, M.

    2014-08-01

    Full Text Available The paper presents a single-phase direct AC-AC boost converter. The circuit of the converter is simple and it has good performances, irrespective of the load nature. The adequate functioning and high performance of the circuit (the efficiency and waveform of the absorbed input current were tested both by simulation and experimentally.

  10. New OTRA-Based Generalized Impedance Simulator

    OpenAIRE

    Ashish Gupta; Raj Senani; Bhaskar, D. R.; Singh, A. K.

    2013-01-01

    Operational transresistance amplifier (OTRA) has attracted considerable attention in the recent literature in several applications such as impedance simulation, universal biquad filter realization, realization of sinusoidal oscillators and multivibrators. However, to the best knowledge of the authors, any OTRA-based generalized impedance simulator circuits have not been reported so far. The purpose of this paper is to present such a circuit.

  11. Quadratic Boost A-Source Impedance Network

    DEFF Research Database (Denmark)

    Siwakoti, Yam Prasad; Blaabjerg, Frede; Chub, Andrii

    2016-01-01

    A novel quadratic boost A-source impedance network is proposed to realize converters that demand very high voltage gain. To satisfy the requirement, the network uses an autotransformer where the obtained gain is quadratically dependent on the duty ratio and is unmatched by any existing impedance ...

  12. Quantification of coating aging using impedance measurements

    NARCIS (Netherlands)

    Westing, E.P.M. van; Weijde, D.H. van der; Vreijling, M.P.W.; Ferrari, G.M.; Wit, J.H.W. de

    1998-01-01

    This chapter shows the application results of a novel approach to quantify the ageing of organic coatings using impedance measurements. The ageing quantification is based on the typical impedance behaviour of barrier coatings in immersion. This immersion behaviour is used to determine the limiting c

  13. Impedance of a slotted-pipe kicker

    Energy Technology Data Exchange (ETDEWEB)

    Feng Zhou [Academia Sinica, Beijing, BJ (China). Inst. of High Energy Physics

    1996-08-01

    This paper introduces the principle of a new slotted kicker simply, which is made by using vacuum pipe itself with proper slits as current conductors, and then, presents a rough estimation of its longitudinal and transverse impedance, respectively. Calculation shows that its impedance is reduced significantly compared to our present air-coil kicker. (author)

  14. Possibilities of electrical impedance tomography in gynecology

    Science.gov (United States)

    V, Trokhanova O.; A, Chijova Y.; B, Okhapkin M.; V, Korjenevsky A.; S, Tuykin T.

    2013-04-01

    The paper describes results of comprehensive EIT diagnostics of mammary glands and cervix. The data were obtained from examinations of 170 patients by EIT system MEM (multi-frequency electrical impedance mammograph) and EIT system GIT (gynecological impedance tomograph). Mutual dependence is discussed.

  15. Active impedance matching of complex structural systems

    Science.gov (United States)

    Macmartin, Douglas G.; Miller, David W.; Hall, Steven R.

    1991-01-01

    Viewgraphs on active impedance matching of complex structural systems are presented. Topics covered include: traveling wave model; dereverberated mobility model; computation of dereverberated mobility; control problem: optimal impedance matching; H2 optimal solution; statistical energy analysis (SEA) solution; experimental transfer functions; interferometer actuator and sensor locations; active strut configurations; power dual variables; dereverberation of complex structure; dereverberated transfer function; compensators; and relative power flow.

  16. Impedance Spectroscopy of Dielectrics and Electronic Conductors

    DEFF Research Database (Denmark)

    Bonanos, Nikolaos; Pissis, Polycarpos; Macdonald, J. Ross

    2013-01-01

    Impedance spectroscopy is used for the characterization of materials, such as electroceramics, solid and liquid electrochemical cells, dielectrics and also fully integrated devices, such as fuel cells. It consists of measuring the electrical impedance - or a closely related property, such as admi......Impedance spectroscopy is used for the characterization of materials, such as electroceramics, solid and liquid electrochemical cells, dielectrics and also fully integrated devices, such as fuel cells. It consists of measuring the electrical impedance - or a closely related property......, and procedures for the correction of measurement errors. The applications of impedance spectroscopy are illustrated with examples from electroceramics and polymer-based dielectric systems. The way in which the technique is applied to the two classes of materials is compared with reference to the different models...

  17. Fractional Order Element Based Impedance Matching

    KAUST Repository

    Radwan, Ahmed Gomaa

    2014-06-24

    Disclosed are various embodiments of methods and systems related to fractional order element based impedance matching. In one embodiment, a method includes aligning a traditional Smith chart (|.alpha.|=1) with a fractional order Smith chart (|.alpha.|.noteq.1). A load impedance is located on the traditional Smith chart and projected onto the fractional order Smith chart. A fractional order matching element is determined by transitioning along a matching circle of the fractional order Smith chart based at least in part upon characteristic line impedance. In another embodiment, a system includes a fractional order impedance matching application executed in a computing device. The fractional order impedance matching application includes logic that obtains a first set of Smith chart coordinates at a first order, determines a second set of Smith chart coordinates at a second order, and determines a fractional order matching element from the second set of Smith chart coordinates.

  18. Update of the SPS Impedance Model

    CERN Document Server

    Salvant, B; Zannini, C; Arduini, G; Berrig, O; Caspers, F; Grudiev, A; Métral, E; Rumolo, G; Shaposhnikova, E; Zotter, B; Migliorati, M; Spataro, B

    2010-01-01

    The beam coupling impedance of the CERN SPS is expected to be one of the limitations to an intensity upgrade of the LHC complex. In order to be able to reduce the SPS impedance, its main contributors need to be identified. An impedance model for the SPS has been gathered from theoretical calculations, electromagnetic simulations and bench measurements of single SPS elements. The current model accounts for the longitudinal and transverse impedance of the kickers, the horizontal and vertical electrostatic beam position monitors, the RF cavities and the 6.7 km beam pipe. In order to assess the validity of this model, macroparticle simulations of a bunch interacting with this updated SPS impedance model are compared to measurements performed with the SPS beam.

  19. Variations in electrical impedance and phase angle among seedlings of Pinus densata and parental species in Pinus tabuliformis habitat environment

    Institute of Scientific and Technical Information of China (English)

    Xinyu Chen; Huwei Yuan; Xiange Hu; Jingxiang Meng; Xianqing Zhou; Xiao-Ru Wang; Yue Li

    2015-01-01

    Electrical impedance (EI) and phase angle (PHI) parameters in AC impedance spectroscopy are important electrical parameters in the study of medical pathology. However, little is known about their application in variation and genetic relationship studies of forest trees. In order to test whether impedance parameters could be used in genetic relationship analysis among conifer species, EI and PHI were measured in a seedling experiment test composed of Pinus tabuliformis, Pinus yunnanensis, and Pinus densata in a habitat of Pinus tabuliformis. The results showed that variations in both EI and PHI among species were sig-nificant in different electric frequencies, and the EI and PHI values measured in the two populations of P. densata were between the two parental species, P. yunnanensis and P. tabuliformis. These results show that these two impedance parameters could reflect the genetic relationship among pine species. This was the first time using the two AC impedance spectroscopy parameters to test the genetic relationship analysis between tree species, and would be a hopeful novel reference methodology for future studies in evolution and genetic variation of tree species.

  20. Cooling Floor AC Systems

    Science.gov (United States)

    Jun, Lu; Hao, Ding; Hong, Zhang; Ce, Gao Dian

    The present HVAC equipments for the residential buildings in the Hot-summer-and-Cold-winter climate region are still at a high energy consuming level. So that the high efficiency HVAC system is an urgently need for achieving the preset government energy saving goal. With its advantage of highly sanitary, highly comfortable and uniform of temperature field, the hot-water resource floor radiation heating system has been widely accepted. This paper has put forward a new way in air-conditioning, which combines the fresh-air supply unit and such floor radiation system for the dehumidification and cooling in summer or heating in winter. By analyze its advantages and limitations, we found that this so called Cooling/ Heating Floor AC System can improve the IAQ of residential building while keep high efficiency quality. We also recommend a methodology for the HVAC system designing, which will ensure the reduction of energy cost of users.

  1. Modified structural and frequency dependent impedance formalism of nanoscale BaTiO3 due to Tb inclusion

    Science.gov (United States)

    Borah, Manjit; Mohanta, Dambarudhar

    2016-05-01

    We report the effect of Tb-doping on the structural and high frequency impedance response of the nanoscale BaTiO3 (BT) systems. While exhibiting a mixed phase crystal structure, the nano-BT systems are found to evolve with edges, and facets. The interplanar spacing of crystal lattice fringes is ~0.25 nm. The Cole-Cole plots, in the impedance formalism, have demonstrated semicircles which are the characteristic feature of grain boundary resistance of several MΩ. A lowering of ac conductivity with doping was believed to be due to the manifestation of oxygen vacancies and vacancy ordering.

  2. Method to detect the end-point for PCR DNA amplification using an ionically labeled probe and measuring impedance change

    Science.gov (United States)

    Miles, Robin R.; Belgrader, Phillip; Fuller, Christopher D.

    2007-01-02

    Impedance measurements are used to detect the end-point for PCR DNA amplification. A pair of spaced electrodes are located on a surface of a microfluidic channel and an AC or DC voltage is applied across the electrodes to produce an electric field. An ionically labeled probe will attach to a complementary DNA segment, and a polymerase enzyme will release the ionic label. This causes the conductivity of the solution in the area of the electrode to change. This change in conductivity is measured as a change in the impedance been the two electrodes.

  3. Impedance matching at arterial bifurcations.

    Science.gov (United States)

    Brown, N

    1993-01-01

    Reflections of pulse waves will occur in arterial bifurcations unless the impedance is matched continuously through changing geometric and elastic properties. A theoretical model is presented which minimizes pulse wave reflection through bifurcations. The model accounts for the observed linear changes in area within the bifurcation, generalizes the theory to asymmetrical bifurcations, characterizes changes in elastic properties from parent to daughter arteries, and assesses the effect of branch angle on the mechanical properties of daughter vessels. In contradistinction to previous models, reflections cannot be minimized without changes in elastic properties through bifurcations. The theoretical model predicts that in bifurcations with area ratios (beta) less than 1.0 Young's moduli of daughter vessels may be less than that in the parent vessel if the Womersley parameter alpha in the parent vessel is less than 5. Larger area ratios in bifurcations are accompanied by greater increases in Young's moduli of branches. For an idealized symmetric aortic bifurcation (alpha = 10) with branching angles theta = 30 degrees (opening angle 60 degrees) Young's modulus of common iliac arteries relative to that of the distal abdominal aorta has an increase of 1.05, 1.68 and 2.25 for area ratio of 0.8, 1.0 and 1.15, respectively. These predictions are consistent with the observed increases in Young's moduli of peripheral vessels.(ABSTRACT TRUNCATED AT 250 WORDS)

  4. Rotor damage detection by using piezoelectric impedance

    Science.gov (United States)

    Qin, Y.; Tao, Y.; Mao, Y. F.

    2016-04-01

    Rotor is a core component of rotary machinery. Once the rotor has the damage, it may lead to a major accident. Thus the quantitative rotor damage detection method based on piezoelectric impedance is studied in this paper. With the governing equation of piezoelectric transducer (PZT) in a cylindrical coordinate, the displacement along the radius direction is derived. The charge of PZT is calculated by the electric displacement. Then, by the use of the obtained displacement and charge, an analytic piezoelectric impedance model of the rotor is built. Given the circular boundary condition of a rotor, annular elements are used as the analyzed objects and spectral element method is used to set up the damage detection model. The Electro-Mechanical (E/M) coupled impedance expression of an undamaged rotor is deduced with the application of a low-cost impedance test circuit. A Taylor expansion method is used to obtain the approximate E/M coupled impedance expression for the damaged rotor. After obtaining the difference between the undamaged and damaged rotor impedance, a rotor damage detection method is proposed. This method can directly calculate the change of bending stiffness of the structural elements, it follows that the rotor damage can be effectively detected. Finally, a preset damage configuration is used for the numerical simulation. The result shows that the quantitative damage detection algorithm based on spectral element method and piezoelectric impedance proposed in this paper can identify the location and the severity of the damaged rotor accurately.

  5. Tracking of electrochemical impedance of batteries

    Science.gov (United States)

    Piret, H.; Granjon, P.; Guillet, N.; Cattin, V.

    2016-04-01

    This paper presents an evolutionary battery impedance estimation method, which can be easily embedded in vehicles or nomad devices. The proposed method not only allows an accurate frequency impedance estimation, but also a tracking of its temporal evolution contrary to classical electrochemical impedance spectroscopy methods. Taking into account constraints of cost and complexity, we propose to use the existing electronics of current control to perform a frequency evolutionary estimation of the electrochemical impedance. The developed method uses a simple wideband input signal, and relies on a recursive local average of Fourier transforms. The averaging is controlled by a single parameter, managing a trade-off between tracking and estimation performance. This normalized parameter allows to correctly adapt the behavior of the proposed estimator to the variations of the impedance. The advantage of the proposed method is twofold: the method is easy to embed into a simple electronic circuit, and the battery impedance estimator is evolutionary. The ability of the method to monitor the impedance over time is demonstrated on a simulator, and on a real Lithium ion battery, on which a repeatability study is carried out. The experiments reveal good tracking results, and estimation performance as accurate as the usual laboratory approaches.

  6. Cascaded impedance networks for NPC inverter

    DEFF Research Database (Denmark)

    Li, Ding; Gao, Feng; Loh, Poh Chiang;

    2010-01-01

    would have a higher output voltage gain. It is anticipated that it would help the formed inverters find applications in photovoltaic and other renewable systems, where a high voltage gain is usually requested. Experimental testing has already been conducted and verifies the theory. ©2010 IEEE....... they are subject to the renewable sources. To date, three distinct types of impedance networks can be summarized for implementing a hybrid source impedance network, which can in principle be combined and cascaded before connected to a NPC inverter by proposed two ways. The resulting cascaded impedance network NPC...

  7. SPATIAL VARIABILITY OF PEDOZEMS MECHANICAL IMPEDANCE

    Directory of Open Access Journals (Sweden)

    Zhukov A.V.

    2013-04-01

    Full Text Available We studied the spatial variability of pedozem mechanical impedance in ResearchRemediation Center of the Dnipropetrovsk State Agrarian University in Ordzhonikidze. Thestatistical distribution of the soil mechanical impedance within the studied area is characterized by deviation from the normal law in 0–10 and 30–50 cm layers from the surface. 2D and 3D modeling shows the structural design of the soil as locations of high mechanical impedance which found in the soils with less hardness.

  8. Electrical Impedance Measurements of PZT Nanofiber Sensors

    Directory of Open Access Journals (Sweden)

    Richard Galos

    2017-01-01

    Full Text Available Electrical impedance measurements of PZT nanofiber sensors were performed using a variety of methods over a frequency spectrum ranging from DC to 1.8 GHz. The nanofibers formed by electrospinning with diameters ranging from 10 to 150 nm were collected and integrated into sensors using microfabrication techniques. Special matching circuits with ultrahigh input impedance were fabricated to produce low noise, measurable sensor outputs. Material properties including resistivity and dielectric constant are derived from the impedance measurements. The resulting material properties are also compared with those of individual nanofibers being tested using conductive AFM and Scanning Conductive Microscopy.

  9. Electrochemical Impedance Studies of SOFC Cathodes

    DEFF Research Database (Denmark)

    Hjelm, Johan; Søgaard, Martin; Wandel, Marie

    2007-01-01

    impedance of the cathode at intermediate operating temperatures. The perovskite is of the La-Sr-Co-Fe type. The EIS response of symmetrical cells with a thick (similar to 200 mu m) gadolinia doped ceria electrolyte was compared with the impedance contribution of the cathode of a full anode supported cell....... The full cells had a Ni-YSZ anode and anode support, a thin YSZ electrolyte, and a CGO barrier layer. The symmetric and full cell cathode responses were compared at open-circuit voltage. Humidified hydrogen was used as the fuel in the full cell measurements. Differential analysis of the impedance data...

  10. Wearable impedance monitoring system for dialysis patients.

    Science.gov (United States)

    Bonnet, S; Bourgerette, A; Gharbi, S; Rubeck, C; Arkouche, W; Massot, B; McAdams, E; Montalibet, A; Jallon, P

    2016-08-01

    This paper describes the development and the validation of a prototype wearable miniaturized impedance monitoring system for remote monitoring in home-based dialysis patients. This device is intended to assess the hydration status of dialysis patients using calf impedance measurements. The system is based on the low-power AD8302 component. The impedance calibration procedure is described together with the Cole parameter estimation and the hydric volume estimation. Results are given on a test cell to validate the design and on preliminary calf measurements showing Cole parameter variations during hemodialysis.

  11. Universal impedance fluctuations in wave chaotic systems.

    Science.gov (United States)

    Hemmady, Sameer; Zheng, Xing; Ott, Edward; Antonsen, Thomas M; Anlage, Steven M

    2005-01-14

    We experimentally investigate theoretical predictions of universal impedance fluctuations in wave chaotic systems using a microwave analog of a quantum chaotic infinite square well potential. We emphasize the use of the radiation impedance to remove the nonuniversal effects of the particular coupling between the outside world and the scatterer. Specific predictions that we test include the probability density functions (PDFs) of the real and imaginary parts of the universal impedance, the equality of the variances of these PDFs, and the dependence of these PDFs on a single loss parameter.

  12. Irradiation programme HFR phase IIb - SPICE. Impact testing on up to 16.3 dpa irradiated RAFM steels. Final report for task TW2-TTMS 001b-D05

    Energy Technology Data Exchange (ETDEWEB)

    Gaganidze, E.; Dafferner, B.; Ries, H.; Rolli, R.; Schneider, H.C.; Aktaa, J.

    2008-04-15

    The objective of this work is to study the effects of neutron irradiation on the embrittlement behavior of different reduced activation ferritic/martensitic (RAFM) steels. The irradiation was carried out in the Petten High Flux Reactor (HFR) in the framework of the HFR Phase IIb (SPICE) irradiation project at a nominal dose of 16.3 dpa and at different irradiation temperatures (250-450 C). The impact properties are investigated by instrumented Charpy-V tests with subsize specimens (KLST-type). The emphasis is put on the investigation of irradiation induced embrittlement and hardening of the European RAFM reference steel for the first wall of a DEMO fusion reactor, EURO- FER97 under different heat treatment conditions. The mechanical properties of EUROFER97 are compared with the results on international reference steels (F82H-mod, OPTIFER-Ia, GA3X and MANET-I) included in the SPICE project. EUROFER97 irradiated up to 16.3 dpa between 250 and 450 C showed irradiation resistance that is comparable to those of best RAFM steels. Large low temperature (T{sub irr} {<=} 300 C) embrittlement is seen for all investigated RAFM steels. Heat treatment of EUROFER97 at higher austenitizing temperature led to the reduction of embrittlement at low temperatures (T{sub irr} {<=} 350 C). At T{sub irr} {>=} 350 C the DBTTs of the steels remain below -20 C and, hence, are well below the application temperature. Analysis of hardening vs. embrittlement behaviour indicated hardening dominated embrittlement at T{sub irr} {<=} 350 C with 0.17 {<=} C{sub 100} {<=} 0.53 C/MPa. Oxygen dispersion hardened ODS EUROFER with 0.5 wt.% Y{sub 2}O{sub 3} has been irradiated at selected irradiation temperatures. ODS EUROFER showed not satisfying impact properties already in the unirradiated condition characterized by low USE = 2.54 J and large DBTT = 135 C. Furthermore, the increase of USE for irradiation temperatures below T{sub irr} {<=} 350 C indicates not optimized fabrication process. At T{sub irr

  13. ACS CCD Stability Monitor

    Science.gov (United States)

    Grogin, Norman

    2012-10-01

    A moderately crowded stellar field in the cluster 47 Tuc {6 arcmin West of the cluster core} is observed every four months with the WFC. The first visit exercises the full suite of broad and narrow band imaging filters and sub-array modes; following visits observe with only the six most popular Cycle 18 filters in full-frame mode. The positions and magnitudes of objects will be used to monitor local and large scale variations in the plate scale and the sensitivity of the detectors and to derive an independent measure of the detector CTE. One exposure in each sub-array mode with the WFC will allow us to verify that photometry obtained in full-frame and in sub-array modes are repeatable to better than 1%. This test is important for the ACS Photometric Cross-Calibration program, which uses sub-array exposures. This program may receive additional orbits to investigate ORIENT-dependent geometric distortion, which motivates the ORIENT and BETWEEN requirement on the first visit.

  14. AcEST: DK956383 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TAC +HPGP Sbjct: 130 TP----GQAEEEKIEPLAPPVQKAVIDINQPQVCKNKGCGQTFKERDNHETACSHHPGPA 185 Query: 574 VF 579 VF S...AC +HPGP Sbjct: 130 TP----GQAEEEKIEPLAPPVQKAVIDINQPQVCKNKGCGQTFKERDNHETACSHHPGPA 185 Query: 574 VF 579 VF Sb

  15. Bridge Network for Measuring Very Small Impedances from 4.2 to 300 degrees K with a Null-Detector Sensitivity of 10-11 Volt

    DEFF Research Database (Denmark)

    Bak, Christen Kjeldahl; Dalsgaard, Erik

    1967-01-01

    An ac measuring technique devised primarily for measuring galvanomagnetic effects in metals is presented. The instrument may, however, be useful whenever it is desired to measure and record continuously impedances in the range 10−3 to 10−8 Omega. The sample assembly is disscussed in some detail...

  16. Phase-sensitive detection of both inductive and non-inductive ac voltages in ferromagnetic resonance

    Science.gov (United States)

    Weiler, Mathias; Shaw, Justin M.; Nembach, Hans T.; Schoen, Martin A.; Boone, Carl T.; Silva, Thomas J.

    2014-03-01

    Spin pumping causes significant damping in ultrathin ferromagnetic/normal metal (NM) multilayers via spin-current generation of both dc and ac character in the NM system. While the nonlinear dc component has been investigated in detail by utilization of the inverse spin Hall effect (iSHE) in NMs, much less is known about the linear ac component that is presumably much larger in the small-excitation limit. We measured generated ac voltages in a wide variety of Permalloy/NM multilayers via vector-network-analyzer ferromagnetic resonance. We employ a custom, impedance-matched, broadband microwave coupler that features a ferromagnetic thin film reference resonator to accurately compare ac voltage amplitudes and phases between varieties of multilayers. By use of the fact that inductive and ac iSHE signals are phase-shifted by π/2, we find that inductive signals are major contributors in all investigated samples. It is only by comparison of the phase and amplitude of the recorded ac voltages between multiple samples that we can extract the non-inductive contributions due to spin-currents. Voltages due to the ac iSHE in Permalloy(10nm)/platinum(5nm) bilayers are weaker than inductive signals, in agreement with calculations based upon recent theoretical predictions. M.W. acknowledges financial support by the German Academic Exchange service (DAAD).

  17. Using AC Motors in Robotics

    Directory of Open Access Journals (Sweden)

    Hosein Marzi

    2008-11-01

    Full Text Available It has been proven that fuzzy controllers are capable of controlling non-linear systems where it is cumbersome to develop conventional controllers based on mathematical modeling. This paper describes designing fuzzy controllers for an AC motor run mechanism. It also compares performance of two controllers designed based on Mamdani and Takagi-Sugeno with the conventional control scheme in a short track length, following a high disturbance. Fine and rapid control of AC motors have been a challenge and the main obstacle in gaining popularity in use of AC motors in robots actuators. This chapter reviews how use of intelligent control scheme can help to solve this problem.

  18. Capacitive Behavior in Conducting Polymers: AC Impedance and Quartz Crystal Microbalance Studies

    Science.gov (United States)

    1989-06-15

    Extended Abstracts, 175th National Meeting of the Electrochemical Society , Los Angeles, California, 1989 Corrosion Research Center Department of Chemical...114. DATE OF REPORT (Vear,Montha) 15PAGE COUNT Technical I Rom 7/88 TO 619I 89/06/15I 16. SUPPLEMENTARY NOTATION 175th Meeting of the Electrochemical ... Society , Extended Abstracts, May 1989 17 COSATI CODES IS. SUBJECT TERMS (Continue in reverie if necessary and identify by block number) FIELD GROUP

  19. Mode Adaptive Droop Control with Virtual Output Impedances for an Inverter-Based Flexible AC Microgrid

    DEFF Research Database (Denmark)

    Kim, Jaehong; Guerrero, Josep M.; Rodriguez, Pedro;

    2011-01-01

    in islanded and grid-connected mode. The proposed control scheme does not need any mode switching action. Thus, it is relatively simple in control for full mode of operation. Smooth transitions between the operation modes and the effectiveness of the proposed control scheme are evaluated through simulation...... control combined with a derivative controller is used in islanded mode. In grid-connected mode, to strictly control the power factor in the point of common coupling (PCC), a droop method combined with an integral controller is adopted. Small-signal analysis of the proposed control is shown both...

  20. Structure, ac conductivity and complex impedance study of Co3O4 ...

    African Journals Online (AJOL)

    user

    structure of the single phased samples is cubic spinel phase with space .... The pre-sintered mixture was ground and pressed at 5 tons pressure into a disk of 13 mm ... heated at 2000C for 2 hours to make it little bit hard before placing the ...

  1. New Regularization Method in Electrical Impedance Tomography

    Institute of Scientific and Technical Information of China (English)

    侯卫东; 莫玉龙

    2002-01-01

    Image reconstruction in elecrical impedance tomography(EIT)is a highly ill-posed inverse problem,Regularization techniques must be used in order to solve the problem,In this paper,a new regularization method based on the spatial filtering theory is proposed.The new regularized reconstruction for EIT is independent of the estimation of impedance distribution,so it can be implemented more easily than the maxiumum a posteriori(MAP) method.The regularization level in our proposed method varies spatially so as to be suited to the correlation character of the object's impedance distribution.We implemented our regularization method with two dimensional computer simulations.The experimental results indicate that the quality of the reconstructed impedance images with the descibed regularization method based on spatial filtering theory is better than that with Tikhonov method.

  2. Impedance and collective effects in the LHC

    Energy Technology Data Exchange (ETDEWEB)

    Gareyte, J. [European Organization for Nuclear Research, Geneva (Switzerland)

    1996-08-01

    After a review of the main LHC parameters, and a brief description of the RF and vacuum systems, the coupling impedances of the main machine elements are given, as well as the resulting thresholds for instabilities. (author)

  3. Wave impedance retrieving via Bloch modes analysis

    DEFF Research Database (Denmark)

    Andryieuski, Andrei; Ha, S.; Sukhorukov, A.;

    2011-01-01

    of the Bloch mode, respectively. Case studies prove that our ap-proach can determine material and wave effective parameters of lossy and lossless metamaterials. In some examples when the passivity is violated we made further analysis and showed that this is due to the failure of concept of impedance retrieving......-ciples violation, like antiresonance behaviour with Im(ε) mode analysis of periodic metamaterials to extract the dominating (fundamental) Bloch mode. Then it is possible to determine the Bloch and wave impedances by the surface and volume aver-aging of the electromagnetic field......The main bottleneck in the restoration of electromagnetic effective parameters is connected to the impedance retrieving. The S-parameters method gives the input (Bloch) impedance, which, being then used for permittivity and permeability determination, causes some fundamental physics prin...

  4. Thermal Impedance of Rectangular Microwave Oven Linings

    Institute of Scientific and Technical Information of China (English)

    SHIShang-zhao; XUFu-qiu; 等

    1996-01-01

    Amodel was preseted for calcultaing the thermal impedance of the insulation and refractory linings of rectangular microwave ovens,of which the oven cavity's dimensions are relatively small,while the linings re relatively thick.

