Site investigation SFR. Boremap mapping of percussion drilled borehole HFR106

Energy Technology Data Exchange (ETDEWEB)

Winell, Sofia (Geosigma AB (Sweden))

2010-06-15

This report presents the result from the Boremap mapping of the percussion drilled borehole HFR106, which is drilled from an islet located ca 220 m southeast of the pier above SFR. The purpose of the location and orientation of the borehole is to investigate the possible occurrence of gently dipping, water-bearing structures in the area. HFR106 has a length of 190.4 m and oriented 269.4 deg/-60.9 deg. The mapping is based on the borehole image (BIPS), investigation of drill cuttings and generalized, as well as more detailed geophysical logs. The dominating rock type, which occupies 68% of HFR106, is fine- to medium-grained, pinkish grey metagranite-granodiorite (rock code 101057) mapped as foliated with a medium to strong intensity. Pegmatite to pegmatitic granite (rock code 101061) occupies 29% of the borehole. Subordinate rock types are felsic to intermediate meta volcanic rock (rock code 103076) and fine- to medium-grained granite (rock code 111058). Rock occurrences (rock types < 1 m in length) occupy about 16% of the mapped interval, of which half is veins, dykes and unspecified occurrences of pegmatite and pegmatitic granite. Only 5.5% of HFR106 is inferred to be altered, mainly oxidation in two intervals with an increased fracture frequency. A total number of 845 fractures are registered in HFR106. Of these are 64 interpreted as open with a certain aperture, 230 open with a possible aperture, and 551 sealed. This result in the following fracture frequencies: 1.6 open fractures/m and 3.0 sealed fractures/m. Three fracture sets of open and sealed fractures with the orientations 290 deg/70 deg, 150 deg/85 deg and 200 deg/85 deg can be distinguished in HFR106. The fracture frequency is generally higher in the second half of the borehole, and particularly in the interval 176-187.4 m.

Site investigation SFR. Boremap mapping of percussion drilled borehole HFR106

International Nuclear Information System (INIS)

Winell, Sofia

2010-06-01

This report presents the result from the Boremap mapping of the percussion drilled borehole HFR106, which is drilled from an islet located ca 220 m southeast of the pier above SFR. The purpose of the location and orientation of the borehole is to investigate the possible occurrence of gently dipping, water-bearing structures in the area. HFR106 has a length of 190.4 m and oriented 269.4 deg/-60.9 deg. The mapping is based on the borehole image (BIPS), investigation of drill cuttings and generalized, as well as more detailed geophysical logs. The dominating rock type, which occupies 68% of HFR106, is fine- to medium-grained, pinkish grey metagranite-granodiorite (rock code 101057) mapped as foliated with a medium to strong intensity. Pegmatite to pegmatitic granite (rock code 101061) occupies 29% of the borehole. Subordinate rock types are felsic to intermediate meta volcanic rock (rock code 103076) and fine- to medium-grained granite (rock code 111058). Rock occurrences (rock types < 1 m in length) occupy about 16% of the mapped interval, of which half is veins, dykes and unspecified occurrences of pegmatite and pegmatitic granite. Only 5.5% of HFR106 is inferred to be altered, mainly oxidation in two intervals with an increased fracture frequency. A total number of 845 fractures are registered in HFR106. Of these are 64 interpreted as open with a certain aperture, 230 open with a possible aperture, and 551 sealed. This result in the following fracture frequencies: 1.6 open fractures/m and 3.0 sealed fractures/m. Three fracture sets of open and sealed fractures with the orientations 290 deg/70 deg, 150 deg/85 deg and 200 deg/85 deg can be distinguished in HFR106. The fracture frequency is generally higher in the second half of the borehole, and particularly in the interval 176-187.4 m

HFpEF and HFrEF Display Different Phenotypes as Assessed by IGF-1 and IGFBP-1.

Science.gov (United States)

Faxén, Ulrika Ljung; Hage, Camilla; Benson, Lina; Zabarovskaja, Stanislava; Andreasson, Anna; Donal, Erwan; Daubert, Jean-Claude; Linde, Cecilia; Brismar, Kerstin; Lund, Lars H

2017-04-01

Anabolic drive is impaired in heart failure with reduced ejection fraction (HFrEF) but insufficiently studied in heart failure with preserved ejection fraction (HFpEF). Insulin-like growth factor 1 (IGF-1) mediates growth hormone effects and IGF binding protein 1 (IGFBP-1) regulates IGF-1 activity. We tested the hypothesis that HFpEF and HFrEF are similar with regard to IGF-1 and IGFBP-1. In patients with HFpEF (n = 79), HFrEF (n = 85), and controls (n = 136), we analyzed serum IGF-1 and IGFBP-1 concentrations, correlations, and associations with outcome. Age-standardized scores of IGF-1 were higher in HFpEF, median arbitrary units (interquartile range); 1.21 (0.57-1.96) vs HFrEF, 0.09 (-1.40-1.62), and controls, 0.22 (-0.47-0.96), P overall IGF-1 was associated with outcomes in HFrEF, hazard ratio per natural logarithmic increase in IGF-1 SD score 0.51 (95% confidence interval 0.32-0.82, P = .005), but not significantly in HFpEF. IGFBP-1 was not associated with outcomes in either HFpEF nor HFrEF. HFpEF and HFrEF phenotypes were similar with regard to increased IGFBP-1 concentrations but differed regarding IGF-1 levels and prognostic role. HFrEF and HFpEF may display different impairment in anabolic drive. Copyright © 2016 Elsevier Inc. All rights reserved.

Impedance-Source Networks for Electric Power Conversion Part II

DEFF Research Database (Denmark)

Siwakoti, Yam P.; Peng, Fang Zheng; Blaabjerg, Frede

2015-01-01

Impedance-source networks cover the entire spectrum of electric power conversion applications (dc-dc, dc-ac, ac-dc, ac-ac) controlled and modulated by different modulation strategies to generate the desired dc or ac voltage and current at the output. A comprehensive review of various impedance......-source-network-based power converters has been covered in a previous paper and main topologies were discussed from an application point of view. Now Part II provides a comprehensive review of the most popular control and modulation strategies for impedance-source network-based power converters/inverters. These methods...

Status report on the HFR conversion and re-licensing project

International Nuclear Information System (INIS)

Wijtsma, F.G.

2003-01-01

In 1999 the HFR license holder (JRC, Petten, the Netherlands) initiated a project to study the conversion of the HFR from HEU to LEU. The first phase of this project consisted of a parametric study to determine the optimum fuel element and control rod design within given boundary conditions such as geometry, density, performance and cycle length. Results of this study are a 22 plates fuel element (550 g 235 U) at a density of 4.8 g.cm -3 and a 17 plates control rod (440 g 235 U). The second phase contains all aspects related to the conversion including a full-scale test irradiation of a prototype LEU element. The actual conversion of the HFR requires a new license. For this reason the re-licensing project has started in 2001. In this context many studies have been performed e.g. Risk Scoping Study, Safety Analyses, TOPA (Technical, Operational, Personnel and Administrative) evaluation. The license application will be based on a new Safety Report and an Environmental Impact Statement and will be submitted to the competent Authorities at the end of October 2003. (author)

AC impedance spectroscopy of NASICON type Na3Fe2(PO4)3 ceramic

Science.gov (United States)

Mandal, Biswajit; Thakur, A. K.

2018-05-01

Super ionic conductors (e.g.; A3M2(XO4)3, A=Li, Na) have received attention in applied research due to their interesting electrochemical property and inherently high ionic conductivity [1]. However, structural and compatibility requirements for fast ion transport is stringent and it plays a crucial role. In A3M2(XO4)3, a suitable cage formation in the crystal framework due to corner sharing arrangement of XO4 tetrahedra and MO6 octahedra creates voids that acts as host/guest site for cation transport. In this work, we report Nasicon structure Na3Fe2(PO4)3 (NFP) prepared via sol-gel route mediated by citric acid. Structural analysis confirmed that NFP sample belongs to monoclinic crystal structure having Cc space group (S. G. No 9) with lattice parameters, a=15.106 Å, b=8.722 Å, c=8.775 Å and β=124.96°. Electrical properties of the prepared sample have been studied by AC impedance spectroscopy technique. The AC conductivity results indicated typical signature of ionically conducting system.

High Flux Materials Testing Reactor (HFR), Petten

International Nuclear Information System (INIS)

1975-09-01

After conversion to burnable poison fuel elements, the High Flux Materials Testing Reactor (HFR) Petten (Netherlands), operated through 1974 for 280 days at 45 MW. Equipment for irradiation experiments has been replaced and extended. The average annual occupation by experiments was 55% as compared to 38% in 1973. Work continued on thirty irradiation projects and ten development activities

AcEST: BP915042 [AcEST

Lifescience Database Archive (English)

Full Text Available LG_EBLV2 Glycoprotein G OS=European bat lyssavirus 2 (strain Human/Scotland/RV133...p|Q91C28|VGLG_DUVV Glycoprotein G OS=Duvenhage virus GN=G PE=3 ... 35 0.24 sp|A4UHQ6|VGLG_EBLV2 Glycoprotein G OS=European bat lyssav...irus 2... 32 1.5 sp|Q9FE22|HFR1_ARATH Transcription factor HFR1 OS=Arabidopsis th..

AC Conductivity and Impedance Properties of 0.65Pb(Mg1/3Nb2/3O3-0.35PbTiO3 Ceramics

Directory of Open Access Journals (Sweden)

Banarji Behera

2009-01-01

impedance spectroscopy technique. The impedance and electric permittivity were strongly temperature and frequency dependent. The activation energy, calculated from the temperature dependence of AC conductivity of the ceramics was found to be ∼0.5 eV. The relaxation process in the ceramics was found to be of non-Debye type. The nature of Cole-Cole diagram reveals the contribution of grain (bulk and grain boundary permittivity in the ceramics.

Analysis of High Frequency Resonance in DFIG-based Offshore Wind Farm via Long Transmission Cable

DEFF Research Database (Denmark)

Song, Yipeng; Ebrahimzadeh, Esmaeil; Blaabjerg, Frede

2018-01-01

During the past two decades, the Doubly Fed Induction Generator (DFIG) based wind farm has been under rapid growth, and the increasing wind power penetration has been seen. Practically, these wind farms are connected to the three-phase AC grid through long transmission cable which can be modelled...... as several II units. The impedance of this cable cannot be neglected and requires careful investigation due to its long distance. As a result, the impedance interaction between the DFIG based wind farm and the long cable is inevitable, and may produce High Frequency Resonance (HFR) in the wind farm....... This paper discusses the HFR of the large scale DFIG based wind farm connected to the long cable. Several influencing factors, including 1) the length of the cable, 2) the output active power and 3) the rotor speed, are investigated. Simulation validations using MATLAB / Simulink have been conducted...

A short tutorial contribution to impedance and AC-electrokinetic characterization and manipulation of cells and media: Are electric methods more versatile than acoustic and laser methods?

Directory of Open Access Journals (Sweden)

Jan Gimsa

2014-11-01

Full Text Available Lab-on-chip systems (LOCs can be used as in vitro systems for cell culture or manipulation in order to analyze or monitor physiological cell parameters. LOCs may combine microfluidic structures with integrated elements such as piezo-transducers, optical tweezers or electrodes for AC-electrokinetic cell and media manipulations. The wide frequency band (<1 kHz to >1 GHz usable for AC-electrokinetic manipulation and characterization permits avoiding electrochemical electrode processes, undesired cell damage, and provides a choice between different polarization effects that permit a high electric contrast between the cells and the external medium as well as the differentiation between cellular subpopulations according to a variety of parameters. It has been shown that structural polarization effects do not only determine the impedance of cell suspensions and the force effects in AC-electrokinetics but can also be used for the manipulation of media with inhomogeneous temperature distributions. This manuscript considers the interrelations of the impedance of suspensions of cells and AC-electrokinetic single cell effects, such as electroorientation, electrodeformation, dielectrophoresis, electrorotation, and travelling wave (TW dielectrophoresis. Unified models have allowed us to derive new characteristic equations for the impedance of a suspension of spherical cells, TW dielectrophoresis, and TW pumping. A critical review of the working principles of electro-osmotic, TW and electrothermal micropumps shows the superiority of the electrothermal pumps. Finally, examples are shown for LOC elements that can be produced as metallic structures on glass chips, which may form the bottom plate for self-sealing microfluidic systems. The structures can be used for cell characterization and manipulation but also to realize micropumps or sensors for pH, metabolites, cell-adhesion, etc.

HFR1 Sequesters PIF1 to Govern the Transcriptional Network Underlying Light-Initiated Seed Germination in Arabidopsis[C][W][OPEN

Science.gov (United States)

Shi, Hui; Zhong, Shangwei; Mo, Xiaorong; Liu, Na; Nezames, Cynthia D.; Deng, Xing Wang

2013-01-01

Seed germination is the first step for seed plants to initiate a new life cycle. Light plays a predominant role in promoting seed germination, where the initial phase is mediated by photoreceptor phytochrome B (phyB). Previous studies showed that PHYTOCHROME-INTERACTING FACTOR1 (PIF1) represses seed germination downstream of phyB. Here, we identify a positive regulator of phyB-dependent seed germination, LONG HYPOCOTYL IN FAR-RED1 (HFR1). HFR1 blocks PIF1 transcriptional activity by forming a heterodimer with PIF1 that prevents PIF1 from binding to DNA. Our whole-genomic analysis shows that HFR1 and PIF1 oppositely mediate the light-regulated transcriptome in imbibed seeds. Through the HFR1–PIF1 module, light regulates expression of numerous genes involved in cell wall loosening, cell division, and hormone pathways to initiate seed germination. The functionally antagonistic HFR1–PIF1 pair constructs a fail-safe mechanism for fine-tuning seed germination during low-level illumination, ensuring a rapid response to favorable environmental changes. This study identifies the HFR1–PIF1 pair as a central module directing the whole genomic transcriptional network to rapidly initiate light-induced seed germination. PMID:24179122

Neutron metrology in the HFR. Steel irradiation R139-697/698

International Nuclear Information System (INIS)

Hoving, A.H.; Voorbraak, W.P.

1996-06-01

The experiment R139-697/698, for testing the austenitic stainless steel type AISI-316 TIG, has been irradiated in the HFR Petten. This report presents the final metrology results obtained from activation monitors in the specimen holders, coded as R139/697 and R139/698. Data about the helium production as well as the number of displacements per atom are also included. The irradiation conditions for this experiment, carried out in a TRIO type capsule in HFR position F2, are as close as possible relevant for the candidate materials which will be used for the first wall of the NET (Next European Torus). The main results of the thermal and fast neutron fluence mesurements are presented in table 2 and 3 as well as in figures 3 and 4. (orig.)

HFR irradiation testing of light water reactor (LWR) fuel

International Nuclear Information System (INIS)

Markgraf, J.F.W.

1985-01-01

For the materials testing reactor HFR some characteristic information with emphasis on LWR fuel rod testing capabilities and hot cell investigation is presented. Additionally a summary of LWR fuel irradiation programmes performed and forthcoming programmes are described. Project management information and a list of publications pertaining to LWR fuel rod test programmes is given

Effect of temperature on the AC impedance of protein

Indian Academy of Sciences (India)

The depression parameter reveals the electrical equivalent circuit for the biopolymers. The AC electrical conductivity in the biopolymers follows the universal power law. From this, it is observed that the AC conductivity is frequency dependent and the biopolymer papain obeys large polaron tunnelling model, gum acacia and ...

Local impedance measurement of an electrode/single-pentacene-grain interface by frequency-modulation scanning impedance microscopy

Energy Technology Data Exchange (ETDEWEB)

Kimura, Tomoharu; Yamada, Hirofumi, E-mail: h-yamada@kuee.kyoto-u.ac.jp [Department of Electronic Science and Engineering, Kyoto University, Kyoto 615-8510 (Japan); Kobayashi, Kei [Department of Electronic Science and Engineering, Kyoto University, Kyoto 615-8510 (Japan); The Hakubi Center for Advanced Research, Kyoto University, Kyoto 615-8520 (Japan)

2015-08-07

The device performances of organic thin film transistors are often limited by the metal–organic interface because of the disordered molecular layers at the interface and the energy barriers against the carrier injection. It is important to study the local impedance at the interface without being affected by the interface morphology. We combined frequency modulation atomic force microscopy with scanning impedance microscopy (SIM) to sensitively measure the ac responses of the interface to an ac voltage applied across the interface and the dc potential drop at the interface. By using the frequency-modulation SIM (FM-SIM) technique, we characterized the interface impedance of a Pt electrode and a single pentacene grain as a parallel circuit of a contact resistance and a capacitance. We found that the reduction of the contact resistance was caused by the reduction of the energy level mismatch at the interface by the FM-SIM measurements, demonstrating the usefulness of the FM-SIM technique for investigation of the local interface impedance without being affected by its morphology.

Reactor transients tests for SNR fuel elements in HFR reactor

International Nuclear Information System (INIS)

Plitz, H.

1989-01-01

In HFR reactor, fuel pins of LMFBR reactors are putted in irradiation specimen capsules cooled with sodium for reactor transients tests. These irradiation capsules are instrumented and the experiences realized until this day give results on: - Fuel pins subjected at a continual variation of power - melting fuel - axial differential elongation of fuel pins

AC/RF Superconductivity

Energy Technology Data Exchange (ETDEWEB)

Ciovati, G [Jefferson Lab (United States)

2014-07-01

This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

AC/RF Superconductivity

Energy Technology Data Exchange (ETDEWEB)

Ciovati, Gianluigi [JLAB

2015-02-01

This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

Temperature dependent dielectric relaxation and ac-conductivity of alkali niobate ceramics studied by impedance spectroscopy

Science.gov (United States)

Yadav, Abhinav; Mantry, Snigdha Paramita; Fahad, Mohd.; Sarun, P. M.

2018-05-01

Sodium niobate (NaNbO3) ceramics is prepared by conventional solid state reaction method at sintering temperature 1150 °C for 4 h. The structural information of the material has been investigated by X-ray diffraction (XRD) and Field emission scanning electron microscopy (FE-SEM). The XRD analysis of NaNbO3 ceramics shows an orthorhombic structure. The FE-SEM micrograph of NaNbO3 ceramics exhibit grains with grain sizes ranging between 1 μm to 5 μm. The surface coverage and average grain size of NaNbO3 ceramics are found to be 97.6 % and 2.5 μm, respectively. Frequency dependent electrical properties of NaNbO3 is investigated from room temperature to 500 °C in wide frequency range (100 Hz-5 MHz). Dielectric constant, ac-conductivity, impedance, modulus and Nyquist analysis are performed. The observed dielectric constant (1 kHz) at transition temperature (400 °C) are 975. From conductivity analysis, the estimated activation energy of NaNbO3 ceramics is 0.58 eV at 10 kHz. The result of Nyquist plot shows that the electrical behavior of NaNbO3 ceramics is contributed by grain and grain boundary responses. The impedance and modulus spectrum asserts that the negative temperature coefficient of resistance (NTCR) behavior and non-Debye type relaxation in NaNbO3.

A novel option for reducing free light chains in myeloma kidney: supra-hemodiafiltration with endogenous reinfusion (HFR).

Science.gov (United States)

Pasquali, Sonia; Iannuzzella, Francesco; Corradini, Mattia; Mattei, Silvia; Bovino, Achiropita; Stefani, Alfredo; Palladino, Giuseppe; Caiazzo, Marialuisa

2015-04-01

In myeloma cast nephropathy, fast reduction of serum free light chain (FLC) levels correlates with renal recovery. Recently, extracorporeal treatments using filters with a high-molecular weight cut-off have been successfully used for FLC removal. However, using these new filters, high cost and elevated albumin leakage are common drawbacks. We studied a new and cheaper therapeutic approach with adsorbent resins to evaluate its efficacy. We treated four patients, affected by dialysis-dependent acute kidney injury (AKI) due to biopsy proven de novo FLC myeloma cast nephropathy. Each patient underwent bortezomib chemotherapy and extracorporeal treatment with the supra-hemodiafiltration with endogenous reinfusion (HFR) technique (Supra-HFR, Bellco Mirandola, Modena, Italy). Supra-HFR is a kind of hemodiafiltration that utilizes separated convection, diffusion and adsorption. The sorbent cartridge has a high affinity for FLC (both κ and λ) but is able to re-infuse albumin, avoiding the need for albumin perfusions. Supra HFR treatments (4 h each) were carried out for eight consecutive days and then every other day. All patients showed a significant reduction of serum FLC, whereas serum albumin concentration remained unchanged. Renal function recovered in three out of four patients. FLC removal with adsorbent resins represents an effective therapeutic strategy that does not require replacement with albumin .