  5. A Rotative Electrical Impedance Tomography Reconstruction System

    Energy Technology Data Exchange (ETDEWEB)

    Yu, F-M [St. John' s and St. Mary' s Institute of Technology, Department of computer science and information Engineering, 499, Sec. 4, Tam King Road Tamsui, Taipei, Taiwan (China); Huang, C-N [National Central University, Department of Electrical Engineering, No.300, Jungda Rd, Jhongli City, 320 Taoyuan, Taiwan (China); Chang, F-W [National Central University, Department of Electrical Engineering, No.300, Jungda Rd, Jhongli City, 320 Taoyuan, Taiwan (China); Chung, H-Y [National Central University, Department of Electrical Engineering, No.300, Jungda Rd, Jhongli City, 320 Taoyuan, Taiwan (China)

    2006-10-15

    Electrical impedance tomography (EIT) is a powerful tool for mapping the conductivity distribution of estimated objects. The EIT system is entirely implemented by electrical technique, so it is a relatively cheap system and data can be collected very rapidly. But it has few commercially medical EIT systems available. This is because impedance image unable to achieve the essential spatial resolution and this technique has an intrinsically poor signal to noise ratio. In this paper, we have developed a high performance rotative EIT system (REIT) for expanding the independent measurements. By rotate the electrodes successive, REIT could change the position of electrodes and acquire more measurement data. This rotative measurement method not only can increase the resolution of impedance images, but also reduce the complexity of measurement system. We hope the improvement of REIT will bring some help in electrical impedance tomography.

  6. Modeling degradation in SOEC impedance spectra

    DEFF Research Database (Denmark)

    Jensen, Søren Højgaard; Hauch, Anne; Knibbe, Ruth;

    2013-01-01

    Solid oxide cell (SOC) performance is limited by various processes. One way to investigate these processes is by electrochemical impedance spectroscopy. In order to quantify and characterize the processes, an equivalent circuit can be used to model the SOC impedance spectra (IS). Unfortunately......, the optimal equivalent circuit is often unknown and to complicate matters further, several processes contribute to the SOC impedance - making detailed process characterization difficult. In this work we analyze and model a series of IS measured during steam electrolysis operation of an SOC. During testing......, degradation is only observed in the Ni/YSZ electrode and not in the electrolyte or the LSM/YSZ electrode. A batch fit of the differences between the IS shows that a modified Gerischer element provides a better fit to the Ni/YSZ electrode impedance than the frequently used RQ element - albeit neither...

  7. Influnce of exposure with Xe radiation on heterojunction solar cell a-SiC/c-Si studied by impedance spectroscopy

    Science.gov (United States)

    Perný, M.; Šály, V.; Packa, J.; Mikolášek, M.; Váry, M.; Huran, J.; Hrubčín, L.; Skuratov, V. A.; Arbet, J.

    2017-04-01

    The photovoltaic efficiency of heterostructures a-SiC/c-Si may be the same or even better in comparison with conventional silicon structures when suitable adjustment of technological parameters is realized. The main advantage of heterojunction formed amorphous SiC thin film and crystalline silicon compared to standard crystalline solar cell lies in high build-in voltage and thus a high open-circuit voltage. Solar cells can be exposed to various influences of hard environment. A deterioration of properties of heterostructures (a-SiC/c-Si) due to irradiation is examined in our paper using impedance spectroscopy method. Xe ions induced damage is reflected in changes of proposed AC equivalent circuit elements. AC equivalent circuit was proposed and verified using numerical simulations. Impedance spectra were also measured at different DC bias voltages due to a more detailed understanding correlation between Xe ions induced damage and transport phenomenon in the heterostructure.

  8. General analytical solutions for DC/AC circuit network analysis

    CERN Document Server

    Rubido, Nicolás; Baptista, Murilo S

    2014-01-01

    In this work, we present novel general analytical solutions for the currents that are developed in the edges of network-like circuits when some nodes of the network act as sources/sinks of DC or AC current. We assume that Ohm's law is valid at every edge and that charge at every node is conserved (with the exception of the source/sink nodes). The resistive, capacitive, and/or inductive properties of the lines in the circuit define a complex network structure with given impedances for each edge. Our solution for the currents at each edge is derived in terms of the eigenvalues and eigenvectors of the Laplacian matrix of the network defined from the impedances. This derivation also allows us to compute the equivalent impedance between any two nodes of the circuit and relate it to currents in a closed circuit which has a single voltage generator instead of many input/output source/sink nodes. Contrary to solving Kirchhoff's equations, our derivation allows to easily calculate the redistribution of currents that o...

  9. Moderately nonlinear diffuse-charge dynamics under an ac voltage

    Science.gov (United States)

    Stout, Robert F.; Khair, Aditya S.

    2015-09-01

    The response of a symmetric binary electrolyte between two parallel, blocking electrodes to a moderate amplitude ac voltage is quantified. The diffuse charge dynamics are modeled via the Poisson-Nernst-Planck equations for a dilute solution of point-like ions. The solution to these equations is expressed as a Fourier series with a voltage perturbation expansion for arbitrary Debye layer thickness and ac frequency. Here, the perturbation expansion in voltage proceeds in powers of Vo/(kBT /e ) , where Vo is the amplitude of the driving voltage and kBT /e is the thermal voltage with kB as Boltzmann's constant, T as the temperature, and e as the fundamental charge. We show that the response of the electrolyte remains essentially linear in voltage amplitude at frequencies greater than the RC frequency of Debye layer charging, D /λDL , where D is the ion diffusivity, λD is the Debye layer thickness, and L is half the cell width. In contrast, nonlinear response is predicted at frequencies below the RC frequency. We find that the ion densities exhibit symmetric deviations from the (uniform) equilibrium density at even orders of the voltage amplitude. This leads to the voltage dependence of the current in the external circuit arising from the odd orders of voltage. For instance, the first nonlinear contribution to the current is O (Vo3) which contains the expected third harmonic but also a component oscillating at the applied frequency. We use this to compute a generalized impedance for moderate voltages, the first nonlinear contribution to which is quadratic in Vo. This contribution predicts a decrease in the imaginary part of the impedance at low frequency, which is due to the increase in Debye layer capacitance with increasing Vo. In contrast, the real part of the impedance increases at low frequency, due to adsorption of neutral salt from the bulk to the Debye layer.

  10. Analysis of impedance measurements of a suspension of microcapsules using a variable length impedance measurement cell

    Directory of Open Access Journals (Sweden)

    Dejan Krizaj

    2012-10-01

    Full Text Available Electrical impedance measurements of the suspensions have to take into account the double layer impedance that is due to a very thin charged layer formed at the electrode-electrolite interface. A dedicated measuring cell that enables variation of the distance between the electrodes was developed for investigation of electrical properties of suspensions using two electrode impedance measurements. By varying the distance between the electrodes it is possible to separate the double layer and the suspension impedance from the measured data. From measured and extracted impedances electrical lumped models have been developed. The error of non inclusion of the double layer impedance has been analyzed. The error depends on the frequency of the measurements as well as on the distance between the electrodes.

  11. Effect of shear on duct wall impedance.

    Science.gov (United States)

    Goldstein, M.; Rice, E.

    1973-01-01

    The solution to the equation governing the propagation of sound in a uniform shear layer is expressed in terms of parabolic cylinder functions. This result is used to develop a closed-form solution for acoustic wall impedance which accounts for both the duct liner and the presence of a boundary layer in the duct. The effective wall impedance can then be used as the boundary condition for the much simpler problem of sound propagation in uniform flow.

  12. CSR Impedance for Non-Ultrarelativistic Beams

    Energy Technology Data Exchange (ETDEWEB)

    Li, Rui [Jefferson Lab., Newport News, VA (United States); Tsai, Cheng Y. [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States); Jefferson Lab., Newport News, VA (United States)

    2015-09-01

    For the analysis of the coherent synchrotron radiation (CSR)-induced microbunching gain in the low energy regime, such as when a high-brightness electron beam is transported through a low-energy merger in an energy-recovery linac (ERL) design, it is necessary to extend the CSR impedance expression in the ultrarelativistic limit to the non-ultrarelativistic regime. This paper presents our analysis of CSR impedance for general beam energies.

  13. Design of an impedance matching acoustic bend

    OpenAIRE

    Yang, Yuzhen; Jia, Han; Lu, Wenjia; Sun, Zhaoyong; Yang, Jun

    2017-01-01

    We propose the design of an impedance matching acoustic bend in this article. The bending structure is composed of sub-wavelength unit cells with perforated plates and side pipes, whose mass density and bulk modulus can be tuned simultaneously. So the refraction index and the impedance of the acoustic bend can be modulated simultaneously to guarantee both the bending effect and the high transmission. The simulation results of sound pressure field distribution show that the bending effect of t...

  14. Antenna impedance matching with neural networks.

    Science.gov (United States)

    Hemminger, Thomas L

    2005-10-01

    Impedance matching between transmission lines and antennas is an important and fundamental concept in electromagnetic theory. One definition of antenna impedance is the resistance and reactance seen at the antenna terminals or the ratio of electric to magnetic fields at the input. The primary intent of this paper is real-time compensation for changes in the driving point impedance of an antenna due to frequency deviations. In general, the driving point impedance of an antenna or antenna array is computed by numerical methods such as the method of moments or similar techniques. Some configurations do lend themselves to analytical solutions, which will be the primary focus of this work. This paper employs a neural control system to match antenna feed lines to two common antennas during frequency sweeps. In practice, impedance matching is performed off-line with Smith charts or relatively complex formulas but they rarely perform optimally over a large bandwidth. There have been very few attempts to compensate for matching errors while the transmission system is in operation and most techniques have been targeted to a relatively small range of frequencies. The approach proposed here employs three small neural networks to perform real-time impedance matching over a broad range of frequencies during transmitter operation. Double stub tuners are being explored in this paper but the approach can certainly be applied to other methodologies. The ultimate purpose of this work is the development of an inexpensive microcontroller-based system.

  15. Impedance Biosensing to detect food allergens, endocrine disrupting chemicals, and food pathogens

    Science.gov (United States)

    Radhakrishnan, Rajeswaran

    Electrochemical impedance biosensors can be viewed as an AC electroanalytical method for the analyte detection in the fields of biomedicine, environmental monitoring, and food and agriculture, amongst others. The most common format for AC impedance biosensing involves surface immobilization of an antibody, receptor protein, DNA strand, or other species capable of bio-recognition, and AC impedance detection of the binding event. Technological application of AC impedance biosensors has been hindered by several obstacles, including the more complex circuitry required for AC relative to DC electrochemistry, chemical and physical interference arising from non-specific adsorption, and the stability and reproducibility of protein immobilization. One focus of these PhD studies is on methods to reduce or compensate for non-specific adsorption, including sample dilution, site blocking with BSA, and the use of control electrodes onto which reference antibodies are immobilized. Examples that will be presented include impedance detection of food pathogens, such as Listeria monocytogenes, using a mouse monoclonal antibody immobilized onto an Au electrode. This yields detection limits of 5 CFU/ml and 4 CFU/ml for ideal solutions and filtered tomato extract, respectively. Control experiments with an Au electrode onto which a mouse monoclonal antibody to GAPDH is immobilized demonstrate that non-specific adsorption is insignificant for the system and methodology studied here. Control experiments with Salmonella enterica demonstrate no cross-reactivity to this food pathogen. In addition, Detection of two endocrine-disrupting chemicals (EDC), norfluoxetine and BDE-47, is reported here by impedance biosensing, with a detection limit of 8.5 and 1.3 ng/ml for norfluoxetine and BDE-47, respectively. Additional research has focused on alternative substrates and linker chemistries for protein immobilization, including the use of degenerate (highly doped) Si and bidendate thiol monolayer

  16. Aislamiento acústico

    Directory of Open Access Journals (Sweden)

    Tobío, J. M.

    1970-07-01

    Full Text Available This is a very specific subject in the field of architectural acoustics, namely, insulation'. Emphasis is placed on the theoretical foundations of this phenomenon, and the most simple formula are developed to calculate easily the transmission losses of a material or the constructional insulating arrangements. The practical aspect of insulation can be considered by means of several graphs and charts, without the use of mathematics, and utilising common materials, that will not substantially increase the cost of the project. Finally this papers offers a critical discussion of building codes, and their reference to the acoustical insulation of dwellings, and data is included on the new regulations of the Madrid Municipality.Se trata un tema muy concreto de la Acústica Arquitectónica, el aislamiento, haciendo hincapié en los fundamentos teóricos del fenómeno y estableciendo las fórmulas más sencillas que permiten calcular fácilmente las pérdidas de transmisión de un material o disposición constructiva aislante. Varias gráficas y abacos permiten abordar, sin ningún tratamiento matemático, el problema práctico del aislamiento, aprovechando los materiales comunes y sin ocasionar gastos que graven sustancialmente el importe del proyecto. Por último, se hace un estudio crítico de las normas y su incidencia en los problemas del aislamiento de viviendas, incluyendo datos referentes a la nueva Ordenanza del Ayuntamiento de Madrid.

  17. Partial AC-coupling minigrids

    Energy Technology Data Exchange (ETDEWEB)

    Moix, Pierre-Olivier; Ruchet, Claude [Studer Innotec, Sion (Switzerland)

    2010-07-01

    Partial AC-coupling: - It is feasible to make AC-coupling of some compatible elements without V/f droops. Standard elements available on the market were tested. - Optimum design for efficiency is a share of the solar modules between DC-coupling with a solar charger and AC-coupling with a grid inverter according to the load profile. - Partial AC-coupling is better in term of robustness; it is more reliable to have at least a part of the solar production connected directly to DC, or even only DC coupling. The presented concepts are not only theoretical but were implemented and tested on real products available on the market. Many tests have been done to find out the limits and problems that can occur with the use of grid connected and stand alone inverter together. Many combinations were tested and it was found robust enough to be used in the field with the precautions mentioned about microcycling. (orig.)

  18. Measurement of surface resistivity/conductivity of different organic thin films by a combination of optical shearography and electrochemical impedance spectroscopy

    Science.gov (United States)

    Habib, Khaled

    2013-11-01

    Shearography techniques were applied again to measure the surface resistivity/conductivity of different organic thin films on a metallic substrate. The coatings were ACE premium-grey enamel (spray coating), a yellow Acrylic lacquer, and a gold nail polish on a carbon steel substrate. The investigation was focused on determining the in-plane displacement of the coatings by shearography between 20 and 60 °C. Then, the alternating current (AC) impedance (resistance) of the same coated samples was determined by electrochemical impedance spectroscopy (EIS) in 3.0% NaCl solution at room temperature. As a result, the proportionality constant (resistivity or conductivity = 1/surface resistivity) between the determined AC impedance and the in-plane displacement was obtained. The obtained resistivity of all investigated coatings, 40:15 × 106-24:6 × 109Ωcm, was found in the insulator range.

  19. Determination of Surface pKa of Pure Mercaptoacetic Acid and 2- Mercaptobenzothiazole Mixed Monolayers by Impedance Titration

    Institute of Scientific and Technical Information of China (English)

    Guang Han LU; Chuan Yin LIU; Hong Yan ZHAO; Wei LIU; Li Ping JIANG; Ling Yan JIANG

    2004-01-01

    Interfacial proton transfer reactions of pure mercaptoacetic acid (MA) and 2-mercaptobenzothiazole (Mbz) mixed self-assembled monolayers (SAMs) have been studied using a.c. impedance titration method. The charge-transfer resistance (Rct) is measured with the monolayer composition and the ionic strength of pH solution. The surface pKa can be obtained by the plots of Rct and pH, the reasons of shifts of surface pKa are also explained.

  20. Impedance Based Analysis and Design of Harmonic Resonant Controller for a Wide Range of Grid Impedance

    DEFF Research Database (Denmark)

    Kwon, Jun Bum; Wang, Xiongfei; Blaabjerg, Frede

    2014-01-01

    in the closed-loop output admittance of converter. Such negative resistances may interact with the grid impedance resulting in steady state error or unstable harmonic compensation. To deal with this problem, a design guideline for harmonic resonant controllers under a wide range of grid impedance is proposed......This paper investigates the effect of grid impedance variation on harmonic resonant current controllers for gridconnected voltage source converters by means of impedance-based analysis. It reveals that the negative harmonic resistances tend to be derived from harmonic resonant controllers...

  1. Dielectric, Impedance and Conduction Behavior of Double Perovskite Pr2CuTiO6 Ceramics

    Science.gov (United States)

    Mahato, Dev K.; Sinha, T. P.

    2016-08-01

    Polycrystalline Pr2CuTiO6 (PCT) ceramics exhibits dielectric, impedance and modulus characteristics as a possible material for microelectronic devices. PCT was synthesized through the standard solid-state reaction method. The dielectric permittivity, impedance and electric modulus of PCT have been studied in a wide frequency (100 Hz-1 MHz) and temperature (303-593 K) range. Structural analysis of the compound revealed a monoclinic phase at room temperature. Complex impedance Cole-Cole plots are used to interpret the relaxation mechanism, and grain boundary contributions towards conductivity have been estimated. From electrical modulus formalism polarization and conductivity relaxation behavior in PCT have been discussed. Normalization of the imaginary part of impedance (Z″) and the normalized imaginary part of modulus (M″) indicates contributions from both long-range and localized relaxation effects. The grain boundary resistance along with their relaxation frequencies are plotted in the form of an Arrhenius plot with activation energy 0.45 eV and 0.46 eV, respectively. The ac conductivity mechanism has been discussed.

  2. Dielectric, Impedance and Conduction Behavior of Double Perovskite Pr2CuTiO6 Ceramics

    Science.gov (United States)

    Mahato, Dev K.; Sinha, T. P.

    2017-01-01

    Polycrystalline Pr2CuTiO6 (PCT) ceramics exhibits dielectric, impedance and modulus characteristics as a possible material for microelectronic devices. PCT was synthesized through the standard solid-state reaction method. The dielectric permittivity, impedance and electric modulus of PCT have been studied in a wide frequency (100 Hz-1 MHz) and temperature (303-593 K) range. Structural analysis of the compound revealed a monoclinic phase at room temperature. Complex impedance Cole-Cole plots are used to interpret the relaxation mechanism, and grain boundary contributions towards conductivity have been estimated. From electrical modulus formalism polarization and conductivity relaxation behavior in PCT have been discussed. Normalization of the imaginary part of impedance ( Z″) and the normalized imaginary part of modulus ( M″) indicates contributions from both long-range and localized relaxation effects. The grain boundary resistance along with their relaxation frequencies are plotted in the form of an Arrhenius plot with activation energy 0.45 eV and 0.46 eV, respectively. The ac conductivity mechanism has been discussed.

  3. Total AC loss of YBCO coated conductor carrying AC transport current in AC transverse magnetic field with various orientations

    Energy Technology Data Exchange (ETDEWEB)

    Amemiya, Naoyuki [Faculty of Engineering, Yokohama National University, 79-5 Tokiwadai, Hodogaya, Yokohama 240-8501 (Japan); Jiang, Zhenan [Faculty of Engineering, Yokohama National University, 79-5 Tokiwadai, Hodogaya, Yokohama 240-8501 (Japan); Iijima, Yasuhiro [Materials Research Laboratory, Fujikura Ltd, 1-5-1 Kiba, Koto, Tokyo 135-8512 (Japan); Kakimoto, Kazuomi [Materials Research Laboratory, Fujikura Ltd, 1-5-1 Kiba, Koto, Tokyo 135-8512 (Japan); Saitoh, Takashi [Materials Research Laboratory, Fujikura Ltd, 1-5-1 Kiba, Koto, Tokyo 135-8512 (Japan)

    2004-08-01

    Using an electro-magnetic method, we measured the total AC loss of a YBCO coated conductor carrying an AC transport current in an AC transverse magnetic field with various orientations. We measured the magnetization loss (energy flow from the external magnetic field) and the transport loss (energy flow from the transport current circuit) independently during simultaneous application of an AC transverse magnetic field and AC transport current. Their sum gave us the total AC loss. The transport loss increases with increasing AC transverse magnetic field, and the magnetization loss increases with increasing AC transport current. The AC transverse magnetic field and the AC self magnetic field interact with each other at the conductor edges. This nonlinear interaction is a possible cause of the increase in AC loss. Due to the high aspect ratio of YBCO coated conductors, this increase in AC loss due to the interaction between the AC transverse and AC self magnetic fields is observed even when the transverse magnetic field is nearly parallel to the conductor wide-face. When the total AC losses for various transport currents and various field orientations are plotted against a transverse magnetic field component which is perpendicular to the conductor wide-face, the plots with different field angles but identical transport current all agree quite well with each other. The total AC loss is dominated by the self magnetic field and the perpendicular component of the transverse magnetic field, both of which mostly penetrate from the conductor edges.

  4. Impedance spectroscopy studies in cobalt ferrite-reduced graphene oxide nanocomposite

    Energy Technology Data Exchange (ETDEWEB)

    Supriya, Sweety, E-mail: sweety@iitp.ac.in; Kumar, Sunil, E-mail: sunil.pph13@iitp.ac.in; Kar, Manoranjan, E-mail: mano@iitp.ac.in [Department of Physics, Indian Institute of Technology Patna, Bihta-801103 (India)

    2016-05-06

    (1-x)Cobalt ferrite-(x)reduced graphene oxidenanocomposites with x=0, 0.1, 0.2 and 0.3 were prepared by the ultrasonic method. The crystal symmetry modification due to reduced graphene oxide and cobalt ferrite interaction has been studied by employing the X-ray diffraction technique. Morphology of the samples was studied by the Field emission scanning electron microscopy (FE-SEM). Study on electrical properties of the cobalt ferrite-reduced graphene oxide nanocomposites explores the possible application of these composites as anode material. Impedance decreases with an increase in frequency as well as temperature, which supports an increase in ac electrical conductivity. The modified Debye relaxation model can explain the behavior of impedance in cobalt ferrite-reduced graphene oxide nanocomposites.

  5. Three-Level Z-Source Inverters Using a Single LC Impedance Network

    DEFF Research Database (Denmark)

    Loh, Poh Chiang; Lim, Sok Wei; Gao, Feng

    2007-01-01

    two LC impedance networks and two isolated dc sources, which can significantly increase the overall system cost and require a more complex modulator for balancing the network inductive voltage boosting. Offering a number of less costly alternatives, this letter presents the design and control of two...... three-level Z-source inverters, whose output voltage can be stepped down or up using only a single LC impedance network connected between the dc input source and either a neutral-point-clamped (NPC) or dc-link cascaded inverter circuitry. Through careful design of their modulation scheme, both inverters...... can function with the minimum of six device commutations per half carrier cycle (similar to that needed by a traditional buck three-level NPC inverter), while producing the correct volt-sec average and inductive voltage boosting at their ac output terminals. Physically, the designed modulation scheme...

  6. Electrical characterization of zirconium substituted barium titanate using complex impedance spectroscopy

    Indian Academy of Sciences (India)

    Priyanka; A K Jha

    2013-02-01

    This paper reports complex impedance analysis of polycrystalline complex perovskite structured BaZr0.025Ti0.975O3 prepared by solid state reaction method. XRD analysis reveals the formation of single phase perovskite structure. SEM has been used to investigate grain morphology of the material. Impedance plots have been used as a tool to analyse electrical properties of the sample as a function of frequency and temperature. Bulk resistance is observed to decrease with an increase in temperature showing a typical negative temperature coefficient of resistance (NTCR) type behaviour. Nyquist (Cole–Cole) plots show both inter and intra grain boundary effects. Relaxation time is found to decrease with increasing temperature and it obeys the Arrhenius relationship. The variation of d.c. and a.c. conductivity as a function of temperature is also reported.

  7. Impedance spectroscopic analysis of nanoparticle functionalized graphene/p-Si Schottky diode sensors

    Science.gov (United States)

    Uddin, Md Ahsan; Singh, Amol; Daniels, Kevin; Vogt, Thomas; Chandrashekhar, M. V. S.; Koley, Goutam

    2016-11-01

    Metallic nanoparticle (NP) functionalized graphene/p-Si Schottky diode (chemidiode) sensors have been investigated through dc amperometric and ac impedance spectroscopic (IS) measurements. Four fold sensitivity enhancement for NH3 is demonstrated after Pt nanoparticle functionalization of graphene/p-Si Schottky diode sensor, and the response is also orders of magnitude higher compared to functionalized graphene chemiresistor. Experimentally obtained impedance spectra were modeled utilizing an equivalent circuit for both sensor types, and the junction resistance and capacitance were extracted for various gaseous analytes exposure. Variations in junction resistance, capacitance and 3-dB cut-off frequency plotted in three-dimensional (3D) enables extraction of unique signatures for various analyte gases.

  8. Distributed AC power flow method for AC and AC-DC hybrid ...

    African Journals Online (AJOL)

    DR OKE

    Present MGs incorporate AC and DC sources and loads along with storage and power ... Keywords: Microgrid (MG), Distributed Energy Resources (DER), Particle ... But in case of renewable based MGs, where small and intermittent sources ...

  9. Impedance and ferroelectric properties of Sr2+modified PZT-PMN ceramics

    Institute of Scientific and Technical Information of China (English)

    Arvind Kumar; SK Mishra

    2014-01-01

    Sr2+modified polycrystalline PZT-PMN ceramics were synthesized by a semi-wet route. Impedance spectroscopy studies indicate the bulk and grain boundary effects of PZT-PMN material along with the negative temperature coefficient of resistance. The bulk conductiv-ity exhibits an Arrhenius-type thermally activated hopping process which is supported by the AC conductivity behavior as a function of fre-quency and temperature. It is observed that the remnant polarization increases with an increase in the Sr2+content in PZT-PMN.

  10. Study of lithium glassy solid electrolyte/electrode interface by impedance analysis

    Indian Academy of Sciences (India)

    A Karthikeyan; P Vinatier; A Levasseur

    2000-06-01

    Cells of lithium ion conducting glassy electrolyte Li2SO4–Li2O–B2O3 with different combinations of electrodes (stainless steel blocking electrode, lithium non-blocking electrode and TiS2 electrode) have been prepared. The a.c. impedance measurements of the cells have been studied at elevated temperature as a function of time. The circuit elements such as bulk resistance, double layer capacitance and charge transfer resistance have been inferred and their time dependence studied. The results show that the electrolyte and the interface are chemically very stable with the different types of electrodes studied here.