Neutron metrology in the HFR. Steel irradiation R139-805 (SINAS)

International Nuclear Information System (INIS)

Baard, J.H.

1996-10-01

The experiment R139-80 is part of a material program to test austenitic stainless steel of different types and has been irradiated in the HFR Petten. This report presents the final metrology results obtained from activation monitors in the specimen holder, coded as R139-805. Data about the helium production as well as the number of displacements per atom are included. The irradiation circumstances for this experiment, carried out in a TRIO type capsule in HFR position F2, represent the conditions at the first wall of NET (Next European Torus). The aim of this irradiation for specimen holder R139-805 was to reach a damage level of 2.4 dpa at a temperature of 325 C. However, the specimens have been irradiated up to a damage level of 1.7-2.0 dpa. The main results of the thermal and fast neutron fluence measurements are presented in tables 2 and 3 as well as in the figure 2. (orig.)

Evaluation of the electrode performance for PAFC by using acid absorption, acceleration and ac-impedance measurement

Energy Technology Data Exchange (ETDEWEB)

Kim, Chang-Soo; Song, Rak-Hyun; Choi, Byung-Woo [Korea Institute of Energy Research, Taejon (Korea, Republic of)] [and others

1996-12-31

In PAFC, the degradation on cathode electrode caused by carbon corrosion, platinum dissolution and growth is especially severe. An acceleration test is a good technique for evaluating the degradation of electrode performance, because it does not need long time. Coleman et al used thermal cycling and on-off cycling as an acceleration test. Song et al showed that hydrogen shortage decreased the electrode performance more rapidly than that of air shortage in gas shortage test. Honji et al reported that the rate of coarsening of Pt particle is rapid in open circuit potential and this is one of major causes on the performance degradation of electrode. The cathode performance has been studied by using acid absorption, acceleration and ac-impedance measurements as functions of the polytetrafluoroethylene (PTFE) contents and sintering temperatures of the electrode.

High temperature impedance spectroscopy of barium stannate

Indian Academy of Sciences (India)

... differential thermal analysis, thermogravimetric analysis and Fourier transform infrared techniques. Electrical properties were studied using a.c. impedance spectroscopy technique in the temperature range of 50–650 °C and frequency range of 10 Hz–13 MHz. The complex impedance plots at temperature ≥ 300 °C show ...

Formation of Escherichia coli Hfr strains by integrative suppression with the P group plasmid RP1.

OpenAIRE

Martin, R R; Thorlton, C L; Unger, L

1981-01-01

Hfr strains of Escherichia coli were obtained by integrative suppression of a dnaA(Ts) mutation by the Inc P-1 plasmid RP1 without prior creation of an unnatural homology between the plasmid and the E. coli chromosome. Unmodified RP1 mobilized the polarized transfer of the chromosome in a counterclock-wise direction from a distinct origin between 81 min (pyrE) and 82 min (dnaA) with pyrE as a leading marker. Inheritance of RP1-Hfr chromosomal and antibiotic resistance genes was due to recombi...

Experiment HFR-B1: A preliminary analysis of the water-vapor injection experiments in capsule 3

International Nuclear Information System (INIS)

Myers, B.F.

1993-01-01

A preliminary analysis of the response of uranium oxycarbide (UCO) fuel to water vapor addition in capsule 3 of experiment HFR-B1 (HFR-B1/3) has been conducted. The analysis provides an early indication of the behavior of fission gas release under a wider range of water-vapor pressures and of temperatures than heretofore studied. A preliminary analysis of selected aspects of the water-vapor injection tests in capsule 3 of experiment HFR-B1 is presented. The release of fission gas stored in bubbles and the diffusive release of fission-gas atoms are distinguished. The dependence of the release of stored fission gas ( 85m Kr) on water-vapor pressure, P(H 2 O), and temperature were established taking into account the contributing mechanisms of gaseous release, the effect of graphite hydrolysis, and the requirement of consistency with experiment HRB-17 in which similar water-vapor injection tests were conducted. The dependence on P(H 2 O) becomes weaker as temperatures increase above 770 degree C; the activation energy for release of stored-fission gas is 393 kJ/mol. Isorelease curves for the pressure-temperature plane were deduced from a derived functional relation. The stored-fission gas releases as a function of P(H 2 O) at a common temperature for experiments HFR-B1 and HRB-17 differ by a factor of 4; this discrepancy could be attributed to the differences in fission-rate density and neutron flux between the two experiments. Diffusive release of fission gas occurred during and after the release of stored gas. The ratio of diffusive release during water-vapor injection to that prior to injection varied in contrast to the results from HRB-17. The variation was attributed to the practice of injecting water vapor into HFR-B1 before sintering of the fuel, hydrolyzed in the previous test, was completed. The derived activation energy for diffusive release is 23.6 kJ/mol

Experiment HFR-B1: A preliminary analysis of the water-vapor injection experiments in capsule 3

Energy Technology Data Exchange (ETDEWEB)

Myers, B.F.

1993-08-01

A preliminary analysis of the response of uranium oxycarbide (UCO) fuel to water vapor addition in capsule 3 of experiment HFR-B1 (HFR-B1/3) has been conducted. The analysis provides an early indication of the behavior of fission gas release under a wider range of water-vapor pressures and of temperatures than heretofore studied. A preliminary analysis of selected aspects of the water-vapor injection tests in capsule 3 of experiment HFR-B1 is presented. The release of fission gas stored in bubbles and the diffusive release of fission-gas atoms are distinguished. The dependence of the release of stored fission gas ({sup 85m}Kr) on water-vapor pressure, P(H{sub 2}O), and temperature were established taking into account the contributing mechanisms of gaseous release, the effect of graphite hydrolysis, and the requirement of consistency with experiment HRB-17 in which similar water-vapor injection tests were conducted. The dependence on P(H{sub 2}O) becomes weaker as temperatures increase above 770{degree}C; the activation energy for release of stored-fission gas is 393 kJ/mol. Isorelease curves for the pressure-temperature plane were deduced from a derived functional relation. The stored-fission gas releases as a function of P(H{sub 2}O) at a common temperature for experiments HFR-B1 and HRB-17 differ by a factor of 4; this discrepancy could be attributed to the differences in fission-rate density and neutron flux between the two experiments. Diffusive release of fission gas occurred during and after the release of stored gas. The ratio of diffusive release during water-vapor injection to that prior to injection varied in contrast to the results from HRB-17. The variation was attributed to the practice of injecting water vapor into HFR-B1 before sintering of the fuel, hydrolyzed in the previous test, was completed. The derived activation energy for diffusive release is 23.6 kJ/mol.

Effect of temperature on the AC impedance of protein and ...

Indian Academy of Sciences (India)

2016-08-26

Aug 26, 2016 ... The depression parameter reveals the electrical equivalent circuit for the biopolymers. The AC electrical conductivity in the biopolymers follows the universal power law. From this, it is observed that the AC conductivity is frequency dependent and the biopolymer papain obeys large polaron tunnelling model ...

The electrical conductivities of polyimide and polyimide/Li triflate composites: An a.c. impedance study

Science.gov (United States)

Aziz, Nor Diyana Abdul; Kamarulzaman, Norlida; Subban, Ri Hanum Yahaya; Hamzah, Ahmad Sazali; Ahmed, Azni Zain; Osman, Zurina; Rusdi, Roshidah; Kamarudin, Norashikin; Mohalid, Norhanim; Romli, Ahmad Zafir; Shaameri, Zurina

2017-09-01

Polymer electrolytes have been an essential area of research for many decades. One of the reasons was the need to find new electrolyte materials suitable for device applications like solid-state batteries, supercapacitors, fuel cells, etc. with enhanced characteristics. For more than 40 years, polyimide has been known as a super-engineering plastic due to its excellent thermal stability (Tg > 250 °C) and mechanical properties. Therefore, in an effort to develop new polymer electrolytes, polyimide as a polymer matrix was chosen. Composite films of the polymer doped with lithium salt, LiCF3SO3 was prepared. These PI based polymer electrolyte films were investigated by the alternating current (a.c.) impedance spectroscopy method in the temperature range from 300 K to 373 K. It was observed that conductivity increased with the increase of temperature and amount of doping salt. Alternatively, the activation energy (Ea) of the composite films decreased with the increase of the doping salt, LiCF3SO3.

Prevalence of Prediabetes and Undiagnosed Diabetes in Patients with HFpEF and HFrEF and Associated Clinical Outcomes

DEFF Research Database (Denmark)

Kristensen, Søren L; Jhund, Pardeep S; Lee, Matthew M Y

2017-01-01

PURPOSE: The prevalence and consequences of prediabetic dysglycemia and undiagnosed diabetes is unknown in patients with heart failure (HF) and preserved ejection fraction (HFpEF) and has not been compared to heart failure and reduced ejection fraction (HFrEF). METHODS: We examined the prevalence...... and outcomes associated with normoglycemia, prediabetic dysglycemia and diabetes (diagnosed and undiagnosed) among individuals with a baseline glycated hemoglobin (hemoglobin A1c, HbA1c) measurement stratified by HFrEF or HFpEF in the Candesartan in Heart failure Assessment of Reduction in Mortality...... and was available in 1072/3023 (35%) of patients with HFpEF and 1578/4576 (34%) patients with HFrEF. 18 and 16% had normoglycemia (HbA1c prediabetes (HbA1c 6.0-6.4), respectively. Finally among patients with HFpEF 22% had undiagnosed diabetes (HbA1c > 6.4), and 40% had known diabetes (any Hb...

Application of the parametric proper generalized decomposition to the frequency-dependent calculation of the impedance of an AC line with rectangular conductors

Directory of Open Access Journals (Sweden)

Sancarlos-González Abel

2017-12-01

Full Text Available AC lines of industrial busbar systems are usually built using conductors with rectangular cross sections, where each phase can have several parallel conductors to carry high currents. The current density in a rectangular conductor, under sinusoidal conditions, is not uniform. It depends on the frequency, on the conductor shape, and on the distance between conductors, due to the skin effect and to proximity effects. Contrary to circular conductors, there are not closed analytical formulas for obtaining the frequency-dependent impedance of conductors with rectangular cross-section. It is necessary to resort to numerical simulations to obtain the resistance and the inductance of the phases, one for each desired frequency and also for each distance between the phases’ conductors. On the contrary, the use of the parametric proper generalized decomposition (PGD allows to obtain the frequency-dependent impedance of an AC line for a wide range of frequencies and distances between the phases’ conductors by solving a single simulation in a 4D domain (spatial coordinates x and y, the frequency and the separation between conductors. In this way, a general “virtual chart” solution is obtained, which contains the solution for any frequency and for any separation of the conductors, and stores it in a compact separated representations form, which can be easily embedded on a more general software for the design of electrical installations. The approach presented in this work for rectangular conductors can be easily extended to conductors with an arbitrary shape.

Application of the parametric proper generalized decomposition to the frequency-dependent calculation of the impedance of an AC line with rectangular conductors

Science.gov (United States)

Sancarlos-González, Abel; Pineda-Sanchez, Manuel; Puche-Panadero, Ruben; Sapena-Bano, Angel; Riera-Guasp, Martin; Martinez-Roman, Javier; Perez-Cruz, Juan; Roger-Folch, Jose

2017-12-01

AC lines of industrial busbar systems are usually built using conductors with rectangular cross sections, where each phase can have several parallel conductors to carry high currents. The current density in a rectangular conductor, under sinusoidal conditions, is not uniform. It depends on the frequency, on the conductor shape, and on the distance between conductors, due to the skin effect and to proximity effects. Contrary to circular conductors, there are not closed analytical formulas for obtaining the frequency-dependent impedance of conductors with rectangular cross-section. It is necessary to resort to numerical simulations to obtain the resistance and the inductance of the phases, one for each desired frequency and also for each distance between the phases' conductors. On the contrary, the use of the parametric proper generalized decomposition (PGD) allows to obtain the frequency-dependent impedance of an AC line for a wide range of frequencies and distances between the phases' conductors by solving a single simulation in a 4D domain (spatial coordinates x and y, the frequency and the separation between conductors). In this way, a general "virtual chart" solution is obtained, which contains the solution for any frequency and for any separation of the conductors, and stores it in a compact separated representations form, which can be easily embedded on a more general software for the design of electrical installations. The approach presented in this work for rectangular conductors can be easily extended to conductors with an arbitrary shape.

Joint research centre fusion materials irradiations in HFR: Present status and prospectives

International Nuclear Information System (INIS)

Casini, G.; Fenici, P.

1989-01-01

First a review is made of the Joint Research Centre experimental activity at HFR-Petten in the frame of the Fusion Technology and Safety Programme. The materials under investigation are: Cr-Ni Austenitic steels (316-L type) and Cr-Mn Austenitic steels (AMCR and FI type) as structural materials and Pb-17Li eutetic as tritium breeding material. The experiments on structural materials comprise: Sample irradiations with post-irradiation tensile tests (FRUST) Sample irradiations under constant load and post-irradiation strain measurement (TRIESTE) On-line creep tests (CRISP). The experiments on Pb-17Li breeder material regard sample irradiations to investigate tritium production and recovery as well as tritium permeation through blanket structures (LIBRETTO Experiment). Both irradiations on structural and breeding materials will be pursued up to the end of the current JRC-Multiannual Programme (1988-1991) and even further. In the last part of the paper expected developments of the testing programme at HFR are discussed. New areas of research should involve materials for divertor applications (NET/ITER) and advanced low activation composite materials for Commercial Power Reactors

Modelling carbon steels corrosion during a long period in soils: Contribution of A.C. impedance spectroscopy

Energy Technology Data Exchange (ETDEWEB)

Pons, E.; Lemaitre, C.; Crusset, D.; David, D. [Laboratoire Roberval de Mecanique, UMR 6066 du CNRS, Universite de Technologie de Compiegne, BP 20529, F - 60205 Compiegne cedex (France)

2004-07-01

The corrosion of historical objects from World War I fields were studied by using two methods: characterization of the corrosion products by Raman Laser Spectroscopy, and behaviour of the corrosion layers by using electrochemical studies. The first technique, previously used, had shown that two layers are present on these objects, containing both different oxides and oxy-hydroxides of iron. In the present part of the work, the A.C. Impedance Spectroscopy was used to show the differences between the two layers concerning the corrosion of these objects. In order to observe the different behaviours, the specimens were studied in three surface states: with the two layers, with the internal layer only, and without oxide. The results have shown that the internal layer limits the corrosion kinetics. Then this layer was especially studied, particularly its porosity, by a comparison of the impedance results in two media with very different conductivity, and the evolution of these results with different immersion times. The buried objects had the behaviour of a porous electrode, due to the presence of the internal layer. Thus, this behaviour can be modelled with the simplified De Levie's theory, considering that each porosity is a semi-infinite hole. It appeared that the corrosion process at the oxidized interface corresponds to the transport in the electrolyte in the pores completed by a part of transport in the solid phase. These properties can be used to predict the long term corrosion behaviour of carbon steels in soils for long periods. (authors)

Modelling carbon steels corrosion during a long period in soils: Contribution of A.C. impedance spectroscopy

International Nuclear Information System (INIS)

Pons, E.; Lemaitre, C.; Crusset, D.; David, D.

2004-01-01

The corrosion of historical objects from World War I fields were studied by using two methods: characterization of the corrosion products by Raman Laser Spectroscopy, and behaviour of the corrosion layers by using electrochemical studies. The first technique, previously used, had shown that two layers are present on these objects, containing both different oxides and oxy-hydroxides of iron. In the present part of the work, the A.C. Impedance Spectroscopy was used to show the differences between the two layers concerning the corrosion of these objects. In order to observe the different behaviours, the specimens were studied in three surface states: with the two layers, with the internal layer only, and without oxide. The results have shown that the internal layer limits the corrosion kinetics. Then this layer was especially studied, particularly its porosity, by a comparison of the impedance results in two media with very different conductivity, and the evolution of these results with different immersion times. The buried objects had the behaviour of a porous electrode, due to the presence of the internal layer. Thus, this behaviour can be modelled with the simplified De Levie's theory, considering that each porosity is a semi-infinite hole. It appeared that the corrosion process at the oxidized interface corresponds to the transport in the electrolyte in the pores completed by a part of transport in the solid phase. These properties can be used to predict the long term corrosion behaviour of carbon steels in soils for long periods. (authors)

Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

DEFF Research Database (Denmark)

Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin

2009-01-01

This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can produce the correct volt...

Measurements of the surface impedance and the ac critical field of superconducting thin tin films at 10 GHz

International Nuclear Information System (INIS)

Spencer, G.L.

1976-01-01

The surface impedances and ac critical fields of superconducting thin tin films were studied. These experiments were performed using a superconducting frequency stabilized microwave cavity of high Q. Measurements of the power losses in the cavity and the center frequency of the cavity were used to determine the surface impedance and the critical field of a thin film sample placed in the cavity. In this case a theoretical treatment based on a model proposed by I.O. Kulik was used to fit the data. The general agreement between the modified Kulik treatment and the data, obtained in this experiment, was substantial. The second method was to modify the thin film data to correspond to a bulk situation. This modification was accomplished by taking into account the measuring techniques used and the geometric consideration inherent in the experiment. The comparison between the modified experimental data and calculations obtained from the Mattis-Bardeen bulk model was generally very good. One aspect of the results which was not explained was the presence of a slight increase in the surface resistance in the vicinity of the transition temperature. The critical field measurements were compared to the (1 - (T/T/sub c/)/sup 1/2) dependence predicted by Bardeen. If it is assumed that substantial microwave heating took place in the sample near T/sub c/, then remarkable agreement with the Bardeen model can be reached

Decontamination of the HFR dismantling cell

International Nuclear Information System (INIS)

Cloes, K.; Husmann, K.; Hardt, P. von der.

1976-05-01

The Commission of the European Communities operates in the Petten Establishment of the Joint Research Centre (EURATOM), a 45 MW light-water cooled materials testing reactor, the HFR. Inside the reactor containment building, on top of a side wing of the main pool, a hot cell had been constructed for the dismantling, of irradiated equipment, and brought into active service in July 1966. Early in 1973, the cell was contaminated by 0.1 to 1 Ci of Po 210 , originating from an irradiation capsule containing Bi impregnated graphite specimens. Due to the elevated radiotoxicity of this isotope, and to numerous potential ways of spreading out the contamination it was decided to stop routine operation of the cell until a satisfactory degree of decontamination had been reached. Two years have been spent for preparation of specialized equipment and thorough clean-up and overhaul work of the cell. It went back into normal operation on February 21st, 1975 and has since then been working very successfully

HFR irradiation testing of fusion materials

International Nuclear Information System (INIS)

Conrad, R.; von der Hardt, P.; Loelgen, R.; Scheurer, H.; Zeisser, P.

1984-01-01

The present and future role of the High Flux Reactor Petten for fusion materials testing has been assessed. For practical purposes the Tokamak-based fusion reactor is chosen as a point of departure to identify material problems and materials data needs. The identification is largely based on the INTOR and NET design studies, the reported programme strategies of Japan, the U.S.A. and the European Communities for technical development of thermonuclear fusion reactors and on interviews with several experts. Existing and planned irradiation facilities, their capabilities and limitations concerning materials testing have been surveyed and discussed. It is concluded that fission reactors can supply important contributions for fusion materials testing. From the point of view of future availability of fission testing reactors and their performance it appears that the HFR is a useful tool for materials testing for a large variety of materials. Prospects and recommendations for future developments are given

Dielectric and impedance spectral characteristics of bulk ZnIn2Se4

Science.gov (United States)

El-Nahass, M. M.; Attia, A. A.; Salem, G. F.; Ali, H. A. M.; Ismail, M. I.