  11. A study of the electrochemical processes in lithium-sulphur cells by impedance spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Kolosnitsyn, V.S.; Kuzmina, E.V.; Karaseva, E.V.; Mochalov, S.E. [Institution of the Russian Academy of Sciences Institute of Organic Chemistry of Ufa Scientific Center of the Russian Academy of Sciences, Laboratory of Electrochemistry, 71, pr. Oktyabrya, Ufa, Bashkortostan, 450054 (Russian Federation)

    2011-02-01

    The changes in the properties of lithium-sulphur cell components (electrolyte, sulphur and lithium electrodes) during cycling are studied by AC impedance spectroscopy. It is shown that during the charge and discharge of lithium-sulphur cells the conductivity of the electrolyte is changed. We believe that the observed changes in the electrolyte conductivity can be explained by the formation of soluble lithium polysulphides by electrochemical reactions. The properties of the electrolyte significantly influence the rate of the electrochemical processes which occur both on the sulphur and lithium electrodes in lithium-sulphur cells. (author)

  12. Development of a method to estimate the lifespan of proton exchange membrane fuel cell using electrochemical impedance spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Ju-hyung; Lee, Jong-Hak; Choi, Woojin [Department of Electrical Engineering, Soongsil University, 1-1 Sangdo-dong, Dongjak-gu, Seoul 156-743 (Korea); Park, Kyung-Won [Department of Chemical/Environmental Engineering, Soongsil University, 1-1 Sangdo-dong, Dongjak-gu, Seoul 156-743 (Korea); Sun, Hee-Young [Samsung Advanced Institute of Technology, Mt. 14-1, Nongseo-dong, Giheung-gu, Yongin-si, Gyeonggi-do 446-712 (Korea); Oh, Jae-Hyuk [Samsung Electronics, 416 Maetan-dong, Youngtong-gu, Suwon-si, Gyeonggi-do 443-370 (Korea)

    2010-09-15

    This paper proposes a new method for estimating the state and lifespan of fuel cells in operation by fuel cell equivalent impedance modeling by electrochemical impedance spectroscopy (EIS) and observing degradation. The performance change of fuel cells takes place in the form of changes in each parameter value comprising an equivalent AC impedance circuit; monitoring such changes allows for the prediction of the state and lifespan of a fuel cell. In the experiments, the AC impedance of high-temperature proton exchange membrane (PEM) fuel cells was measured at constant time intervals during their continuous operation for over 2200 h. The expression for the lifespan of a fuel cell was deduced by curve fitting the changes in each parameter to a polynomial. Electric double layer capacitance and charge transfer resistance, which show the reduction reaction of the cathode, were used as major parameters for judging the degradation; a method of using time constants is proposed to more accurately estimate the degree of degradation. In addition, an algorithm that can evaluate the soundness and lifespan of a fuel cell is proposed; it compares the measured time constant of the fuel cell being tested with that of average lifespan fuel cell. (author)

  13. Dielectric, ferroelectrics properties and impedance spectroscopy analysis of the [(Na0.535K0.480)0.966Li0.058](Nb0.90Ta0.10)O3-based lead-free ceramics

    Science.gov (United States)

    Saidi, M.; Chaouchi, A.; D'Astorg, S.; Rguiti, M.; Courtois, C.

    2015-04-01

    Polycrystalline of [(Na0.535K0.480)0.966Li0.058](Nb0.90Ta0.10)O3 samples were prepared using the high-temperature solid-state reaction technique. X-ray diffraction (XRD) analysis indicates the formation of a single-phase with orthorhombic structure. AC impedance plots were used as tool to analyze the electrical behavior of the sample as a function of frequency at different temperatures. The AC impedance studies revealed the presence of grain effect, from 425°C onwards. Complex impedance analysis indicated non-Debye type dielectric relaxation. The Nyquist plot showed the negative temperature coefficient of resistance (NTCR) characteristic of NKLNT. The AC conductivity results were used to correlate with the barrier hopping (CBH) model to evaluate the binding energy (Wm), the minimum hopping distance (Rmin), the density of states at Fermi level (N(Ef)), and the activation energy of the compound.

  14. Electromagnetic Wave Scattering By the Coated Impedance Cylinder

    Directory of Open Access Journals (Sweden)

    V.I. Vyunnik

    2010-01-01

    Full Text Available In this work the boundary conditions for the impedance circular cylinder coated by a low contrast dielectric thin layer are derived. Expression for the reduced impedance of the cylinder is obtained. Conditions and applicability limits of the proposed approach are defined. Influence of the coating impedance on the reduced impedance of the cylinder is investigated.

  15. VISUALIZATION OF BIOLOGICAL TISSUE IMPEDANCE PARAMETERS

    Directory of Open Access Journals (Sweden)

    V. I. Bankov

    2016-01-01

    Full Text Available Objective. Investigation the opportunity for measurement of biological tissue impedance to visualize its parameters.Materials and methods. Studies were undertook on the experimental facility, consists of registrating measuring cell, constructed from flat inductors system, formed in oscillatory circuit, herewith investigated biological tissue is the part of this oscillatory circuit. An excitation of oscillatory circuit fulfilled by means of exciter inductor which forms impulse complex modulated electromagnetic field (ICM EMF. The measurement process and visualizations provided by set of certificated instruments: a digital oscillograph AKTAKOM ADS-2221MV, a digital generator АКТАКОМ AWG-4150 (both with software and a gauge RLC E7-22. Comparative dynamic studies of fixed volume and weight pig’s blood, adipose tissue, muscular tissue impedance were conducted by contact versus contactless methods. Contactless method in contrast to contact method gives opportunity to obtain the real morphological visualization of biological tissue irrespective of their nature.Results. Comparison of contact and contactless methods of impedance measurement shows that the inductance to capacitance ratio X(L / X(C was equal: 17 – for muscular tissue, 4 – for blood, 1 – for adipose tissue. It demonstrates the technical correspondence of both impedance registration methods. If propose the base relevance of X (L and X (C parameters for biological tissue impedance so contactless measurement method for sure shows insulating properties of adipose tissue and high conductivity for blood and muscular tissue in fixed volume-weight parameters. Registration of biological tissue impedance complex parameters by contactless method with the help of induced ICM EMF in fixed volume of biological tissue uncovers the most important informative volumes to characterize morphofunctional condition of biological tissue namely X (L / X (C.Conclusion. Contactless method of biological

  16. Analysis on electromagnetic scattering by a wedge with impedance faces under exact impedance boundary

    Institute of Scientific and Technical Information of China (English)

    吴良超; 汪茂光

    1995-01-01

    Under the exact impedance boundary condition (EIBC), by using wave equations and the longitudinal field method, the electromagnetic scattenng by an impedance wedge has been analysed in detail, following the Maliuzhinets approach, and the uniform diffraction coefficient of the diffracted field has been presented.

  17. On the impedance of galvanic cells XIX. The potential dependence of the faradaic impedance in the case of an irreversible electrode reaction; experimental verification for the redox couple Eu3+/Eu2+ In 1 M NaClO4 and The mechanism of the Zn2+/Zn(Hg) reaction in KCl

    NARCIS (Netherlands)

    Timmer, B.; Sluyters-Rehbach, M.; Sluyters, J.H.

    1967-01-01

    An experimental verification of the theory for the potential dependence of the faradaic impedance in the case of irreversible electrode reactions, described in part XVIII, is presented for the Eu3+/Eu2+ couple in 1 M NaClO4 at a D.M.E. It is shown that two peaks occur in an a.c. polarogram, if both

  18. Resonant impedance matchers for Mario Schenberg detector

    Energy Technology Data Exchange (ETDEWEB)

    Frajuca, Carlos; Bortoli, Fabio S. [Centro Federal de Educacao Tecnologica de Sao Paulo, SP (Brazil)

    2006-07-01

    'Mario Schenberg' is a spherical resonant-mass gravitational wave (GW) detector that will be part of a GW detection array of two detectors, the other one is been built in The Netherlands. Their resonant frequencies will be around 3.2 kHz with a bandwidth of about 200 Hz. This range of frequencies is new in a field where the typical frequencies lay below 1 kHz, making the transducer development much more complex. Some studies indicated that using low mass mechanical resonators (used for impedance matching to the parametric transducer, in a cold damping regime), allow the detector to reach the standard quantum limit. In this work we describe the study of mechanical impedance matcher resonators used to obtain a better coupling between the sphere and the transducers and keeping the same calibration for all transducers, this has been show to be not a easy task since the differential motions of the sphere surface propagates to the motions of the resonant mechanical impedance matchers, when it can be done then the next step is to calculate the effective mass of the resonating mechanical impedance matcher and then, calculate the detector sensitivity, this is also complicated because there is a spread in the resonant mechanical impedance matcher frequencies. (author)

  19. Resonant impedance of bellows above cutoff

    Energy Technology Data Exchange (ETDEWEB)

    Krinsky, S

    1980-01-01

    The perturbation method of Chatard-Moulin and Papiernik is used to calculate the longitudinal and transverse impedances, Z(..omega..) and Z/sub perpendicular/(..omega..), of a bellows. The bellows shape is defined by its radius a(z) = a (1 + epsilons(z)), where a is the mean radius, epsilon a small parameter, and s(z) describes the convolution of the bellows. A finite wall conductivity is considered and the resonant contribution to the impedance above the cutoff frequency of the unperturbed chamber is determined, obtaining analytic approximations to the resonant frequencies, quality factors, and shunt impedances. The relation Z/sub perpendicular/(..omega..) = (2c/a/sup 2/)Z(..omega..)/..omega.., of course, does not hold as an identity, but it is found to be a useful relation for the shunt impedances, holding exactly for one family of transverse modes and providing an upper bound on the shunt impedances of the second set of transverse modes.

  20. Structural characterization and impedance studies of PbO nanofibers synthesized by electrospinning technique

    Energy Technology Data Exchange (ETDEWEB)

    Hari Prasad, Kamatam [Department of Physics, Pondicherry University, Puducherry, 605 014 (India); Vinoth, S. [Department of Physics, Pondicherry University, Puducherry, 605 014 (India); Centre for Nanoscience, Pondicherry University, Puducherry, 605014 (India); Jena, Paramananda [Department of Physics, Pondicherry University, Puducherry, 605 014 (India); School of Materials Science and Technology, Indian Institute of Technology(BHU), Varanasi, 221 005 (India); Venkateswarlu, M. [R & D, Amara Raja Batteries Ltd, Karakambadi, 517 520, A.P (India); Satyanarayana, N., E-mail: nallanis2011@gmail.com [Department of Physics, Pondicherry University, Puducherry, 605 014 (India)

    2017-06-15

    One-dimensional electrospun lead oxide nanofibers synthesized by a simple electrospinning technique. The prepared lead oxide nanofibers investigated by using TG/DTA, FTIR, Raman, X-ray diffraction (XRD), Brunauer–Emmett–Teller (BET) surface area analyzer, scanning electron microscopy–energy dispersive X-ray spectroscopy (SEM-EDX), atomic force microscopy (AFM), Transmission electron microscopy (TEM), and impedance spectroscopy techniques. TG/DTA results confirmed the thermal behavior of the as-spun nanofibers. XRD, FTIR, and Raman spectra results, respectively, confirm the formation of pure orthorhombic crystalline phase and structural coordination of the lead oxide (β-PbO) nanofibers. The BET specific surface area of β-PbO nanofibers sample is found to be 51.23 m{sup 2} g{sup -1}. SEM and AFM micrographs showed the formation of β-PbO nanofibers with a diameter of 85–300 nm. The impedance measurements of lead oxide nanofibers as a function of temperature, 25–150 °C, was evaluated by analyzing the measured impedance data using the winfit software. The electrical conductivity of the lead oxide (β-PbO) nanofibers evaluated by analyzing the measured impedance data using the winfit software is found to be 5.68 × 10{sup -6} S cm{sup -1} at 150 °C. Also, an activation energy (E{sub a}) for the migration of the charge carrier evaluated from the temperature dependence of conductivity plot is found to be 0.27 eV. The temperature dependence AC conductivity of β-PbO nanofibers was evaluated using the measured impedance data and sample dimension. The observed variation of high-frequency AC conductivity attributed to the hopping electrons between the adjacent sites. - Highlights: • First time, β-PbO nanofibers were successfully prepared by electrospinning technique. • Structural, morphological, roughness and electrical properties are studied. • TG/DTA, XRD, FTIR, Raman, SEM/AFM, TEM-EDX, and impedance measurements were made.

  1. Measurement of changes in impedance of DNA nanowires due to radiation induced structural damage. A novel approach for a DNA-based radiosensitive device

    Science.gov (United States)

    Heimbach, Florian; Arndt, Alexander; Nettelbeck, Heidi; Langner, Frank; Giesen, Ulrich; Rabus, Hans; Sellner, Stefan; Toppari, Jussi; Shen, Boxuan; Baek, Woon Yong

    2017-08-01

    The ability of DNA to conduct electric current has been the topic of numerous investigations over the past few decades. Those investigations indicate that this ability is dependent on the molecular structure of the DNA. Radiation-induced damages, which lead to an alteration of the molecular structure, should therefore change the electrical impedance of a DNA molecule. In this paper, the damage due to ionising radiation is shown to have a direct effect on the electrical transport properties of DNA. Impedance measurements of DNA samples were carried out by an AC impedance spectrometer before, during and after irradiation. The samples comprised of DNA segments, which were immobilized between gold electrodes with a gap of 12 μm. The impedance of all DNA samples exhibited rising capacitive behaviour with increasing absorbed dose.

  2. Plasma Diagnostics by Antenna Impedance Measurements

    Science.gov (United States)

    Swenson, C. M.; Baker, K. D.; Pound, E.; Jensen, M. D.

    1993-01-01

    The impedance of an electrically short antenna immersed in a plasma provides an excellent in situ diagnostic tool for electron density and other plasma parameters. By electrically short we mean that the wavelength of the free-space electromagnetic wave that would be excited at the driving frequency is much longer than the physical size of the antenna. Probes using this impedance technique have had a long history with sounding rockets and satellites, stretching back to the early 1960s. This active technique could provide information on composition and temperature of plasmas for comet or planetary missions. Advantages of the impedance probe technique are discussed and two classes of instruments built and flown by SDL-USU for determining electron density (the capacitance and plasma frequency probes) are described.

  3. Impedance properties of circular microstrip antenna

    Science.gov (United States)

    Deshpande, M. D.; Bailey, M. C.

    1983-01-01

    A moment method solution to the input impedance of a circular microstrip antenna excited by either a microstrip feed or a coaxial probe is presented. Using the exact dyadic Green's function and the Fourier transform the problem is formulated in terms of Richmond's reaction integral equation from which the unknown patch current can be solved for. The patch current is expanded in terms of regular surface patch modes and an attachment mode (for probe excited case) which insures continuity of the current at probe/patch junction, proper polarization and p-dependance of patch current in the vicinity of the probe. The input impedance of a circular microstrip antenna is computed and compared with earlier results. Effect of attachment mode on the input impedance is also discussed.

  4. Impedance plethysmographic observations in thoracic outlet syndrome.

    Directory of Open Access Journals (Sweden)

    Nerurkar S

    1990-07-01

    Full Text Available Forty patients with symptoms of neuro-vascular compression in the upper extremities were subjected to impedance plethysmographic study using Parulkar′s method. Two patients recorded decreased blood flow (BFI in supine position and were diagnosed as having partial occlusion at subclavian level. Sixteen of the patients recorded decreased BFI on 90 degrees abduction and hyper-abduction. Twelve of these patients had radiological evidence of anomalous cervicle ribs. In remaining four patients extrinsic impression on the subclavian artery due to fibrous deposits was confirmed by arteriography. Remaining 22 patients recorded normal impedance plethysmograms. Impedance plethysmography thus provided a non-invasive modality for confirmation of vascular compression in thoracic outlet syndrome.

  5. Bench Measurements of Low Frequency Transverse Impedance

    CERN Document Server

    Caspers, Friedhelm; Mostacci, A

    2003-01-01

    For frequencies below 10 MHz the classical two wire transmission line method is subject to difficulties in sensitivity and measurement uncertainties. Thus for evaluation of the low frequency transverse impedance properties of the LHC dump kicker a modified version of the two wire transmission line has been used. It consists, in the present case, of a 10 turn loop of approximately 1 meter length and 2 cm width. The change of input impedance of the loop is measured as a function of the surroundings and by using a proper reference (metallic beampipe) these changes are converted into a meaningful transverse beam coupling impedance. Measurements of several calibration objects have shown close agreement with theoretical results.

  6. Wavelet analysis of the impedance cardiogram waveforms

    Science.gov (United States)

    Podtaev, S.; Stepanov, R.; Dumler, A.; Chugainov, S.; Tziberkin, K.

    2012-12-01

    Impedance cardiography has been used for diagnosing atrial and ventricular dysfunctions, valve disorders, aortic stenosis, and vascular diseases. Almost all the applications of impedance cardiography require determination of some of the characteristic points of the ICG waveform. The ICG waveform has a set of characteristic points known as A, B, E ((dZ/dt)max) X, Y, O and Z. These points are related to distinct physiological events in the cardiac cycle. Objective of this work is an approbation of a new method of processing and interpretation of the impedance cardiogram waveforms using wavelet analysis. A method of computer thoracic tetrapolar polyrheocardiography is used for hemodynamic registrations. Use of original wavelet differentiation algorithm allows combining filtration and calculation of the derivatives of rheocardiogram. The proposed approach can be used in clinical practice for early diagnostics of cardiovascular system remodelling in the course of different pathologies.

  7. Complex impedance studies of lithium iodine batteries

    Energy Technology Data Exchange (ETDEWEB)

    Schmidt, C.L.; Skarstad, P.M. (Promeon Division Medtronic, Inc. Minneapolis, MN (US))

    1990-08-01

    Complex impedance spectra of conductivity cells containing iodine/poly-2-vinylpyridine cathode material were taken by two- and four-probe techniques. The impedance spectra contain a current-independent bulk resistance in series with a current-dependent interfacial resistance. The current-dependent interfacial resistance has the characteristics expected of a charge-transfer resistance. Moreover, electronically blocked (lithium/lithium iodide) electrodes give the same result as non-blocked (stainless steel) electrodes. This is exactly what would be expected if the medium were an ionic conductor. Complex impedance spectra of lithium/iodine batteries show additional structure, as might be expected, but are consistent with results from the conductivity cells.

  8. AC conductivity and dielectric properties of bulk tungsten trioxide (WO{sub 3})

    Energy Technology Data Exchange (ETDEWEB)

    El-Nahass, M.M. [Department of Physics, Faculty of Education, Ain Shams University, Roxy 11757, Cairo (Egypt); Ali, H.A.M., E-mail: hend2061@yahoo.com [Department of Physics, Faculty of Education, Ain Shams University, Roxy 11757, Cairo (Egypt); Saadeldin, M.; Zaghllol, M. [Physics Department, Faculty of Science, Cairo University, Giza 12613 (Egypt)

    2012-11-15

    AC conductivity and dielectric properties of tungsten trioxide (WO{sub 3}) in a pellet form were studied in the frequency range from 42 Hz to 5 MHz with a variation of temperature in the range from 303 K to 463 K. AC conductivity, {sigma}{sub ac}({omega}) was found to be a function of {omega}{sup s} where {omega} is the angular frequency and s is the frequency exponent. The values of s were found to be less than unity and decrease with increasing temperature, which supports the correlated barrier hopping mechanism (CBH) as the dominant mechanism for the conduction in WO{sub 3}. The dielectric constant ({epsilon} Prime ) and dielectric loss ({epsilon} Double-Prime ) were measured. The Cole-Cole diagram determined complex impedance for different temperatures.

  9. Hopping models and ac universality

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2002-01-01

    Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed.......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA...

  10. Compact rat-race ring coupler with meander high-impedance transmission line and port impedance matching

    Directory of Open Access Journals (Sweden)

    Jun He

    2015-08-01

    Full Text Available A novel compact rat-race ring coupler with meander high-impedance transmission line and port impedance matching is presented in this Letter. First, a ring coupler with high port impedance is designed using meander lines. Secondly, an impedance matching section is designed to match the high port impedance to ordinary 50 Ω. The proposed coupler effectively reduces occupied area to 16.8% of conventional one. The design is validated both by simulation and measurement.

  11. Pumping slots: Coupling impedance calculations and estimates

    Energy Technology Data Exchange (ETDEWEB)

    Kurennoy, S.

    1993-08-01

    Coupling impedances of small pumping holes in vacuum-chamber walls have been calculated at low frequencies, i.e., for wavelengths large compared to a typical hole size, in terms of electric and magnetic polarizabilities of the hole. The polarizabilities can be found by solving and electro- or magnetostatic problem and are known analytically for the case of the elliptic shape of the hole in a thin wall. The present paper studies the case of pumping slots. Using results of numerical calculations and analytical approximations of polarizabilities, we give formulae for practically important estimates of slot contribution to low-frequency coupling impedances.

  12. On coupling impedances of pumping holes

    Energy Technology Data Exchange (ETDEWEB)

    Kurennoy, S.

    1993-04-01

    Coupling impedances of a single small hole in vacuum-chamber walls have been calculated at low frequencies. To generalize these results for higher frequencies and/or larger holes one needs to solve coupled integral equations for the effective currents. These equations are solved for two specific hole shapes. The effects of many holes at high frequencies where the impedances are not additive are studied using a perturbation-theory method. The periodic versus random distributions of the pumping holes in the Superconducting Super Collider liner are compared.

  13. Protein Aggregation Measurement through Electrical Impedance Spectroscopy

    Science.gov (United States)

    Affanni, A.; Corazza, A.; Esposito, G.; Fogolari, F.; Polano, M.

    2013-09-01

    The paper presents a novel methodology to measure the fibril formation in protein solutions. We designed a bench consisting of a sensor having interdigitated electrodes, a PDMS hermetic reservoir and an impedance meter automatically driven by calculator. The impedance data are interpolated with a lumped elements model and their change over time can provide information on the aggregation process. Encouraging results have been obtained by testing the methodology on K-casein, a protein of milk, with and without the addition of a drug inhibiting the aggregation. The amount of sample needed to perform this measurement is by far lower than the amount needed by fluorescence analysis.

  14. Electrochemical Impedance Spectroscopy Of Metal Alloys

    Science.gov (United States)

    Macdowell, L. G.; Calle, L. M.

    1993-01-01

    Report describes use of electrochemical impedance spectroscopy (EIS) to investigate resistances of 19 alloys to corrosion under conditions similar to those of corrosive, chloride-laden seaside environment of Space Transportation System launch site. Alloys investigated: Hastelloy C-4, C-22, C-276, and B-2; Inconel(R) 600, 625, and 825; Inco(R) G-3; Monel 400; Zirconium 702; Stainless Steel 304L, 304LN, 316L, 317L, and 904L; 20Cb-3; 7Mo+N; ES2205; and Ferralium 255. Results suggest electrochemical impedance spectroscopy used to predict corrosion performances of metal alloys.

  15. Impedance-matched cavity quantum memory

    CERN Document Server

    Afzelius, Mikael

    2010-01-01

    We consider an atomic frequency comb based quantum memory inside an asymmetric optical cavity. In this configuration it is possible to absorb the input light completely in a system with an effective optical depth of one, provided that the absorption per cavity round trip exactly matches the transmission of the coupling mirror ("impedance matching"). We show that the impedance matching results in a readout efficiency only limited by irreversible atomic dephasing, whose effect can be made very small in systems with large inhomogeneous broadening. Our proposal opens up an attractive route towards quantum memories with close to unit efficiency.

  16. Estimating the short-circuit impedance

    DEFF Research Database (Denmark)

    Nielsen, Arne Hejde; Pedersen, Knud Ole Helgesen; Poulsen, Niels Kjølstad

    1997-01-01

    and current are derived each period, and the short-circuit impedance is estimated from variations in these components created by load changes in the grid. Due to the noisy and dynamic grid with high harmonic distortion it is necessary to threat the calculated values statistical. This is done recursively...... through a RLS-algorithm. The algorithms have been tested and implemented on a PC at a 132 kV substation supplying a rolling mill. Knowing the short-circuit impedance gives the rolling mill an opportunity to adjust the arc furnace operation to keep flicker below a certain level. Therefore, the PC performs...

  17. Impedance and modulus spectroscopic study of nano hydroxyapatite

    Science.gov (United States)

    Jogiya, B. V.; Jethava, H. O.; Tank, K. P.; Raviya, V. R.; Joshi, M. J.

    2016-05-01

    Hydroxyapatite (Ca10 (PO4)6 (OH)2, HAP) is the main inorganic component of the hard tissues in bones and also important material for orthopedic and dental implant applications. Nano HAP is of great interest due to its various bio-medical applications. In the present work the nano HAP was synthesized by using surfactant mediated approach. Structure and morphology of the synthesized nano HAP was examined by the Powder XRD and TEM. Impedance study was carried out on pelletized sample in a frequency range of 100Hz to 20MHz at room temperature. The variation of dielectric constant, dielectric loss, and a.c. conductivity with frequency of applied field was studied. The Nyquist plot as well as modulus plot was drawn. The Nyquist plot showed two semicircle arcs, which indicated the presence of grain and grain boundary effect in the sample. The typical behavior of the Nyquist plot was represented by equivalent circuit having two parallel RC combinations in series.

  18. Graph-Analytical Method of Determining Impedance in Electrical Transformers

    Directory of Open Access Journals (Sweden)

    Zorica Bogicevic

    2015-01-01

    Full Text Available This paper presents a graph-analytical method for determining the electrical impedance of alternate energy sources, especially small power transformers and current transformers in electric networks. Unlike conventional short-circuit and idle tests, according to proposed method, in this paper, transformer parameters are determined in a new way, which is based on measurement of voltages and currents on the active and reactive load (inductive or capacitive. The effectiveness of the proposed model was verified using an adapted simulation in the software package MATLAB Simulink. The simulation was performed for three types of ABB transformers with a 100% load. Simulation results were obtained for power transformers: Sn1=1 [MVA], Sn2=2 [MVA], Sn3=3.15 [MVA]. If we compare measurement result values of RT, XT, which are contained in a brochure for ABB transformers and those obtained through simulation, different tolerances are obtained. For reactance results, deviations are up to 20% for all three tested transformers. For results of active resistance tolerances are up to 5% for all three tested transformers. This method can be used not only to determine the active and inductive AC power source parameters but also to determine and analyze the impendence of electrical sources with high frequencies.

  19. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Directory of Open Access Journals (Sweden)

    Rakan Kh Antar

    2013-05-01

    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  20. AC410 Unit 9 Assignment

    OpenAIRE

    Laynebaril1

    2017-01-01

     AC410 Unit 9 Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-9-assignment/   18–29. The CPA firm of Carson & Boggs LLP is performing an internal control audit in accordance with PCAOB Standard No. 5. The partner in charge of the engagement has asked you to explain the process of determining which controls to test. Describe the process, presenting each of the links in this process and a short summary of how the auditors approach each of them. v ...

  1. Electrothermal ac electro-osmosis

    Science.gov (United States)

    Gagnon, Zachary R.; Chang, Hsueh-Chia

    2009-01-01

    Two ac polarization mechanisms, charge accumulation due to electrode double layer charging and bulk permittivity/conductivity gradients generated by Joule heating, are combined in the double layer by introducing zwitterions to produce a new ac electrokinetic pump with the largest velocity (>1 mm/s) and flow penetration depth (100 μm) reported for low-conductivity fluids. The large fluid velocity is due to a quartic scaling with respect to voltage, as is true of electrothermal flow, but exhibits a clear maximum at a frequency corresponding to the electrode double layer inverse RC time.