2014-02-01

The frequency and temperature dependence of ac conductivity, dielectric constant and dielectric loss of ZnIn2Se4 in a pellet form were investigated in the frequency range of 102-106 Hz and temperature range of 293-356 K. The behavior of ac conductivity was interpreted by the correlated barrier hopping (CBH) model. Temperature dependence of ac conductivity indicates that ac conduction is a thermally activated process. The density of localized states N(EF) and ac activation energy were estimated for various frequencies. Dielectric constant and dielectric loss showed a decrease with increasing frequency and an increase with increasing in temperature. The frequency dependence of real and imaginary parts of the complex impedance was investigated. The relaxation time decreases with the increase in temperature. The impedance spectrum exhibits the appearance of the single semicircular arc. The radius of semicircular arcs decreases with increasing temperature which suggests a mechanism of temperature-dependent on relaxation.

ELECTRONIC SYSTEM FOR EXPERIMENTATION IN AC ELECTROGRAVIMETRY I: TECHNIQUE FUNDAMENTALS

Directory of Open Access Journals (Sweden)

Róbinson Torres

Full Text Available Basic fundamentals of AC electrogravimetry are introduced. Their main requirements and characteristics are detailed to establish the design of an electronic system that allows the appropriate extraction of data needed to determine the electrogravimetric transfer function (EGTF and electrochemical impedance (EI, in an experimental set-up for the AC electrogravimetry technique.

AC-Conductivity measurements on γ-aluminium oxynitride

NARCIS (Netherlands)

Willems, H.X.; Hal, van P.F.; Metselaar, R.; With, de G.

1995-01-01

AC-conductivity measurements were performed on aluminium oxynitrides (Alons) because of their interesting defect structure. Although it became apparent that these Alons are not stable in the temperature range used, the electrical properties of the materials could be measured with impedance

Single and multi-frequency impedance characterization of symmetric activated carbon single capacitor cells

Directory of Open Access Journals (Sweden)

Suzana Sopčić

2018-05-01

Full Text Available Electrochemical impedance spectroscopy (EIS technique is used for characterization of single cell symmetric capacitors having different mass loadings of activated carbon (AC. Relevant values of charge storage capacitance (CT and internal resistance (ESR were evaluated by the single frequency and multi-frequency analyses of measured impedance spectra. Curve fittings were based on the non-ideal R-C model that takes into account the parasitic inductance, contributions from electrode materials/contacts and the effects of AC porosity. Higher CT and lower ESR values were obtained not only for the cell with higher mass of AC, but also using the single vs. multi-frequency approach. Lower CT and higher values of ESR that are generally obtained using the multi-frequency method and curve fittings should be related to the not ideal capacitive response of porous AC material and too high frequency chosen in applying the single frequency analysis.

Neutron metrology in the HFR. Steel irradiation. R139-801 (SINAS)

International Nuclear Information System (INIS)

Ketema, D.J.

1999-02-01

The R139-80 series irradiation experiments is part of the NRG materials test programme to evaluate the irradiation behaviour of several types of austenitic stainless steel. Within this programme five R139-80 specimen holders were irradiated in the HFR Petten to different dose levels. This report presents the final metrology results obtained from activation monitors in a specimen holder, coded as R139-801, containing 12 Compact Tension (CT-10 mm) specimens made from the austenitic stainless steel types 308LSXB/TIG and 304-SXB. The R139-801 assembly was irradiated in channel 1 of a TRIO type facility placed in HFR core-position F8. The aim of this irradiation of specimen holder R139-801 was to reach a minimum target damage level of 7.5 dpa for the specimens at a temperature of 335C. The monitor sets are used to calculate the thermal and fast neutron fluences, displacements per atom and the generated helium content. Additionally detailed information concerning an estimation of the fluence and damage doses received by each specimen and its temperature during irradiation are presented. The main results of the thermal and fast neutron fluence measurements are presented. The results indicate that the obtained damage levels in the steel specimens loaded in this specimen holder vary from 5.8 to 7.9 dpa. The temperatures of the specimens during irradiation varied between 304 and 337C. 14 refs

Impedance Analysis of Silicon Nanowire Lithium Ion Battery Anodes

KAUST Repository

Ruffo, Riccardo; Hong, Seung Sae; Chan, Candace K.; Huggins, Robert A.; Cui, Yi

2009-01-01

The impedance behavior of silicon nanowire electrodes has been investigated to understand the electrochemical process kinetics that influences the performance when used as a high-capacity anode in a lithium ion battery. The ac response was measured

Neutron radiography at the HFR Petten

International Nuclear Information System (INIS)

Markgraf, J.F.W.

1990-03-01

This report contains the five papers on neutron radiography activities at the Petten High Flux Reactor (HFR) presented at the Third World Conference on Neutron Radiography which was held in May 1989 in Osaka, Japan. In addition, a survey on neutron radiography in Europe for industry and research as presented at the SITEF NDT symposium 1989 on European Advances in Non-Destructive Testing, held in Toulouse/France in October 1989 is included. The papers compiled here are concerned with: the neutron radiography services available in Petten; the experience with and applications of neutron radiography at Petten; image evaluation and analysis techniques at Petten; the practical utilization of nitrocellulose film in neutron radiography in Europe; an introduction into the basic principles of neutron radiography; an overview of the neutron radiography facilities in Europe for industry and research; and a survey of typical applications of neutron radiography in industry, research and sciences. It is the intention of this compilation to provide a comprehensive overview of the present Petten activities and European facilities in this young and promising field of non-destructive testing of materials and components from the nuclear and the non-nuclear industries and research organizations, and from the sciences

The AC Impedance Characteristic of High Power Li4Ti5O12-based Battery Cells

DEFF Research Database (Denmark)

Stroe, Ana-Irina; Stroe, Daniel Loan; Swierczynski, Maciej Jozef

2015-01-01

This paper studies the impedance characteristics of a fresh 13 Ah high-power lithium titanate oxide (LTO) battery cell and analyses its dependence on the temperature and state-of-charge. The impedance of the battery cell was measured by means of the electrochemical impedance spectroscopy (EIS......) technique for the entire state-of-charge (SOC) interval and considering five temperatures between 5oC and 45oC. By analyzing the measured impedance spectra of the LTO-based battery cell, it was found out that the cell’s impedance is extremely dependent on the operating conditions. By further processing...

Soybean oil in water-borne coatings and latex film formation study by AC impedance

Science.gov (United States)

Jiratumnukul, Nantana

Conventional coalescing agents such as butyl cellosolve, butyl carbitol, and TexanolRTM are widely use in the latex coatings industry to facilitate film formation at ambient temperature. Coalescent aids are composed of solvents with low evaporation rates. After water evaporates, coalescent aids would help soften polymer molecules and form continuous films, then gradually evaporates from the film. Coalescent aids, therefore, are considered as volatile organic compounds (VOC), which are of environmental concern. The main purpose of this research project was to prepare a fatty acid glycol ester from soybean oil and glycol (polyols). The soybean oil glycol ester can be used as a coalescent aid in latex paint formulation. The soybean oil glycol ester not only lowered the minimum film formation temperature of latex polymers and continuous film formed at ambient temperature, but also after it has facilitated film formation, does not substantially evaporate, but becomes part of the film. Soybean oil glycol esters, therefore, can reduce the VOC levels and facilitate film formation of latex paints. In the second part of this research AC-Impedance was used to investigate the efficiency of soybean oil coalescent aid in latex film formation relative to the conventional ones. The coating resistance showed that the efficiency of film formation was increased as a function of dry time. The coating resistance also exhibited the effect of soybean oil ester in latex film formation in the same fashion as a conventional coalescent aid, TexanolRTM.

Characterization and evaluation of EB-PVD thermal barrier coatings by impedance spectroscopy

Energy Technology Data Exchange (ETDEWEB)

Zhang Chunxia; Liu Fushun; Gong Shengkai; Xu Huibin [School of Materials Science and Engineering, Beihang Univ., Beijing, BJ (China)

2005-07-01

Two layer thermal barrier coatings (TBCs) were prepared by EB-PVD (electron beam-physical vapor deposition) at different substrate temperatures in the range of 823 to 1123 K, and their microstructure was investigated with SEM and AC impedance as a function of substrate temperature and thermal cycling time. YSZ layer of all TBCs samples is in column structure, but the grain size and growth orientation are different with substrate. In this research, impedance spectra (IS) was measured as a function of thermal cycling between 1323 K and 298 K for these thermal barrier coatings. Grain boundary and bulk can be distinguished from analysis of AC impedance spectroa to provide information about the relation between microstructure and electric properties. The change in IS until failure was found to be related with the thickness, microcracks and macrocracks of TGO and the change in the interfacial of TGO/YSZ. (orig.)

Investigation of body's impedance under different conditions for electro-acupuncture

International Nuclear Information System (INIS)

Ahmed, M.M.; Abrarov, S.; Khan, R.R.; Maqsood, R.S.; Qaiser, M.A.; Karimov, Kh. S.

2001-01-01

A computer controlled automated setup has been designed to investigate the body acupuncture points (bio-active points) by using a probes matrix which exerts a uniform pressure on the body. 16 probes matrix was placed in a 15 : 15 mm/sup 2/ dielectric substrate with 5 mm inter probe distance, compatible with the average diameter of the points. These probes have been designed to facilitate a semiconductor injection laser for probing of the points along with optical and/or electric signal. The bioactive points were identified by evaluating the impedance between each probe and a hand held electrode through a micro-controlled scan. This also allowed the selection of an appropriate signal - DC, AC or tidal waveform, for the electric treatment of bioactive points. It has been found that body impedance decreases with the increase of measuring voltage. Moreover, for current-voltage characteristics a nonlinearity coefficient in the range 2-3 was also observed. The study revealed that at low applied voltages 0.l V, the impedance depends on the polarity of the applied signal. Furthermore, body impedance decreases nonlinearly by increasing the probe's pressure on the skin, which may be attributed to piezo resistive effect. By using the AC and Dc measurements an appropriate body equivalent circuit is proposed in this investigation. (author)

Neutronic feasibility studies for LEU conversion of the HFR Petten reactor

International Nuclear Information System (INIS)

Hanan, N.A.; Deen, J.R.; Matos, J.E.; Hendriks, J.A.; Thijssen, P.J.M.; Wijtsma, F.J.

2000-01-01

Design and safety analyses to determine an optimum LEU fuel assembly design using U 3 Si 2 -Al fuel with up to 4.8 g/cm 3 for conversion of the HFR Petten reactor were performed by the RERTR program in cooperation with the Joint Research Centre and NRG. Credibility of the calculational methods and models were established by comparing calculations with recent measurements by NRG for a core configuration set up for this purpose. This model and methodology were then used to study various LEU fissile loading and burnable poison options that would satisfy specific design criteria. (author)

Predictors and Prognostic Value of Worsening Renal Function During Admission in HFpEF Versus HFrEF: Data From the KorAHF (Korean Acute Heart Failure) Registry.

Science.gov (United States)

Kang, Jeehoon; Park, Jin Joo; Cho, Young-Jin; Oh, Il-Young; Park, Hyun-Ah; Lee, Sang Eun; Kim, Min-Seok; Cho, Hyun-Jai; Lee, Hae-Young; Choi, Jin Oh; Hwang, Kyung-Kuk; Kim, Kye Hun; Yoo, Byung-Su; Kang, Seok-Min; Baek, Sang Hong; Jeon, Eun-Seok; Kim, Jae-Joong; Cho, Myeong-Chan; Chae, Shung Chull; Oh, Byung-Hee; Choi, Dong-Ju

2018-03-13

Worsening renal function (WRF) is associated with adverse outcomes in patients with heart failure. We investigated the predictors and prognostic value of WRF during admission, in patients with preserved ejection fraction (HFpEF) versus those with reduced ejection fraction (HFrEF). A total of 5625 patients were enrolled in the KorAHF (Korean Acute Heart Failure) registry. WRF was defined as an absolute increase in creatinine of ≥0.3 mg/dL. Transient WRF was defined as recovery of creatinine at discharge, whereas persistent WRF was indicated by a nonrecovered creatinine level. HFpEF and HFrEF were defined as a left ventricle ejection fraction ≥50% and ≤40%, respectively. Among the total population, WRF occurred in 3101 patients (55.1%). By heart failure subgroup, WRF occurred more frequently in HFrEF (57.0% versus 51.3%; P failure subgroups. Among various predictors of WRF, chronic renal failure was the strongest predictor. WRF was an independent predictor of adverse in-hospital outcomes (HFrEF: odds ratio; 2.75; 95% confidence interval, 1.50-5.02; P =0.001; HFpEF: odds ratio, 9.48; 95% confidence interval, 1.19-75.89; P =0.034) and 1-year mortality (HFrEF: hazard ratio, 1.41; 95% confidence interval, 1.12-1.78; P =0.004 versus HFpEF: hazard ratio, 1.72; 95% confidence interval, 1.23-2.42; P =0.002). Transient WRF was a risk factor for 1-year mortality, whereas persistent WRF had no additive risk compared to transient WRF. In patients with acute heart failure patients, WRF is an independent predictor of adverse in-hospital and follow-up outcomes in both HFrEF and HFpEF, though with a different effect size. URL: https://www.clinicaltrials.gov. Unique identifier: NCT01389843. © 2018 The Authors. Published on behalf of the American Heart Association, Inc., by Wiley.

Comparison of thermohydraulic and nuclear aspects in a standard HEU core and a typical LEU core for the HFR Petten. A case study

International Nuclear Information System (INIS)

Pruimboom, H.; Tas, A.

1985-01-01

Within the framework of the RERTR program various HEU-LEU core calculations have been performed by ANL in a cooperative effort with ECN and JRC Petten. The main purpose of this work has been to gain competence in analysing HEU-LEU core conversion for high power Materials Testing Reactors and to assist in a possible HEU-LEU conversion of the HFR Petten. For reference purposes the present HFR standard core (HEU) in the 'old' vessel geometry was calculated at first. As a next step the new vessel geometry and the increased fuel weights were taken into account. Subsequently various LEU HFR core options have been analysed. Main parameters in the LEU study were the uranium loading in the meat, the fuel type, the thickness of the meat, the number of fuel plates per element and the type of burnable poison applied. Though the study has not yet been completed, one of its striking preliminary results concerns the increased power peaking in the LEU fuel elements as compared with the HEU situation. A preliminary analysis of the thermal characteristics of a typical LEU core as compared with a standard HEU core has been made and is presented in the paper. A short survey of the various HEU and LEU calculations is given. The thermal safety analysis procedure for the HFR, as based on the flow instability criterion, is clarified. Finally, the thermal comparison HEU versus LEU and the resulting conclusions are presented. (author)

Use of an AC/DC/AC Electrochemical Technique to Assess the Durability of Protection Systems for Magnesium Alloys

Science.gov (United States)

Song, Sen; McCune, Robert C.; Shen, Weidian; Wang, Yar-Ming

One task under the U.S. Automotive Materials Partnership (USAMP) "Magnesium Front End Research and Development" (MFERD) Project has been the evaluation of methodologies for the assessment of protective capability for a variety of proposed protection schemes for this hypothesized multi-material, articulated structure. Techniques which consider the entire protection system, including both pretreatments and topcoats are of interest. In recent years, an adaptation of the classical electrochemical impedance spectroscopy (EIS) approach using an intermediate cathodic DC polarization step (viz. AC/DC/AC) has been employed to accelerate breakdown of coating protection, specifically at the polymer-pretreatment interface. This work reports outcomes of studies to employ the AC/DC/AC approach for comparison of protective coatings to various magnesium alloys considered for front end structures. In at least one instance, the protective coating system breakdown could be attributed to the poorer intrinsic corrosion resistance of the sheet material (AZ31) relative to die-cast AM60B.

AC and DC electrical behavior of MWCNT/epoxy nanocomposite near percolation threshold: Equivalent circuits and percolation limits

Science.gov (United States)

Alizadeh Sahraei, Abolfazl; Ayati, Moosa; Baniassadi, Majid; Rodrigue, Denis; Baghani, Mostafa; Abdi, Yaser

2018-03-01

This study attempts to comprehensively investigate the effects of multi-walled carbon nanotubes (MWCNTs) on the AC and DC electrical conductivity of epoxy nanocomposites. The samples (0.2, 0.3, and 0.5 wt. % MWCNT) were produced using a combination of ultrason and shear mixing methods. DC measurements were performed by continuous measurement of the current-voltage response and the results were analyzed via a numerical percolation approach, while for the AC behavior, the frequency response was studied by analyzing phase difference and impedance in the 10 Hz to 0.2 MHz frequency range. The results showed that the dielectric parameters, including relative permittivity, impedance phase, and magnitude, present completely different behaviors for the frequency range and MWCNT weight fractions studied. To better understand the nanocomposites electrical behavior, equivalent electric circuits were also built for both DC and AC modes. The DC equivalent networks were developed based on the current-voltage curves, while the AC equivalent circuits were proposed by using an optimization problem according to the impedance magnitude and phase at different frequencies. The obtained equivalent electrical circuits were found to be highly useful tools to understand the physical mechanisms involved in MWCNT filled polymer nanocomposites.

How the Inductive Voltage Adder (IVA) output impedance affects impedance dynamics of a Self-Magnetic Pinch (SMP) diode

Science.gov (United States)

Renk, Timothy; Simpson, Sean; Webb, Timothy; Mazarakis, Michael; Kiefer, Mark

2016-10-01

The SMP diode, fielded on the RITS-6 (3.5-8.5 MV) IVA accelerator at Sandia National Laboratories, produces a focused electron beam (transmission line (MITL) center conductors, of 40 and 80 ohms flow impedance. We have operated in-situ heating and discharge-cleaning hardware in the load region, in order to address the tendency of some shots to undergo premature impedance (Z) collapse, defined as a fall in impedance beyond that due to normal movement of electrode plasmas that reduces the effective A-K gap. The goal of heating/cleaning was to reduce the volume of evolving gases near the A-K gap. Despite clear evidence that the cleaning techniques removed the proton portion of beam current, we observed no consistent increase in diode impedance (ZDIODE). This forced an examination of the role that the IVA flow impedance has on ZDIODE. A preliminary conclusion is that ZDIODE should be at least 1.5 times the flow impedance before ZDIODE is a parameter independent of flow impedance. This has implications for SMP as a load for a IVA, since ZDIODE >100 ohms has not been consistently demonstrated. Data analysis is ongoing, and latest results will be reported. Sandia National Laboratories is a multi-program laboratory managed and operated by Sandia Corporation, a wholly owned subsidiary of Lockheed Martin Corporation, for the U.S. Department of Energy's National Nuclear Security Administration under contract DE-AC04-94AL85000.

High flux materials testing reactor HFR Petten. Characteristics of facilities and standard irradiation devices

International Nuclear Information System (INIS)

Roettger, H.; Hardt, P. von der; Tas, A.; Voorbraak, W.P.

1981-01-01

For the materials testing reactor HFR some characteristic information is presented. Besides the nuclear data for the experiment positions short descriptions are given of the most important standard facilities for material irradiation and radionuclide production. One paragraph deals with the experimental set-ups for solid state and nuclear structure investigations. The information in this report refers to a core type, which is operational since March 1977. The numerical data compiled have been up-dated to January 1981

AC impedance behaviour and state-of-charge dependence of Zr0 ...

Indian Academy of Sciences (India)

Unknown

measurement encompasses a wide range of AC signal frequencies, various characteristic parameters of the electrochemical cell and kinetics of the associated reactions can be evaluated. Metal-hydride (MH) electrodes form the anode or the negative plate of a nickel-metal- hydride battery. However, the development of MH ...

A comparison of HFrEF vs HFpEF's clinical workload and cost in the first year following hospitalization and enrollment in a disease management program.