  2. Nuclear structure of $^{231}$Ac

    CERN Document Server

    Boutami, R; Mach, H; Kurcewicz, W; Fraile, L M; Gulda, K; Aas, A J; García-Raffi, L M; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O

    2008-01-01

    The low-energy structure of 231Ac has been investigated by means of gamma ray spectroscopy following the beta-decay of 231Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a mini-orange electron spectrometer. The decay scheme of 231Ra --> 231Ac has been constructed for the first time. The Advanced Time Delayed beta-gamma-gamma(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  3. AcEST: DK963222 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sp|P81919|OR46A_DROME Odorant receptor 46a, isoform A OS=Drosoph... 32 2.8 sp|Q5MJ68|SPDYC_HUMAN Speed...FCFKA 181 CS +T + AV S L + +YV + AC Q FI C+ A Sbjct: 262 CSVLVLTANFYAIAVLSDERLELFKYVTYQACMLIQIFILCYYA 305 >sp|Q5MJ68|SPDYC_HUMAN Spee

  4. AcEST: DK953266 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 34 0.49 sp|A5VSF3|ACSA_BRUO2 Acetyl-coenzyme A synthetase OS=Brucella ov... 34 0.49 sp|Q8YJ48|ACSA_BRUME Ac... K++ + NK L+ R G WG GR++ Sbjct: 180 FVITADEGVRGGKPVALKENTDTAIDIAAKQYVMVNKVLVVRRTGGKVSWGRGRDL 235 >sp|A5VSF3|ACSA_BRUO2

  5. AcEST: BP918420 [AcEST

    Lifescience Database Archive (English)

    Full Text Available D 180 >sp|A8AC98|APGM_IGNH4 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ignicoccus hosp...italis (strain KIN4/I / DSM 18386 / JCM 14125) GN=apgM PE=3 SV=1 Length = 416 Score

  6. AcEST: BP921446 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 34 2e-30 tr|A4VIU1|A4VIU1_PSEU5 Putative uncharacterized protein OS=Pseud... 129 1e-28 tr|Q11HF6|Q11HF6_MESSB...EHTHLMLDSKAGWVEPHIQAGDRCFAEYPDESLAQWHERLGL 159 >tr|Q11HF6|Q11HF6_MESSB Glutathione-dependent formaldehyde-ac

  7. AcEST: BP917259 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Q96AC6|KIFC2_HUMAN Kinesin-like protein KIFC2 OS=Homo sapiens... 30 9.0 sp|O88737|BSN_MOUSE Protein bassoon ... WGQPG AAGS + PG Sbjct: 748 SSSPTEWVKWSWGQPG-------AAGSRAPPG 772 >sp|O88737|BSN_MOUSE Protein bassoon

  8. AcEST: DK947455 [AcEST

    Lifescience Database Archive (English)

    Full Text Available tative uncharacterized protein OS=Picea... 246 9e-64 tr|A8QIH7|A8QIH7_MORAL Chlor...DPTARSDNGSCEYEFKE 479 >tr|A8QIH7|A8QIH7_MORAL Chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase ac

  9. AcEST: DK943932 [AcEST

    Lifescience Database Archive (English)

    Full Text Available rella paten... 145 2e-33 tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-bisphosphatase ...EAL++SHVCK+AC Sbjct: 67 ATACVNTFGDEQLAVDMLADKLLFEALRHSHVCKYAC 103 >tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-

  10. AcEST: DK961189 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=A... 127 7e-29 sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS... 125 2e-28 sp|P00785|AC...IRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYP 347 >sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=

  11. Thorax mapping for localised lung impedance change using focused impedance measurement (FIM: A pilot study

    Directory of Open Access Journals (Sweden)

    Humayra Ferdous

    2013-12-01

    Full Text Available Focused Impedance Measurement (FIM is a technique where impedance can be measured with the optimum level of localization without much increase in complexity of measuring instrument. The electrodes are applied on the skin surface but the organs inside also contributes to the measurement, as the body is a volume conductor. In a healthy and disease free lung region, the air enters at breathe-in increases the impedance of the lung and impedance reduces during breathe-out. In contrast, for a diseased lung, where part of the lungs is filled with water or some fluid, air will not enter into this zone reducing impedance change between inspiration and expiration. With this idea, the current work had been executed to have general view of localised impedance change throughout thorax using 6-electrode FIM. This generated a matrix mapping from both the front and from the back of the thorax, which  afterwards provided that how impedance change due to ventilation varies from frontal plane to back plane of human bodies.

  12. Locating Impedance Change in Electrical Impedance Tomography Based on Multilevel BP Neural Network

    Institute of Scientific and Technical Information of China (English)

    彭源; 莫玉龙

    2003-01-01

    Electrical impedance tomography (EIT) is a new computer tomography technology, which reconstructs an impedance (resistivity, conductivity) distribution, or change of impedance, by making voltage and current measurements on the object's periphery.Image reconstruction in EIT is an ill-posed, non-linear inverse problem. A method for finding the place of impedance change in EIT is proposed in this paper, in which a multilevel BP neural network (MBPNN) is used to express the non-linear relation between theimpedance change inside the object and the voltage change measured on the surface of the object. Thus, the location of the impedance change can be decided by the measured voltage variation on the surface. The impedance change is then reconstructed using a linear approximate method. MBPNN can decide the impedance change location exactly without long training time. It alleviates some noise effects and can be expanded, ensuring high precision and space resolution of the reconstructed image that are not possible by using the back projection method.

  13. Electrical Impedance Tomography Technology (EITT) Project

    Science.gov (United States)

    Oliva-Buisson, Yvette J.

    2014-01-01

    Development of a portable, lightweight device providing two-dimensional tomographic imaging of the human body using impedance mapping. This technology can be developed to evaluate health risks and provide appropriate medical care on the ISS, during space travel and on the ground.

  14. Estimating the short-circuit impedance

    DEFF Research Database (Denmark)

    Nielsen, Arne Hejde; Pedersen, Knud Ole Helgesen; Poulsen, Niels Kjølstad

    1997-01-01

    through a RLS-algorithm. The algorithms have been tested and implemented on a PC at a 132 kV substation supplying a rolling mill. Knowing the short-circuit impedance gives the rolling mill an opportunity to adjust the arc furnace operation to keep flicker below a certain level. Therefore, the PC performs...

  15. Measuring mechanical impedance in clayey gravelly soils

    Directory of Open Access Journals (Sweden)

    R. Stolf

    1998-06-01

    Full Text Available Mechanical impedance of clayey and gravelly soils is often needed to interpret experimental results from tillage and other field experiments. Its measurement is difficult with manual and hydraulic penetrometers, which often bend or break in such soils. The purpose of this study was to evaluate the feasibility of a hand-operated "Stolf" impact penetrometer to measure mechanical impedance (soil resistance. The research was conducted in Raleigh, North Carolina, USA (35º 45'N, 78º 42'W, elevation 75 m. Corn was planted on April 19, 1991. Penetrometer measurements were taken on May 10, 1991, in 5 cm intervals to 60 cm at 33 locations on a transect perpendicular to the corn rows in each of four tillage treatments. The data permitted three-dimensional displays showing how mechanical impedance changed with depth and distance along the transect. The impact penetrometer proved to be a useful tool to collect quantitative mechanical impedance data on "hard" clayey and/or gravelly soils which previously were difficult to reliably quantify.

  16. High Impedance Comparator for Monitoring Water Resistivity.

    Science.gov (United States)

    Holewinski, Paul K.

    1984-01-01

    A high-impedance comparator suitable for monitoring the resistivity of a deionized or distilled water line supplying water in the 50 Kohm/cm-2 Mohm/cm range is described. Includes information on required circuits (with diagrams), sensor probe assembly, and calibration techniques. (JN)

  17. Quadratic Boost A-Source Impedance Network

    DEFF Research Database (Denmark)

    Siwakoti, Yam Prasad; Blaabjerg, Frede; Chub, Andrii

    2016-01-01

    A novel quadratic boost type A-source impedance network is proposed in this paper for realizing converters that demand a very high voltage gain. To achieve that, the proposed network uses an auto-transformer, whose obtained gain is quadratically dependent on the duty ratio and is presently not ma...

  18. Electrical Impedance Tomography of Breast Cancer

    Science.gov (United States)

    2005-06-01

    Impedance Scanning; OPAMP , Operational Amplifier; SVD, Singular Value Decomposition; NEX, Number of Excitations; CE-MRI, Contrast Enhanced MRI. 599 600...the Poisson’s built using three LM741 OPAMP circuits to convert the volt- equation with Neumann boundary value conditions. This age from the signal

  19. Impedance-matched drilling telemetry system

    Science.gov (United States)

    Normann, Randy A.; Mansure, Arthur J.

    2008-04-22

    A downhole telemetry system that uses inductance or capacitance as a mode through which signal is communicated across joints between assembled lengths of pipe wherein efficiency of signal propagation through a drill string, for example, over multiple successive pipe segments is enhanced through matching impedances associated with the various telemetry system components.

  20. Electrical impedance spectroscopy and diagnosis of tendinitis.

    Science.gov (United States)

    Yoon, Kisung; Lee, Kyeong Woo; Kim, Sang Beom; Han, Tai Ryoon; Jung, Dong Keun; Roh, Mee Sook; Lee, Jong Hwa

    2010-02-01

    There have been a number of studies that investigate the usefulness of bioelectric signals in diagnoses and treatment in the medical field. Tendinitis is a musculoskeletal disorder with a very high rate of occurrence. This study attempts to examine whether electrical impedance spectroscopy (EIS) can detect pathological changes in a tendon and find the exact location of the lesion. Experimental tendinitis was induced by injecting collagenase into one side of the patellar tendons in rabbits, while the other side was used as the control. After measuring the impedance in the tendinitis and intact tendon tissue, the dissipation factor was computed. The real component of impedance and the dissipation factor turned out to be lower in tendinitis than in intact tissues. Moreover, the tendinitis dissipation factor spectrum showed a clear difference from that of the intact tendon, indicating its usefulness as a tool for detecting the location of the lesion. Pathologic findings from the tissues that were obtained after measuring the impedance confirmed the presence of characteristics of tendinitis. In conclusion, EIS is a useful method for diagnosing tendinitis and detecting the lesion location in invasive treatment.

  1. Surface impedance and the Casimir force

    CERN Document Server

    Bezerra, V B; Romero, C

    2002-01-01

    The impedance boundary condition is used to calculate the Casimir force in configurations of two parallel plates and a shpere (spherical lens) above a plate at both zero and nonzero temperature. The impedance approach allows one to find the Casimir force between the realistic test bodies regardless of the electromagnetic fluctuations inside the media. Although this approach is an approximate one, it has wider areas of application than the Lifshitz theory of the Casimir force. The general formulas of the impedance approach to the theory of the Casimir force are given and the formal substitution is found for connecting it with the Lifshitz formula. The range of micrometer separations between the test bodies which is interesting from the experimental point of view is investigated in detail. It is shown that at zero temperature the results obtained on the basis of the surface impedance method are in agreement with those obtained in framework of the Lifshitz theory within a fraction of a percent. The temperature c...

  2. Impedance Control of a Redundant Parallel Manipulator

    DEFF Research Database (Denmark)

    Méndez, Juan de Dios Flores; Schiøler, Henrik; Madsen, Ole

    2017-01-01

    This paper presents the design of Impedance Control to a redundantly actuated Parallel Kinematic Manipulator. The proposed control is based on treating each limb as a single system and their connection through the internal interaction forces. The controller introduces a stiffness and damping matr...

  3. Online contact impedance identification for robotic systems

    NARCIS (Netherlands)

    Haddadi, Amir; Hashtrudi-Zaad, Keyvan

    2008-01-01

    In this paper, we study the performance of various algorithms for fast online identification of environment impedance during robotic contact tasks. In particular, we evaluate and compare algorithms with regard to their convergence rate, computational complexity and sensitivity to noise for different

  4. Small-signal Loudspeaker Impedance Emulator

    DEFF Research Database (Denmark)

    Knott, Arnold; Iversen, Niels Elkjær

    2014-01-01

    Specifying the performance of audio ampliers is typically done by playing sine waves into a pure ohmic load. However real loudspeaker impedances are not purely ohmic but characterised by the mechanical resonance between the mass of the diaphragm and the compliance of its' suspension which vary fr...

  5. Wave impedance retrieving via Bloch modes analysis

    DEFF Research Database (Denmark)

    Andryieuski, Andrei; Ha, S.; Sukhorukov, A.

    2011-01-01

    of the Bloch mode, respectively. Case studies prove that our ap-proach can determine material and wave effective parameters of lossy and lossless metamaterials. In some examples when the passivity is violated we made further analysis and showed that this is due to the failure of concept of impedance retrieving...

  6. Impedance and collective effects in the KEKB

    Energy Technology Data Exchange (ETDEWEB)

    Chin, Yongho [National Lab. for High Energy Physics, Tsukuba, Ibaraki (Japan); Oide, Katsunobu

    1996-08-01

    This paper focuses on beam instabilities due to single-beam collective effects, impedances from various beamline elements, ion trapping, photo-electrons, and other issues in the KEKB. We will also discuss the power deposition generated by a beam in the form of the Higher-Order-Mode (HOM) losses by interacting with its surroundings. (author)

  7. Perioperative bioelectrical impedence analysis in neurosurgery.

    Science.gov (United States)

    El-Dawlatly, Abdelazeem A

    2005-10-01

    The use of bioelectrical impedence (BI) measurement to assess body composition has recently attracted the attention of anesthesiologists. Analysis of BI provides a non-invasive method to quantify fluid distribution in different body compartments. This study was designed to assess whether BI analysis reflects fluid depletion in neurosurgical patients with moderate blood loss. Six adult male patients scheduled for elective craniotomy under general anesthesia were studied. Exclusion criteria included patients with cardio-respiratory disease. BI analysis was performed at three stages, A, day before operation, B, during surgery and C, on the first postoperative day. Total body resistivity was measured by BI analysis with a four-terminal portable impedence analyzer. At each frequency, impedence was calculated as resistance (Rx)2 + reactance (Rc)2. The mean values of total body water (TBW) at stages A, B and C were 39.8 L (range: 33.1-46.7 L), 43.2 L (range: 33.1-66.2 L) and 36.8 L (range: 22.4-36.3 L) respectively with significant differences (P<0.05). The impedence at the three frequencies during stages A, B and C showed significant differences (P<0.05). In conclusion, we have found that in male neurosurgical patients multiple frequency BI measurements has reflected fluid balance perioperatively. Whether this observation remains true for other surgical procedures with massive blood loss, yet to be further investigated.

  8. Bioelectrical impedance analysis--part I

    DEFF Research Database (Denmark)

    Kyle, Ursula G; Bosaeus, Ingvar; De Lorenzo, Antonio D;

    2004-01-01

    The use of bioelectrical impedance analysis (BIA) is widespread both in healthy subjects and patients, but suffers from a lack of standardized method and quality control procedures. BIA allows the determination of the fat-free mass (FFM) and total body water (TBW) in subjects without significant ...

  9. Microwave transmission-line impedance data

    CERN Document Server

    Gunston, M A R

    1996-01-01

    A compendium of data for computing the characteristic impedance of transmission lines based on physical dimensions. Covers both conventional structures and unusual geometries, including coaxial, eccentric and elliptic coaxial, twin-wire, wire-above-ground, microstrip and derivatives, stripline, slabline and trough line. Also details numerous configurations of coupled lines.

  10. Impedance matching between ventricle and load.

    Science.gov (United States)

    Piene, H

    1984-01-01

    Impedance matching in the cardiovascular system is discussed in light of two models of ventricle and load: a Thevenin equivalent consisting of a hydromotive pressure source and an internal, source resistance and compliance in parallel; and a time-varying compliance filled from a constant pressure source and ejecting into a load of three components, a central resistor, a compliance, and a peripheral resistance. According to the Thevenin analog, the energy source and the load are matched when the load resistance is T/t times the internal source resistance (T is total cycle length, t is systolic time interval). Both from this model and from the variable compliance model it appears that optimum matching between source and load depends on the compliance of the Windkessel, as low compliance shifts the matching load resistance to a low value. Animal experiments (isolated cat hearts) indicated that both left and right ventricles at normal loads work close to their maxima of output hydraulic power, and, according to experiments in the right ventricle, maximum power output is related to load resistance and compliance as predicted by the above models. From an experimentally determined relationship among instantaneous ventricular pressure and volume (right ventricle of isolated cat hearts), an optimum load impedance was calculated on the basis of the assumption that the ratio between stroke work and static, potential energy developed in the ventricular cavity is maximum. The optimum load impedance found by this procedure closely resembles the normal input impedance of the cat lung vessel bed.

  11. Loudspeaker impedance emulator for multi resonant systems

    DEFF Research Database (Denmark)

    Iversen, Niels Elkjær; Knott, Arnold

    2015-01-01

    Specifying the performance of audio amplifiers is typically done by playing sine waves into a pure ohmic load. However real loudspeaker impedances are not purely ohmic but characterised by its electrical, mechanical and acoustical properties. Therefore a loudspeaker emulator capable of adjusting...

  12. Mapping Electrochemical Heterogeneity at Iron Oxide Surfaces: A Local Electrochemical Impedance Study.

    Science.gov (United States)

    Lucas, Marie; Boily, Jean-François

    2015-12-22

    Alternating current scanning electrochemical microscopy (AC-SECM) was used for the first time to map key electrochemical attributes of oriented hematite (α-Fe2O3) single crystal surfaces at the micron-scale. Localized electrochemical impedance spectra (LEIS) of the (001) and (012) faces provided insight into the spatial variations of local double layer capacitance (C(dl)) and charge transfer resistance (R(ad)). These parameters were extracted by LEIS measurements in the 0.4-8000 Hz range to probe the impedance response generated by the redistribution of water molecules and charge carriers (ions) under an applied AC. These were attributed to local variations in the local conductivity of the sample surfaces. Comparison with global EIS measurements on the same samples uncovered highly comparable frequency-resolved processes, that were broken down into contributions from the bulk hematite, the interface as well as the microelectrode/tip assembly. This work paves the way for new studies aimed at mapping electrochemical processes at the mesoscale on this environmentally and technologically important material.

  13. ACS from development to operations

    Science.gov (United States)

    Caproni, Alessandro; Colomer, Pau; Jeram, Bogdan; Sommer, Heiko; Chiozzi, Gianluca; Mañas, Miguel M.

    2016-08-01

    The ALMA Common Software (ACS), provides the infrastructure of the distributed software system of ALMA and other projects. ACS, built on top of CORBA and Data Distribution Service (DDS) middleware, is based on a Component- Container paradigm and hides the complexity of the middleware allowing the developer to focus on domain specific issues. The transition of the ALMA observatory from construction to operations brings with it that ACS effort focuses primarily on scalability, stability and robustness rather than on new features. The transition came together with a shorter release cycle and a more extensive testing. For scalability, the most problematic area has been the CORBA notification service, used to implement the publisher subscriber pattern because of the asynchronous nature of the paradigm: a lot of effort has been spent to improve its stability and recovery from run time errors. The original bulk data mechanism, implemented using the CORBA Audio/Video Streaming Service, showed its limitations and has been replaced with a more performant and scalable DDS implementation. Operational needs showed soon the difference between releases cycles for Online software (i.e. used during observations) and Offline software, which requires much more frequent releases. This paper attempts to describe the impact the transition from construction to operations had on ACS, the solution adopted so far and a look into future evolution.

  14. AC Small Signal Modeling of PWM Y-Source Converter by Circuit Averaging and Averaged Switch Modeling Technique

    DEFF Research Database (Denmark)

    Forouzesh, Mojtaba; Siwakoti, Yam Prasad; Blaabjerg, Frede

    2016-01-01

    Magnetically coupled Y-source impedance network is a newly proposed structure with versatile features intended for various power converter applications e.g. in the renewable energy technologies. The voltage gain of the Y-source impedance network rises exponentially as a function of turns ratio......, which is inherited from a special coupled inductor with three windings. Due to the importance of modeling in the converter design procedure, this paper is dedicated to dc and ac small signal modeling of the PWM Y-source converter. The derived transfer functions are presented in detail and have been...

  15. Correlation between AC and DC transport properties of Mn substituted cobalt ferrite

    Science.gov (United States)

    Supriya, Sweety; Kumar, Sunil; Kar, Manoranjan

    2016-12-01

    The CoFe2-xMnxO4 compound is prepared by following the sol gel technique. The structural analysis through XRD and Rietveld has been confirmed for the single cubic phase having F d 3 ¯ m space group for CoFe2-xMnxO4 and also verified it through Raman spectroscopy measurements. The tetrahedral site observed to be red shifted with increase in Mn concentration in cobalt ferrite. All the XRD patterns have been analyzed by employing the Rietveld refinement technique. The particle size was found to be in the range of 30-40 nm. The electrical properties of polycrystalline CoFe2-xMnxO4 for x = 0.00, 0.10, 0.15, and 0.2, spinel ferrite was investigated by impedance spectroscopy. The influence of doping, frequency and temperature on the electrical transport properties of the CoFe2-xMnxO4 for x = 0.00, 0.10, 0.15, and 0.20 were investigated. The magnitude of Z' and Z″ decreases with increase in temperature. Only one semicircle is observed in each Cole Cole plot which reveals that ac conductivity is dominated by grains. The grain resistance and grain boundary resistance both were found to decrease as a function of temperature. Temperature variation of DC electrical conductivity follows the Arrhenius relationship. A detailed analysis of electrical parameters provides assistance in connecting information regarding the conduction mechanism as well as determination of both dielectric and magnetic transition temperatures in the substituted cobalt ferrite. Detailed analysis of ac impedance and DC resistivity measurement reveals that, the magnetic ordering temperature in the Mn substituted cobalt ferrite does not respond to the frequency of ac electrical signal; however, it responds to the DC resistivity. The correlation between ac impedance and DC resistivity has been established.

  16. Beam measurements of the LHC impedance and validation of the impedance model

    CERN Document Server

    Esteban Müller, J F; Bohl, T; Mounet, N; Shaposhnikova, E; Timko, H

    2014-01-01

    Different measurements of the longitudinal impedance of the LHC done with single bunches with various intensities and longitudinal emittances during measurement sessions in 2011-2012 are compared with particle simulations based on the existing LHC impedance model. The very low reactive impedance of the LHC, with Im Z=n = 0.08, is not easy to measure. The most sensitive observation is the loss of Landau damping, which shows at which energy bunches become unstable depending on their parameters. In addition, the synchrotron frequency shift due to the reactive impedance was estimated following two methods. Firstly, it was obtained from the peak-detected Schottky spectrum. Secondly, a sine modulation in the RF phase was applied to the bunches of different intensities and the modulation frequency was scanned. In both cases, the synchrotron frequency shift was of the order of the measurement precision.

  17. Dynamic electrochemical impedance spectroscopy reconstructed from continuous impedance measurement of single frequency during charging/discharging

    Science.gov (United States)

    Huang, Jun; Li, Zhe; Zhang, Jianbo

    2015-01-01

    In this study, a novel implementation of dynamic electrochemical impedance spectroscopy (DEIS) is proposed. The method first measures the impedance continuously at a single frequency during one charging/discharging cycle, then repeats the measurement at a number of other selected frequencies. The impedance spectrum at a specific SOC is obtained by interpolating and collecting the impedance at all of the selected frequencies. The charge transfer resistance, Rct, from the DEIS is smaller than that from the steady EIS in a wide state-of-charge (SOC) range from 0.4 to 1.0, the Rct during charging is generally smaller than that during discharging for the battery chemistry used in this study.

  18. A compact wideband precision impedance measurement system based on digital auto-balancing bridge

    Science.gov (United States)

    Hu, Binxin; Wang, Jinyu; Song, Guangdong; Zhang, Faxiang

    2016-05-01

    The ac impedance spectroscopy measurements are predominantly taken by using impedance analyzers based on analog auto-balancing bridge. However, those bench-top analyzers are generally complicated, bulky and expensive, thus limiting their usage in industrial field applications. This paper presents the development of a compact wideband precision measurement system based on digital auto-balancing bridge. The methods of digital auto-balancing bridge and digital lock-in amplifier are analyzed theoretically. The overall design and several key sections including null detector, direct digital synthesizer-based sampling clock, and digital control unit are introduced in detail. The results show that the system achieves a basic measurement accuracy of 0.05% with a frequency range of 20 Hz-2 MHz. The advantages of versatile measurement capacity, fast measurement speed, small size and low cost make it quite suitable for industrial field applications. It is demonstrated that this system is practical and effective by applying in determining the impedance-temperature characteristic of a motor starter PTC thermistor.

  19. High temperature impedance spectroscopy of barium stannate, BaSnO3

    Indian Academy of Sciences (India)

    Shail Upadhyay

    2013-11-01

    Polycrystalline powder of BaSnO3 was prepared at 1300 °C using a high-temperature solid-state reaction technique. X-ray diffraction analysis indicated the formation of a single-phase cubic structure with lattice parameter: = (4.1158 ± 0.0003) Å. The synthesized powder was characterized using X-ray diffraction (XRD) scanning electron micrographs, energy dispersive X-ray analysis, differential thermal analysis, thermogravimetric analysis and Fourier transform infrared techniques. Electrical properties were studied using a.c. impedance spectroscopy technique in the temperature range of 50–650 °C and frequency range of 10 Hz–13 MHz. The complex impedance plots at temperature ≥ 300 °C show that total impedance is due to the contributions of grains, grain boundaries and electrode. Resistance of these contributions has been determined. Variation of these resistances with temperature shows the presence of two different regions with different slopes. The nature of variation for the above three resistances, in both the temperature regions confirms that conducting species (phases) responsible for grain, grain boundaries and electrode are the same. Based on the value of activation energy, it is proposed that conduction via hopping of doubly ionized oxygen vacancies ($V^{\\bullet \\bullet}_{o}$) is taking place in the temperature region of 300–450 °C, whereas in the temperature region of 450–650 °C, hopping of proton, i.e. OH$^{\\bullet}$ ions occurs.

  20. AcEST: DK943965 [AcEST

    Lifescience Database Archive (English)

    Full Text Available FKBP-type OS=Cya... 55 2e-06 tr|B8EIG1|B8EIG1_METSI Peptidylprolyl isomerase FKBP-type OS=Met... 53 9e-06 t... type OS=Ac... 51 4e-05 tr|B8I9L2|B8I9L2_METNO Peptidylprolyl isomerase FKBP-type OS=Met.

  1. Structural and AC conductivity study of CdTe nanomaterials

    Science.gov (United States)

    Das, Sayantani; Banerjee, Sourish; Sinha, T. P.

    2016-04-01

    Cadmium telluride (CdTe) nanomaterials have been synthesized by soft chemical route using mercapto ethanol as a capping agent. Crystallization temperature of the sample is investigated using differential scanning calorimeter. X-ray diffraction and transmission electron microscope measurements show that the prepared sample belongs to cubic structure with the average particle size of 20 nm. Impedance spectroscopy is applied to investigate the dielectric relaxation of the sample in a temperature range from 313 to 593 K and in a frequency range from 42 Hz to 1.1 MHz. The complex impedance plane plot has been analyzed by an equivalent circuit consisting of two serially connected R-CPE units, each containing a resistance (R) and a constant phase element (CPE). Dielectric relaxation peaks are observed in the imaginary parts of the spectra. The frequency dependence of real and imaginary parts of dielectric permittivity is analyzed using modified Cole-Cole equation. The temperature dependence relaxation time is found to obey the Arrhenius law having activation energy ~0.704 eV. The frequency dependent conductivity spectra are found to follow the power law. The frequency dependence ac conductivity is analyzed by power law.

  2. Concentric artificial impedance surface for directional sound beamforming

    Science.gov (United States)

    Song, Kyungjun; Anzan-Uz-Zaman, Md.; Kwak, Jun-Hyuk; Jung, Joo-Yun; Kim, Jedo; Hur, Shin

    2017-03-01

    Utilizing acoustic metasurfaces consisting of subwavelength resonant textures, we design an artificial impedance surface by creating a new boundary condition. We demonstrate a circular artificial impedance surface with surface impedance modulation for directional sound beamforming in three-dimensional space. This artificial impedance surface is implemented by revolving two-dimensional Helmholtz resonators with varying internal coiled path. Physically, the textured surface has inductive surface impedance on its inner circular patterns and capacitive surface impedance on its outer circular patterns. Directional receive beamforming can be achieved using an omnidirectional microphone located at the focal point formed by the gradient-impeding surface. In addition, the uniaxial surface impedance patterning inside the circular aperture can be used for steering the direction of the main lobe of the radiation pattern.

  3. Scattering by a groove in an impedance plane

    Science.gov (United States)

    Bindiganavale, Sunil; Volakis, John L.

    1993-09-01

    An analysis of two-dimensional scattering from a narrow groove in an impedance plane is presented. The groove is represented by a impedance surface and the problem reduces to that of scattering from an impedance strip in an otherwise uniform impedance plane. On the basis of this model, appropriate integral equations are constructed using a form of the impedance plane Green's functions involving rapidly convergent integrals. The integral equations are solved by introducing a single basis representation of the equivalent current on the narrow impedance insert. Both transverse electric (TE) and transverse magnetic (TM) polarizations are treated. The resulting solution is validated by comparison with results from the standard boundary integral method (BIM) and a high frequency solution. It is found that the presented solution for narrow impedance inserts can be used in conjunction with the high frequency solution for the characterization of impedance inserts of any given width.