Science.gov (United States)

Murphy, T M; Waterhouse, D F; James, S; Casey, C; Fitzgerald, E; O'Connell, E; Watson, C; Gallagher, J; Ledwidge, M; McDonald, K

2017-04-01

Admission with heart failure (HF) is a milestone in the progression of the disease, often resulting in higher intensity medical care and ensuing readmissions. Whilst there is evidence supporting enrolling patients in a heart failure disease management program (HF-DMP), not all reported HF-DMPs have systematically enrolled patients with HF with preserved ejection fraction (HFpEF) and there is a scarcity of literature differentiating costs based on HF-phenotype. 1292 consenting, consecutive patients admitted with a primary diagnosis of HF were enrolled in a hospital based HF-DMP and categorized as HFpEF (EF≥45%) or HFrEF (EFHospitalizations, primary care, medications, and DMP workload with associated costs were evaluated assessing DMP clinic-visits, telephonic contact, medication changes over 1year using a mixture of casemix and micro-costing techniques. The total average annual cost per patient was marginally higher in patients with HFrEF €13,011 (12,011, 14,078) than HFpEF, €12,206 (11,009, 13,518). However, emergency non-cardiovascular admission rates and average cost per patient were higher in the HFpEF vs HFrEF group (0.46 vs 0.31 per patient/12months) & €655 (318, 1073) vs €584 (396, 812). In the first 3months of the outpatient HF-DMP the HFrEF population cost more on average €791 (764, 819) vs €693 (660, 728). There are greater short-term (3-month) costs of HFrEF versus HFpEF as part of a HF-DMP following an admission. However, long-term (3-12month) costs of HFpEF are greater because of higher non-cardiovascular rehospitalisations. As HFpEF becomes the dominant form of HF, more work is required in HF-DMPs to address prevention of non-cardiovascular rehospitalisations and to integrate hospital based HF-DMPs into primary healthcare structures. Copyright © 2017 Elsevier Ireland Ltd. All rights reserved.

Sample preparation for the HAW project and experimental results from the HFR

International Nuclear Information System (INIS)

Garcia Celma, A.; Wees, H. van; Miralles, L.

1990-09-01

This report deals with the preparation and analysis of samples, during the period May 1989-November 1989, for the High-Active Waste (HAW) project, a large-scale in situ test being performed underground in the Asse salt mine, Remlingen FRG. The development of the technical procedures required, and the scientific results, which regard mostly characterization of Potasas del Llobregat sample, are reported. Prior to using the samples in both the H.A.W. and the H.F.R. experiments they have to be machined to fit their holders. Technical improvements for machining samples of salt are reported. (H.W.). 9 refs.; 68 figs.; 10 tabs

AC characterization of bulk organic solar cell in the dark and under illumination

International Nuclear Information System (INIS)

Váry, Michal; Perný, Milan; Šály, Vladimír; Packa, Juraj

2014-01-01

Highlights: • A study of organic bulk photovoltaic (PV) solar cell. • Current–voltage characteristics in the dark and under illumination. • AC measurements, both under illumination and in the dark conditions. • Equivalent AC circuit. • Effective lifetime assigned with electron–hole recombination and diffusion time of the electron was estimated. - Abstract: Impedance spectroscopy has been used widely to evaluate the transport processes in photovoltaic, mainly based on inorganic semiconductors, structures – solar cells. The aim of this research was to characterize improved organic bulk photovoltaic (PV) solar cells exploiting this method. Progress in technology of investigated organic solar cell involves the use of an active layer based on low band gap type of polymer. The organic PV cell with front transparent electrode and rear metal electrode and active layer produced by Konarka Technologies was analyzed by electrical DC and AC measurements. Current–voltage (I–V) characteristics in the dark and under illumination were measured and basic PV parameters were calculated. AC measurements, both under illumination and in the dark conditions, were processed in order to identify electronic behavior using equivalent AC circuit which was suggested by fitting of measured impedance data. Circuit with the best correlation to measured data is analyzed in details. Voltage and frequency dependences of fitted equivalent circuit components and calculated parameters are explained and presented in the paper

The electrochemical impedance of metal hydride electrodes

DEFF Research Database (Denmark)

Valøen, Lars Ole; Lasia, Andrzej; Jensen, Jens Oluf

2002-01-01

The electrochemical impedance responses for different laboratory type metal hydride electrodes were successfully modeled and fitted to experimental data for AB5 type hydrogen storage alloys as well as one MgNi type electrode. The models fitted the experimental data remarkably well. Several AC......, explaining the experimental impedances in a wide frequency range for electrodes of hydride forming materials mixed with copper powder, were obtained. Both charge transfer and spherical diffusion of hydrogen in the particles are important sub processes that govern the total rate of the electrochemical...... hydrogen absorption/desorption reaction. To approximate the experimental data, equations describing the current distribution in porous electrodes were needed. Indications of one or more parallel reduction/oxidation processes competing with the electrochemical hydrogen absorption/desorption reaction were...

Neutron metrology in the HFR. Steel irradiation R139-699 (SINAS)

International Nuclear Information System (INIS)

Baard, J.H.; Paardekooper, A.

1996-06-01

The aim of the irradiation of experiment R139-699 was the testing of austenitic stainless steel type AISI-316 TIG. This report presents the final metrology results obtained from activation monitors in the specimen holder, coded as R139-699. Data about the helium production as well as the number of displacements per atom are also included. The irradiation circumstances for this experiment, carried out in a TRIO type capsule in HFR position F2, are as close as possible relevant for the candidate materials which will be used for the first wall of the NET (Next European Torus). The main results of the thermal and fast neutron fluence measurements are presented in tables 2 and 3 as well as in the figure 2. (orig.)

Automated AC Electrical Impedance Measurement of Ceramic Oxides by means of a Lock-in Amplifier

International Nuclear Information System (INIS)

Al-Khawaja, S.; Al-Sous, M. B.; Nasrallah, F.

2009-06-01

In this study, the electrical impedance of some ceramic oxides has been investigated employing the Perkin Elmer DSP 7280 Lock-in amplifier, while recording the electric response versus frequency and temperature at constant amplitude. Via integral automation of this lock-in with other delicate electrical measuring devices, a control program has been developed to accurately and swiftly acquire the frequency response of the sample, in order to lately infer the resulting samples' impedance in volt and ampere. Two maxima peaks characterising the impedance, in the curve of the doped molybdenum oxide have been observed discerning two phases in the sample (doped with 40% of niobium oxide), which shows a remarkable relaxation related to improvement in its ionic conductivity within the solid phase, with respect to increasing frequency. (author)

Comparison of Modified Impedance Whole Blood Platelet Aggregation Method Detecting Platelet Function in ACS Patients with Different CYP2C19 Genotypes.

Science.gov (United States)

Cui, Chanjuan; Qiao, Rui; Zhang, Jie

2016-01-01

A reliable laboratory test to monitor onclopidogrel platelet reactivity (PR) is very necessary. In addition, genetic factors also play an important part in onclopidogrel PR. This study aimed to modify the original impedance whole blood platelet aggregation assay associated with the release assay to monitor onclopidogrel PR and assess their relationship with genotype. We adjusted the concentration of calcium in the in vitro reaction system of platelet aggregation to modify the original impedance whole blood platelet aggregation assay. Meanwhile, chronolume, which quantified the adenosine triphosphate (ATP) released from platelet dense granules, is added to this reaction system to reflect the platelet release function. In the modified assay, platelet magnified activation time (MAT) and the maximal platelet ATP release value (RV) were used to reflect platelet function parameters. In the original assay, the electrical resistance (omega) and RV were used to reflect platelet function parameters. Onclopidogrel PR was detected by the original impedance whole blood platelet aggregation assay, modified assay, and flow cytometric vasodilator stimulated phosphoprotein (VASP) assay in 168 patients with acute coronary syndromes (ACS). CYP2C19*2 and CYP2C19*3 polymorphisms were also detected in all of these patients. This modified method showed that when 12.5 microL CaCl2 (0.2 mmol/L) was added to the reaction system, MAT was appropriate (93 +/- 23 seconds). The CVs for the modified impedance assay and release assay were 9.31% and 6.13%, respectively. The mean VASP-PRI in the patient group treated with clopidogrel was significantly lower than that in the control group without antiplatelet therapy (54.88 +/- 16.81% vs. 79.86 +/- 10.24%, p 50% group were shorter than that in the PRI 50% group were higher than that in the PRI omega) and RV of the original method showed no differences between the two groups [0 (0-2) vs. 0 (0-1.25), 0.05 (0-0.25) vs. 0.08 (0-0.24); p > 0.05, p > 0

AC and DC electrical properties of graphene nanoplatelets reinforced epoxy syntactic foam

Science.gov (United States)

Zegeye, Ephraim; Wicker, Scott; Woldesenbet, Eyassu

2018-04-01

Benefits of employing graphene nanopletlates (GNPLs) in composite structures include mechanical as well as multifunctional properties. Understanding the impedance behavior of GNPLs reinforced syntactic foams may open new applications for syntactic foam composites. In this work, GNPLs reinforced syntactic foams were fabricated and tested for DC and AC electrical properties. Four sets of syntactic foam samples containing 0, 0.1, 0.3, and 0.5 vol% of GNPLs were fabricated and tested. Significant increase in conductivity of syntactic foams due to the addition of GNPLs was noted. AC impedance measurements indicated that the GNPLs syntactic foams become frequency dependent as the volume fraction of GNPLs increases. With addition of GNPLs, the characteristic of the syntactic foams are also observed to transition from dominant capacitive to dominant resistive behavior. This work was carried out at Southern University, Mechanical Engineering Department, Baton Rouge, LA 70802, United States of America.

Transcranial extracellular impedance control (tEIC modulates behavioral performances.

Directory of Open Access Journals (Sweden)

Ayumu Matani

Full Text Available Electric brain stimulations such as transcranial direct current stimulation (tDCS, transcranial random noise stimulation (tRNS, and transcranial alternating current stimulation (tACS electrophysiologically modulate brain activity and as a result sometimes modulate behavioral performances. These stimulations can be viewed from an engineering standpoint as involving an artificial electric source (DC, noise, or AC attached to an impedance branch of a distributed parameter circuit. The distributed parameter circuit is an approximation of the brain and includes electric sources (neurons and impedances (volume conductors. Such a brain model is linear, as is often the case with the electroencephalogram (EEG forward model. Thus, the above-mentioned current stimulations change the current distribution in the brain depending on the locations of the electric sources in the brain. Now, if the attached artificial electric source were to be replaced with a resistor, or even a negative resistor, the resistor would also change the current distribution in the brain. In light of the superposition theorem, which holds for any linear electric circuit, attaching an electric source is different from attaching a resistor; the resistor affects each active electric source in the brain so as to increase (or decrease in some cases of a negative resistor the current flowing out from each source. From an electrophysiological standpoint, the attached resistor can only control the extracellular impedance and never causes forced stimulation; we call this technique transcranial extracellular impedance control (tEIC. We conducted a behavioral experiment to evaluate tEIC and found evidence that it had real-time enhancement and depression effects on EEGs and a real-time facilitation effect on reaction times. Thus, tEIC could be another technique to modulate behavioral performance.

Impedance-based Analysis of DC Link Control in Voltage Source Rectifiers

DEFF Research Database (Denmark)

Lu, Dapeng; Wang, Xiongfei; Blaabjerg, Frede

2018-01-01

This paper analyzes the dynamics influences of the outer dc link control in the voltage source rectifiers based on the impedance model. The ac-dc interactions are firstly presented by means of full order small signal model in dq frame, which shows the input voltage and load condition are the two...

Equivalence of Primary Control Strategies for AC and DC Microgrids

Directory of Open Access Journals (Sweden)

Eneko Unamuno

2017-01-01

Full Text Available Microgrid frequency and voltage regulation is a challenging task, as classical generators with rotational inertia are usually replaced by converter-interfaced systems that inherently do not provide any inertial response. The aim of this paper is to analyse and compare autonomous primary control techniques for alternating current (AC and direct current (DC microgrids that improve this transient behaviour. In this context, a virtual synchronous machine (VSM technique is investigated for AC microgrids, and its behaviour for different values of emulated inertia and droop slopes is tested. Regarding DC microgrids, a virtual-impedance-based algorithm inspired by the operation concept of VSMs is proposed. The results demonstrate that the proposed strategy can be configured to have an analogous behaviour to VSM techniques by varying the control parameters of the integrated virtual-impedances. This means that the steady-state and transient behaviour of converters employing these strategies can be configured independently. As shown in the simulations, this is an interesting feature that could be, for instance, employed for the integration of different dynamic generation or storage systems, such as batteries or supercapacitors.

AC conductivity and dielectric properties of bulk tungsten trioxide (WO3)

Science.gov (United States)

El-Nahass, M. M.; Ali, H. A. M.; Saadeldin, M.; Zaghllol, M.

2012-11-01

AC conductivity and dielectric properties of tungsten trioxide (WO3) in a pellet form were studied in the frequency range from 42 Hz to 5 MHz with a variation of temperature in the range from 303 K to 463 K. AC conductivity, σac(ω) was found to be a function of ωs where ω is the angular frequency and s is the frequency exponent. The values of s were found to be less than unity and decrease with increasing temperature, which supports the correlated barrier hopping mechanism (CBH) as the dominant mechanism for the conduction in WO3. The dielectric constant (ε‧) and dielectric loss (ε″) were measured. The Cole-Cole diagram determined complex impedance for different temperatures.

Revisiting the electrochemical impedance spectroscopy of magnesium with online inductively coupled plasma atomic emission spectroscopy.

Science.gov (United States)

Shkirskiy, Viacheslav; King, Andrew D; Gharbi, Oumaïma; Volovitch, Polina; Scully, John R; Ogle, Kevin; Birbilis, Nick

2015-02-23

The electrochemical impedance of reactive metals such as magnesium is often complicated by an obvious inductive loop with decreasing frequency of the AC polarising signal. The characterisation and ensuing explanation of this phenomenon has been lacking in the literature to date, being either ignored or speculated. Herein, we couple electrochemical impedance spectroscopy (EIS) with online atomic emission spectroelectrochemistry (AESEC) to simultaneously measure Mg-ion concentration and electrochemical impedance spectra during Mg corrosion, in real time. It is revealed that Mg dissolution occurs via Mg(2+) , and that corrosion is activated, as measured by AC frequencies less than approximately 1 Hz approaching DC conditions. The result of this is a higher rate of Mg(2+) dissolution, as the voltage excitation becomes slow enough to enable all Mg(2+) -enabling processes to adjust in real time. The manifestation of this in EIS data is an inductive loop. The rationalisation of such EIS behaviour, as it relates to Mg, is revealed for the first time by using concurrent AESEC. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Microwave impedance imaging on semiconductor memory devices

Science.gov (United States)

Kundhikanjana, Worasom; Lai, Keji; Yang, Yongliang; Kelly, Michael; Shen, Zhi-Xun

2011-03-01

Microwave impedance microscopy (MIM) maps out the real and imaginary components of the tip-sample impedance, from which the local conductivity and dielectric constant distribution can be derived. The stray field contribution is minimized in our shielded cantilever design, enabling quantitative analysis of nano-materials and device structures. We demonstrate here that the MIM can spatially resolve the conductivity variation in a dynamic random access memory (DRAM) sample. With DC or low-frequency AC bias applied to the tip, contrast between n-doped and p-doped regions in the dC/dV images is observed, and p-n junctions are highlighted in the dR/dV images. The results can be directly compared with data taken by scanning capacitance microscope (SCM), which uses unshielded cantilevers and resonant electronics, and the MIM reveals more information of the local dopant concentration than SCM.

Dielectric relaxation and ac conduction in γ-irradiated UHMWPE/MWCNTs nano composites: Impedance spectroscopy analysis

International Nuclear Information System (INIS)

Maqbool, Syed Asad; Mehmood, Malik Sajjad; Mukhtar, Saqlain Saqib; Baluch, Mansoor A.; Khan, Shamim; Yasin, Tariq; Khan, Yaqoob

2017-01-01

The dielectric behavior of γ-irradiated ultra-high molecular weight polyethylene (UHMWPE) and its nano composites (NCs) with γ-ray modified multi wall carbon nano tubes (γ-MWCNTs) and MWCNTs had been studied using impedance spectroscopy. The study had been carried out in the frequency range of 20–2 MHz at room temperature. All samples (pure and NCs) were prepared in the form of sheets and irradiated with γ-dose of 50 kGy and 100 kGy, respectively. The comprehensive analysis of results revealed that resistivity of UHMWPE for conduction decreased on irradiation and incorporation of MWCNTs (whether γ ray modified or un-modified) due to the radiation induced damage and conductive networks induced by MWCNTs. At low frequency range a significant increase in the dielectric constant had been observed because of irradiation and addition of MWNCTs. The trend of loss tangent and ac conductivity for each investigated sample depended on resistivity offered and had a decreasing trend as a function of frequency. Moreover, dissipation factor increased with the incorporation of MWNCTs and irradiation from 0.12 to 0.22. In addition to this, non-frequency dependent static dielectric constant was also found to increase with irradiation and incorporation of MWCNTs. The relaxation time was found to increase from 1.2 to 4.3 ms due to hindrance offered by radiation induced mutual cross linking of PE chains and polymer-MWNCTs bindings. - Highlights: • The resistivity for conduction in pristine UHMWPE is decreased with γ-irradiation. • Conduction in PE/MWCNTs nanocomposites increased due to MWCNTs addition. • Static dielectric constant of UHMWPE increased with γ-irradiation. • Static dielectric constant of UHMWPE increased due to MWCNTs incorporation.

Computational analysis of modern HTGR fuel performance and fission product release during the HFR-EU1 irradiation experiment

Energy Technology Data Exchange (ETDEWEB)

Verfondern, Karl, E-mail: k.verfondern@fz-juelich.de [Research Center Jülich, Institute of Energy and Climate Research, 52425 Jülich (Germany); Xhonneux, André, E-mail: xhonneux@lrst.rwth-aachen.de [Research Center Jülich, Institute of Energy and Climate Research, 52425 Jülich (Germany); Nabielek, Heinz, E-mail: heinznabielek@me.com [Research Center Jülich, Monschauerstrasse 61, 52355 Düren (Germany); Allelein, Hans-Josef, E-mail: h.j.allelein@fz-juelich.de [Research Center Jülich, Institute of Energy and Climate Research, 52425 Jülich (Germany); RWTH Aachen, Chair for Reactor Safety and Reactor Technology, 52072 Aachen (Germany)

2014-07-01

Highlights: • HFR-EU1 irradiation test demonstrates high quality of HTGR spherical fuel elements. • Irradiation performance is in good agreement with German fuel performance modeling. • International benchmark exercise expected first particle to fail at ∼13–17% FIMA. • EOL silver release is predicted to be in the percentage range. • EOL cesium and strontium are expected to remain at a low level. - Abstract: Various countries engaged in the development and fabrication of modern HTGR fuel have initiated activities of modeling the fuel and fission product release behavior with the aim of predicting the fuel performance under HTGR operating and accident conditions. Verification and validation studies are conducted by code-to-code benchmarking and code-to-experiment comparisons as part of international exercises. The methodology developed in Germany since the 1980s represents valuable and efficient tools to describe fission product release from spherical fuel elements and TRISO fuel performance, respectively, under given conditions. Continued application to new results of irradiation and accident simulation testing demonstrates the appropriateness of the models in terms of a conservative estimation of the source term as part of interactions with HTGR licensing authorities. Within the European irradiation testing program for HTGR fuel and as part of the former EU RAPHAEL project, the HFR-EU1 irradiation experiment explores the potential for high performance of the presently existing German and newly produced Chinese fuel spheres under defined conditions up to high burnups. The fuel irradiation was completed in 2010. Test samples are prepared for further postirradiation examinations (PIE) including heatup simulation testing in the KÜFA-II furnace at the JRC-ITU, Karlsruhe, to be conducted within the on-going ARCHER Project of the European Commission. The paper will describe the application of the German computer models to the HFR-EU1 irradiation test and

Temperature dependence of ac response in diluted half-metallic CrO{sub 2} powder compact

Energy Technology Data Exchange (ETDEWEB)

Chen Yajie; Zhang Xiaoyu; Cai Tianyi; Li Zhenya

2004-10-06

We present a study on temperature dependence of impedance spectra of the cold-pressed chromium dioxide (CrO{sub 2})-titanic dioxide (TiO{sub 2}) composite over the temperature range of 77-300 K, and over the frequency range of 40 Hz-500 kHz. The microstructure of the sample is analyzed using transmission electron microscopy (TEM), SEM and X-ray diffraction (XRD). The impedance spectra exhibit a strong dependence upon temperature. By evaluating the ac electricity behavior of the composite, we find the experimental data are successfully described by a power-law behavior {sigma}{sub ac}=A(T){omega}{sup s}, in which the frequency exponent s shows slightly greater than a universal value (0{<=}s{<=}1), and rises approximately linearly with temperature over a broad range of low temperature.

Resonance reduction for AC drives with small capacitance in the DC link

DEFF Research Database (Denmark)

Máthé, Lászlo; Török, Lajos; Wang, Dong

2016-01-01

Pulse Width Modulated AC drives equipped with small DC-link capacitor are becoming an attractive solution for electric drive applications with moderate requirements for shaft dynamic performance. However, when these drives are fed from a weak grid a resonance between the line side impedance...... and the DC-link capacitor appears. Due to this resonance, the THD and the partially weighted harmonic distortion of the line currents are increased, which may rise compatibility problems with the AC line harmonic standards. By using vector control the motor drive is transformed into a constant power load...

Dielectric and impedance spectroscopic studies of neodymium gallate

Energy Technology Data Exchange (ETDEWEB)

Sakhya, Anup Pradhan, E-mail: npshakya31@gmail.com [Department of Physics, Bose Institute, 93/1 Acharya Prafulla Chandra Road, Kolkata 700009 (India); Dutta, Alo [Department of Condensed Matter Physics and Material Sciences, S. N. Bose National Centre for Basic Sciences, Block-JD, Sector-III, Salt Lake, Kolkata 700098 (India); Sinha, T.P. [Department of Physics, Bose Institute, 93/1 Acharya Prafulla Chandra Road, Kolkata 700009 (India)

2016-05-01

The AC electrical properties of a polycrystalline neodymium gallate, NdGaO{sub 3} (NGO), synthesized by the sol–gel method have been investigated by employing impedance spectroscopy in the frequency range from 42 Hz to 5 MHz and in the temperature range from 323 K to 593 K. The X-ray diffraction analysis shows that the compound crystallizes in the orthorhombic phase with Pbnm space group at room temperature. Two relaxation processes with different relaxation times are observed from the impedance as well as modulus spectroscopic measurements, which have been attributed to the grain and the grain boundary effects at different temperatures in NGO. The complex impedance data are analyzed by an electrical equivalent circuit consisting of a resistance and a constant phase element in parallel. It has been observed that the value of the capacitance and the resistance associated with the grain boundary is higher than those associated with the grain. The temperature dependent electrical conductivity shows the negative temperature coefficient of resistance. The frequency dependent conductivity spectra are found to follow the power law.

Diffusion and Gas Conversion Analysis of Solid Oxide Fuel Cells at Loads via AC Impedance

Directory of Open Access Journals (Sweden)

Robert U. Payne

2011-01-01

Full Text Available Impedance measurements were conducted under practical load conditions in solid oxide fuel cells of differing sizes. For a 2 cm2 button cell, impedance spectra data were separately measured for the anode, cathode, and total cell. Improved equivalent circuit models are proposed and applied to simulate each of measured impedance data. Circuit elements related to the chemical and physical processes have been added to the total-cell model to account for an extra relaxation process in the spectra not measured at either electrode. The processes to which elements are attributed have been deduced by varying cell temperature, load current, and hydrogen concentration. Spectra data were also obtained for a planar stack of five 61 cm2 cells and the individual cells therein, which were fitted to a simplified equivalent circuit model of the total button cell. Similar to the button cell, the planar cells and stack exhibit a pronounced low-frequency relaxation process, which has been attributed to concentration losses, that is, the combined effects of diffusion and gas conversion. The simplified total-cell model approximates well the dynamic behavior of the SOFC cells and the whole stack.

Evaluating the Safety and Tolerability of Sacubitril/Valsartan for HFrEF Managed Within a Pharmacist Clinic.

Science.gov (United States)

Pogge, Elizabeth K; Davis, Lindsay E

2018-04-01

The objective of this research was to describe the use of pharmacist-managed sacubitril/valsartan therapy in a multi-center, outpatient cardiac group. Sacubitril/valsartan, an angiotensin receptor-neprilysin inhibitor (ARNi), is a novel agent for the treatment of heart failure. An ARNi is recommended by national guidelines to be used in place of angiotensin-converting enzyme inhibitor (ACEi) or angiotensin receptor blocker (ARB) therapy for patients who remain symptomatic. A retrospective chart review was performed to identify patients initiated and fully titrated on sacubitril/valsartan therapy from July 7, 2015 to March 7, 2017. Fifty-two of the 72 symptomatic heart failure with reduced ejection fraction (HFrEF) patients prescribed sacubitril/valsartan during the 21-month period were included in this analysis. The average ejection fraction was 26%. The average age was 69 years. At baseline, 26.9% of patients were not on ACEi/ARB therapy and 13.5% were on target-dose therapy. After completing the uptitration process, the maximally tolerated dose of sacubitril/valsartan was 5.8% low-dose, 7.7% mid-dose, and 86.5% target-dose. Loop and thiazide diuretic use decreased significantly. There was a significant mean reduction in systolic blood pressure of 6 mmHg with no significant changes in serum creatinine, blood urea nitrogen, or potassium levels. With close monitoring and follow-up, ARNi therapy was a safe alternative to ACEi/ARB therapy for chronic symptomatic HFrEF when initiated within a pharmacist clinic.

Impedance-spectroscopy analysis and piezoelectric properties of Pb2KNb5O15 ceramics

International Nuclear Information System (INIS)

Rao, K. Sambasiva; Murali Krishna, P.; Swarna Latha, T.; Madhava Prasad, D.

2006-01-01

Preparation, dielectric, piezoelectric, hysteresis, impedance spectroscopy and AC conductivity studies in the Pb 0.8 K 0.4 Nb 2 O 6 ferroelectric ceramic have been presented. The Pb 1-x K 2x Nb 2 O 6 (PKN) characterized for ferroelectric and impedance spectroscopy studies from room temperature to 600 deg. C. The sample shows a single phase with orthorhombic structure from X-ray diffraction studies. The Cole-Cole plots and electric modulus plots at different temperatures are drawn. The results obtained from the impedance spectroscopy are analyzed, to understand the conductivity behavior of PKN. The piezoelectric constant, d 33 , has been found to be 75 x 10 -12 C/N

Tests of the SNR fuel pin behaviour in case of operational transients in the HFR Petten

International Nuclear Information System (INIS)

Plitz, H.

1989-05-01

The loadings on fast reactor fuel pins under operational transients (power and temperature increases in the design area) have been studied in the High-Flux-Reactor HFR in Petten with sodium cooled irradiation capsules. The results of the first campaign of transient experiments are described in the report. No cladding defects have been observed, and the fuel pins of the Mark-I and Mark-II type resisted to linear power levels of more than 800 W/cm, thus demonstrating the required design margins. The plans for further experiments are outlined

Upgrading activities for the HFR Petten

International Nuclear Information System (INIS)

Ahlf, J.

1990-01-01

The HFR in Petten, the Netherlands, is a water cooled and moderated research reactor. It has been in continuous and successful operation for more than 25 years. The reactor is utilized as a multi-purpose research reactor with a predominance of materials testing for fission and fusion energy. It has been continuous policy to keep the installation up to date by implementing technical developments and by refurbishing or replacing all components and equipment which approach the end of their useful life. In addition the facilities and the ancillary experimental equipment are continuously adapted and kept versatile in view of changing requirements from the experimental programmes. Performance upgrading comprised increasing the power in two steps to 30 MW and now 45 MW, accompanied by improving the core loading pattern in order to provide an increasing number of high flux irradiation positions. These improvements were rendered possible because of achievements in fuel element design and manufacture. In the mid 70's it became apparent that embrittlement of the reactor vessel material would become a licensing problem. A decision was taken to replace the old vessel by a new one which then could take into account recent experience with respect to experimental requirements. After the vessel replacement a programme was started to replace other ageing components. The primary heat exchangers and the pool heat exchanger have been replaced recently; replacement of the beryllium reflector is nearly finished. All the nuclear instrumentation channels have been replaced. Repair or refurbishment of peripheral equipment such as the outlet line for secondary cooling, the guaranteed power supply for the reactor and the fire prevention system is under preparation. Because all upgrading actions were carefully planned well in advance of actual component failures, unanticipated outages could be avoided

Current distribution effects in AC impedance spectroscopy of electroceramic point contact and thin film model electrodes

DEFF Research Database (Denmark)

Nielsen, Jimmi; Jacobsen, Torben

2010-01-01

the primary current distribution to the DC current distribution restricted to the Three-Phase-Boundary (TPB) zone introduces an error in the determination of the reaction resistance, Rreac = Z(freq. → 0) − Z(freq. → ∞). The error is estimated for different width of the effective TPB zone and a rule of thumb...... regarding its significance is provided. The associated characteristic impedance spectrum shape change is simulated and its origin discussed. Furthermore, the characteristic shape of impedance spectra of thin electroceramic film electrodes with lateral ohmic resistance is studied as a function...

Method and device for bio-impedance measurement with hard-tissue applications

International Nuclear Information System (INIS)

Guimerà, A; Calderón, E; Los, P; Christie, A M

2008-01-01

Bio-impedance measurements can be used to detect and monitor several properties of living hard-tissues, some of which include bone mineral density, bone fracture healing or dental caries detection. In this paper a simple method and hardware architecture for hard tissue bio-impedance measurement is proposed. The key design aspects of such architecture are discussed and a commercial handheld ac impedance device is presented that is fully certified to international medical standards. It includes a 4-channel multiplexer and is capable of measuring impedances from 10 kΩ to 10 MΩ across a frequency range of 100 Hz to 100 kHz with a maximum error of 5%. The device incorporates several user interface methods and a Bluetooth link for bi-directional wireless data transfer. Low-power design techniques have been implemented, ensuring the device exceeds 8 h of continuous use. Finally, bench test results using dummy cells consisting of parallel connected resistors and capacitors, from 10 kΩ to 10 MΩ and from 20 pF to 100 pF, are discussed

Method and device for bio-impedance measurement with hard-tissue applications.

Science.gov (United States)

Guimerà, A; Calderón, E; Los, P; Christie, A M

2008-06-01

Bio-impedance measurements can be used to detect and monitor several properties of living hard-tissues, some of which include bone mineral density, bone fracture healing or dental caries detection. In this paper a simple method and hardware architecture for hard tissue bio-impedance measurement is proposed. The key design aspects of such architecture are discussed and a commercial handheld ac impedance device is presented that is fully certified to international medical standards. It includes a 4-channel multiplexer and is capable of measuring impedances from 10 kOmega to 10 MOmega across a frequency range of 100 Hz to 100 kHz with a maximum error of 5%. The device incorporates several user interface methods and a Bluetooth link for bi-directional wireless data transfer. Low-power design techniques have been implemented, ensuring the device exceeds 8 h of continuous use. Finally, bench test results using dummy cells consisting of parallel connected resistors and capacitors, from 10 kOmega to 10 MOmega and from 20 pF to 100 pF, are discussed.

Structural, dielectric and AC conductivity study of Sb2O3 thin film ...

Indian Academy of Sciences (India)

52

However, to date, no reports have appeared on impedance spectroscopy, modulus behavior, electrical conductivity, dielectric relaxation and dielectric properties of crystalline Sb2O3 thin films. This paper deals for the first time with the frequency and temperature dependence of AC conductivity and complex electric modulus ...

Structural characterization and impedance studies of PbO nanofibers synthesized by electrospinning technique

Energy Technology Data Exchange (ETDEWEB)

Hari Prasad, Kamatam [Department of Physics, Pondicherry University, Puducherry, 605 014 (India); Vinoth, S. [Department of Physics, Pondicherry University, Puducherry, 605 014 (India); Centre for Nanoscience, Pondicherry University, Puducherry, 605014 (India); Jena, Paramananda [Department of Physics, Pondicherry University, Puducherry, 605 014 (India); School of Materials Science and Technology, Indian Institute of Technology(BHU), Varanasi, 221 005 (India); Venkateswarlu, M. [R & D, Amara Raja Batteries Ltd, Karakambadi, 517 520, A.P (India); Satyanarayana, N., E-mail: nallanis2011@gmail.com [Department of Physics, Pondicherry University, Puducherry, 605 014 (India)

2017-06-15

One-dimensional electrospun lead oxide nanofibers synthesized by a simple electrospinning technique. The prepared lead oxide nanofibers investigated by using TG/DTA, FTIR, Raman, X-ray diffraction (XRD), Brunauer–Emmett–Teller (BET) surface area analyzer, scanning electron microscopy–energy dispersive X-ray spectroscopy (SEM-EDX), atomic force microscopy (AFM), Transmission electron microscopy (TEM), and impedance spectroscopy techniques. TG/DTA results confirmed the thermal behavior of the as-spun nanofibers. XRD, FTIR, and Raman spectra results, respectively, confirm the formation of pure orthorhombic crystalline phase and structural coordination of the lead oxide (β-PbO) nanofibers. The BET specific surface area of β-PbO nanofibers sample is found to be 51.23 m{sup 2} g{sup -1}. SEM and AFM micrographs showed the formation of β-PbO nanofibers with a diameter of 85–300 nm. The impedance measurements of lead oxide nanofibers as a function of temperature, 25–150 °C, was evaluated by analyzing the measured impedance data using the winfit software. The electrical conductivity of the lead oxide (β-PbO) nanofibers evaluated by analyzing the measured impedance data using the winfit software is found to be 5.68 × 10{sup -6} S cm{sup -1} at 150 °C. Also, an activation energy (E{sub a}) for the migration of the charge carrier evaluated from the temperature dependence of conductivity plot is found to be 0.27 eV. The temperature dependence AC conductivity of β-PbO nanofibers was evaluated using the measured impedance data and sample dimension. The observed variation of high-frequency AC conductivity attributed to the hopping electrons between the adjacent sites. - Highlights: • First time, β-PbO nanofibers were successfully prepared by electrospinning technique. • Structural, morphological, roughness and electrical properties are studied. • TG/DTA, XRD, FTIR, Raman, SEM/AFM, TEM-EDX, and impedance measurements were made.

A Circulating-Current Suppression Method for Parallel-Connected Voltage-Source Inverters With Common DC and AC Buses

DEFF Research Database (Denmark)

Wei, Baoze; Guerrero, Josep M.; Quintero, Juan Carlos Vasquez

2017-01-01

This paper presents a theoretical study with experimental validation of a circulating-current suppression method for parallel operation of three-phase voltage source inverters (VSI), which may be suitable for modular parallel uninterruptible power supply systems or hybrid AC/DC microgrid applicat......This paper presents a theoretical study with experimental validation of a circulating-current suppression method for parallel operation of three-phase voltage source inverters (VSI), which may be suitable for modular parallel uninterruptible power supply systems or hybrid AC/DC microgrid......, and added into the conventional droop plus virtual impedance control. In the control architecture, the reference voltages of the inverters are generated by the primary control loop which consists of a droop control and a virtual impedance. The secondary control is used to compensate the voltage drop...

Results from post-mortem tests with materials from the old core-box of the High Flux Reactor (HFR) at Petten

International Nuclear Information System (INIS)

de Vries, M.I.; Cundy, M.R.

1990-01-01

Results are reported from hardness measurements, tensile tests and fracture mechanics experiments (fatigue crack growth and fracture toughness) on 5154 aluminum specimens fabricated from remnants of the old HFR core box. The specimen material was exposed to a maximum thermal neutron fluence of 7.5 * 10 26 n/m 2 (E 26 n/m 2 , but with a thermal to fast neutron ratio of about 4, shows more radiation hardening : 67HR15N, 0.2 - yield strength 580 MPa and 1.5% total elongation. Fatigue crack growth rates range from 5 * 10 -5 mm/cycle to 10 -3 mm/cycle for ΔK ranging from 8 to 20 MPa√m. The most highly exposed (7.5 * 10 26 n/m 2 ) materials shows accelerated fatigue crack growth due to unstable crack extension at ΔK of about 15 MPa√m. The lowermost meaningful measure of plane strain fracture toughness is 18 MPa√m. Except for the fracture toughness, which is a factor of about 3 higher, the results show reasonable agreement with the expected mechanical properties estimated in the 'safe end-of-life' assessment of the old HFR vessel

Impedance Scaling and Impedance Control

International Nuclear Information System (INIS)

Chou, W.; Griffin, J.

1997-06-01

When a machine becomes really large, such as the Very Large Hadron Collider (VLHC), of which the circumference could reach the order of megameters, beam instability could be an essential bottleneck. This paper studies the scaling of the instability threshold vs. machine size when the coupling impedance scales in a ''normal'' way. It is shown that the beam would be intrinsically unstable for the VLHC. As a possible solution to this problem, it is proposed to introduce local impedance inserts for controlling the machine impedance. In the longitudinal plane, this could be done by using a heavily detuned rf cavity (e.g., a biconical structure), which could provide large imaginary impedance with the right sign (i.e., inductive or capacitive) while keeping the real part small. In the transverse direction, a carefully designed variation of the cross section of a beam pipe could generate negative impedance that would partially compensate the transverse impedance in one plane

On the impedance of galvanic cells XVIII. The potential dependence of the faradaic impedance in the case of an irreversible electrode reaction, and its application to A.C. polarography

NARCIS (Netherlands)

Timmer, B.; Sluyters-Rehbach, M.; Sluyters, J.H.

A theoretical treatment for the potential dependence of the faradaic impedance, in the case that the electrode reaction behaves irreversibly with respect to the direct current, using the steady-state concept, is presented. An analysis of the expressions obtained in the complex impedance plane is

ac impedance, DSC and FT-IR investigations on (x)PVAc-(1 - x)PVdF blends with LiClO4

International Nuclear Information System (INIS)

Baskaran, R.; Selvasekarapandian, S.; Kuwata, N.; Kawamura, J.; Hattori, T.

2006-01-01

The blended polymer electrolytes comprising poly(vinyl acetate) (PVAc)-poly(vinylidene fluoride) (PVdF) have been prepared for different blend composition with constant lithium perchlorate (LiClO 4 ) ratio by solution casting technique. The formation of the blend polymer electrolyte complex has been confirmed by FT-IR spectroscopy analysis. DSC analysis has been performed in order to observe the change in transition temperature that is caused by the blending of polymers and addition of LiClO 4 . The ac impedance and dielectric spectroscopy studies are carried out on the blended matrix to identify the optimized blend composition, which is having high ionic conductivity. The temperature dependence of conductivity of the polymer electrolytes is found to follow VTF type equation. The high ionic conductivity of 6.4 x 10 -4 S cm -1 at 343 K has been observed for blended polymer electrolyte having blend ratio 75:25 (PVAc:PVdF). The ionic transference number of mobile ions has been estimated by Wagner's polarization method and the value is reported to be t ion is 0.95-0.98 for all the blended samples. The modulus spectra reveal the non-Debye nature and distribution of relaxation times of the samples. The dielectric spectra show the low frequency dispersion, which implies the space charge effects arising from the electrodes

Conventional P-ω/Q-V Droop Control in Highly Resistive Line of Low-Voltage Converter-Based AC Microgrid

Directory of Open Access Journals (Sweden)

Xiaochao Hou

2016-11-01

Full Text Available In low-voltage converter-based alternating current (AC microgrids with resistive distribution lines, the P-V droop with Q-f boost (VPD/FQB is the most common method for load sharing. However, it cannot achieve the active power sharing proportionally. To overcome this drawback, the conventional P-ω/Q-V droop control is adopted in the low-voltage AC microgrid. As a result, the active power sharing among the distributed generators (DGs is easily obtained without communication. More importantly, this study clears up the previous misunderstanding that conventional P-ω/Q-V droop control is only applicable to microgrids with highly inductive lines, and lays a foundation for the application of conventional droop control under different line impedances. Moreover, in order to guarantee the accurate reactive power sharing, a guide for designing Q-V droop gains is given, and virtual resistance is adopted to shape the desired output impedance. Finally, the effects of power sharing and transient response are verified through simulations and experiments in converter-based AC Microgrid.