  4. On Improving Impedance Probe Plasma Potential Measurements

    Science.gov (United States)

    2014-02-21

    assumption of a collisionless, stationary Maxwellian plasma and are seen to work well in non -flowing plasmas of sufficient density. However, as plasma...collection area. For Maxwellian electrons, np = n exp(Vp-φp)/Te and so at low frequency from Eq. (1) above, the resistive component of the ac

  5. Impedance spectroscopic analysis of composite electrode from activated carbon/conductive materials/ruthenium oxide for supercapacitor applications

    Energy Technology Data Exchange (ETDEWEB)

    Taer, E.; Awitdrus,; Farma, R. [School of Applied Physics, Faculty of Science and Technology, Universiti Kebangsaan Malaysia, 43600 Bangi, Selangor (Malaysia); Department of Physics, Faculty of Mathematics and Natural Sciences, University of Riau, 28293 Pekanbaru, Riau (Indonesia); Deraman, M., E-mail: madra@ukm.my; Talib, I. A.; Ishak, M. M.; Omar, R.; Dolah, B. N. M.; Basri, N. H.; Othman, M. A. R. [School of Applied Physics, Faculty of Science and Technology, Universiti Kebangsaan Malaysia, 43600 Bangi, Selangor (Malaysia); Kanwal, S. [ICCBS, H.E.J. Research Institute of Chemistry, University of Karachi, 75270 Karachi (Pakistan)

    2015-04-16

    Activated carbon powders (ACP) were produced from the KOH treated pre-carbonized rubber wood sawdust. Different conductive materials (graphite, carbon black and carbon nanotubes (CNTs)) were added with a binder (polivinylidene fluoride (PVDF)) into ACP to improve the supercapacitive performance of the activated carbon (AC) electrodes. Symmetric supercapacitor cells, fabricated using these AC electrodes and 1 molar H{sub 2}SO{sub 4} electrolyte, were analyzed using a standard electrochemical impedance spectroscopy technique. The addition of graphite, carbon black and CNTs was found effective in reducing the cell resistance from 165 to 68, 23 and 49 Ohm respectively, and increasing the specific capacitance of the AC electrodes from 3 to 7, 17, 32 F g{sup −1} respectively. Since the addition of CNTs can produce the highest specific capacitance, CNTs were chosen as a conductive material to produce AC composite electrodes that were added with 2.5 %, 5 % and 10 % (by weight) electro-active material namely ruthenium oxide; PVDF binder and CNTs contents were kept at 5 % by weight in each AC composite produced. The highest specific capacitance of the cells obtained in this study was 86 F g{sup −1}, i.e. for the cell with the resistance of 15 Ohm and composite electrode consists of 5 % ruthenium oxide.

  6. Ag incorporated Mn3O4/AC nanocomposite based supercapacitor devices with high energy density and power density.

    Science.gov (United States)

    Nagamuthu, S; Vijayakumar, S; Muralidharan, G

    2014-12-14

    Silver incorporated Mn3O4/amorphous carbon (AC) nanocomposites are synthesized by a green chemistry method. X-ray diffraction studies revealed the structural changes in Mn3O4/AC nanocomposites attributable to the addition of silver. Cyclic voltammetry, charge-discharge and ac-impedance studies indicated that the Ag-Mn3O4/AC-5 electrode was the most suitable candidate for supercapacitor applications. From the galvanostatic charge-discharge studies, a higher specific capacitance of 981 F g(-1) at a specific current of 1 A g(-1) was obtained. An Ag-Mn3O4/AC-symmetric supercapacitor consisting of an Ag-incorporated Mn3O4/AC composite as an anode as well as a cathode, and an asymmetric supercapacitor consisting of an Ag-incorporated Mn3O4/AC composite as a cathode and an activated carbon as an anode have been fabricated. The symmetric device exhibits a specific cell capacitance of 72 F g(-1) at a specific current of 1 A g(-1) whereas the asymmetric device delivers a specific cell capacitance of 180 F g(-1) at a high current rate of 10 A g(-1). The asymmetric supercapacitor device yields a high energy density of 81 W h kg(-1). This is higher than that of lead acid batteries and comparable with that of nickel hydride batteries.

  7. Experimental and theoretical study of AC electrical conduction mechanisms of Bis (4-acetylanilinium) tetrachloridozincate

    Energy Technology Data Exchange (ETDEWEB)

    Amine Fersi, M., E-mail: fersi_amine@yahoo.fr; Chaabane, I.; Gargouri, M.

    2014-07-01

    The Bis (4-acetylanilinium) tetrachloridozincate [C{sub 8}H{sub 10}NO]{sub 2}[ZnCl{sub 4}] compound was obtained by slow evaporation at room temperature and characterized by XRD. It is crystallized in an orthorhombic system (Cmca space group). The material was characterized by impedance spectroscopy technique measured in the 209 Hz–5 MHz frequency range from 423 to 498 K. Besides, the Cole–Cole (Z″ versus Z′) plots were well fitted to an equivalent circuit built up by a parallel combination of resistance (R), fractal capacitance (CPE) and capacitance (C). Furthermore, the AC conductivity was investigated as a function of temperature and frequency in the same range. The experimental results indicated that AC conductivity (σ{sub ac}) was proportional to Aω{sup S1}+Bω{sup S2}(0AC conductivity behavior of [C{sub 8}H{sub 10}NO]{sub 2}[ZnCl{sub 4}] can be explained by CBH model. The contribution of single polaron hopping to AC conductivity in a present alloy was also studied.

  8. AC dynamometer; Koryu dinamo meter

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-01-10

    Fuji Electric Co., Ltd., developed an AC dynamometer for testing automobiles, and the product was delivered to Hokkaido Automotive Engineering College via Safety Automobile Company. The device is used for testing 1,300cc-class automobiles. It is similar to the conventional type in that its force of reaction to an imposed load is measured by load cells. It is a variable speed motor driven by an inverter (FRENIC5000VG5), whose specifications and features are mentioned below. It is a totally-enclosed self-cooled oscillating AC dynamometer that outputs 75kW, revolves at 1500/2868rpm, and operates for 30min. Since it is rated for a short time operation, the external fan is dispensed with, and this reduces noise. A number of parts for the standard type (R90 series) are utilized for reduction in the cost, and the time required for its delivery was short. (NEDO)

  9. Current injection electrodes for electrical impedance tomography.

    Science.gov (United States)

    Armstrong, S; Jennings, D

    2004-08-01

    Current conveyors have been identified as a possible component within the current injection electrodes of an electrical impedance tomography system, where accurate current generation or precise measurement of the current injected is required. Several circuit configurations have been investigated through simulation to determine the most suitable to meet the specifications of the EIT system. A bipolar (floating source) circuit configuration employing the use of current conveyors has been designed, which achieves greater than 12 mA output current without saturation, over an accepted body impedance range. Simulations were performed over frequencies in excess of 1 MHz, and the output phase shift was less than 0.15 degrees up to 250 kHz, and 0.6 degrees up to 1 MHz.

  10. FEM electrode refinement for electrical impedance tomography.

    Science.gov (United States)

    Grychtol, Bartlomiej; Adler, Andy

    2013-01-01

    Electrical Impedance Tomography (EIT) reconstructs images of electrical tissue properties within a body from electrical transfer impedance measurements at surface electrodes. Reconstruction of EIT images requires the solution of an inverse problem in soft field tomography, where a sensitivity matrix, J, of the relationship between internal changes and measurements is calculated, and then a pseudo-inverse of J is used to update the image estimate. It is therefore clear that a precise calculation of J is required for solution accuracy. Since it is generally not possible to use analytic solutions, the finite element method (FEM) is typically used. It has generally been recommended in the EIT literature that FEMs be refined near electrodes, since the electric field and sensitivity is largest there. In this paper we analyze the accuracy requirement for FEM refinement near electrodes in EIT and describe a technique to refine arbitrary FEMs.

  11. Estimating the Transverse Impedance in the Fermilab Recycler

    Energy Technology Data Exchange (ETDEWEB)

    Ainsworth, Robert [Fermilab; Adamson, Philip [Fermilab; Burov, Alexey [Fermilab; Kourbanis, Ioanis [Fermilab; Yang, Ming-Jen [Fermilab

    2016-06-01

    Impedance could represent a limitation of running high intensity bunches in the Fermilab recycler. With high intensity upgrades foreseen, it is important to quantify the impedance. To do this, studies have been performed measuring the tune shift as a function of bunch intensity allowing the transverse impedance to be derived.

  12. PHEMT Distributed Power Amplifier Adopting Broadband Impedance Transformer

    DEFF Research Database (Denmark)

    Narendra, K.; Limiti, E.; Paoloni, C.

    2013-01-01

    A non-uniform drain line distributed power amplifier (DPA) employing a broadband impedance transformer is presented. The DPA is based on GaAs PHEMT technology. The impedance transformer employs asymmetric coupled lines and transforms a low output impedance of the amplifier to a standard 50 Ω...

  13. Analog Video Line Driver with Adaptive Impedance Matching

    NARCIS (Netherlands)

    Nauta, Bram; Dijkstra, Marcel B.

    1998-01-01

    A new principle for an adaptive line driver is presented. This type of line driver can adapt its output impedance automatically to the applied load. This results in automatically corrected output impedance for different cables with terminations. Also, the line-driver output impedance becomes insensi

  14. Effect of rib-cage structure on acoustic chest impedance

    DEFF Research Database (Denmark)

    Zimmermann, Niels Henrik; Møller, Henrik; Hansen, John

    2011-01-01

    even weak sounds originating from e.g. the heart. The acoustic impedance is influenced by the structure of the ribcage; hence the acoustic impedance will change depending on if the coupler has been placed on a top of a rib or between the ribs (the intercostal). The impedance of the chest is measured...

  15. Summary of impedance issues and beam instabilities

    CERN Document Server

    Zimmermann, Frank

    2016-01-01

    This paper summarizes the session on impedance issues and beam instabilities at the ICFA workshop on future circular electron-positron factories “eeFACT2016” [1] held at the Cockcroft Institute, Daresbury, from 24 to 27 October 2016. This session also covered active beam stabilization by feedback systems. Beam-beam effects and coherent beambeam instabilities were addressed separately and, therefore, are not included here.

  16. Applications of Nonlinear Electrochemical Impedance Spectroscopy (NLEIS)

    KAUST Repository

    Adler, S. B.

    2013-08-31

    This paper reviews the use of nonlinear electrochemical impedance spectroscopy (NLEIS) in the analysis of SOFC electrode reactions. By combining EIS and NLEIS, as well as other independent information about an electrode material, it becomes possible to establish quantitative links between electrochemical kinetics and materials properties, even when systems are unstable with time. After a brief review of the method, this paper summarizes recent results analyzing the effects of Sr segregation in thin-film LSC electrodes. © The Electrochemical Society.

  17. OCM and Impedance Analysis of Polypyrrole

    Science.gov (United States)

    1990-05-01

    0e 4 ’.6. SUPPLEMENTARY NOTATION 178th Meeting of the Electrochemical Society , Seattle, Washington, October 1990 !7 COSA7 CODES -4) SUBJECT TERMS...to: The Electrochemical Society , Inc. Abstract No. 10 South Main Street Pennington, NJ 08534.2696 (to be assigned by te Society) With a copy to the... Electrochemical Society . Inc. QCM and Impedance Analysis of Polypyrrole CoLe-Cole plots for anion -intercalating polypyrrole Mary M. Lien. Hesi-ku Park. and

  18. Electrode models in electrical impedance tomography

    Institute of Scientific and Technical Information of China (English)

    WANG M.

    2005-01-01

    This paper presents different views on electrode modelling, which include electrode electrochemistry models for modelling the effects of electrode-electrolyte interface, electric field electrode models for modelling electrode geometry, and electrode models for modelling the effects of electrode common mode voltage and double layer capacitance. Taking the full electrode models into consideration .in electrical impedance tomography (EIT) will greatly help the optimised approach to a good solution and further understanding of the measurement principle.

  19. Giant Magneto-Impedance and its Applications

    CERN Document Server

    Tannous, C

    2002-01-01

    The status of Giant Magneto-Impedance effect is reviewed in Wires, Ribbons and Multilayered Soft Ferromagnetic Thin Films. After establishing the theoretical framework for the description of the effect, and the constraints any material should have in order to show the effect, experimental work in Wires, Ribbons and Multilayered Thin Films is described. Existing and potential applications of the effect in Electronics and Sensing are highlighted.

  20. Impedance Matched Absorptive Thermal Blocking Filters

    CERN Document Server

    Wollack, E J; Rostem, K; U-Yen, K

    2014-01-01

    We have designed, fabricated and characterized absorptive thermal blocking filters for cryogenic microwave applications. The transmission line filter's input characteristic impedance is designed to match $50\\,\\Omega$ and its response has been validated from 0-to-50\\,GHz. The observed return loss in the 0-to-20\\,GHz design band is greater than $20\\,$dB and shows graceful degradation with frequency. Design considerations and equations are provided that enable this approach to be scaled and modified for use in other applications.

  1. Efeitos da estimulação vibro-acústica na velocidade do sangue da artéria cerebral média e na freqüência cardíaca fetal: 1. entre a 35ª e 41ª semanas de gestação The effect of vibratory acoustic stimulation on fetal middle cerebral artery impedance and instantaneous fetal heart rate: 1. a transversal study on fetuses with 35 to 41 weeks of gestational age

    Directory of Open Access Journals (Sweden)

    Ivo Behle

    1999-01-01

    Full Text Available RESUMO Objetivos: estudar, em fetos hígidos, quais são as respostas da freqüência cardíaca fetal basal e da resistência na artéria cerebral média à estimulação vibro-acústica padronizada. Métodos: em estado comportamental de hipo ou de inatividade fetal (apnéia e ausência de movimentos corpóreos, mediu-se o índice de pulsatilidade (IP da artéria cerebral média (ACM, bem como calculou-se a freqüência cardíaca fetal basal (FCFB pela análise da onda espectral, antes e após a aplicação de estímulo vibro-acústico (EVA por 3 segundos. Foram empregados ecógrafos de alta resolução, com Doppler pulsado e mapeamento a cores. A fonte sonora emitia som com 400 a 40.000 Hz, sob forma de varredura, com pressão sonora de 65 a 110 dB. Resultados: a média da FCFB pré-estímulo foi 139 bpm, com desvio padrão de 3,14 bpm. A média da FCFB pós-estímulo foi 153 bpm, com desvio padrão de 7,23 bpm (pSUMMARY Purpose: to examine the response of the fetal heart rate (FHR and middle cerebral artery resistance (MCA PI to vibratory stimulation (VAS in normal human fetuses. Methods: when the fetuses were without activity (in apnea and without corporal movements, we obtained baseline measurements of MCA PI and FHR before and after the application of a 3-sec vibratory acoustic stimulus. Real time ultrasonography with pulsed wave and color Doppler imaging was used for the execution of the study. The VAS was performed using a bicycle horn with 400 to 4000 Hz and sound pressure was 65 to 110 dB. Results: the FHR before VAS was 139 ± 3.14 bpm and after VAS was 153 ± 7.23 bpm (p<0.0001. The MCA PI rate before VAS was 1.84 ± 0.07 and after VAS was 1.56 ± 0.04 (p<0.001. In all cases we observed a fetal response with vigorous corporal movements, FHR rise and MCA PI reduction after VAS. Conclusions: we conclude that VAS, in human fetuses near term, for 3 sec as described in this study, determines some response, with increase in FHR and corporal

  2. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  3. Bioelectrical impedance analysis of bovine milk fat

    Science.gov (United States)

    Veiga, E. A.; Bertemes-Filho, P.

    2012-12-01

    Three samples of 250ml at home temperature of 20°C were obtained from whole, low fat and fat free bovine UHT milk. They were analysed by measuring both impedance spectra and dc conductivity in order to establish the relationship between samples related to fat content. An impedance measuring system was developed, which is based on digital oscilloscope, a current source and a FPGA. Data was measured by the oscilloscope in the frequency 1 kHz to 100 kHz. It was showed that there is approximately 7.9% difference in the conductivity between whole and low fat milk whereas 15.9% between low fat and free fat one. The change of fatness in the milk can be significantly sensed by both impedance spectra measurements and dc conductivity. This result might be useful for detecting fat content of milk in a very simple way and also may help the development of sensors for measuring milk quality, as for example the detection of mastitis.

  4. Probing the LHC impedance with single bunches

    CERN Document Server

    Esteban Müller, J F; Bohl, T; Bhat, C; Calaga, R; Kain, V; Kuhn, M; Mounet, N; Papotti, G; Shaposhnikova, E; Timko, H

    2013-01-01

    The main purpose of this MD was to study longitudinal and transverse beam dynamics in the LHC. Eight bunches with different bunch lengths and intensities were injected into the LHC in two fills. The distance between bunches is large enough so they can be treated as single bunches. The bunch length and the intensity were adjusted in the SPS by applying controlled longitudinal emittance blow-up with different amplitudes and transverse scraping. The aim of the first fill was to measure the longitudinal and the transverse impedance at injection energy (450 GeV). The second fill of the MD included acceleration to 4 TeV and was used to study the loss of Landau damping during the ramp, observed as dipole and quadrupole oscillations, and to measure the impedance at top energy. Measurements of synchronous phase shift and peak-detected Schottky spectra were taken during both fills in order to estimate the longitudinal impedance and they are presented in this Note. We also show the transverse emittance evolution during ...

  5. Application of impedance spectroscopy to SOFC research

    Energy Technology Data Exchange (ETDEWEB)

    Hsieh, G.; Mason, T.O. [Northwestern Univ., Evanston, IL (United States); Pederson, L.R. [Pacific Northwest National Lab., Richland, WA (United States)

    1996-12-31

    With the resurgence of interest in solid oxide fuel cells and other solid state electrochemical devices, techniques originally developed for characterizing aqueous systems are being adapted and applied to solid state systems. One of these techniques, three-electrode impedance spectroscopy, is particularly powerful as it allows characterization of subcomponent and interfacial properties. Obtaining accurate impedance spectra, however, is difficult as reference electrode impedance is usually non-negligible and solid electrolytes typically have much lower conductance than aqueous solutions. Faidi et al and Chechirlian et al have both identified problems associated with low conductivity media. Other sources of error are still being uncovered. Ford et al identified resistive contacts with large time constants as a possibility, while Me et al showed that the small contact capacitance of the reference electrode was at fault. Still others show that instrument limitations play a role. Using the voltage divider concept, a simplified model that demonstrates the interplay of these various factors, predicts the form of possible distortions, and offers means to minimize errors is presented.

  6. DC and AC linear magnetic field sensor based on glass coated amorphous microwires with Giant Magnetoimpedance

    Energy Technology Data Exchange (ETDEWEB)

    García-Chocano, Víctor Manuel, E-mail: vicgarch@teleco.upv.es [Wave Phenomena Group, Universitat Politécnica de Valencia, 46022 Valencia (Spain); Electronic Engineering Department, Universitat Politécnica de Valencia, 46022 Valencia (Spain); García-Miquel, Héctor, E-mail: hgmiquel@eln.upv.es [ITEAM Research Institute, Universitat Politécnica de Valencia, C/Camino de Vera s/n, E-46022 Valencia (Spain); Electronic Engineering Department, Universitat Politécnica de Valencia, 46022 Valencia (Spain)

    2015-03-15

    Giant Magnetoimpedance (GMI) effect has been studied in amorphous glass-coated microwires of composition (Fe{sub 6}Co{sub 94}){sub 72.5}Si{sub 12.5}B{sub 15}. The impedance of a 1.5 cm length sample has been characterized by using constant AC currents in the range of 400 µA–4 mA at frequencies from 7 to 15 MHz and DC magnetic fields from −900 to 900 A/m. Double peak responses have been obtained, showing GMI ratios up to 107%. A linear magnetic field sensor for DC and AC field has been designed, using two microwires connected in series with a magnetic bias of 400 A/m with opposite direction in each microwire in order to obtain a linear response from ±70 (A/m){sub rms} for AC magnetic field, and ±100 A/m for DC magnetic field. A closed loop feedback circuit has been implemented to extend the linear range to ±1 kA/m for DC magnetic field. - Highlights: • Giant Magneto Impedance phenomenon has been studied in amorphous microwires. • A combination of two microwires with a bias field has been developed to get a linear response. • An electronic circuit has been developed to obtain a sensor with a linear response. • A feedback coil have been added to increase the measurable range of the sensor.

  7. Modeling a reversible solid oxide fuel cell as a storage device within AC power networks

    Energy Technology Data Exchange (ETDEWEB)

    Ren, J.; Roscoe, A.J.; Burt, G. [Department of Electronic and Electrical Engineering, Royal College, University of Strathclyde, Glasgow (United Kingdom); Gamble, S.R.; Irvine, J.T.S. [School of Chemistry, University of St. Andrews, Purdie Building, St. Andrews (United Kingdom)

    2012-10-15

    A reversible solid oxide fuel cell (RSOFC) system, consisting of a RSOFC stack, heat store, and electrical inverters to convert DC to AC power, is shown by computer modeling to have the potential to efficiently store electrical energy. This paper describes the modeling of a single RSOFC, based on a proposed cell geometry, empirical data on the resistivities of the components, and calculation of activation and diffusion polarization resistances from electrochemical theory. Data from ac impedance spectroscopy measurements on symmetrical cells are used to model RSOFC impedance. A RSOFC stack is modeled by electrically linking the individual cells inside a pressurized vessel. A phase change heat store is added to improve energy storage efficiency. The model is implemented in MATLAB {sup registered} /Simulink {sup registered}. Two competing inverter control schemes are compared, trading off DC bus ripple against AC power quality. It is found that selection of appropriate DC bus capacitance is important in certain scenarios, with potential system cost implications. It is shown that the system can store electrical energy at an efficiency of 64% over a single discharge-charge cycle, i.e., hydrogen to electricity and heat to hydrogen. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  8. Real-time measurement of glucose using chrono-impedance technique on a second generation biosensor.

    Science.gov (United States)

    Mayorga Martinez, Carmen C; Treo, Ernesto F; Madrid, Rossana E; Felice, Carmelo C

    2011-11-15

    Chrono-impedance technique (CIT) was implemented as a new transduction method for real time measurement of glucose in a biosensor system based in carbon paste (CP)/Ferrocene (FC)/glucose oxidase (GOx). The system presents high selectivity because the optimal stimulation signal composed by a 165mV DC potential and 50mV(RMS) AC signal at 0.4Hz was used. The low DC potential used decreased the interfering species effect and the biosensor showed a linear impedance response toward glucose detection at concentrations from 0mM to 20mM,with 0.9853 and 0.9945 correlation coefficient for impedance module (|Z|) and phase (Φ), respectively. The results of quadruplicate sets reveal the high repeatability and reproducibility of the measurements with a relative standard deviation (RSD) less than 10%. CIT presented good accuracy (within 10% of the actual value) and precision did not exceed 15% of RSD for high concentration values and 20% for the low concentration ones. In addition, a high correlation coefficient (R(2)=0.9954) between chrono-impedance and colorimetric methods was obtained. On the other hand, when two samples prepared at the same conditions were measured in parallel with both methods (the measurement was repeated four times), it should be noticed that student's t-test produced no difference between the two mentioned methods (p=1). The biosensor system hereby presented is highly specific to glucose detection and shows a better linear range than the one reported on the previous article.

  9. A self-consistent impedance method for electromagnetic surface impedance modeling

    Science.gov (United States)

    Thiel, David V.; Mittra, Raj

    2001-01-01

    A two-dimensional, self-consistent impedance method has been derived and used to calculate the electromagnetic surface impedance above buried objects at very low frequencies. The earth half space is discretized using an array of impedance elements. Inhomogeneities in the complex permittivity of the earth are reflected in variations in these impedance elements. The magnetic field is calculated for each cell in the solution space using a difference equation derived from Faraday's and Ampere's laws. It is necessary to include an air layer above the earth's surface to allow the scattered magnetic field to be calculated at the surface. The source field is applied above the earth's surface as a Dirichlet boundary condition, whereas the Neumann condition is employed at all other boundaries in the solution space. This, in turn, enables users to use both finite and infinite magnetic field sources as excitations. The technique is shown to be computationally efficient and yields reasonably accurate results when applied to a number of one- and two-dimensional earth structures with a known surface impedance distribution.

  10. Impedance adaptation for optimal robot-environment interaction

    Science.gov (United States)

    Ge, Shuzhi Sam; Li, Yanan; Wang, Chen

    2014-02-01

    In this paper, impedance adaptation is investigated for robots interacting with unknown environments. Impedance control is employed for the physical interaction between robots and environments, subject to unknown and uncertain environments dynamics. The unknown environments are described as linear systems with unknown dynamics, based on which the desired impedance model is obtained. A cost function that measures the tracking error and interaction force is defined, and the critical impedance parameters are found to minimise it. Without requiring the information of the environments dynamics, the proposed impedance adaptation is feasible in a large number of applications where robots physically interact with unknown environments. The validity of the proposed method is verified through simulation studies.

  11. Broadband electrical impedance matching for piezoelectric ultrasound transducers.

    Science.gov (United States)

    Huang, Haiying; Paramo, Daniel

    2011-12-01

    This paper presents a systematic method for designing broadband electrical impedance matching networks for piezoelectric ultrasound transducers. The design process involves three steps: 1) determine the equivalent circuit of the unmatched piezoelectric transducer based on its measured admittance; 2) design a set of impedance matching networks using a computerized Smith chart; and 3) establish the simulation model of the matched transducer to evaluate the gain and bandwidth of the impedance matching networks. The effectiveness of the presented approach is demonstrated through the design, implementation, and characterization of impedance matching networks for a broadband acoustic emission sensor. The impedance matching network improved the power of the acquired signal by 9 times.