IMPEDANCE SPECTROSCOPY OF POLYCRYSTALLINE TIN DIOXIDE FILMS

Directory of Open Access Journals (Sweden)

D. V. Adamchuck

2016-01-01

Full Text Available The aim of this work is the analysis of the influence of annealing in an inert atmosphere on the electrical properties and structure of non-stoichiometric tin dioxide films by means of impedance spectroscopy method. Non-stoichiometric tin dioxide films were fabricated by two-step oxidation of metallic tin deposited on the polycrystalline Al2O3 substrates by DC magnetron sputtering. In order to modify the structure and stoichiometric composition, the films were subjected to the high temperature annealing in argon atmosphere in temperature range 300–800 °С. AC-conductivity measurements of the films in the frequency range 20 Hz – 2 MHz were carried out. Variation in the frequency dependencies of the real and imaginary parts of the impedance of tin dioxide films was found to occur as a result of high-temperature annealing. Equivalent circuits for describing the properties of films with various structure and stoichiometric composition were proposed. Possibility of conductivity variation of the polycrystalline tin dioxide films as a result of аnnealing in an inert atmosphere was demonstrated by utilizing impedance spectroscopy. Annealing induces the recrystallization of the films, changing in their stoichiometry as well as increase of the sizes of SnO2 crystallites. Variation of electrical conductivity and structure of tin dioxide films as a result of annealing in inert atmosphere was confirmed by X-ray diffraction analysis. Analysis of the impedance diagrams of tin dioxide films was found to be a powerful tool to study their electrical properties. 

Dielectric, ferroelectrics properties and impedance spectroscopy analysis of the [(Na0.535K0.4800.966Li0.058](Nb0.90Ta0.10O3-based lead-free ceramics

Directory of Open Access Journals (Sweden)

M. Saidi

2015-03-01

Full Text Available Polycrystalline of [(Na0.535K0.4800.966Li0.058](Nb0.90Ta0.10O3 samples were prepared using the high-temperature solid-state reaction technique. X-ray diffraction (XRD analysis indicates the formation of a single-phase with orthorhombic structure. AC impedance plots were used as tool to analyze the electrical behavior of the sample as a function of frequency at different temperatures. The AC impedance studies revealed the presence of grain effect, from 425°C onwards. Complex impedance analysis indicated non-Debye type dielectric relaxation. The Nyquist plot showed the negative temperature coefficient of resistance (NTCR characteristic of NKLNT. The AC conductivity results were used to correlate with the barrier hopping (CBH model to evaluate the binding energy (Wm, the minimum hopping distance (Rmin, the density of states at Fermi level (N(Ef, and the activation energy of the compound.

Impedance spectroscopy of heterojunction solar cell a-SiC/c-Si with ITO antireflection film investigated at different temperatures

Science.gov (United States)

Šály, V.; Perný, M.; Janíček, F.; Huran, J.; Mikolášek, M.; Packa, J.

2017-04-01

Progressive smart photovoltaic technologies including heterostructures a-SiC/c-Si with ITO antireflection film are one of the prospective replacements of conventional photovoltaic silicon technology. Our paper is focused on the investigation of heterostructures a-SiC/c-Si provided with a layer of ITO (indium oxide/tin oxide 90/10 wt.%) which acts as a passivating and antireflection coating. Prepared photovoltaic cell structure was investigated at various temperatures and the influence of temperature on its operation was searched. The investigation of the dynamic properties of heterojunction PV cells was carried out using impedance spectroscopy. The equivalent AC circuit which approximates the measured impedance data was proposed. Assessment of the influence of the temperature on the operation of prepared heterostructure was carried out by analysis of the temperature dependence of AC equivalent circuit elements.

Impedance measurements on YB/sub 2/Cu/sub 3/O/sub 7-delta) interpretation and trapping parameters

International Nuclear Information System (INIS)

Yasmeen, S.; Mohammad, M.; Khan, A.Y.; Subhani, M.S.

1997-01-01

Two probe impedance spectroscopic studies were carried out on YBa/sub 2/Cu/sub 3/ O/sub 7-delta/ two different sintering conditions i.e. at before final sintering and at after final sintering. In both condition ac impedance studies were done in the frequency range of 1Hz to 100kHz and at different temperatures from room temperature down to 78K. Measurements were done with contacts opposite side (i.e., ceramic behaves as a resister) as well as on opposite sides (i.e., ceramic behaves as a capacitor). Results were obtained in the form of Nyquist plot. Log, Yi/omega Vs log f plot and Yr/omega Vs log f plot. These plots were explained through equivalent circuits. The bulk resistance Rb, the grain boundary resistance R/sub b/ and grain boundary capacitance C/sub gb/ were obtained through these plots. The ac conductivities were also obtained at all temperatures. The log sigma g Vs log omega (frequency) plots were interpreted invoking the theory of ac conductivity in polycrystalline solids. The trapping parameters (binding energy, the hopping distance etc.) were calculated and interpreted. (author)

Impedance Analysis of Silicon Nanowire Lithium Ion Battery Anodes

KAUST Repository

Ruffo, Riccardo

2009-07-02

The impedance behavior of silicon nanowire electrodes has been investigated to understand the electrochemical process kinetics that influences the performance when used as a high-capacity anode in a lithium ion battery. The ac response was measured by using impedance spectroscopy in equilibrium conditions at different lithium compositions and during several cycles of charge and discharge in a half cell vs. metallic lithium. The impedance analysis shows the contribution of both surface resistance and solid state diffusion through the bulk of the nanowires. The surface process is dominated by a solid electrolyte layer (SEI) consisting of an inner, inorganic insoluble part and several organic compounds at the outer interface, as seen by XPS analysis. The surface resistivity, which seems to be correlated with the Coulombic efficiency of the electrode, grows at very high lithium contents due to an increase in the inorganic SEI thickness. We estimate the diffusion coefficient of about 2 × 10 -10 cm 2/s for lithium diffusion in silicon. A large increase in the electrode impedance was observed at very low lithium compositions, probably due to a different mechanism for lithium diffusion inside the wires. Restricting the discharge voltage to 0.7 V prevents this large impedance and improves the electrode lifetime. Cells cycled between 0.07 and 0.70 V vs. metallic lithium at a current density of 0.84 A/g (C/5) showed good Coulombic efficiency (about 99%) and maintained a capacity of about 2000 mAh/g after 80 cycles. © 2009 American Chemical Society.

A Simultaneous and Continuous Excitation Method for High-Speed Electrical Impedance Tomography with Reduced Transients and Noise Sensitivity

Directory of Open Access Journals (Sweden)

Antoine Dupré

2018-03-01

Full Text Available This paper presents a concept for soft field tomographic scan of all the projections of electromagnetic waves emanating from an array of electrodes. Instead of the sequential excitation of all pairs of electrodes in the list of all projections, the new method present here consists of a single and continuous excitation. This excitation signal is the linear combination of the excitation signals in the projection set at different AC frequencies. The response to a given projection is discriminated by selecting the corresponding AC frequency component in the signal spectra of the digitally demodulated signals. The main advantage of this method is the suppression of transients after each projection, which is particularly problematic in electrical impedance tomography due to contact impedance phenomena and skin effect. The second benefit over the sequential scan method is the increased number of samples for each measurement for reduced noise sensitivity with digital demodulation. The third benefit is the increased temporal resolution in high-speed applications. The main drawback is the increased number of signal sources required (one per electrode. This paper focuses on electrical impedance tomography, based on earlier work by the authors. An experimental proof-of-concept using a simple 4-electrodes electrical impedance tomographic system is presented using simulations and laboratory data. The method presented here may be extended to other modalities (ultrasonic, microwave, optical, etc..

Impedance adaptation methods of the piezoelectric energy harvesting

Science.gov (United States)

Kim, Hyeoungwoo

In this study, the important issues of energy recovery were addressed and a comprehensive investigation was performed on harvesting electrical power from an ambient mechanical vibration source. Also discussed are the impedance matching methods used to increase the efficiency of energy transfer from the environment to the application. Initially, the mechanical impedance matching method was investigated to increase mechanical energy transferred to the transducer from the environment. This was done by reducing the mechanical impedance such as damping factor and energy reflection ratio. The vibration source and the transducer were modeled by a two-degree-of-freedom dynamic system with mass, spring constant, and damper. The transmissibility employed to show how much mechanical energy that was transferred in this system was affected by the damping ratio and the stiffness of elastic materials. The mechanical impedance of the system was described by electrical system using analogy between the two systems in order to simply the total mechanical impedance. Secondly, the transduction rate of mechanical energy to electrical energy was improved by using a PZT material which has a high figure of merit and a high electromechanical coupling factor for electrical power generation, and a piezoelectric transducer which has a high transduction rate was designed and fabricated. The high g material (g33 = 40 [10-3Vm/N]) was developed to improve the figure of merit of the PZT ceramics. The cymbal composite transducer has been found as a promising structure for piezoelectric energy harvesting under high force at cyclic conditions (10--200 Hz), because it has almost 40 times higher effective strain coefficient than PZT ceramics. The endcap of cymbal also enhances the endurance of the ceramic to sustain ac load along with stress amplification. In addition, a macro fiber composite (MFC) was employed as a strain component because of its flexibility and the high electromechanical coupling

Impedance spectroscopy of heterojunction solar cell a-SiC/c-Si with ITO antireflection film investigated at different temperatures

International Nuclear Information System (INIS)

Šály, V; Pern, M; Janíček, F; Mikolášek, M; Packa, J; Huran, J

2017-01-01

Progressive smart photovoltaic technologies including heterostructures a-SiC/c-Si with ITO antireflection film are one of the prospective replacements of conventional photovoltaic silicon technology. Our paper is focused on the investigation of heterostructures a-SiC/c-Si provided with a layer of ITO (indium oxide/tin oxide 90/10 wt.%) which acts as a passivating and antireflection coating. Prepared photovoltaic cell structure was investigated at various temperatures and the influence of temperature on its operation was searched. The investigation of the dynamic properties of heterojunction PV cells was carried out using impedance spectroscopy. The equivalent AC circuit which approximates the measured impedance data was proposed. Assessment of the influence of the temperature on the operation of prepared heterostructure was carried out by analysis of the temperature dependence of AC equivalent circuit elements. (paper)

Array of piezoelectric energy harvesting by the equivalent impedance approach

International Nuclear Information System (INIS)

Lien, I C; Shu, Y C

2012-01-01

This article proposes to use the idea of equivalent impedance to investigate the electrical response of an array of piezoelectric oscillators endowed with distinct energy harvesting circuits. Three interface electronics systems are considered including standard AC/DC and parallel/series-SSHI (synchronized switch harvesting on inductor) circuits. Various forms of equivalent load impedance are analytically obtained for different interfaces. The steady-state response of an array system is then shown to be determined by the matrix formulation of generalized Ohm’s law whose impedance matrix is explicitly expressed in terms of the load impedance. A model problem is proposed for evaluating the ability of power harvesting under various conditions. It is shown first that harvested power is increased dramatically for the case of small deviation in the system parameters. On the other hand, if the deviation in mass is relatively large, the result is changed from the power-boosting mode to wideband mode. In particular, the parallel-SSHI array system exhibits much more significant bandwidth improvement than the other two cases. Surprisingly, the series-SSHI array system shows the worst electrical response. Such an observation is opposed to our previous finding that an SSHI technique avails against the standard technique in the case based on a single piezoelectric energy harvester and the explanation is under investigation. (fast track communication)

Modelling of long High Voltage AC Cables in the Transmission System

DEFF Research Database (Denmark)

Gudmundsdottir, Unnur Stella

: conductor-insulation (with or without SC layers)-conductor-insulation(-conductor-insulation), whereas a transmission line single core XLPE cable will normally have the configuration: conductor-SC layerinsulation-SC layer-conductor-SC layer-conductor-insulation. Furthermore the existing cable models use......, EMTDC/PSCAD is provided. A typical HV AC underground power cable is formed by 4 main layers, namely; Conductor-Insulation-Screen-Insulation. In addition to these main layers, the cable also has semiconductive screens, swelling tapes and metal foil. For high frequency modelling in EMT-based software......-SC layer-solid hollow conductor) is implemented in the model. These improvements result in a more correct series impedance and hence a more correct damping of the simulations. Even though the series impedance is more correct, it does still not include the proximity effect and high frequency oscillations...

A compact wideband precision impedance measurement system based on digital auto-balancing bridge

International Nuclear Information System (INIS)

Hu, Binxin; Wang, Jinyu; Song, Guangdong; Zhang, Faxiang

2016-01-01

The ac impedance spectroscopy measurements are predominantly taken by using impedance analyzers based on analog auto-balancing bridge. However, those bench-top analyzers are generally complicated, bulky and expensive, thus limiting their usage in industrial field applications. This paper presents the development of a compact wideband precision measurement system based on digital auto-balancing bridge. The methods of digital auto-balancing bridge and digital lock-in amplifier are analyzed theoretically. The overall design and several key sections including null detector, direct digital synthesizer-based sampling clock, and digital control unit are introduced in detail. The results show that the system achieves a basic measurement accuracy of 0.05% with a frequency range of 20 Hz–2 MHz. The advantages of versatile measurement capacity, fast measurement speed, small size and low cost make it quite suitable for industrial field applications. It is demonstrated that this system is practical and effective by applying in determining the impedance-temperature characteristic of a motor starter PTC thermistor. (paper)

Ionic conductivity measurements of zirconia under pressure using impedance spectroscopy

International Nuclear Information System (INIS)

Takebe, H; Sakamoto, D; Ohtaka, O; Fukui, H; Yoshiasa, A; Yamanaka, T; Ota, K; Kikegawa, T

2002-01-01

We have set up an electrical conductivity measurement system under high-pressure and high-temperature conditions with a multi-anvil high-pressure apparatus using an AC complex impedance method. With this system, we have successfully measured the electrical conductivity of stabilized ZrO 2 (Y 2 O 3 -ZrO 2 solid solution) under pressures up to 5 GPa in the temperature range from 300 to 1200 K. The electrical conductivities obtained under pressure are compatible with those of previous results measured at ambient pressure

Report on HFR power cycling experiment MEDINA/POCY 02

International Nuclear Information System (INIS)

Goetzmann, O.

1993-09-01

MEDINA or POCY 02 was a single rod experiment to study power ramp induced FCMI with the smear density parameter. Four separate fuel columns with different void volume redistribution were integrated in one rod. The irradiation device should allow for the measurements of the rod diameter along all fuel columns after each power cycle. Irradiation took place in the Pool Side Facility of the HFR in Petten from October 1985 through January 1988. The experiment had to be terminated prematurely due to mishandling of the capsule. The in-pile diameter measurements were of no use. Even though the primary goal was not attained, the experiment furnished some interesting insights into the fuel behaviour during cyclic operation. Mechanical interactions between fuel and cladding took place in all four fuel columns. Maximum rod diameter increase observed was 0,2%. The largest value was measured in the rod section where the original gap was the largest. Apparently, in cyclic operation a large gap does not ease the FCMI situtation. Fuel and fission product movements seem to be enhanced by cyclic operation. Large quantities of solid fission products in the central channel and large reaction zones in the gap between fuel and cladding were observed for these short fuel stacks. Both ends of the annular pellet column were closed by fuel condensation. Pore migration was activated throughout the experiment. It was even capable of transporting cladding reaction products into the central hole. (orig.) [de

Y-source impedance-network-based isolated boost DC/DC converter

DEFF Research Database (Denmark)

Siwakoti, Yam P.; Town, Graham; Loh, Poh Chiang

2014-01-01

A dc-dc converter with very high voltage gain is proposed in this paper for any medium-power application requiring a high voltage boost with galvanic isolation. The proposed converter topology can be realized using only two switches. With this topology a very high voltage boost can be achieved even...... with a relatively low duty cycle of the switches, and the gain obtainable is presently not matched by any existing impedance network based converter operated at the same duty ratio. The proposed converter has a Y-source impedance network to boost the voltage at the intermediate dc-link side and a push......-pull transformer for square-wave AC inversion and isolation. The voltage-doubler rectifier provides a constant dc voltage at the output stage. A theoretical analysis of the converter is presented, supported by simulation and experimental results. A 250 W down-scaled prototype was implemented in the laboratory...

An integrated microfluidic analysis microsystems with bacterial capture enrichment and in-situ impedance detection

Science.gov (United States)

Liu, Hai-Tao; Wen, Zhi-Yu; Xu, Yi; Shang, Zheng-Guo; Peng, Jin-Lan; Tian, Peng

2017-09-01

In this paper, an integrated microfluidic analysis microsystems with bacterial capture enrichment and in-situ impedance detection was purposed based on microfluidic chips dielectrophoresis technique and electrochemical impedance detection principle. The microsystems include microfluidic chip, main control module, and drive and control module, and signal detection and processing modulet and result display unit. The main control module produce the work sequence of impedance detection system parts and achieve data communication functions, the drive and control circuit generate AC signal which amplitude and frequency adjustable, and it was applied on the foodborne pathogens impedance analysis microsystems to realize the capture enrichment and impedance detection. The signal detection and processing circuit translate the current signal into impendence of bacteria, and transfer to computer, the last detection result is displayed on the computer. The experiment sample was prepared by adding Escherichia coli standard sample into chicken sample solution, and the samples were tested on the dielectrophoresis chip capture enrichment and in-situ impedance detection microsystems with micro-array electrode microfluidic chips. The experiments show that the Escherichia coli detection limit of microsystems is 5 × 104 CFU/mL and the detection time is within 6 min in the optimization of voltage detection 10 V and detection frequency 500 KHz operating conditions. The integrated microfluidic analysis microsystems laid the solid foundation for rapid real-time in-situ detection of bacteria.

Kinetic mechanism of steel corrosion in clay soils by impedance measurements

International Nuclear Information System (INIS)

Arpaia, M.; Pernice, P.; Costantini, A.

1990-01-01

The corrosion of steel in clay soil at m.c. 15% has been studied for a long exposure time by electrochemical methods. A.c. impedance measurements results show that at a short exposure time the corrosion process is controlled by the diffusion of H + coupled with a rate determining homogeneous reaction, whereas at a long exposure time the process is controlled by pure diffusion. We have hypothesized that the rate determining homogeneous reaction might be the clay particles cations exchange. (orig.)

Moderately nonlinear diffuse-charge dynamics under an ac voltage.

Science.gov (United States)

Stout, Robert F; Khair, Aditya S

2015-09-01

The response of a symmetric binary electrolyte between two parallel, blocking electrodes to a moderate amplitude ac voltage is quantified. The diffuse charge dynamics are modeled via the Poisson-Nernst-Planck equations for a dilute solution of point-like ions. The solution to these equations is expressed as a Fourier series with a voltage perturbation expansion for arbitrary Debye layer thickness and ac frequency. Here, the perturbation expansion in voltage proceeds in powers of V_{o}/(k_{B}T/e), where V_{o} is the amplitude of the driving voltage and k_{B}T/e is the thermal voltage with k_{B} as Boltzmann's constant, T as the temperature, and e as the fundamental charge. We show that the response of the electrolyte remains essentially linear in voltage amplitude at frequencies greater than the RC frequency of Debye layer charging, D/λ_{D}L, where D is the ion diffusivity, λ_{D} is the Debye layer thickness, and L is half the cell width. In contrast, nonlinear response is predicted at frequencies below the RC frequency. We find that the ion densities exhibit symmetric deviations from the (uniform) equilibrium density at even orders of the voltage amplitude. This leads to the voltage dependence of the current in the external circuit arising from the odd orders of voltage. For instance, the first nonlinear contribution to the current is O(V_{o}^{3}) which contains the expected third harmonic but also a component oscillating at the applied frequency. We use this to compute a generalized impedance for moderate voltages, the first nonlinear contribution to which is quadratic in V_{o}. This contribution predicts a decrease in the imaginary part of the impedance at low frequency, which is due to the increase in Debye layer capacitance with increasing V_{o}. In contrast, the real part of the impedance increases at low frequency, due to adsorption of neutral salt from the bulk to the Debye layer.

Moderately nonlinear diffuse-charge dynamics under an ac voltage

Science.gov (United States)

Stout, Robert F.; Khair, Aditya S.

2015-09-01

The response of a symmetric binary electrolyte between two parallel, blocking electrodes to a moderate amplitude ac voltage is quantified. The diffuse charge dynamics are modeled via the Poisson-Nernst-Planck equations for a dilute solution of point-like ions. The solution to these equations is expressed as a Fourier series with a voltage perturbation expansion for arbitrary Debye layer thickness and ac frequency. Here, the perturbation expansion in voltage proceeds in powers of Vo/(kBT /e ) , where Vo is the amplitude of the driving voltage and kBT /e is the thermal voltage with kB as Boltzmann's constant, T as the temperature, and e as the fundamental charge. We show that the response of the electrolyte remains essentially linear in voltage amplitude at frequencies greater than the RC frequency of Debye layer charging, D /λDL , where D is the ion diffusivity, λD is the Debye layer thickness, and L is half the cell width. In contrast, nonlinear response is predicted at frequencies below the RC frequency. We find that the ion densities exhibit symmetric deviations from the (uniform) equilibrium density at even orders of the voltage amplitude. This leads to the voltage dependence of the current in the external circuit arising from the odd orders of voltage. For instance, the first nonlinear contribution to the current is O (Vo3) which contains the expected third harmonic but also a component oscillating at the applied frequency. We use this to compute a generalized impedance for moderate voltages, the first nonlinear contribution to which is quadratic in Vo. This contribution predicts a decrease in the imaginary part of the impedance at low frequency, which is due to the increase in Debye layer capacitance with increasing Vo. In contrast, the real part of the impedance increases at low frequency, due to adsorption of neutral salt from the bulk to the Debye layer.

Influence of the ac magnetic field frequency on the magnetoimpedance of amorphous wire

International Nuclear Information System (INIS)

Chen, A P; Garcia, C; Zhukov, A; Dominguez, L; Blanco, J M; Gonzalez, J

2006-01-01

Experimental and theoretical studies on the influence of ac magnetic field frequency on the axial diagonal (ζ zz ) and off-diagonal (ζ Φz ) components of the magnetoimpedance (MI) tensor in (Co 0.94 Fe 0.06 ) 72.5 Si 12.5 B 15 amorphous wires have been performed. The frequency (f) of an ac current flowing along the wire was varied from 1 to 20 MHz with the current amplitude less than 15 mA. In order to enhance the ζ Φz component, the amorphous wire was submitted to torsion annealing for developing and preserving a helical magnetic anisotropy in the surface of the wire. The experimental measurements show that the value of the impedance is proportional to the square-root of the ac current frequency, √f, in the vicinity of H ex K and this increase is due to the contribution of the resistance (real part of the impedance). The measurements also indicate that the peaks of the MI curve shift slightly towards higher field values with increasing f. In a theoretical study the magnetoimpedance expressions ζ zz and ζ Φz have been deduced using the Faraday law in combination with the solutions of the Maxwell and Landau-Lifshitz-Gilbert (LLG) equations. By analysing quantitatively the spectra of ζ zz and ζ Φz , the phenomenon of the shift in the peaks of the MI curve with f has been considered as a characteristic of the helical anisotropy in the domain structure of the wire surface

Electrochemical impedance spectroscopy analysis of a thin polymer film-based micro-direct methanol fuel cell

Science.gov (United States)

Schulz, Tobias; Weinmüller, Christian; Nabavi, Majid; Poulikakos, Dimos

A single cell micro-direct methanol fuel cell (micro-DMFC) was investigated using electrochemical impedance spectroscopy. The electrodes consisted of thin, flexible polymer (SU8) film microchannel structures fabricated in-house using microfabrication techniques. AC impedance spectroscopy was used to separate contributions to the overall cell polarization from the anode, cathode and membrane. A clear distinction between the different electrochemical phenomena occurring in the micro-DMFC, especially the distinction between double layer charging and Faradaic reactions was shown. The effect of fuel flow rate, temperature, and anode flow channel structure on the impedance of the electrode reactions and membrane/electrode double layer charging were investigated. Analysis of impedance data revealed that the performance of the test cell was largely limited by the presence of intermediate carbon monoxide in the anode reaction. Higher temperatures increase cell performance by enabling intermediate CO to be oxidized at much higher rates. The results also revealed that serpentine anode flow microchannels show a lower tendency to intermediate CO coverage and a more stable cell behavior than parallel microchannels.

Mediated oxidation of hydroquinone on poly(N-ethylcarbazole): Analysis of transport and kinetic phenomena by impedance techniques

Energy Technology Data Exchange (ETDEWEB)

Deslouis, C.; Tribollet, B. (Physique des Liquides et Electrochimie Lab., Univ. Pierre et Marie Curie, 75 - Paris (France)); Musiani, M.M. (Ist. di Polarografia ed Elettrochimica Preparativa del CNR, Padua (Italy))

1990-09-01

The oxidation of hydroquinone on Pt electrodes modified by electrosynthesized p-ethylcarbazole is studied in 5 M HClO{sub 4}. Electrohydrodynamical and a.c. impedance measurements yield the redox capacitance of the film and electron diffusivity D{sub E} with reasonable dependence on the thickness. D{sub E} values near to 10{sup -7} cm{sup 2} s{sup -1} confirm the average conductivity of this polymer. Change-transfer resistances in agreement with {alpha}=0.5 are measured. These results {alpha} posteriori justify the hypotheses put forward when developing the theoretical impedance model used for the analysis of the data. (orig.).

DC and AC linear magnetic field sensor based on glass coated amorphous microwires with Giant Magnetoimpedance

International Nuclear Information System (INIS)

García-Chocano, Víctor Manuel; García-Miquel, Héctor

2015-01-01

Giant Magnetoimpedance (GMI) effect has been studied in amorphous glass-coated microwires of composition (Fe 6 Co 94 ) 72.5 Si 12.5 B 15 . The impedance of a 1.5 cm length sample has been characterized by using constant AC currents in the range of 400 µA–4 mA at frequencies from 7 to 15 MHz and DC magnetic fields from −900 to 900 A/m. Double peak responses have been obtained, showing GMI ratios up to 107%. A linear magnetic field sensor for DC and AC field has been designed, using two microwires connected in series with a magnetic bias of 400 A/m with opposite direction in each microwire in order to obtain a linear response from ±70 (A/m) rms for AC magnetic field, and ±100 A/m for DC magnetic field. A closed loop feedback circuit has been implemented to extend the linear range to ±1 kA/m for DC magnetic field. - Highlights: • Giant Magneto Impedance phenomenon has been studied in amorphous microwires. • A combination of two microwires with a bias field has been developed to get a linear response. • An electronic circuit has been developed to obtain a sensor with a linear response. • A feedback coil have been added to increase the measurable range of the sensor

Electrochemical AC impedance model of a solid oxide fuel cell and its application to diagnosis of multiple degradation modes

Energy Technology Data Exchange (ETDEWEB)

Gazzarri, J.I.; Kesler, O. [Department of Mechanical Engineering, University of British Columbia, 2054-6250 Applied Science Lane, Vancouver, BC V6T 1Z4 (Canada)

2007-05-01

A finite element model of the impact of diverse degradation mechanisms on the impedance spectrum of a solid oxide fuel cell is presented as a tool for degradation mode identification. Among the degradation mechanisms that cause electrode active area loss, the attention is focused on electrode delamination and uniformly distributed surface area loss, which were found to cause distinct and specific changes in the impedance spectrum. Degradation mechanisms resulting in uniformly distributed reactive surface area loss include sintering, sulphur poisoning, and possibly incipient coke formation at the anode, and chromium deposition at the cathode. Parametric studies reveal the extent and limits of applicability of the model and detectability of the different degradation modes, as well as the influence of different cell geometries on the change in impedance behaviour resulting from the loss of active area. It is expected that this technique could form the basis of a useful diagnostic tool for both solid oxide fuel cell developers and users. (author)

Acoustic impedances of ear canals measured by impedance tube

DEFF Research Database (Denmark)

Ciric, Dejan; Hammershøi, Dorte

2007-01-01

During hearing sensitivity tests, the sound field is commonly generated by an earphone placed on a subject ear. One of the factors that can affect the sound transmission in the ear is the acoustic impedance of the ear canal. Its importance is related to the contribution of other elements involved...... in the transmission such as the earphone impedance. In order to determine the acoustic impedances of human ear canals, the standardized method for measurement of complex impedances used for the measurement of the audiometric earphone impedances is applied. It is based on the transfer function between two microphone...... locations in an impedance tube. The end of the tube representing the measurement plane is placed at the ear canal entrance. Thus, the impedance seen from the entrance inward is measured on 25 subjects. Most subjects participated in the previous measurement of the ratio between the pressures at the open...

Electrical impedance along connective tissue planes associated with acupuncture meridians

Directory of Open Access Journals (Sweden)

Hammerschlag Richard

2005-05-01

Full Text Available Abstract Background Acupuncture points and meridians are commonly believed to possess unique electrical properties. The experimental support for this claim is limited given the technical and methodological shortcomings of prior studies. Recent studies indicate a correspondence between acupuncture meridians and connective tissue planes. We hypothesized that segments of acupuncture meridians that are associated with loose connective tissue planes (between muscles or between muscle and bone visible by ultrasound have greater electrical conductance (less electrical impedance than non-meridian, parallel control segments. Methods We used a four-electrode method to measure the electrical impedance along segments of the Pericardium and Spleen meridians and corresponding parallel control segments in 23 human subjects. Meridian segments were determined by palpation and proportional measurements. Connective tissue planes underlying those segments were imaged with an ultrasound scanner. Along each meridian segment, four gold-plated needles were inserted along a straight line and used as electrodes. A parallel series of four control needles were placed 0.8 cm medial to the meridian needles. For each set of four needles, a 3.3 kHz alternating (AC constant amplitude current was introduced at three different amplitudes (20, 40, and 80 μAmps to the outer two needles, while the voltage was measured between the inner two needles. Tissue impedance between the two inner needles was calculated based on Ohm's law (ratio of voltage to current intensity. Results At the Pericardium location, mean tissue impedance was significantly lower at meridian segments (70.4 ± 5.7 Ω compared with control segments (75.0 ± 5.9 Ω (p = 0.0003. At the Spleen location, mean impedance for meridian (67.8 ± 6.8 Ω and control segments (68.5 ± 7.5 Ω were not significantly different (p = 0.70. Conclusion Tissue impedance was on average lower along the Pericardium meridian, but not

Electrochemical Impedance Spectroscopy Studies of Magnesium-Based Polymethylmethacrylate Gel Polymer Electroytes

International Nuclear Information System (INIS)

Osman, Z.; Zainol, N.H.; Samin, S.M.; Chong, W.G.; Md Isa, K.B.; Othman, L.; Supa’at, I.; Sonsudin, F.

2014-01-01

Magnesium-based rechargeable batteries might be an interesting future alternative to lithium-based batteries since magnesium compounds are highly abundant in the earth and are environmental friendly. In this work, we have prepared polymethylmethacrylate (PMMA) based gel polymer electrolyte (GPE) films containing two different magnesium salts, which is magnesium triflate, Mg(CF 3 SO 3 ) 2 and magnesium perchlorate, Mg(ClO 4 ) 2 using solution casting technique . The ionic conductivity of both gel polymer electrolyte systems was evaluated using a.c impedance spectroscopy. Results show that at room temperature, GPE-Mg(CF 3 SO 3 ) 2 system exhibits the highest conductivity value at 1.27 × 10 −3 S cm −1 for the film containing 20 wt.% of Mg(CF 3 SO 3 ) 2 salt, while the highest conductivity value for the GPE-Mg(ClO 4 ) 2 system is 3.13 × 10 −3 S cm −1 for the film containing 15 wt.% of Mg(ClO 4 ) 2 salt. The conductivity-temperature studies of both GPE systems follow the Arrhenius behavior. The activation energies for ionic conduction were determined to be in the range of 0.18–0.26 eV. The transport numbers of magnesium ions in both GPE systems were evaluated using the combination of a.c impedance spectroscopy and d.c polarization techniques. The results obtained indicate that the charge carriers in the GPE films for both systems are predominantly due to ions

Final design of the Korean AC/DC converters for the ITER coil power supply system

Energy Technology Data Exchange (ETDEWEB)

Oh, Jong-Seok, E-mail: jsoh@nfri.re.kr [ITER Korea, National Fusion Research Institute, Daejeon 305-806 (Korea, Republic of); Choi, Jungwan; Suh, Jae-Hak; Choi, Jihyun [ITER Korea, National Fusion Research Institute, Daejeon 305-806 (Korea, Republic of); Lee, Lacksang; Kim, Changwoo; Park, Hyungjin; Jo, Seongman; Lee, Seungyun; Hwang, Kwangcheol; Liu, Hyoyol [Dawonsys Corp., Siheung 429-450 (Korea, Republic of); Hong, Ki-Don; Sim, Dong-Joon; Lee, Jang-Soo [Hyosung Corp., Gongdeok-Dong, Seoul 121-720 (Korea, Republic of); Lee, Eui-Jae; Kwon, Yang-Hae; Lee, Dae-Yeol; Ko, Ki-Won; Kim, Jong-Min [Mobiis Corp., Yangjae-dong, Seoul 137-888 (Korea, Republic of); Song, Inho [ITER Organization, Route de Vinon sur Verdon, CS 90 046, 13067 St. Paul Lez Durance Cedex (France); and others

2015-10-15

The final design of the ITER TF, CS, CC and VS AC/DC converters has been completed to implement ITER requirements following the detailed design and refinements of the preliminary design. The number of parallel thyristors and the rating of fuses are coordinated to keep those devices within the explosion limit even under most severe fault conditions. The impedance of the converter transformer has been optimized taking into account the energization inrush current, short circuit current, reactive power consumption and the available DC voltage. To ensure system integrity, AC/DC converters are mechanically divided into transformers, AC busbars, 6-pulse bridges, DC interconnecting busbars and DC reactors, and then all subsystems are decoupled by flexible links. To provide stable real time network communication down to the converters, a one GbE link is deployed between master controllers and local controllers. IEEE 1588 is implemented to the embedded controllers for precision time synchronization. This paper describes the detailed solutions implemented in the final design for the ITER AC/DC converters with R&D results of converter prototypes.

LIBRETTO-3: Performance of tritium permeation barriers under irradiation at the HFR Petten

International Nuclear Information System (INIS)

Conrad, R.; Fuetterer, M.A.; Giancarli, L.; May, R.; Perujo, A.; Sample, T.

1994-01-01

The LIBRETTO-3 irradiation was performed at the HFR Petten during 77 full power days in three cycles to compare the efficiency of three different tritium permeation barriers in presence of Pb-17Li to uncoated AISI 316L steel. For this purpose four steel capsules (arnothing o =10 mm, arnothing i =8 mm, l=300 mm) were filled with 28 g Pb-17Li. The coatings included CVD TiC (outside), CVD TiC+Al 2 O 3 (inside), and pack cementation aluminisation (inside). The generated tritium was partly extracted by bubbling, partly it permeated through the capsules. Permeated and extracted tritium were measured as a function of temperature (280-450 C), H 2 doping (0-1 vol%) and purge gas flow rate. The driving partial pressure in the coated capsules were from an extraction model calibrated by the uncoated capsule for which tritium partial pressure could be calculated. In LIBRETTO-3 conditons, the best barrier was pack cementation aluminisation. The first interpretation of the experiment could, however, not confirm permeation reduction factors of 100 or more expected from this barrier. ((orig.))

Ion transfer kinetics at the micro-interface between two immiscible electrolyte solutions investigated by electrochemical impedance spectroscopy and steady-state voltammetry

Czech Academy of Sciences Publication Activity Database

Silver, Barry Richard; Holub, Karel; Mareček, Vladimír

2014-01-01

Roč. 731, OCT 2014 (2014), s. 107-111 ISSN 1572-6657 R&D Projects: GA ČR GA13-04630S Institutional support: RVO:61388955 Keywords : Liquid/liquid interfaces * Ion transport * AC impedance Subject RIV: CG - Electrochemistry Impact factor: 2.729, year: 2014

Status of the in-pile test of HCPB pebble-bed assemblies in the HFR Petten

Energy Technology Data Exchange (ETDEWEB)

Laan, J.G. van der; Fokkens, J.H.; Hofmans, H.E.; Jong, M.; Magielsen, A.J.; Pijlgroms, B.J.; Stijkel, M.P. [NRG, Petten (Netherlands); Conrad, R. [JRC, Inst. for Energy, Petten (Netherlands); Malang, S.; Reimann, J. [FZK, Karlsruhe (Germany); Roux, N. [CEA Saclay (France)

2002-06-01

In the framework of developing the helium cooled pebble-bed (HCPB) blanket an irradiation test of pebble-bed assemblies is prepared at the HFR Petten. The test objective is to concentrate on the effect of neutron irradiation on the thermal-mechanical behaviour of the HCPB breeder pebble-bed at DEMO representative levels of temperature and defined thermal-mechanical loads. The basic test elements are EUROFER-97 cylinders with a horizontal bed of ceramic breeder pebbles sandwiched between two beryllium beds. The pebble beds are separated by EUROFER-97 steel plates. The heat flow is managed such as to have a radial temperature distribution in the ceramic breeder pebble-bed as flat as reasonably possible. The paper reports on the project status, and presents the results of pre-tests, material characteristics, the manufacturing of the pebble-bed assemblies, and the nuclear and thermo-mechanical loading parameters. (orig.)

Corrosion monitoring of iron, protected by an organic coating, with the aid of impedance measurements

International Nuclear Information System (INIS)

Hubrecht, J.; Piens, M.; Vereecken, J.

1984-01-01

The ac impedance measurement has proved to be a useful electrochemical technique for mainly qualitative studies of electrochemical and corrosion systems. Even for complicated systems such as coated metals in corrosive environments this technique has been used with success. The system chosen for the present study is an ARMCO iron plate, coated with a SrCrO 4 -pigmented styrene acrylic polymer, and immersed for several weeks in an aqueous NaCl solution. Impedance measurements analyze a system under test into its constituting phenomena. The dependence of system parameters on coating layer thickness, NaCl concentration, and pigmentation of the coating during the immersion time provides insight into the corrosion and protection mechanisms at the coating/metal interface, besides the behavior of the coating itself

Surge Protection in Low-Voltage AC Power Circuits: An Anthology

Science.gov (United States)

Martzloff, F. D.

2002-10-01

The papers included in this part of the Anthology provide basic information on the propagation of surges in low-voltage AC power circuits. The subject was approached by a combination of experiments and theoretical considerations. One important distinction is made between voltage surges and current surges. Historically, voltage surges were the initial concern. After the introduction and widespread use of current-diverting surge-protective devices at the point-of-use, the propagation of current surges became a significant factor. The papers included in this part reflect this dual dichotomy of voltage versus current and impedance mismatch effects versus simple circuit theory.

Thickness-, Composition-, and Magnetic-Field-Dependent Complex Impedance Spectroscopy of Granular-Type-Barrier Co/Co-Al2O3/Co MTJs

Science.gov (United States)

Tuan, Nguyen Anh; Anh, Nguyen Tuan; Nga, Nguyen Tuyet; Tue, Nguyen Anh; Van Cuong, Giap

2016-06-01

The alternating-current (ac) electrical properties of granular-type-barrier magnetic tunnel junctions (GBMTJs) based on Co/Co x (Al2O3)1- x ( t)/Co trilayer structures have been studied using complex impedance spectroscopy (CIS). Their CIS characteristics were investigated in external magnetic fields varying from 0 kOe to 3 kOe as a function of Co composition x at 10 at.%, 25 at.%, and 35 at.%, with barrier layer thickness t of 20 nm to 90 nm. The influence of these factors on the behaviors of the ac impedance response of the GBMTJs was deeply investigated and attributed to the dielectric or conducting nature of the Co-Al2O3 barrier layer. The most remarkable typical phenomena observed in these behaviors, even appearing paradoxical, include lower impedance for thicker t for each given x, a declining trend of Z with increasing x, a clear decrease of Z with H, and especially a partition of Z into zones according to the H value. All these effects are analyzed and discussed to demonstrate that diffusion-type and mass-transfer-type phenomena can be inferred from processes such as spin tunneling and Coulomb or spin blockade in the Co-Al2O3 barrier layer.

TR-LIF LIFETIME MEASUREMENTS AND HFR+CPOL CALCULATIONS OF RADIATIVE PARAMETERS IN VANADIUM ATOM (V I)

International Nuclear Information System (INIS)

Wang, Q.; Jiang, L. Y.; Shang, X.; Tian, Y. S.; Dai, Z. W.; Quinet, P.; Palmeri, P.; Zhang, W.