  12. AcEST: DK943968 [AcEST

    Lifescience Database Archive (English)

    Full Text Available = +2 Query: 71 SSIRDLDNSRPRAIACSDNSGICVAVAYNHLANM------AVATFRDKPSVHQAGS---M 223 SS+ S P AC+ N+ VA HL+N+ A+ F...ives = 24/56 (42%) Frame = +2 Query: 107 AIACSDNSGICVAVAYNHLANMAVATFRDKPSVHQAGSMN...es = 83/195 (42%), Gaps = 1/195 (0%) Frame = +2 Query: 32 VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYNHLANMAVA.../188 (41%), Gaps = 2/188 (1%) Frame = +2 Query: 32 VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYN-HLANMAVATFRDKP... VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYN-HLANMAVATFRDKPSVH 208 V++A S G WD D +RP + +N G+C+++A N +++ VA+FR

  13. AcEST: DK954735 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AC ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q7TMD5 Definition sp|Q7TMD5...ng significant alignments: (bits) Value sp|Q7TMD5|ZC3HE_RAT Zinc finger CCCH domain-containing protein 1... ...tein pstB ... 30 5.8 sp|Q2S081|PSTB_SALRD Phosphate import ATP-binding protein pstB O... 30 7.6 >sp|Q7TMD5

  14. INVESTIGATION OF CEMENT CONCRETE CONGLOMERATE SOLIDIFICATION PROCESS BY IMPEDANCE SPECTROSCOPY METHOD

    Directory of Open Access Journals (Sweden)

    S. N. Bandarenka

    2015-01-01

    Full Text Available One of the most prospective directions in preservation  and increase of service live of  road pavements is a construction of  automobile roads with cement concrete surface. Modern tendencies for provision of road construction quality presuppose a necessity to control processes of solidification and subsequent destruction of the material while forming and using cement concrete conglomerate being considered as a basic element of the road surface.  Multiyear practical experience of  automobile road operation using cement concrete pavements reveals an importance for monitoring  such processes as formation and destruction of cement concrete materials. An impedance spectroscopy method has been tried out and proposed as a tool for solution of the given problem.Experimental samples of cement concrete have been prepared for execution of tests, graded silica sand and granite chippings with particle size from 0.63 to 2.5 mm have been used as a fine aggregate in the samples. Dependencies of resistance (impedance on AC-current frequency  have been studied for samples of various nature and granulometric composition. The Gamry  G300 potentiostat has been used for measurement of complex impedance value. A spectrum analysis and calculation of equivalent circuit parameters calculation have been carried out while using EIS Spectrum Analyzer program.Comparison of impedance spectra for the prepared cement concrete samples have made it possible to reveal tendencies in changing spectrum parameters during solidification and subsequent contact with moisture in respect of every type of the sample. An equivalent electrical circuit has been developed that  characterizes physical and chemical processes which are accompanied by charge transfer in cement concrete conglomerate. The paper demonstrates a possibility to use an impedance spectroscopy for solution of a number of actual problems in the field of cement concrete technology problems. Particularly, the problems

  15. Bioelectrical Impedance Methods for Noninvasive Health Monitoring: A Review

    Directory of Open Access Journals (Sweden)

    Tushar Kanti Bera

    2014-01-01

    Full Text Available Under the alternating electrical excitation, biological tissues produce a complex electrical impedance which depends on tissue composition, structures, health status, and applied signal frequency, and hence the bioelectrical impedance methods can be utilized for noninvasive tissue characterization. As the impedance responses of these tissue parameters vary with frequencies of the applied signal, the impedance analysis conducted over a wide frequency band provides more information about the tissue interiors which help us to better understand the biological tissues anatomy, physiology, and pathology. Over past few decades, a number of impedance based noninvasive tissue characterization techniques such as bioelectrical impedance analysis (BIA, electrical impedance spectroscopy (EIS, electrical impedance plethysmography (IPG, impedance cardiography (ICG, and electrical impedance tomography (EIT have been proposed and a lot of research works have been conducted on these methods for noninvasive tissue characterization and disease diagnosis. In this paper BIA, EIS, IPG, ICG, and EIT techniques and their applications in different fields have been reviewed and technical perspective of these impedance methods has been presented. The working principles, applications, merits, and demerits of these methods has been discussed in detail along with their other technical issues followed by present status and future trends.

  16. Impedance pattern of vaginal and vestibular mucosa in cyclic goats

    Directory of Open Access Journals (Sweden)

    Ivo Křivánek

    2008-01-01

    Full Text Available The changes of vaginal and vestibular impedance during the oestrous cycle in goats were examined. The onset of oestrus was teased with a buck once a day during the experiment. Impedance was mea­sured by a four-terminal method. The vaginal impedance was recorded under slight pressure of electrodes to the vaginal dorsal wall at the cervix. The vestibular impedance was recorded under slight pressure of electrodes to the vestibular dorsal wall 5 cm from the vulva and at the vulva. The im­pe­dan­ce was measured once a day from 4 days before the expected oestrus to 6 days after onset of oestrus. The vaginal impedance at the cervix decreased during pro-oestrus (P < 0.01 and increased du­ring oestrus (P < 0.01. The vestibular impedance 5 cm from the vulva decreased during pro-oestrus (P < 0.01 and increased after oestrus (P < 0.01. The decrease of vaginal impedance during peri-oestrus was nearly twofold in comparison with the vestibular impedance 5 cm from the vulva. No sig­ni­fi­cant decrease of the vestibular impedance at the vulva was found during the oestrous cycle. The results indicate that the vaginal impedance at the cervix and vestibular impedance 5 cm from the vulva measured by means of a four-terminal method during the oestrous cycle display cyclic changes that are closely related to the oestrous behaviour of goats.

  17. Superconducting fault current-limiter with variable shunt impedance

    Science.gov (United States)

    Llambes, Juan Carlos H; Xiong, Xuming

    2013-11-19

    A superconducting fault current-limiter is provided, including a superconducting element configured to resistively or inductively limit a fault current, and one or more variable-impedance shunts electrically coupled in parallel with the superconducting element. The variable-impedance shunt(s) is configured to present a first impedance during a superconducting state of the superconducting element and a second impedance during a normal resistive state of the superconducting element. The superconducting element transitions from the superconducting state to the normal resistive state responsive to the fault current, and responsive thereto, the variable-impedance shunt(s) transitions from the first to the second impedance. The second impedance of the variable-impedance shunt(s) is a lower impedance than the first impedance, which facilitates current flow through the variable-impedance shunt(s) during a recovery transition of the superconducting element from the normal resistive state to the superconducting state, and thus, facilitates recovery of the superconducting element under load.

  18. A review of impedance measurements of whole cells.

    Science.gov (United States)

    Xu, Youchun; Xie, Xinwu; Duan, Yong; Wang, Lei; Cheng, Zhen; Cheng, Jing

    2016-03-15

    Impedance measurement of live biological cells is widely accepted as a label free, non-invasive and quantitative analytical method to assess cell status. This method is easy-to-use and flexible for device design and fabrication. In this review, three typical techniques for impedance measurement, i.e., electric cell-substrate impedance sensing, Impedance flow cytometry and electric impedance spectroscopy, are reviewed from the aspects of theory, to electrode design and fabrication, and applications. Benefiting from the integration of microelectronic and microfluidic techniques, impedance sensing methods have expanded their applications to nearly all aspects of biology, including living cell counting and analysis, cell biology research, cancer research, drug screening, and food and environmental safety monitoring. The integration with other techniques, the fabrication of devices for certain biological assays, and the development of point-of-need diagnosis devices is predicted to be future trend for impedance sensing techniques. Copyright © 2015 Elsevier B.V. All rights reserved.

  19. Battery impedance spectroscopy using bidirectional grid connected converter

    Indian Academy of Sciences (India)

    SHIMUL KUMAR DAM; VINOD JOHN

    2017-08-01

    Battery impedance can provide valuable insight into the condition of the battery. Commercially available impedance measurement instruments are expensive. Hence their direct use in a battery management system is not justifiable. In this work, a 3-kW bi-directional converter for charging and discharging a batterybank has been implemented with the capability of impedance measurement. The converter is grid connected and controlled to operate at unity power factor. Additional requirements on filter design and control structure of battery converter for impedance measurement are discussed. An algorithm has been developed to measure impedance by frequency sweep, avoiding transients. The measured impedance has been compared to that from a commercially available impedance measurement equipment and is shown to have a good match.

  20. Impedance analysis of Bi3.25La0.75Ti3O12 ferroelectric ceramic

    Indian Academy of Sciences (India)

    S Rachna; Surya M Gupta; S Bhattacharyya

    2008-09-01

    AC impedance spectroscopy technique has been used to study electrical properties of Bi3.25La0.75Ti3O12 (BLT) ceramic. Complex impedance plots were fitted with three depressed semicircles, which are attributed to crystalline layer, plate boundary and grain boundary and all three were found to comprise of universal capacitance nature [ = 0−1]. Grain boundary resistance and capacitance evaluated from complex impedance plots have larger values than that of plate boundary and crystalline layer. The activation energies (a) for DC-conductance in grain boundary, plate boundary and crystalline layer are 0.68 eV, 0.89 eV and 0.89 eV, respectively. Relaxation activation energies calculated from impedance plots showed similar values, 0.81 eV and 0.80 eV for crystalline layer and plate boundary, respectively. These activation energy values are found to be consistent with the a value of oxygen vacancies in perovskite materials. A mechanism is offered to explain the generation of oxygen vacancies in BLT ceramic and its role in temperature dependence of DC-conductance study.

  1. Electrochemical impedance spectroscopy analysis of a thin polymer film-based micro-direct methanol fuel cell

    Energy Technology Data Exchange (ETDEWEB)

    Schulz, Tobias; Weinmueller, Christian; Nabavi, Majid; Poulikakos, Dimos [Department of Mechanical and Process Engineering, Laboratory of Thermodynamics in Emerging Technologies, Institute of Energy Technology, ETH Zurich, CH-8092 Zurich (Switzerland)

    2010-11-15

    A single cell micro-direct methanol fuel cell (micro-DMFC) was investigated using electrochemical impedance spectroscopy. The electrodes consisted of thin, flexible polymer (SU8) film microchannel structures fabricated in-house using microfabrication techniques. AC impedance spectroscopy was used to separate contributions to the overall cell polarization from the anode, cathode and membrane. A clear distinction between the different electrochemical phenomena occurring in the micro-DMFC, especially the distinction between double layer charging and Faradaic reactions was shown. The effect of fuel flow rate, temperature, and anode flow channel structure on the impedance of the electrode reactions and membrane/electrode double layer charging were investigated. Analysis of impedance data revealed that the performance of the test cell was largely limited by the presence of intermediate carbon monoxide in the anode reaction. Higher temperatures increase cell performance by enabling intermediate CO to be oxidized at much higher rates. The results also revealed that serpentine anode flow microchannels show a lower tendency to intermediate CO coverage and a more stable cell behavior than parallel microchannels. (author)

  2. Two-Point Stretchable Electrode Array for Endoluminal Electrochemical Impedance Spectroscopy Measurements of Lipid-Laden Atherosclerotic Plaques.

    Science.gov (United States)

    Packard, René R Sevag; Zhang, XiaoXiao; Luo, Yuan; Ma, Teng; Jen, Nelson; Ma, Jianguo; Demer, Linda L; Zhou, Qifa; Sayre, James W; Li, Rongsong; Tai, Yu-Chong; Hsiai, Tzung K

    2016-09-01

    Four-point electrode systems are commonly used for electric impedance measurements of biomaterials and tissues. We introduce a 2-point system to reduce electrode polarization for heterogeneous measurements of vascular wall. Presence of endoluminal oxidized low density lipoprotein (oxLDL) and lipids alters the electrochemical impedance that can be measured by electrochemical impedance spectroscopy (EIS). We developed a catheter-based 2-point micro-electrode configuration for intravascular deployment in New Zealand White rabbits. An array of 2 flexible round electrodes, 240 µm in diameter and separated by 400 µm was microfabricated and mounted on an inflatable balloon catheter for EIS measurement of the oxLDL-rich lesions developed as a result of high-fat diet-induced hyperlipidemia. Upon balloon inflation, the 2-point electrode array conformed to the arterial wall to allow deep intraplaque penetration via alternating current (AC). The frequency sweep from 10 to 300 kHz generated an increase in capacitance, providing distinct changes in both impedance (Ω) and phase (ϕ) in relation to varying degrees of intraplaque lipid burden in the aorta. Aortic endoluminal EIS measurements were compared with epicardial fat tissue and validated by intravascular ultrasound and immunohistochemistry for plaque lipids and foam cells. Thus, we demonstrate a new approach to quantify endoluminal EIS via a 2-point stretchable electrode strategy.

  3. Origin of Capacity Fading in Nano-Sized Co3O4Electrodes: Electrochemical Impedance Spectroscopy Study

    Science.gov (United States)

    2008-01-01

    Transition metal oxides have been suggested as innovative, high-energy electrode materials for lithium-ion batteries because their electrochemical conversion reactions can transfer two to six electrons. However, nano-sized transition metal oxides, especially Co3O4, exhibit drastic capacity decay during discharge/charge cycling, which hinders their practical use in lithium-ion batteries. Herein, we prepared nano-sized Co3O4with high crystallinity using a simple citrate-gel method and used electrochemical impedance spectroscopy method to examine the origin for the drastic capacity fading observed in the nano-sized Co3O4anode system. During cycling, AC impedance responses were collected at the first discharged state and at every subsequent tenth discharged state until the 100th cycle. By examining the separable relaxation time of each electrochemical reaction and the goodness-of-fit results, a direct relation between the charge transfer process and cycling performance was clearly observed.

  4. Impedance analysis of an enhanced piezoelectric biosensor

    Science.gov (United States)

    Kim, Gi-Ho

    This study investigated the usefulness and characteristics of a five-megahertz quartz crystal resonator oscillating in a thickness-shear mode as a sensor of biological pathogens such as Salmonella typhimurium . An impedance analyzer measured the impedance of the oscillating quartz crystal, which determined all mechanical properties of the oscillating quartz and its immediate environment. In this study, the impedance behavior of the bare crystal was characterized in air and in potassium phosphate buffer solution. The potassium phosphate buffer was a Newtonian liquid. The resonance frequency of the oscillating quartz shifted down about 900 Hz by contacting with the buffer. An immobilized-antibody layer on the quartz surface behaved like a rigid mass when immersed in the buffer solution. The quartz crystal with immobilized antibodies was characterized in various solutions containing antibody- coated paramagnetic microspheres and varying concentrations of Salmonella typhimurium (102 - 108 cells/ml). The Salmonella cells were captured by antibody- coated paramagnetic microspheres, and then these complexes were moved magnetically to the oscillating quartz and were captured by antibodies immobilized on the crystal surface. The response of the crystal was expressed in terms of equivalent circuit parameters. The motional inductance and the motional resistance increased as a function of the concentration of Salmonella. The viscous damping was the main contribution to the resistance and the inductance in a liquid environment. The load resistance was the most effective and sensitive circuit parameter. A magnetic force was a useful method to collect the complexes of Salmonella-microspheres on the crystal surface and enhance the response sensor. In this system, the detection limit, based on resistance monitoring, was about 103 cells/ml.

  5. Electrochemical characterization of the LiCoO{sub 2}/acetylene carbon ratios for porous electrodes in alkaline lithium aqueous solutions by electrochemical impedance spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Castaneda, H., E-mail: castanedah@battelle.or [Battelle Memorial Institute, 505 King Avenue, Columbus OH, 43201 (United States); Tan, B.; Saunders, J. [Battelle Memorial Institute, 505 King Avenue, Columbus OH, 43201 (United States)

    2010-05-01

    LiCoO{sub 2} electrodes were fabricated with different acetylene carbon (AC) additions and fixed binder content. Subsequent electrochemical testing showed different processes at the interface that are related to pore distribution and electrode composition. Electrochemical impedance spectroscopy characterized the mechanisms close to open circuit conditions. The active state, combined with diffusion mechanisms within the cylindrical pores, contributed to the functionality of the particles according to the LiCoO{sub 2}/AC content, and surface characteristics of the electrode influenced the impedance distribution. The de Levie theory for porous electrode was used to describe the influence of the LiCoO{sub 2}/AC ratios in the impedance distribution when exposed to alkaline aqueous electrolytes (LiOH + Li{sub 2}SO{sub 4}). The pore model helped relate physical properties of the composite material, such as pore count, pore length, and double layer capacitance, with the mechanisms present at the interface. The theoretical model was validated with experimental data and the fitting process resulted in good agreement.

  6. Effect of the magnetic material on AC losses in HTS conductors in AC magnetic field carrying AC transport current

    Science.gov (United States)

    Wan, Xing-Xing; Huang, Chen-Guang; Yong, Hua-Dong; Zhou, You-He

    2015-11-01

    This paper presents an investigation on the AC losses in several typical superconducting composite conductors using the H-formulation model. A single superconducting strip with ferromagnetic substrate or cores and a stack of coated conductors with ferromagnetic substrates are studied. We consider all the coated conductors carrying AC transport currents and simultaneously exposed to perpendicular AC magnetic fields. The influences of the amplitude, frequency, phase difference and ferromagnetic materials on the AC losses are investigated. The results show that the magnetization losses of single strip and stacked strips have similar characteristics. The ferromagnetic substrate can increase the magnetization loss at low magnetic field, and decrease the loss at high magnetic field. The ferromagnetic substrate can obviously increase the transport loss in stacked strips. The trends of total AC losses of single strip and stacked strips are similar when they are carrying current or exposed to a perpendicular magnetic field. The effect of the frequency on the total AC losses of single strip is related to the amplitude of magnetic field. The AC losses decrease with increasing frequency in low magnetic field region while increase in high magnetic field region. As the phase difference changes, there is a periodic variation for the AC losses. Moreover, when the strip is under only the transport current and magnetic field, the ferromagnetic cores will increase the AC losses for large transport current or field.

  7. Some boundary problems in electrical impedance tomography.

    Science.gov (United States)

    Pidcock, M; Ciulli, S; Ispas, S

    1996-11-01

    Accurate mathematical modelling is important in the development of iterative image reconstruction algorithms for electrical impedance tomography (EIT). In such schemes the forward problem of calculating the electric potential from Neumann boundary data is solved many times. One aspect of this problem which has received some attention is the mathematical modelling of the electrodes used in the technique. In this paper we describe an integral equation formulation of a boundary value problem associated with this tissue and we indicate some of the ways in which this formulation can be used to obtain numerical and analytic results.

  8. Method for conducting nonlinear electrochemical impedance spectroscopy

    Science.gov (United States)

    Adler, Stuart B.; Wilson, Jamie R.; Huff, Shawn L.; Schwartz, Daniel T.

    2015-06-02

    A method for conducting nonlinear electrochemical impedance spectroscopy. The method includes quantifying the nonlinear response of an electrochemical system by measuring higher-order current or voltage harmonics generated by moderate-amplitude sinusoidal current or voltage perturbations. The method involves acquisition of the response signal followed by time apodization and fast Fourier transformation of the data into the frequency domain, where the magnitude and phase of each harmonic signal can be readily quantified. The method can be implemented on a computer as a software program.

  9. Coupled Transmission Lines as Impedance Transformer

    DEFF Research Database (Denmark)

    Jensen, Thomas; Zhurbenko, Vitaliy; Krozer, Viktor

    2007-01-01

    A theoretical investigation of the use of a coupled line section as an impedance transformer is presented. We show how to properly select the terminations of the coupled line structures for effective matching of real and complex loads in both narrow and wide frequency ranges. The corresponding....... Wideband matching performance with relative bandwidth beyond 100% and return loss > 20 dB is demonstrated both theoretically and experimentally. Good agreement is achieved between the measured and predicted performance of the coupled line transformer section....

  10. LHC MD 232: Longitudinal Impedance Evaluation

    CERN Document Server

    Esteban Muller, Juan; Baudrenghien, Philippe; Shaposhnikova, Elena; CERN. Geneva. ATS Department

    2017-01-01

    The aim of the MDstudies presented here was to evaluate the imaginary part of the longitudinal impedance of the LHC by means of synchrotron frequency shift measurements. Single bunches with similar longitudinal emittance but different intensities were studied at flat top. Based on the beam parameters, a maximum shift of about 0.2 Hz was expected between the different bunches. A detailed analysis still needs to be carried out to determine the measured synchrotron frequency shift. The measurements took place between 8:00 p.m. on 26th and 2:00 a.m. on 27th July 2016

  11. Broadband Planar 5:1 Impedence Transformer

    Science.gov (United States)

    Ehsan, Negar; Hsieh, Wen-Ting; Moseley, Samuel H.; Wollack, Edward J.

    2015-01-01

    This paper presents a broadband Guanella-type planar impedance transformer that transforms so 50 omega to 10 omega with a 10 dB bandwidth of 1-14GHz. The transformer is designed on a flexible 50 micrometer thick polyimide substrate in microstrip and parallel-plate transmission line topologies, and is Inspired by the traditional 4:1 Guanella transformer. Back-to-back transformers were designed and fabricated for characterization in a 50 omega system. Simulated and measured results are in excellent agreement.

  12. Impedance matched thin metamaterials make metals absorbing.

    Science.gov (United States)

    Mattiucci, N; Bloemer, M J; Aközbek, N; D'Aguanno, G

    2013-11-13

    Metals are generally considered good reflectors over the entire electromagnetic spectrum up to their plasma frequency. Here we demonstrate an approach to tailor their absorbing characteristics based on the effective metamaterial properties of thin, periodic metallo-dielectric multilayers by exploiting a broadband, inherently non-resonant, surface impedance matching mechanism. Based on this mechanism, we design, fabricate and test omnidirectional, thin ( 99%) over a frequency range spanning from the UV to the IR. Our approach opens new venues to design cost effective materials for many applications such as thermo-photovoltaic energy conversion devices, light harvesting for solar cells, flat panel display, infrared detectors, stray light reduction, stealth and others.

  13. Resistor network approaches to electrical impedance tomography

    CERN Document Server

    Borcea, Liliana; Vasquez, Fernando Guevara; Mamonov, Alexander V

    2011-01-01

    We review a resistor network approach to the numerical solution of the inverse problem of electrical impedance tomography (EIT). The networks arise in the context of finite volume discretizations of the elliptic equation for the electric potential, on sparse and adaptively refined grids that we call optimal. The name refers to the fact that the grids give spectrally accurate approximations of the Dirichlet to Neumann map, the data in EIT. The fundamental feature of the optimal grids in inversion is that they connect the discrete inverse problem for resistor networks to the continuum EIT problem.

  14. Transferring human impedance regulation skills to robots

    CERN Document Server

    Ajoudani, Arash

    2016-01-01

    This book introduces novel thinking and techniques to the control of robotic manipulation. In particular, the concept of teleimpedance control as an alternative method to bilateral force-reflecting teleoperation control for robotic manipulation is introduced. In teleimpedance control, a compound reference command is sent to the slave robot including both the desired motion trajectory and impedance profile, which are then realized by the remote controller. This concept forms a basis for the development of the controllers for a robotic arm, a dual-arm setup, a synergy-driven robotic hand, and a compliant exoskeleton for improved interaction performance.

  15. Method for conducting nonlinear electrochemical impedance spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Adler, Stuart B.; Wilson, Jamie R.; Huff, Shawn L.; Schwartz, Daniel T.

    2015-06-02

    A method for conducting nonlinear electrochemical impedance spectroscopy. The method includes quantifying the nonlinear response of an electrochemical system by measuring higher-order current or voltage harmonics generated by moderate-amplitude sinusoidal current or voltage perturbations. The method involves acquisition of the response signal followed by time apodization and fast Fourier transformation of the data into the frequency domain, where the magnitude and phase of each harmonic signal can be readily quantified. The method can be implemented on a computer as a software program.

  16. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

  17. Single stage buck-boost DC-AC neutral point clamped inverter

    DEFF Research Database (Denmark)

    Mo, Wei; Loh, Poh Chiang; Andrew, A.;

    2012-01-01

    This paper proposes a new single stage buck-boost DC-AC neutral point clamped inverter topology which integrates the cascaded configurations of recently introduced inductor-capacitor-capacitor-transformer impedance source network (by Adamowicz) and classic NPC configuration. As a consequence...... windings thus preventing the core from saturation; lowers the voltage stresses and power losses of inverter switches and reduces the sizes of filtering devices and as well as obtains better output performance compared to the original two-level Z-source inverters. A phase disposition pulse width modulation...

  18. GaAs/Ge solar cell AC parameters at different temperatures

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, R. Anil; Suresh, M.S. [ISRO Satellite centre, ISRO, Bangalore 560 017 (India); Nagaraju, J. [Department of Instrumentation, Indian Institute of Science, Bangalore 560 012 (India)

    2003-05-15

    The AC parameters of Gallium Arsenide (GaAs/Ge) solar cell were measured at different cell temperatures (198-348K) by varying the cell bias voltage (forward and reverse) under dark condition using impedance spectroscopy technique. It was found that the cell capacitance increases with the cell temperature where as the cell resistance decreases, at any bias voltage. The measured cell parameters were used to calculate the intrinsic concentration of electron-hole pair, cell material relative permittivity and its band gap energy. The diode factor and the cell dynamic resistance at the corresponding maximum power point decrease with the cell temperature.

  19. Angiostrongylus cantonensis cathepsin B-like protease (Ac-cathB-1 is involved in host gut penetration

    Directory of Open Access Journals (Sweden)

    Long Ying

    2015-01-01

    Full Text Available Although the global spread of the emerging zoonosis, human angiostrongyliasis, has attracted increasing attention, understanding of specific gene function has been impeded by the inaccessibility of genetic manipulation of the pathogen nematode causing this disease, Angiostrongylus cantonensis. Many parasitic proteases play key roles in host-parasite interactions, but those of A. cantonensis are always expressed as the inactive form in prokaryotic expression systems, thereby impeding functional studies. Hence, a lentiviral system that drives secreted expression of target genes fused to a Myc-His tag was used to obtain recombinant Ac-cathB-1 with biological activity. Although this class of proteases was always reported to function in nutrition and immune evasion in parasitic nematodes, recombinant Ac-cathB-1 was capable of hydrolysis of fibronectin and laminin as well as the extracellular matrix of IEC-6 monolayer, so that the intercellular space of the IEC-6 monolayer increased 5.15 times as compared to the control, while the shape of the adherent cells partly rounded up. This suggests a probable role for this protease in intestinal epithelial penetration. The inhibition of Ac-cathB-1 enzymatic activity with antiserum partly suppressed larval penetration ability in the isolated intestine. Thus, an effective system for heterologous expression of parasite proteases is presented for studying gene function in A. cantonensis; and Ac-cathB-1 was related to larval penetration ability in the host small intestine.

  20. Control of grid interactive AC microgrids

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Guerrero, Josep M.; Chen, Zhe

    2010-01-01

    and reliability, becomes an attractive candidate for the configuration of future electrical power system. This paper gives a brief review of grid interactive ac microgrid configurations. Control methods for power electronics interfaced DER units in grid interactive ac microgrids are discussed. In addition......, microgrid controls and power management strategies are presented. Future trends of microgrid are discussed pointing out how this concept can be a key to achieve a more intelligent and flexible AC grid....

  1. Modelling and analysis of current-programmed ac/dc converters

    Science.gov (United States)

    Tymerski, R. P. E.; Daly, K. C.

    1985-03-01

    Current-programmed dc/dc converters operating at a fixed switching frequency are analyzed using state-space averaged modeling. For converters operating in the continuous conduction mode, general closed form expressions that describe the dynamic ac small signal characteristics of the converter are obtained. A reduced order model is used to derive the control current input-to-output voltage, audio susceptibility and output impedance small signal ac transfer functions for the ideal buck, boost, and buck-boost converters operating in the continuous conduction model. It is shown that state-space averaging can correctly predict instability on the buck converter. Current-programmed converters operating in the discontinuous conduction mode are addressed, showing that the transfer functions are represented by a finite pole and a zero at infinity. Instability is predicted for the buck converter when an external ramp is omitted and the output-to-input voltage ratio is greater than or equal to two-thirds.

  2. Resonance reduction for AC drives with small capacitance in the DC link

    DEFF Research Database (Denmark)

    Máthé, Lászlo; Török, Lajos; Wang, Dong;

    2016-01-01

    Pulse Width Modulated AC drives equipped with small DC-link capacitor are becoming an attractive solution for electric drive applications with moderate requirements for shaft dynamic performance. However, when these drives are fed from a weak grid a resonance between the line side impedance and t...... from the motor current. The method has been experimentally validated and the results show excellent performance. Moreover, the proposed compensation method can be applied for any kind of load connected to a three-phase passive rectifier equipped with small capacitor....... and the DC-link capacitor appears. Due to this resonance, the THD and the partially weighted harmonic distortion of the line currents are increased, which may rise compatibility problems with the AC line harmonic standards. By using vector control the motor drive is transformed into a constant power load...

  3. Study on Impedance Characteristics of Aircraft Cables

    Directory of Open Access Journals (Sweden)

    Weilin Li

    2016-01-01

    Full Text Available Voltage decrease and power loss in distribution lines of aircraft electric power system are harmful to the normal operation of electrical equipment and may even threaten the safety of aircraft. This study investigates how the gap distance (the distance between aircraft cables and aircraft skin and voltage frequency (variable frequency power supply will be adopted for next generation aircraft will affect the impedance of aircraft cables. To be more precise, the forming mechanism of cable resistance and inductance is illustrated in detail and their changing trends with frequency and gap distance are analyzed with the help of electromagnetic theoretical analysis. An aircraft cable simulation model is built with Maxwell 2D and the simulation results are consistent with the conclusions drawn from the theoretical analysis. The changing trends of the four core parameters of interest are analyzed: resistance, inductance, reactance, and impedance. The research results can be used as reference for the applications in Variable Speed Variable Frequency (VSVF aircraft electric power system.

  4. Electrochemical Impedance Spectroscopy of Conductive Polymer Coatings

    Science.gov (United States)

    Calle, Luz Marina; MacDowell, Louis G.

    1996-01-01

    Electrochemical impedance spectroscopy (EIS) was used to investigate the corrosion protection performance of twenty nine proprietary conductive polymer coatings for cold rolled steel under immersion in 3.55 percent NaCl. Corrosion potential as well as Bode plots of the data were obtained for each coating after one hour immersion, All coatings, with the exception of one, have a corrosion potential that is higher in the positive direction than the corrosion potential of bare steel under the same conditions. Group A consisted of twenty one coatings with Bode plots indicative of the capacitive behavior characteristic of barrier coatings. An equivalent circuit consisting of a capacitor in series with a resistor simulated the experimental EIS data for these coatings very well. Group B consisted of eight coatings that exhibited EIS spectra showing an inflection point which indicates that two time constants are present. This may be caused by an electrochemical process taking place which could be indicitive of coating failing. These coatings have a lower impedance that those in Group A.

  5. RHIC spin flipper AC dipole controller

    Energy Technology Data Exchange (ETDEWEB)

    Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.

    2011-03-28

    The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.

  6. AcEST: DK959751 [AcEST

    Lifescience Database Archive (English)

    Full Text Available .. 86 1e-16 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens G... 72 3e-12 sp|Q6PFQ7|RASL2_MOU...SE Ras GTPase-activating protein 4 OS=Mus mus... 72 4e-12 sp|Q3TZZ7|ESYT2_MOUSE Extended...ivating-like protein 1 OS=Mus mu... 65 3e-10 sp|Q5M7N9|ESYT3_XENTR Extended synaptotagmin-3 OS=Xenopus tropi... 1 OS=Homo s... 61 6e-09 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 61 6e-09 sp|Q7ZWU7|EST2B_XENLA Extended... synaptotagmin-2-B OS=Xenopus laev... 60 1e-08 sp|Q5FWL4|EST2A_XENLA Extended

  7. AcEST: BP920842 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ta... 59 6e-09 sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin-2 OS=Mus musculus G... 59 7e-09 sp|Q9ZT47|PP16A_...CUCMA 16 kDa phloem protein 1 OS=Cucurbita maxim... 57 2e-08 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 ... domain-conta... 56 6e-08 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 55 8e-08 sp|A0FGR9|ESYT3_HUMAN Extended... synaptotagmin-3 OS=Homo sapiens G... 55 1e-07 sp|Q5DTI8|ESYT3_MOUSE Extended synap...totagmin-3 OS=Mus musculus G... 54 2e-07 sp|Q5M7N9|ESYT3_XENTR Extended synaptota

  8. AcEST: DK956298 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AIZE Glutamate dehydrogenase OS=Zea mays GN=GDH1... 370 e-102 sp|Q43314|DHE1_ARATH Glutamate dehydrogenase 1...HGK 202 >sp|P93541|DHE3_SOLLC Glutamate dehydrogenase OS=Solanum lycopersicum GN=GDH1 PE=2 SV=1 Length = 412...RG ++A EALL ++G+ Sbjct: 181 RDAATGRGALFATEALLNEHGK 202 >sp|Q43260|DHE3_MAIZE Glutamate dehydrogenase OS=Zea mays GN=GDH1...ATH Glutamate dehydrogenase 1 OS=Arabidopsis thaliana GN=GDH1 PE=1 SV=1 Length = 411 Score = 369 bits (946),...AC Glutamate dehydrogenase OS=Nicotiana taba... 376 e-103 tr|A7YVW3|A7YVW3_ACTCH GDH1 OS=Actinidia chinensis GN=GDH1

  9. Impedance and self-discharge mechanism studies of nickel metal hydride batteries for energy storage applications

    Science.gov (United States)

    Zhu, Wenhua; Zhu, Ying; Tatarchuk, Bruce

    2013-04-01

    Nickel metal hydride battery packs have been found wide applications in the HEVs (hybrid electric vehicles) through the on-board rapid energy conservation and efficient storage to decrease the fossil fuel consumption rate and reduce CO2 emissions as well as other harmful exhaust gases. In comparison to the conventional Ni-Cd battery, the Ni-MH battery exhibits a relatively higher self-discharge rate. In general, there are quite a few factors that speed up the self-discharge of the electrodes in the sealed nickel metal hydride batteries. This disadvantage eventually reduces the overall efficiency of the energy conversion and storage system. In this work, ac impedance data were collected from the nickel metal hydride batteries. The self-discharge mechanism and battery capacity degradation were analyzed and discussed for further performance improvement.

  10. Electrical Conductivity of Synthetic Quartz Crystals at High Temperature and Pressure from Complex Impedance Measurements

    Institute of Scientific and Technical Information of China (English)

    王多君; 李和平; 刘丛强; 易丽; 丁东业; 苏根利; 张卫刚

    2002-01-01

    An electrical conductivity measurement system under high-pressure conditions with a multi-anvil high-pressure apparatus by an ac complex impedance method was set up. With this system, we have successfully measured the electrical conductivity of synthetic quartz under pressure up to approximately 1.0 GPa in the temperature range 661-987K. The values of electrical conductivity decrease with the increasing pressure and increase with the increasing temperature. The activation enthalpies for the α-quartz crystals are 1.10-1.28eV. The electrical conductivity of α-quartz is ionic, with Na ions moving in channels parallel to the c-axis being the predominant current carrier.

  11. A microprocessor-based digital feeder monitor with high-impedance fault detection

    Energy Technology Data Exchange (ETDEWEB)

    Patterson, R.; Tyska, W. [GE Protection and Control, Malvern, PA (United States); Russell, B.D. [Texas A& M Univ., College Station, TX (United States)] [and others

    1994-12-31

    The high impedance fault detection technology developed at Texas A&M University after more than a decade of research, funded in large part by the Electric Power Research Institute, has been incorporated into a comprehensive monitoring device for overhead distribution feeders. This digital feeder monitor (DFM) uses a high waveform sampling rate for the ac current and voltage inputs in conjunction with a high-performance reduced instruction set (RISC) microprocessor to obtain the frequency response required for arcing fault detection and power quality measurements. Expert system techniques are employed to assure security while maintaining dependability. The DFM is intended to be applied at a distribution substation to monitor one feeder. The DFM is packaged in a non-drawout case which fits the panel cutout for a GE IAC overcurrent relay to facilitate retrofits at the majority of sites were electromechanical overcurrent relays already exist.

  12. Giant Magneto-Impedance Effect in Sandwiched FeSiB/Cu/FeSiB Films

    Institute of Scientific and Technical Information of China (English)

    ZHOU Yong; YANG Chun-Sheng; YU Jin-Qiang; ZHAO Xiao-Lin; MAO Hai-Ping

    2000-01-01

    Giant magneto-impedance (GMI) effect has been realized in the sandwiched FeSiB/Cu/FeSiB films. With magnetic field Ha and ac current applied along the longitudinal direction of the sample, the GMI ratio increases with the increasing Ha, reaching a positive maximum, value, and then decreases to negative values with further increase of magnetic field. Field dependence of the GMI ratio also indicates that the magnetic field corresponding to the maximum GMI ratio is different for various frequencies. The positive maximum GMI ratio is 17.2% for Ha=1600 A/m and frequency of 3 MHz. In addition, the films display a large negative GMI ratio with a magnetic field applied along the transverse direction and the value of the GMI ratio is about -13.4% for Ha=5600A/m and frequency of 3 MHz.

  13. Impedance studies of a green blend polymer electrolyte based on PVA and Aloe-vera

    Science.gov (United States)

    Selvalakshmi, S.; Mathavan, T.; Vijaya, N.; Selvasekarapandian, Premalatha, M.; Monisha, S.

    2016-05-01

    The development of polymer electrolyte materials for energy generating and energy storage devices is a challenge today. A new type of blended green electrolyte based on Poly-vinyl alcohol (PVA) and Aloe-vera has been prepared by solution casting technique. The blending of polymers may lead to the increase in stability due to one polymer portraying itself as a mechanical stiffener and the other as a gelled matrix supported by the other. The prepared blend electrolytes were subjected to Ac impedance studies. It has been found out that the polymer film in which 1 gm of PVA was dissolved in 40 ml of Aloe-vera extract exhibits highest conductivity and its value is 3.08 × 10-4 S cm-1.

  14. Correlation between Electrochemical Impedance Spectroscopy and Structural Properties of Amorphous Tunisian Metanacrite Synthetic Material

    Directory of Open Access Journals (Sweden)

    Nouha Jaafar

    2014-01-01

    Full Text Available In the present work, we report the structural and electrochemical properties of metanacrite. Metanacrite is a synthetic material originated by heating (550°C of a clay mineral (Tunisian nacrite belonging to the kaolin group. The structure of the amorphous synthetic product was corroborated by X-ray diffraction (disappearing of nacrite peaks and infrared spectroscopy (disappearing of Al–OH and water bands. The decomposition of the silicate framework was confirmed by transmission electron microscope (TEM. The obtained metanacrite synthetic material was also examined by electrochemical impedance spectroscopy (EIS. Accordingly, the electronic conduction is followed by the correlated barrier hopping (C.B.H. model. Therefore, by combining ac and dc electrical conductivity, a semiconductor behavior is evidenced. The dependence of the dielectric constant (ε′ and dielectric loss (ε″ on both temperature and frequency is also discussed.

  15. Study on electrical impedance matching for broadband ultrasonic transducer

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Geon Woo [University of Science and Technology, Daejeon (Korea, Republic of); Kim, Ki Bok [Korea Research Institute of Standards and Science, Center for Safety Measurement, Daejeon (Korea, Republic of); Baek, Kwang Sae [Elache Co., Busan (Korea, Republic of)

    2017-02-15

    Ultrasonic transducers with high resolution and resonant frequency are required to detect small defects (less than hundreds of μm) by ultrasonic testing. The resonance frequency and resolution of an ultrasonic transducer are closely related to the thickness of piezo-electric materials, backing materials, and the electric impedance matching technique. Among these factors, electrical impedance matching plays an important role because it can reduce the loss and reflection of ultrasonic energy differences in electrical impedance between an ultrasonic transducer and an ultrasonic defects detecting system. An LC matching circuit is the most frequently used electric matching method. It is necessary for the electrical impedance of an ultrasonic transducer to correspond to approximately 50 Ω to compensate the difference in electrical impedance between both connections. In this study, a 15 MHz immersion ultrasonic transducer was fabricated and an LC electrical impedance circuit was applied to that for having broad-band frequency characteristic.

  16. Transverse impedance measurement in RHIC and the AGS

    Energy Technology Data Exchange (ETDEWEB)

    Biancacci, Nicolo [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Blaskiewicz, M. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Dutheil, Y. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Liu, C. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Mernick, M. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Minty, M. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; White, S. M. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.

    2014-05-12

    The RHIC luminosity upgrade program aims for an increase of the polarized proton luminosity by a factor 2. To achieve this goal a significant increase in the beam intensity is foreseen. The beam coupling impedance could therefore represent a source of detrimental effects for beam quality and stability at high bunch intensities. For this reason it is essential to quantify the accelerator impedance budget and the major impedance sources, and possibly cure them. In this MD note we summarize the results of the 2013 transverse impedance measurements in the AGS and RHIC. The studies have been performed measuring the tune shift as a function of bunch intensity and deriving the total accelerator machine transverse impedance. For RHIC, we could obtain first promising results of impedance localization measurements as well.

  17. Breathing detection with a portable impedance measurement system: first measurements.

    Science.gov (United States)

    Cordes, Axel; Foussier, Jerome; Leonhardt, Steffen

    2009-01-01

    For monitoring the health status of individuals, detection of breathing and heart activity is important. From an electrical point of view, it is known that breathing and heart activity change the electrical impedance distribution in the human body over the time due to ventilation (high impedance) and blood shifts (low impedance). Thus, it is possible to detect both important vital parameters by measuring the impedance of the thorax or the region around lung and heart. For some measurement scenarios it is also essential to detect these parameters contactless. For instance, monitoring bus drivers health could help to limit accidents, but directly connected systems limit the drivers free moving space. One measurement technology for measuring the impedance changes in the chest without cables is the magnetic impedance tomography (MIT). This article describes a portable measurement system we developed for this scenario that allows to measure breathing contactless. Furthermore, first measurements with five volunteers were performed and analyzed.

  18. Mapping entrained brain oscillations during transcranial alternating current stimulation (tACS).

    Science.gov (United States)

    Witkowski, Matthias; Garcia-Cossio, Eliana; Chander, Bankim S; Braun, Christoph; Birbaumer, Niels; Robinson, Stephen E; Soekadar, Surjo R

    2016-10-15

    Transcranial alternating current stimulation (tACS), a non-invasive and well-tolerated form of electric brain stimulation, can influence perception, memory, as well as motor and cognitive function. While the exact underlying neurophysiological mechanisms are unknown, the effects of tACS are mainly attributed to frequency-specific entrainment of endogenous brain oscillations in brain areas close to the stimulation electrodes, and modulation of spike timing dependent plasticity reflected in gamma band oscillatory responses. tACS-related electromagnetic stimulator artifacts, however, impede investigation of these neurophysiological mechanisms. Here we introduce a novel approach combining amplitude-modulated tACS during whole-head magnetoencephalography (MEG) allowing for artifact-free source reconstruction and precise mapping of entrained brain oscillations underneath the stimulator electrodes. Using this approach, we show that reliable reconstruction of neuromagnetic low- and high-frequency oscillations including high gamma band activity in stimulated cortical areas is feasible opening a new window to unveil the mechanisms underlying the effects of stimulation protocols that entrain brain oscillatory activity.

  19. Final design of the Korean AC/DC converters for the ITER coil power supply system

    Energy Technology Data Exchange (ETDEWEB)

    Oh, Jong-Seok, E-mail: jsoh@nfri.re.kr [ITER Korea, National Fusion Research Institute, Daejeon 305-806 (Korea, Republic of); Choi, Jungwan; Suh, Jae-Hak; Choi, Jihyun [ITER Korea, National Fusion Research Institute, Daejeon 305-806 (Korea, Republic of); Lee, Lacksang; Kim, Changwoo; Park, Hyungjin; Jo, Seongman; Lee, Seungyun; Hwang, Kwangcheol; Liu, Hyoyol [Dawonsys Corp., Siheung 429-450 (Korea, Republic of); Hong, Ki-Don; Sim, Dong-Joon; Lee, Jang-Soo [Hyosung Corp., Gongdeok-Dong, Seoul 121-720 (Korea, Republic of); Lee, Eui-Jae; Kwon, Yang-Hae; Lee, Dae-Yeol; Ko, Ki-Won; Kim, Jong-Min [Mobiis Corp., Yangjae-dong, Seoul 137-888 (Korea, Republic of); Song, Inho [ITER Organization, Route de Vinon sur Verdon, CS 90 046, 13067 St. Paul Lez Durance Cedex (France); and others

    2015-10-15

    The final design of the ITER TF, CS, CC and VS AC/DC converters has been completed to implement ITER requirements following the detailed design and refinements of the preliminary design. The number of parallel thyristors and the rating of fuses are coordinated to keep those devices within the explosion limit even under most severe fault conditions. The impedance of the converter transformer has been optimized taking into account the energization inrush current, short circuit current, reactive power consumption and the available DC voltage. To ensure system integrity, AC/DC converters are mechanically divided into transformers, AC busbars, 6-pulse bridges, DC interconnecting busbars and DC reactors, and then all subsystems are decoupled by flexible links. To provide stable real time network communication down to the converters, a one GbE link is deployed between master controllers and local controllers. IEEE 1588 is implemented to the embedded controllers for precision time synchronization. This paper describes the detailed solutions implemented in the final design for the ITER AC/DC converters with R&D results of converter prototypes.

  20. Reciprocity and mutual impedance formulas within lossy cavities

    Directory of Open Access Journals (Sweden)

    F. Gronwald

    2005-01-01

    Full Text Available We discuss the validity of reciprocity and mutual impedance formulas within lossy cavities. Mutual impedance formulas are well-known from antenna theory and useful to describe the electromagnetic coupling between electromagnetic interference sources and victims. As an example the mutual impedance between two dipole antennas within a lossy rectangular cavity is calculated from a system of coupled Hallén's equations that efficiently is solved by the method of moments.

  1. Line Impedance Estimation Using Active and Reactive Power Variations

    DEFF Research Database (Denmark)

    Timbus, Adrian Vasile; Rodriguez, Pedro; Teodorescu, Remus;

    2007-01-01

    This paper proposes an estimation method of power system impedance based on power variations caused by a distributed power generation system (DPGS) at the point of common coupling (PCC). The proposed algorithm is computationally simple and uses the voltage variations at the point of common coupling...... (PCC) caused by the variations of the power delivered to utility network to derive the value of grid impedance. Accurate estimation of both resistive and inductive part of the impedance is obtained, as the results presented show....

  2. Investigation of the Coupling Paths of a Galvanically Isolated AC/AC Converter

    NARCIS (Netherlands)

    Roc'h, Anne; Zhao, Dongsheng; Leferink, Frank; Polinder, Henk; Ferreira, Braham

    2007-01-01

    A galvanically isolated three-phase AC/AC converter with a high-frequency AC-link has been analyzed from an EMC point of view. This is a special configuration because of a large number of switches, a high frequency transformer, and a fourwire output. The essential coupling paths are identified. Corr

  3. An electrode polarization impedance based flow sensor for low water flow measurement

    Science.gov (United States)

    Yan, Tinghu; Sabic, Darko

    2013-06-01

    This note describes an electrode polarization impedance based flow sensor for low water flow measurement. It consists of two pairs of stainless steel electrodes set apart and inserted into a non-conductive flow tube with each pair of electrodes placed diametrically at the opposite sides. The flow sensor is modeled as a typical four-electrode system of which two electrodes are current-carrying and the other two serve as output pick ups. The polarization impedances of the two current carrying electrodes are affected by water flows resulting in changes of differential potential between the two pick-up electrodes which are separated by the same fluid. The interrogation of the two excitation electrodes with dc biased ac signals offers significantly higher sensor sensitivities to flow. The prototype flow sensor constructed for a 20 mm diameter pipeline was able to measure water flow rate as low as tested at 1.06 l h-1 and remained sensitive at a flow rate of 25.18 l h-1 when it was driven with a sinusoidal voltage at 1000 Hz with a peak ac amplitude of 2 V and a dc offset of +8 V. The nonlinear characteristics of the sensor response indicate that the sensor is more sensitive at low flows and will not be able to measure at very high flows. Additional experiments are needed to evaluate the influences of impurities, chemical species, ions constituents, conductivity and temperature over a practical range of residential water conditions, the effects of fluctuating ground signals, measurement uncertainty, power consumption, compensation of effects and practical operations. The flow sensor (principle) presented may be used as (in) a secondary sensor in combination with an existing electronic water meter to extend the low end of measurement range in residential water metering.

  4. AC polarographic determination of cloxacillin.

    Science.gov (United States)

    Núñez-Vergara, L J; Silva, M M; Squella, J A

    1982-11-01

    Hydrolysis of cloxacillin at pH 4.0 yields an electroactive product which can be determined by polarography. Depending on the concentration of cloxacillin, one of 2 peaks was obtained: The potential ac peaks for a 4.36 mM cloxacillin solution were peak I, -0.23 V and peak II, -0.13 V. For analytical purposes, the first peak was used. A linear relationship was established for levels of cloxacillin between 2.2 X 10(-5) and 2.2 X 10(-3)M. Average recovery was 98.8% (SD 1.8), indicating satisfactory accuracy for the method. Individual capsule and composite assays as well as interference tests are described.

  5. Lower leg electrical impedance after distal bypass surgery

    DEFF Research Database (Denmark)

    Belanger, G K; Bolbjerg, M L; Heegaard, N H

    1998-01-01

    Electrical impedance was determined in 13 patients following distal bypass surgery to evaluate lower leg oedema as reflected by its circumference. Tissue injury was assessed by the plasma concentration of muscle enzymes. After surgery, the volume of the control lower leg increased from 1250 (816...... of troponin I (n = 8). In conclusion, tissue injury was reflected by increases in muscle enzymes in plasma. We found an inverse correlation between lower leg electrical impedance and volume, but the deviation in electrical impedance was approximately twice that of the leg volume. Electrical impedance appears...

  6. Impedance characterization of PV modules in outdoor conditions

    DEFF Research Database (Denmark)

    Oprea, Matei-lon; Thorsteinsson, Sune; Spataru, Sergiu;

    2016-01-01

    Impedance spectroscopy (IS) has been used for laboratory characterizations of photovoltaic (PV) technologies under well controlled conditions. This work applies IS for outdoor characterization of PV panels, in order to observe the effect of irradiance (G) and temperature (T) on the PV module’s...... impedance spectrum, and further construct an impedance model that can link environmental changes to the model’s parameters. To achieve this, an optimized setup has been developed for long-term impedance spectra monitoring synchronised with accurate irradiance and temperature data. Preliminary results show...

  7. Iterative Reconstruction Methods for Hybrid Inverse Problems in Impedance Tomography

    DEFF Research Database (Denmark)

    Hoffmann, Kristoffer; Knudsen, Kim

    2014-01-01

    For a general formulation of hybrid inverse problems in impedance tomography the Picard and Newton iterative schemes are adapted and four iterative reconstruction algorithms are developed. The general problem formulation includes several existing hybrid imaging modalities such as current density...... impedance imaging, magnetic resonance electrical impedance tomography, and ultrasound modulated electrical impedance tomography, and the unified approach to the reconstruction problem encompasses several algorithms suggested in the literature. The four proposed algorithms are implemented numerically in two...... be based on a theoretical analysis of the underlying inverse problem....

  8. Simulation of the low-frequency collimator impedance

    CERN Document Server

    Kroyer, T

    2008-01-01

    The low-frequency transverse collimator impedance constitutes a major part of the LHC impedance budget. In this paper numerical simulations for frequencies below 1 MHz using a commercial package are presented. From the 3D field solution of the two-wire simulations the transverse impedance is directly calculated. After a cross-check with theory for rotationally symmetric structures a geometry with two jaws and an LHC graphite collimator is examined. Furthermore, a simple physics picture that explains the principal characteristics of the impedance at high and low frequencies is given.

  9. Frequency Bandwidth of Half-Wave Impedance Repeater

    Directory of Open Access Journals (Sweden)

    Marek Dvorsky

    2012-01-01

    Full Text Available This article brings in the second part general information about half-wave impedance repeater. The third part describes the basic functional principles of the half-wave impedance repeater using Smith chart. The main attention is focused in part four on the derivation of repeater frequency bandwidth depending on characteristics and load impedance of unknown feeder line. Derived dependences are based on the elementary features of the feeder lines with specific length. The described functionality is proved in part 4.3 by measurement of transformed impedance using vector several unbalanced feeder lines and network analyzer VNWA3+.

  10. Impedance of the PEP-II DIP screen

    Energy Technology Data Exchange (ETDEWEB)

    Ng, C.-K. [Stanford Linear Accelerator Center, Menlo Park, CA (United States); Weiland, T.

    1996-08-01

    The vacuum chamber of a storage ring normally consists of periodically spaced pumping slots. The longitudinal impedance of slots are analyzed in this paper. It is found that although the broad-band impedance is tolerable, the narrow-band impedance, as a consequence of the periodicity of the slots, may exceed the stability limit given by natural damping with no feedback system on. Based on this analysis, the PEP-II distributed-ion-pump (DIP) screen uses long grooves with hidden holes cut halfway to reduce both the broad-band and narrow-band impedances. (author)

  11. Esophageal impedance baseline according to different time intervals

    Directory of Open Access Journals (Sweden)

    Ummarino Dario

    2012-06-01

    Full Text Available Abstract Background The impedance baseline has been shown to reflect esophageal integrity, and to be decreased in patients with esophagitis. However, different methods for the determination of the impedance baseline have not been compared. Methods The median impedance baseline was calculated in 10 consecutive multichannel intraluminal impedance recordings in children with non-erosive reflux disease. All children underwent an endoscopy with a biopsy as part of the clinical work-up to exclude esophagitis. The impedance baseline was obtained both by including and excluding all impedance episodes (IE; reflux, swallows and gas episodes during the full recording, and during the first 1-minute period without an IE every hour (method 1, every 2 hours (method 2 or every 4 hours (method 3. The impedance baseline obtained during the full recording was set at 100%, and the variation (difference in impedance baseline for the different methods and variability (difference in impedance baseline during one analysis period were assessed. Results None of the participants had esophagitis. The mean difference over the six channels between the impedance baseline over the total recording with and without IE was approximately 2.5%, and comparable for each channel (range 0.47% to 5.55%. A mean of 1,028 IEs were excluded in each tracing, and it took between 4 and 24 hours to delete all events in one tracing. The difference in the impedance baseline obtained with and without IEs was mainly caused by the gas episodes in the upper channels and swallows in the lower channels. The median impedance baseline according to the three one-minute analysis methods was comparable to the median impedance baseline according to the 24 hour analysis. Conclusions The automatic determination of the median impedance baseline over the total tracing including IEs is an adequate method. In isolated tracings with numerous IEs, the calculation of the median impedance baseline over one minute

  12. Impedance cardiography – optimization and efficacy evaluation of antihypertensive treatment

    National Research Council Canada - National Science Library

    Panasiuk-Kamińska, Katarzyna; Szeliga-Król, Jolanta; Zubilewicz, Renata; Jaroszyński, Andrzej

    2016-01-01

    ...% are treated effectively. Impedance cardiography (IC) is an important tool both in diagnostics and the treatment of hypertensive patients, particularly in the case of antihypertensive treatment resistance...

  13. Novel method for planar microstrip antenna matching impedance

    CERN Document Server

    Ali, Mahdi; Samet, Mounir

    2010-01-01

    Because all microstrip antennas have to be matched to the standard generator impedance or load, the input impedance matching method for antenna is particularly important. In this paper a new methodology in achieving matching impedance of a planar microstrip antenna for wireless application is described. The method is based on embedding an Interdigital capacitor. The fine results obtained by using a microstrip Interdigital capacitor for matching antenna impedance led to an efficient method to improve array antenna performance. In fact, a substantial saving on the whole surfaces as well as enhancement of the gain, the directivity and the power radiated was achieved.

  14. Microgrid Reactive and Harmonic Power Sharing Using Enhanced Virtual Impedance

    DEFF Research Database (Denmark)

    He, Jinwei; Wei Li, Yun; Guerrero, Josep M.

    2013-01-01

    To address the load sharing problem in islanding microgrids, this paper proposes an improved approach which regulates the distributed generation (DG) unit interfacing virtual impedance at fundamental and selected harmonic frequencies. In contrast to the conventional virtual impedance control where...... feeder impedances can be properly compensated, resulting in accurate reactive and harmonic power sharing at the same time. In addition, this paper shows that the microgrid PCC harmonic voltages can be mitigated by reducing the magnitude of DG unit equivalent harmonic impedance. Finally, an improved...

  15. Electrochemical Impedance of a Battery Electrode with Anisotropic Active Particles

    CERN Document Server

    Song, J

    2013-01-01

    Electrochemical impedance spectra for battery electrodes are usually interpreted using models that assume isotropic active particles, having uniform current density and symmetric diffusivities. While this can be reasonable for amorphous or polycrystalline materials with randomly oriented grains, modern electrode materials increasingly consist of highly anisotropic, single-crystalline, nanoparticles, with different impedance characteristics. In this paper, analytical expressions are derived for the impedance of anisotropic particles with tensorial diffusivities and orientation-dependent surface reaction rates and capacitances. The resulting impedance spectrum contains clear signatures of the anisotropic material properties and aspect ratio, as well as statistical variations in any of these parameters.

  16. Impedance of SOFC electrodes: A review and a comprehensive case study on the impedance of LSM:YSZ cathodes

    DEFF Research Database (Denmark)

    Nielsen, Jimmi; Hjelm, Johan

    2014-01-01

    It was shown through a comprehensive impedance spectroscopy study that the impedance of the classic composite LSM:YSZ (lanthanum strontium manganite and yttria stabilized zirconia) solid oxide fuel cell (SOFC) cathode can be described well with porous electrode theory. Furthermore, it was illustr......It was shown through a comprehensive impedance spectroscopy study that the impedance of the classic composite LSM:YSZ (lanthanum strontium manganite and yttria stabilized zirconia) solid oxide fuel cell (SOFC) cathode can be described well with porous electrode theory. Furthermore...... acquired in the very broad temperature range of 200–900°C for complete elucidation of the impedance. All impedance spectra were analyzed in terms of porous electrode theory. Physical materials parameters were extracted from the analysis, which were in excellent accordance with literature values. Valuable...

  17. AC-tabsmodeller for superledende kabelledere

    DEFF Research Database (Denmark)

    Østergaard, Jacob; Holm (fratrådt), Jesper; Understrup (fratrådt), Henriette

    1996-01-01

    I denne rapport opstilles tre modeller for beregning af AC-tab (vekselstrømstab) i superledende kabelledere. Beregning af tabenes størrelse er væsentlig i forbindelse med vurdering af superlederteknologiens anvendelighed til AC-applikationer. Viden om tabenes natur giver desuden et vigtigt...

  18. Magnetically Coupled Impedance-Source Inverters

    DEFF Research Database (Denmark)

    Loh, Poh Chiang; Blaabjerg, Frede

    2013-01-01

    input-to-output gain and the presence of an impedance network. The former means a high dc-link voltage, which can stress the semiconductor switches unnecessarily. The latter leads to increases in cost and size, which similarly are undesirable. To lessen these concerns, an interesting approach is to use......Z-source inverters are a new class of inverters proposed with output voltage or current buck-boost ability. Despite their general attractiveness, there are some present limitations faced by existing Z-source inverters, most of which are linked to their requirement for low modulation ratio at high...... magnetically coupled transformers or inductors to raise the gain and modulation ratio simultaneously, while reducing the number of passive components needed. A study of the approach is now presented to show how various existing magnetically coupled inverters can be derived by applying a generic methodology...

  19. Magnetically coupled impedance-source inverters

    DEFF Research Database (Denmark)

    Loh, Poh Chiang; Blaabjerg, Frede

    2012-01-01

    input-to-output gain, and the presence of an impedance network. The former means a high dc-link voltage, which can stress the semiconductor switches unnecessarily. The latter leads to increases in cost and size, which similarly are undesirable. To lessen these concerns, an interesting approach is to use......Z-source inverters are a new class of inverters proposed with output voltage or current buck-boost ability. Despite their general attractiveness, there are some present limitations faced by existing Z-source inverters. Most of which are linked to their requirement for low modulation ratio at high...... magnetically coupled transformers or inductors to raise the gain and modulation ratio simultaneously, while reducing the number of passive components needed. A study of the approach is now presented to show how various existing magnetically coupled inverters can be derived by applying a generic methodology...

  20. The sensitivity in Electrical Impedance Tomography

    Directory of Open Access Journals (Sweden)

    A. I. Rybin

    2013-12-01

    Full Text Available Introduction. The concept of sensitivity in Electrical Impedance Tomography is introduced (first – fourth type. The experimental researches measuring the voltages on the phantom outline are conducted on the created layout (for uniform cylindrical vessel with brine and placed inhomogeneities in a vessel. The main part. The inverse problems are solved for simulated on PC phantom (the third type sensitivity and from measured results (the fourth type sensitivity by conductivity zones method using regularization by A. Tykhonov. The sensitivity to conductivity increasing of elements inside the phantom is significantly less than the sensitivity to resistance increasing. The results of measured voltages processing and the results of projection reconstruction (obtained from mathematical model and from measured results are described. Conclusions. The satisfactory agreements of reconstruction results between themselves and with mathematical and measured phantoms are shown.

  1. Algorithmic Error Correction of Impedance Measuring Sensors

    Science.gov (United States)

    Starostenko, Oleg; Alarcon-Aquino, Vicente; Hernandez, Wilmar; Sergiyenko, Oleg; Tyrsa, Vira

    2009-01-01

    This paper describes novel design concepts and some advanced techniques proposed for increasing the accuracy of low cost impedance measuring devices without reduction of operational speed. The proposed structural method for algorithmic error correction and iterating correction method provide linearization of transfer functions of the measuring sensor and signal conditioning converter, which contribute the principal additive and relative measurement errors. Some measuring systems have been implemented in order to estimate in practice the performance of the proposed methods. Particularly, a measuring system for analysis of C-V, G-V characteristics has been designed and constructed. It has been tested during technological process control of charge-coupled device CCD manufacturing. The obtained results are discussed in order to define a reasonable range of applied methods, their utility, and performance. PMID:22303177

  2. Algorithmic Error Correction of Impedance Measuring Sensors

    Directory of Open Access Journals (Sweden)

    Vira Tyrsa

    2009-12-01

    Full Text Available This paper describes novel design concepts and some advanced techniques proposed for increasing the accuracy of low cost impedance measuring devices without reduction of operational speed. The proposed structural method for algorithmic error correction and iterating correction method provide linearization of transfer functions of the measuring sensor and signal conditioning converter, which contribute the principal additive and relative measurement errors. Some measuring systems have been implemented in order to estimate in practice the performance of the proposed methods. Particularly, a measuring system for analysis of C-V, G-V characteristics has been designed and constructed. It has been tested during technological process control of charge-coupled device CCD manufacturing. The obtained results are discussed in order to define a reasonable range of applied methods, their utility, and performance.

  3. Sensing Estrogen with Electrochemical Impedance Spectroscopy

    Science.gov (United States)

    Li, Jing; Kim, Byung Kun; Im, Ji-Eun; Choi, Han Nim; Kim, Dong-Hwan; Cho, Seong In

    2016-01-01

    This study demonstrates the application feasibility of electrochemical impedance spectroscopy (EIS) in measuring estrogen (17β-estradiol) in gas phase. The present biosensor gives a linear response (R2 = 0.999) for 17β-estradiol vapor concentration from 3.7 ng/L to 3.7 × 10−4 ng/L with a limit of detection (3.7 × 10−4 ng/L). The results show that the fabricated biosensor demonstrates better detection limit of 17β-estradiol in gas phase than the previous report with GC-MS method. This estrogen biosensor has many potential applications for on-site detection of a variety of endocrine disrupting compounds (EDCs) in the gas phase.

  4. Quartz tuning fork based microwave impedance microscopy

    Science.gov (United States)

    Cui, Yong-Tao; Ma, Eric Yue; Shen, Zhi-Xun

    2016-06-01

    Microwave impedance microscopy (MIM), a near-field microwave scanning probe technique, has become a powerful tool to characterize local electrical responses in solid state samples. We present the design of a new type of MIM sensor based on quartz tuning fork and electrochemically etched thin metal wires. Due to a higher aspect ratio tip and integration with tuning fork, such design achieves comparable MIM performance and enables easy self-sensing topography feedback in situations where the conventional optical feedback mechanism is not available, thus is complementary to microfabricated shielded stripline-type probes. The new design also enables stable differential mode MIM detection and multiple-frequency MIM measurements with a single sensor.

  5. The vacuum impedance and unit systems

    CERN Document Server

    Kitano, M

    2006-01-01

    In electromagnetism, the vacuum impedance $Z_0$ is a universal constant, which is as important as the velocity of light $c$ in vacuum. Unfortunately, however, its significance does not seem to be appreciated so well and sometimes the presence itself is ignored. It is partly because in the Gaussian system of units, which has widely been used for long time, $Z_0$ is a dimensionless constant and of unit magnitude. In this paper, we clarify that $Z_0$ is a fundamental parameter in electromagnetism and plays major roles in the following scenes: reorganizing the structure of the electromagnetic formula in reference to the relativity; renormalizing the quantities toward natural unit systems starting from the SI unit system; and defining the magnitudes of electromagnetic units.

  6. Sensing Estrogen with Electrochemical Impedance Spectroscopy

    Directory of Open Access Journals (Sweden)

    Jing Li

    2016-01-01

    Full Text Available This study demonstrates the application feasibility of electrochemical impedance spectroscopy (EIS in measuring estrogen (17β-estradiol in gas phase. The present biosensor gives a linear response (R2=0.999 for 17β-estradiol vapor concentration from 3.7 ng/L to 3.7 × 10−4 ng/L with a limit of detection (3.7 × 10−4 ng/L. The results show that the fabricated biosensor demonstrates better detection limit of 17β-estradiol in gas phase than the previous report with GC-MS method. This estrogen biosensor has many potential applications for on-site detection of a variety of endocrine disrupting compounds (EDCs in the gas phase.

  7. Impedance spectroscopy on ceramic materials at high temperatures, considering stray fields and electromagnetic noise

    Science.gov (United States)

    Müller, T. M.; Meinhardt, J.; Raether, F.

    2013-01-01

    Impedance spectroscopy of many ceramics is a challenge due to their high electrical resistance. Small disturbances can significantly alter the measuring results. In the present paper, it is shown how impedance measurements can be performed in an electromagnetically noisy ac furnace, using consequent Faraday shielding of the sample and the electrical connections. As example, the conductivity data of alumina was measured between room temperature and 1000 °C and compared to literature data. In addition, a correction method for the calculation of permittivity was developed to consider the stray fields in the sample-electrode setup. The distribution of the electrical field was simulated by finite element (FE) methods for different sample geometries and electrode arrangements. The deviations from the behavior of an ideal plate capacitor follow a linear trend and are in the order of 5% to 20% for an experimentally reasonable range of sample thicknesses. To check the theoretical results experimentally, alumina samples of varying thickness were measured. The customary calculation of permittivity leads to a clear trend with sample thickness, whereas the correction from the FE-simulation produces almost constant values of the relative permittivity.

  8. Characterization of Bi4Ge3O12 single crystal by impedance spectroscopy

    Directory of Open Access Journals (Sweden)

    Zélia Soares Macedo

    2003-12-01

    Full Text Available Bi4Ge3O12 (bismuth germanate - BGO single crystals were produced by the Czochralski technique and their electrical and dielectric properties were investigated by impedance spectroscopy. The isothermal ac measurements were performed for temperatures from room temperature up to 750 °C, but only the data taken above 500 °C presented a complete semicircle in the complex impedance diagrams. Experimental data were fitted to a parallel RC equivalent circuit, and the electrical conductivity was obtained from the resistivity values. Conductivity values from 5.4 × 10(9 to 4.3 × 10-7 S/cm were found in the temperature range of 500 to 750 °C. This electrical conductivity is thermally activated, following the Arrhenius law with an apparent activation energy of (1.41 ± 0.04 eV. The dielectric properties of BGO single crystal were also studied for the same temperature interval. Permittivity values of 20 ± 2 for frequencies higher than 10³ Hz and a low-frequency dispersion were observed. Both electric and dielectric behavior of BGO are typical of systems in which the conduction mechanism dominates the dielectric response.

  9. Impedance spectroscopy and investigation of conduction mechanism in BaMnO{sub 3} nanorods

    Energy Technology Data Exchange (ETDEWEB)

    Hayat, Khizar [Nanostructured Materials and Devices Group, Department of Chemicals and Materials Engineering, Pakistan Institute of Engineering and Applied Sciences, P.O. Nilore, Islamabad 45650 (Pakistan); Rafiq, M.A., E-mail: fac221@pieas.edu.p [Nanostructured Materials and Devices Group, Department of Chemicals and Materials Engineering, Pakistan Institute of Engineering and Applied Sciences, P.O. Nilore, Islamabad 45650 (Pakistan); Durrani, S.K. [Material Division, Pakistan Institute of Nuclear Science and Technology, P.O. Nilore, Islamabad 45650 (Pakistan); Hasan, M.M. [Nanostructured Materials and Devices Group, Department of Chemicals and Materials Engineering, Pakistan Institute of Engineering and Applied Sciences, P.O. Nilore, Islamabad 45650 (Pakistan)

    2011-02-01

    BaMnO{sub 3} nanorods were synthesized at 200 {sup o}C and atmospheric pressure using the composite-hydroxide mediated method. X-ray diffraction, scanning electron microscopy and energy dispersive X-ray spectroscopy were used to investigate the structure, size, morphology, phase purity and elemental composition of BaMnO{sub 3} nanorods. Electrical characterization of BaMnO{sub 3} pellet was performed at 300-400 K and in the frequency range 200 Hz-2 MHz. Temperature dependence of AC conductivity suggests that the BaMnO{sub 3} pellet behaves as a semiconducting material and conduction across the pellet can be explained by the correlated barrier hopping model. Impedance analysis was performed using the equivalent circuit model (R{sub 1}Q{sub 1}C{sub 1})(R{sub 2}C{sub 2}) and it suggests a single relaxation process in the BaMnO{sub 3} pellet at a particular temperature. The analysis reveals that the BaMnO{sub 3} pellet behaves like an n-type semiconductor material due to the presence of oxygen vacancies and some disorder. Modulus spectroscopy also supports the impedance results.

  10. A combined complex electrical impedance and acoustic emission study in limestone samples under uniaxial loading

    Science.gov (United States)

    Saltas, V.; Fitilis, I.; Vallianatos, F.

    2014-12-01

    In the present work, complex electrical impedance measurements in the frequency range of 10 mHz to 1 MHz were carried out in conjunction with acoustic emission monitoring in limestone samples subjected to linear and stepped-like uniaxial loading, up to ultimate failure. Cole-Cole plots of the complex impedance during the stepped loading of limestone have been used to discriminate the contributions of grains interior, grain boundaries and electrode polarization effects to the overall electrical behavior. The latter is well-described with an equivalent-circuit model which comprises components of constant phase elements and resistances in parallel connection. Electrical conductivity increases upon uniaxial loading giving rise to negative values of effective activation volume. This is a strong experimental evidence for the generation of transient electric signals recorded prior to seismic events and may be attributed to charge transfer (proton conduction) due to cracks generation and propagation as a result of the applied stress. The time-series of ac-conductivity at two distinct frequencies (10 kHz, 200 kHz) during linear loading of limestone samples exhibits a strong correlation with the acoustic emission activity obeying the same general self-similar law for critical phenomena that has been reported for the energy release before materials fracture.

  11. Gastric emptying patterns of a liquid meal in newborn infants, measured by epigastric impedance

    DEFF Research Database (Denmark)

    Lange, Aksel; Funch-Jensen, Peter; Thommesen, Peter

    1997-01-01

      Epigastric impedance was used to measure patterns of the gastric emptying of a liquid non-caloric meal (5 ml water/kg) in newborn infants. The emptying patterns consisted of two components, theemptying signal - the DC component - and a phasic 3 cycle per minutes (CPM) signal - the AC component....... Phasic 3 CPM signal was also seen during the fasting state. Measurements were erformed in thirty healthy infants. Twenty-six mature infants were examined in the first eight days of life, and four preterm infants were examined within 6 weeks after birth. For the emptying signal the median half emptying.......A periodic change of the impedance signal, the phasic 3 CPM signal, was observed after a meal in 24 of the infants. The median frequency was 3.03 CPM in 20 mature and 2.93 CPM in 4 preterminfants. In 9 infants a phasic 3 CPM signal was observed during fasting state. The median frequency was 2.9 CPM...

  12. Multifrequency impedance measurement technique for wireless characterization of microbiological cell cultures

    Science.gov (United States)

    Wissenwasser, J.; Vellekoop, M. J.; Kapferer, W.; Lepperdinger, G.; Heer, R.

    2011-11-01

    An impedance measurement system with probe signal frequencies up to 50 kHz with AC-probe voltages below 30 mV rms was integrated for wireless and battery-free monitoring of microbiological cell cultures. The here presented modular design and the use of state-of-the-art components greatly eases adoptions to a wide range of biotechnological applications without the need of bulky LCR-meters or potentiostats. The device had a power consumption of less than 2.5 mA at a 3.3 V single power supply and worked trouble-free within the humid environment of a cell culture incubator. Measurements on lumped RC-elements showed an error of less than 1% for absolute values and less than 1° regarding the phase of the complex impedance. The performance of sensor devices with interdigitated electrode structures for the measurement of adherent cell cultures was tested in the presence of phosphate-buffered saline solution in the humid atmosphere of an incubator for biological cell cultures.

  13. Impedance spectroscopy of Ba3Sr2DyTi3V7O30 ceramic

    Indian Academy of Sciences (India)

    P S Sahoo; A Panigrahi; S K Patri; R N P Choudhary

    2010-04-01

    Polycrystalline sample of Ba3Sr2DyTi3V7O30 was prepared at 950°C using a high-temperature solid-state reaction technique. X-ray structural analysis indicated the formation of a single-phase orthorhombic structure with lattice parameters: = 12.2719 (39) Å, = 8.9715(39) Å and = 19.7812(39) Å. Microstructural study showed densely packed uniform distribution of grains over the surface of the sample. The a.c. impedance plots were used as tools to analyse the electrical response of the sample as a function of frequency at different temperatures (30–500°C). These plots revealed the presence of grain boundary effect, from 200°C onwards. Complex impedance analysis showed non-Debye type of dielectric relaxation. The Nyquist plots showed the negative temperature coefficient of resistance character of Ba3Sr2DyTi3V7O30. A hopping mechanism of electrical transport processes in the system is evident from the modulus analysis. The activation energy of the compound (calculated both from loss and modulus spectrum) is the same, and hence the relaxation process may be attributed to the same type of charge carrier.

  14. Modification of Relaxor and Impedance Spectroscopy Properties of Lead Magnesium Niobate by Bismuth Ferrite

    Science.gov (United States)

    Das, S. N.; Pradhan, S.; Bhuyan, S.; Choudhary, R. N. P.; Das, P.

    2017-03-01

    The relaxor and impedance characteristics of classic or traditional lead magnesium niobate (PbMg1/3Nb2/3O3; PMN) ferroelectric relaxor material have been modified by chemically synthesizing with multiferroic bismuth ferrite (BiFeO3; BFO). Detailed studies of structural, morphological and electrical properties of PMN-BFO-prepared solid solutions [((Pb1- x Bi x ) (Mg0.33(1- x)Nb0.66(1- x)Fe x ) O3) with x = 0.1, 0.2, 0.3 and 0.4] reveal some interesting findings on structure-properties relationships. The formation of single phase material of each compound in orthorhombic crystal system is identified from x-ray diffraction. The microstructure analyses reveal that the grain size of PMN-BFO increases for increasing BFO weight percent with PMN. The increase of BFO concentration not only improves the dielectric response of PMN-BFO but also modifies the nature of attained phase transition from a typical relaxor to a normal ferroelectric. The impedance spectroscopy studies exhibit the presence of grain and grain boundary effects, and the existence of a positive temperature coefficient of resistance (PTCR) in the material. The ac conductivity increases with the increase in frequency in the low-temperature region for larger content of BFO in the solid solutions. It is observed that the prepared electronic materials obey the non-Debye-type of conductivity relaxation behavior.

  15. Gastric emptying patterns of a liquid meal in newborn infants, measured by epigastric impedance

    DEFF Research Database (Denmark)

    Lange, Aksel; Funch-Jensen, Peter; Thommesen, Peter;

    1997-01-01

      Epigastric impedance was used to measure patterns of the gastric emptying of a liquid non-caloric meal (5 ml water/kg) in newborn infants. The emptying patterns consisted of two components, theemptying signal - the DC component - and a phasic 3 cycle per minutes (CPM) signal - the AC component....... Phasic 3 CPM signal was also seen during the fasting state. Measurements were erformed in thirty healthy infants. Twenty-six mature infants were examined in the first eight days of life, and four preterm infants were examined within 6 weeks after birth. For the emptying signal the median half emptying.......A periodic change of the impedance signal, the phasic 3 CPM signal, was observed after a meal in 24 of the infants. The median frequency was 3.03 CPM in 20 mature and 2.93 CPM in 4 preterminfants. In 9 infants a phasic 3 CPM signal was observed during fasting state. The median frequency was 2.9 CPM...

  16. Multifrequency impedance measurement technique for wireless characterization of microbiological cell cultures.

    Science.gov (United States)

    Wissenwasser, J; Vellekoop, M J; Kapferer, W; Lepperdinger, G; Heer, R

    2011-11-01

    An impedance measurement system with probe signal frequencies up to 50 kHz with AC-probe voltages below 30 mV rms was integrated for wireless and battery-free monitoring of microbiological cell cultures. The here presented modular design and the use of state-of-the-art components greatly eases adoptions to a wide range of biotechnological applications without the need of bulky LCR-meters or potentiostats. The device had a power consumption of less than 2.5 mA at a 3.3 V single power supply and worked trouble-free within the humid environment of a cell culture incubator. Measurements on lumped RC-elements showed an error of less than 1% for absolute values and less than 1° regarding the phase of the complex impedance. The performance of sensor devices with interdigitated electrode structures for the measurement of adherent cell cultures was tested in the presence of phosphate-buffered saline solution in the humid atmosphere of an incubator for biological cell cultures.

  17. Relating membrane potential to impedance spectroscopy

    Directory of Open Access Journals (Sweden)

    Eugen Gheorghiu

    2011-12-01

    Full Text Available Non-invasive, label-free assessment of membrane potential of living cells is still a challenging task. The theory linking membrane potential to the low frequency α dispersion exhibited by suspensions of spherical shelled particles (presenting a net charge distribution on the inner side of the shell has been pioneered in our previous studies with emphasis on the permittivity spectra. Whereas α dispersion is related to a rather large variation exhibited by the permittivity spectrum, we report that the related decrement presented by the impedance magnitude spectrum is either extremely small, or occurs (for large cells at very small frequencies (~mHz explaining the lack of experimental bioimpedance data on the matter. We stress that appropriate choice of the parameters (as revealed by the microscopic model may enable access to membrane potential as well as to other relevant parameters when investigating living cells and charged lipid vesicles. We analyse the effect on the low frequency of the permittivity and impedance spectra of: I. Parameters pertaining to cell membrane i.e. (i membrane potential (through the amount of the net charge on the inner side of the membrane, (ii size of the cells/vesicles, (iii conductivity of the membrane; II. Parameters of the extra cellular medium (viscosity and conductivity. The applicability of the study has far reaching implications for basic (life sciences (providing non-invasive access to the dynamics of relevant cell parameters as well as for biosensing applications, e.g. assessment of cytotoxicity of a wide range of stimuli. doi:10.5617/jeb.214 J Electr Bioimp, vol. 2, pp. 93-97, 2011

  18. Bioelectric impedance phase angle in breast carcinoma

    Directory of Open Access Journals (Sweden)

    Ruchi Tyagi

    2014-01-01

    Full Text Available Context: Worldwide breast cancer is the most frequently diagnosed life threatening cancer and the leading cause of death in women. Bioelectric impedance analysis (BIA affords an emerging opportunity to assess prognosis because of its ability to non invasively assess cell and plasma membrane structure and function by means of phase angle. Aims: To compare the phase angle between patients of breast cancer and their matched control with the help of BIA. Settings and Design: After taking clearance from ethical committee, a total of 34 female cases of histologically proven infiltrating ductal breast carcinoma were included from the surgery IPD, department of surgery. Equal numbers of the matched controls were recruited from the friends and relatives of cases. Materials and Methods: Bio Electrical Impedance Analyzer (BIA BODY STAT QUAD SCAN 4000 was used to measure resistance (R and reactance (Xc by recording a voltage drop in applied current. Phase angle is the ratio of reactance to resistance and is a measure of cell vitality. Statistical analysis used: Unpaired "t" test was applied. Results: In control group, the phase angle showed a mean of 5.479 whereas in test group, it showed a mean value of 4.726. The P value showed a significant difference (P < 0.0001. The smaller the phase angle values were higher was the tumor, nodes, metastases (TNM staging. The phase angles differed significantly from the healthy age matched control values. Conclusions: This study demonstrated that phase angle is a strong predictor of severity of breast cancer and differed significantly between the two groups.

  19. Impedance measurement for microstructure characterization and internal surface estimation of macroporous silicon

    Energy Technology Data Exchange (ETDEWEB)

    RoyChaudhuri, C. [Department of Electronics and Telecommunication Engineering, Bengal Engineering and Science University, Shibpur, Botanic Garden, Howrah 711103 (India); Jana, M.; Bandopadhyay, N.R. [School of Materials Science and Engineering, Bengal Engineering and Science University, Shibpur, Botanic Garden, Howrah 711103 (India)

    2010-09-15

    In this paper, a simple and convenient method based on impedance measurement has been proposed for the first time to evaluate the average porosity, pore radius, and internal surface area of macroporous silicon structure fabricated by electrochemical method. The porosity and the average pore radius have been obtained by developing a geometrical model and applying the generalized effective medium approximation theory to the dc and ac impedance measurement of both unoxidized and thermally oxidized macroporous silicon. The internal surface area per unit volume is then computed from the porosity and the pore radius using the same model. The method has been applied to a wide range of porosity from 30 to 58% fabricated on p-type <100> silicon with a resistivity of 10-20 {omega} cm. Experimental verification of porosity, mean pore radius, and internal surface area have been performed by standard gravimetric technique and by top-view and cross-section SEM imaging, respectively. A typical mean pore radius, porosity, and internal surface area of a macroporous silicon sample has been obtained to be 1.52 {mu}m, 54.2%, and 3565.7 cm{sup 2}/cm{sup 3}, respectively, from the impedance measurement and 1.5 {mu}m, 55%, and 3666.7 cm{sup 2}/cm{sup 3} from SEM and gravimetric analysis which shows that the results are within 2% of the values obtained by conventional methods. The advantages of this method over the other recently reported techniques for similar characterization have been discussed. (Abstract Copyright [2010], Wiley Periodicals, Inc.)

  20. Determination of beam coupling impedance in the frequency domain

    Energy Technology Data Exchange (ETDEWEB)

    Niedermayer, Uwe

    2016-07-01

    The concept of beam coupling impedance describes the electromagnetic interaction of uniformly moving charged particles with their surrounding structures in the Frequency Domain (FD). In synchrotron accelerators, beam coupling impedances can lead to beam induced component heating and coherent beam instabilities. Thus, in order to ensure the stable operation of a synchrotron, its impedances have to be quantified and their effects have to be controlled. Nowadays, beam coupling impedances are mostly obtained by Fourier transform of wake potentials, which are the results of Time Domain (TD) simulations. However, at low frequencies, low beam velocity, or for dispersive materials, TD simulations become unhandy. In this area, analytical calculations of beam coupling impedance in the FD, combined with geometry approximations, are still widely used. This thesis describes the development of two electromagnetic field solvers to obtain the beam coupling impedance directly in the FD, where the beam velocity is only a parameter and dispersive materials can be included easily. One solver is based on the Finite Integration Technique (FIT) on a staircase mesh. It is implemented both in 2D and 3D. However, the staircase mesh is inefficient on curved structures, which is particularly problematic for the modeling of a dipole source, that is required for the computation of the transverse beam coupling impedance. This issue is overcome by the second solver developed in this thesis, which is based on the Finite Element Method (FEM) on an unstructured triangular mesh. It is implemented in 2D and includes an optional Surface Impedance Boundary Condition (SIBC). Thus, it is well suited for the computation of longitudinal and transverse impedances of long beam pipe structures of arbitrary cross-section. Besides arbitrary frequency and beam velocity, also dispersive materials can be chosen, which is crucial for the computation of the impedance of ferrite kicker magnets. Numerical impedance