2014-01-01

Radiative lifetimes of 79 levels belonging to the 3d 3 4s4p, 3d 4 4p, 3d 3 4s5p, 3d 4 5p, and 3d 3 4s4d configurations of V I with energy from 26,604.807 to 46,862.786 cm –1 have been measured using time-resolved laser-induced fluorescence (TR-LIF) spectroscopy in laser-produced plasma. The lifetime values reported in this paper are in the range of 3.3-494 ns, and the uncertainties of these measurements are within ±10%. A good agreement was obtained with previous data. HFR+CPOL calculations have been performed and used to combine the calculated branching fractions with the available experimental lifetimes to determine semi-empirical transition probabilities for 784 V I transitions

Study of colored anodized aluminum with calcon in sulfuric acidic solution using cyclic voltammetry and impedance measurement methods

Energy Technology Data Exchange (ETDEWEB)

Norouzi, P.; Ganjali, M.R.; Golmohamaddi, M.; Mousavi, S. [Department of Chemistry, Faculty of Science, University of Tehran, Tehran (Iran); Vatankhah, G. [Iranian Organization for Science and Technology (IROST), Isfahan Center, A5 Ghezelbash Avenue, Tohid Street, Isfahan 8173954541 (Iran)

2003-04-01

The effect of coloring condition of Al with Calcon (sodium 2,2'-dihydroxy-azonaphthalene-4-sulfonate), on the corrosion resistance of Al in 0.1 M sulfuric acid solution was studied, using cyclic voltammetry and measurement of impedance noise methods. The changes in the corrosion resistance of colored aluminum electrodes were evaluated by measuring the magnitude of impedance and cyclic voltammetric responses of anodized and colored electrodes. An irreversible corrosion response was observed at the cyclic voltammogram of the colored aluminum electrode. The current and threshold potential of corrosion responses strongly depends on the applied conditions during anodizing, coloring and sealing stages. In addition, significant changes in impedance at the ac voltammogram and noise level at some ac frequencies were observed, when the electrodes were colored under various conditions. In this regard, the surface of the electrode was studied by Scanning Electron Microscopy (SEM). Comparison of SEM images of the colored and uncolored aluminum specimens showed that the colored surface contained a significant numbers of pits. The results indicated that coloring aluminum with Calcon could reduce corrosion resistance of aluminum and increase roughness of the oxide film. (Abstract Copyright [2003], Wiley Periodicals, Inc.) [German] Mit Hilfe zyklischer Voltammetrie und Messungen mit Impedanzrauschmethoden wurde der Einfluss der Faerbungsbedingungen von Aluminium mit Calcon (Natrium 2,2'-Dihydroxyazonaphthalen-4-Sulfonat) auf den Korrosionswiderstand von Aluminium in 0,1 M Schwefelsaeure untersucht. Die Veraenderungen des Korrosionswiderstandes von gefaerbten Aluminiumelektroden wurden durch Messungen der Hoehe der Impedanzreaktion bzw. der Reaktion bei der zyklischen Voltammetrie von anodisierten und gefaerbten Elektroden beurteilt. Eine irreversible Korrosionsreaktion wurde beim zyklischen Voltammogramm der gefaerbten Aluminiumelektrode beobachtet. Der Strom und das

Determination of kinetic parameters of Fe sup 3+ reduction mediated by a polyaniline film using steady-state and impedance methods

Energy Technology Data Exchange (ETDEWEB)

Deslouis, C. (LP15 du CNRS, Physique des Liquides et Electrochimie, Lab. de l' Univ. Pierre et Marie Curie, 75252 Paris Cedex 05 (FR)); Musiani, M.M.; Pagura, C.; Tribollet, C. (Inst. di Polarografia de Elettrochimica Preparativa del CNR, Corso Stati Uniti, 4, 35020 Camin, Padova (IT))

1991-09-01

This paper discusses the Fe{sup 3+} reduction reaction studied at Pt and polyaniline rotating disk electrodes by steady-state and impedance methods with the aim of testing the possibility of achieving the charge transfer resistance (R{sub ts}) of a redox reaction mediated by a conducting polymer film by ac impedance R{sub ts} was obtained as a function of electrode potential and rotation rate by nonlinear least squares fitting of a previously developed kinetic equation to the experimental data. These R{sub ts} values were combined with steady-state ones to calculate b{sub c} and k{sup 0}.

Nature of Dielectric Properties, Electric Modulus and AC Electrical Conductivity of Nanocrystalline ZnIn2Se4 Thin Films

Science.gov (United States)

El-Nahass, M. M.; Attia, A. A.; Ali, H. A. M.; Salem, G. F.; Ismail, M. I.

2018-02-01

The structural characteristics of thermally deposited ZnIn2Se4 thin films were indexed utilizing x-ray diffraction as well as scanning electron microscopy techniques. Dielectric properties, electric modulus and AC electrical conductivity of ZnIn2Se4 thin films were examined in the frequency range from 42 Hz to 106 Hz. The capacitance, conductance and impedance were measured at different temperatures. The dielectric constant and dielectric loss decrease with an increase in frequency. The maximum barrier height was determined from the analysis of the dielectric loss depending on the Giuntini model. The real part of the electric modulus revealed a constant maximum value at higher frequencies and the imaginary part of the electric modulus was characterized by the appearance of dielectric relaxation peaks. The AC electrical conductivity obeyed the Jonscher universal power law. Correlated barrier hopping model was the appropriate mechanism for AC conduction in ZnIn2Se4 thin films. Estimation of the density of states at the Fermi level and activation energy, for AC conduction, was carried out based on the temperature dependence of AC electrical conductivity.

Impedance spectroscopic analysis of composite electrode from activated carbon/conductive materials/ruthenium oxide for supercapacitor applications

Energy Technology Data Exchange (ETDEWEB)

Taer, E.; Awitdrus,; Farma, R. [School of Applied Physics, Faculty of Science and Technology, Universiti Kebangsaan Malaysia, 43600 Bangi, Selangor (Malaysia); Department of Physics, Faculty of Mathematics and Natural Sciences, University of Riau, 28293 Pekanbaru, Riau (Indonesia); Deraman, M., E-mail: madra@ukm.my; Talib, I. A.; Ishak, M. M.; Omar, R.; Dolah, B. N. M.; Basri, N. H.; Othman, M. A. R. [School of Applied Physics, Faculty of Science and Technology, Universiti Kebangsaan Malaysia, 43600 Bangi, Selangor (Malaysia); Kanwal, S. [ICCBS, H.E.J. Research Institute of Chemistry, University of Karachi, 75270 Karachi (Pakistan)

2015-04-16

Activated carbon powders (ACP) were produced from the KOH treated pre-carbonized rubber wood sawdust. Different conductive materials (graphite, carbon black and carbon nanotubes (CNTs)) were added with a binder (polivinylidene fluoride (PVDF)) into ACP to improve the supercapacitive performance of the activated carbon (AC) electrodes. Symmetric supercapacitor cells, fabricated using these AC electrodes and 1 molar H{sub 2}SO{sub 4} electrolyte, were analyzed using a standard electrochemical impedance spectroscopy technique. The addition of graphite, carbon black and CNTs was found effective in reducing the cell resistance from 165 to 68, 23 and 49 Ohm respectively, and increasing the specific capacitance of the AC electrodes from 3 to 7, 17, 32 F g{sup −1} respectively. Since the addition of CNTs can produce the highest specific capacitance, CNTs were chosen as a conductive material to produce AC composite electrodes that were added with 2.5 %, 5 % and 10 % (by weight) electro-active material namely ruthenium oxide; PVDF binder and CNTs contents were kept at 5 % by weight in each AC composite produced. The highest specific capacitance of the cells obtained in this study was 86 F g{sup −1}, i.e. for the cell with the resistance of 15 Ohm and composite electrode consists of 5 % ruthenium oxide.

Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

International Nuclear Information System (INIS)

Jarvis, P.; Belzile, F.; Page, T.; Dean, C.

1997-01-01

The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

Performance of an X-ray single pixel TES microcalorimeter under DC and AC biasing

International Nuclear Information System (INIS)

Gottardi, L.; Kuur, J. van der; Korte, P. A. J. de; Den Hartog, R.; Dirks, B.; Popescu, M.; Hoevers, H. F. C.; Bruijn, M.; Borderias, M. Parra; Takei, Y.

2009-01-01

We are developing Frequency Domain Multiplexing (FDM) for the read-out of TES imaging microcalorimeter arrays for future X-ray missions like IXO. In the FDM configuration the TES is AC voltage biased at a well defined frequencies (between 0.3 to 10 MHz) and acts as an AM modulating element. In this paper we will present a full comparison of the performance of a TES microcalorimeter under DC bias and AC bias at a frequency of 370 kHz. In both cases we measured the current-to-voltage characteristics, the complex impedance, the noise, the X-ray responsivity, and energy resolution. The behaviour is very similar in both cases, but deviations in performances are observed for detector working points low in the superconducting transition (R/R N <0.5). The measured energy resolution at 5.89 keV is 2.7 eV for DC bias and 3.7 eV for AC bias, while the baseline resolution is 2.8 eV and 3.3 eV, respectively.

AC Initiation System.

Science.gov (United States)

An ac initiation system is described which uses three ac transmission signals interlocked for safety by frequency, phase, and power discrimination...The ac initiation system is pre-armed by the application of two ac signals have the proper phases, and activates a load when an ac power signal of the proper frequency and power level is applied. (Author)

Advances In Impedance Theory

International Nuclear Information System (INIS)

Stupakov, G.

2009-01-01

We review recent progress in the following areas of the impedance theory: calculation of impedance of tapers and small angle collimators; optical approximation and parabolic equation for the high-frequency impedance; impedance due to resistive inserts in a perfectly conducting pipe.

Frequency and temperature dependence behaviour of impedance, modulus and conductivity of BaBi4Ti4O15 Aurivillius ceramic

Directory of Open Access Journals (Sweden)

Tanmaya Badapanda

2014-09-01

Full Text Available In this work, we report the dielectric, impedance, modulus and conductivity study of BaBi4Ti4O15 ceramic synthesized by solid state reaction. X-ray diffraction (XRD pattern showed orthorhombic structure with space group A21am confirming it to be an m = 4 member of the Aurivillius oxide. The frequency dependence dielectric study shows that the value of dielectric constant is high at lower frequencies and decreases with increase in frequency. Impedance spectroscopy analyses reveal a non-Debye relaxation phenomenon since relaxation frequency moves towards the positive side with increase in temperature. The shift in impedance peaks towards higher frequency side indicates conduction in material and favouring of the long rangemotion of mobile charge carriers. The Nyquist plot from complex impedance spectrum shows only one semicircular arc representing the grain effect in the electrical conduction. The modulus mechanism indicates the non-Debye type of conductivity relaxation in the material, which is supported by impedance data. Relaxation times extracted using imaginary part of complex impedance (Z′′ and modulus (M′′ were also found to follow Arrhenius law. The frequency dependent AC conductivity at different temperatures indicates that the conduction process is thermally activated. The variation of DC conductivity exhibits a negative temperature coefficient of resistance behaviour.

Amperometric and impedance monitoring systems for biomedical applications

CERN Document Server

Punter-Villagrasa, Jaime; del Campo, Francisco J; Miribel, Pere

2017-01-01

The book presents the conception and realization of a pervasive electronic architecture for electrochemical applications, focusing on electronic instrumentation design and device development, particularly in electrochemical Point-of-Care and Lab-on-a-Chip devices, covering examples based on amperometric (DC) and impedance detection (AC) techniques. The presented electronics combine tailored front-end instrumentation and back-end data post-processing, enabling applications in different areas, and across a variety of techniques, analytes, transducers and environments. It addresses how the electronics are designed and implemented with special interest in the flow process: starting from electronic circuits and electrochemical biosensor design to a final validation and implementation for specific applications. Similarly, other important aspects are discussed throughout the book, such as electrochemical techniques, different analytes, targets, electronics reliability and robustness. The book also describes the use ...

Burnup calculations for cadmium. A case study for HFR experiments

Energy Technology Data Exchange (ETDEWEB)

Pijlgroms, B.J.; Sciolla, C.M

2000-09-11

This report describes the pre-design burnup calculations performed for a cadmium shielded high fluence irradiation experiment in the HFR. The very high absorption cross section in cadmium causes problems in the calculations for two different reasons. Firstly, because of the large reaction rates the assumption that the flux and the cross sections remain piecewise constant is no longer true. Therefore the correct solution can only be obtained when using extremely small time steps which leads to excessive computing times. Secondly, the self-shielding in the cadmium becomes complete (black absorber) causing the depletion to progress in a shell-wise manner. As a consequence the depletion evolves nearly linear instead of exponential with time. Because of this the depletion codes are used in a regime for which these have not been designed leading to a systematic error. The analysis shows however that a good estimate for the burnup time can be obtained by extrapolation from calculations with practically sized time steps and a correction is derived to compensate the systematic error. The calculations were done using the OCTOPUS burnup code system, including the 3-D Monte-Carlo spectrum code MCNP-4B and the depletion code FISPACT-4.2. Verifications were performed with the WIMS code system. The first part of the report describes the study of the cadmium burnup calculations for a shielded steel sample with the emphasis on analyzing the requirements for obtaining the correct solution. The second part describes the time-dependent power production calculations with the steel replaced by lithium containing ceramic material such as to be used in the 'High Fluence Irradiation of Ceramics for Fusion' (HICU) experiment. 12 refs.

License renewal of the HFR research reactor - A regulatory view

International Nuclear Information System (INIS)

Van der Plas, Y.

2006-01-01

Full text: Regulatory policy in The Netherlands is having safety evaluations of a nuclear installation each ten year. Recently a periodic safety evaluation has been finished on the 45 MW High Flux Reactor (HFR) in Petten divided over the following main topics: Risk Scoping Study; HEU-LEU fuel conversion; Evaluation against a pre-defined Reference Licensing Basis; Ageing study. The Risk Scoping Study is a limited probabilistic safety assessment showing scenarios towards serious core degradation and their probabilities. Individual risks for members of the public induced by the incidents analyzed in the first phase are compared with the mortality limits and probabilistic doses limits of the national BKSE decree. For non- proliferation reasons the fuel is converted from high to low enriched uranium. Before starting the project a reference licensing basis (RLB) was defined. A list of postulated initiating events (PIEs), re-establishing a design basis has been approved. An ageing management system shall provide information on the actual status and the residual life time of the plant. The evaluation results into a list of deficiencies, recommendations and suggestions from which modifications are to be proposed. Examples are: more redundancy and separation within the reactor protection system; renewal of the emergency and decay heat cooling; addition of a secundary reactor shut down system; more redundancy in the electric power supply; addition of injection valves introducing efficient use of passive cooling inventor) under LOCA conditions; damping of the impact from loads accidentally falling into the pool. A new nuclear license was issued begin 2004, covering all modifications which are to be implemented ultimate end 2007

Study on ac losses of HTS coil carrying ac transport current

International Nuclear Information System (INIS)

Dai Taozhen; Tang Yuejin; Li Jingdong; Zhou Yusheng; Cheng Shijie; Pan Yuan

2005-01-01

Ac loss has an important influence on the thermal performances of HTS coil. It is necessary to quantify ac loss to ascertain its impact on coil stability and for sizing the coil refrigeration system. In this paper, we analyzed in detail the ac loss components, hysteresis loss, eddy loss and flux flow loss in the pancake HTS coil carrying ac transport current by finite element method. We also investigated the distribution of the ac losses in the coil to study the effects of magnetic field distribution on ac losses

Multi-phase AC/AC step-down converter for distribution systems

Science.gov (United States)

Aeloiza, Eddy C.; Burgos, Rolando P.

2017-10-25

A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.

Nonsynchronous Noncommensurate Impedance Transformers

DEFF Research Database (Denmark)

Zhurbenko, Vitaliy; Kim, K

2012-01-01

Nonsynchronous noncommensurate impedance transformers consist of a combination of two types of transmission lines: transmission lines with a characteristic impedance equal to the impedance of the source, and transmission lines with a characteristic impedance equal to the load. The practical...... advantage of such transformers is that they can be constructed using sections of transmission lines with a limited variety of characteristic impedances. These transformers also provide comparatively compact size in applications where a wide transformation ratio is required. This paper presents the data...... matrix approach and experimentally verified by synthesizing a 12-section nonsynchronous noncommensurate impedance transformer. The measured characteristics of the transformer are compared to the characteristics of a conventional tapered line transformer....

INVESTIGATION OF CEMENT CONCRETE CONGLOMERATE SOLIDIFICATION PROCESS BY IMPEDANCE SPECTROSCOPY METHOD

Directory of Open Access Journals (Sweden)

S. N. Bandarenka

2015-01-01

Full Text Available One of the most prospective directions in preservation  and increase of service live of  road pavements is a construction of  automobile roads with cement concrete surface. Modern tendencies for provision of road construction quality presuppose a necessity to control processes of solidification and subsequent destruction of the material while forming and using cement concrete conglomerate being considered as a basic element of the road surface.  Multiyear practical experience of  automobile road operation using cement concrete pavements reveals an importance for monitoring  such processes as formation and destruction of cement concrete materials. An impedance spectroscopy method has been tried out and proposed as a tool for solution of the given problem.Experimental samples of cement concrete have been prepared for execution of tests, graded silica sand and granite chippings with particle size from 0.63 to 2.5 mm have been used as a fine aggregate in the samples. Dependencies of resistance (impedance on AC-current frequency  have been studied for samples of various nature and granulometric composition. The Gamry  G300 potentiostat has been used for measurement of complex impedance value. A spectrum analysis and calculation of equivalent circuit parameters calculation have been carried out while using EIS Spectrum Analyzer program.Comparison of impedance spectra for the prepared cement concrete samples have made it possible to reveal tendencies in changing spectrum parameters during solidification and subsequent contact with moisture in respect of every type of the sample. An equivalent electrical circuit has been developed that  characterizes physical and chemical processes which are accompanied by charge transfer in cement concrete conglomerate. The paper demonstrates a possibility to use an impedance spectroscopy for solution of a number of actual problems in the field of cement concrete technology problems. Particularly, the problems

Passivation of mechanically polished, chemically etched and anodized zirconium in various aqueous solutions: Impedance measurements

International Nuclear Information System (INIS)

Abo-Elenien, G.M.; Abdel-Salam, O.E.

1987-01-01

Zirconium and its alloys are finding increasing applications especially in water-cooled nuclear reactors. Because of the fact that zirconium is electronegative (E 0 = -1.529V) its corrosion resistance in aqueous solutions is largely determined by the existence of a thin oxide film on its surface. The structure and properties of this film depend in the first place on the method of surface pre-treatment. This paper presents an experimental study of the nature of the oxide film on mechanically polished, chemically etched and anodized zirconium. Ac impedance measurements carried out in various acidic, neutral and alkaline solutions show that the film thickness depends on the method of surface pre-treatment and the type of electrolyte solution. The variation of the potential and impedance during anodization of zirconium at low current density indicates that the initial stages of polarization consist of oxide build-up at a rate dependent on the nature of the electrode surface and the electrolyte. Oxygen evolution commences at a stage where oxide thickening starts to decline. The effect of frequency on the measured impedance indicates that the surface reactivity, and hence the corrosion rate, decreases in the following order: mechanically polished > chemically etched > anodized

AC – AC Converters for UPS

Directory of Open Access Journals (Sweden)

Rusalin Lucian R. Păun

2008-05-01

Full Text Available This paper propose a new control technique forsingle – phase AC – AC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

Performance of AC/graphite capacitors at high weight ratios of AC/graphite

Energy Technology Data Exchange (ETDEWEB)

Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

2008-03-01

The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

Compensating for evanescent modes and estimating characteristic impedance in waveguide acoustic impedance measurements

DEFF Research Database (Denmark)

Nørgaard, Kren Rahbek; Fernandez Grande, Efren

2017-01-01

The ear-canal acoustic impedance and reflectance are useful for assessing conductive hearing disorders and calibrating stimulus levels in situ. However, such probe-based measurements are affected by errors due to the presence of evanescent modes and incorrect estimates or assumptions regarding...... characteristic impedance. This paper proposes a method to compensate for evanescent modes in measurements of acoustic impedance, reflectance, and sound pressure in waveguides, as well as estimating the characteristic impedance immediately in front of the probe. This is achieved by adjusting the characteristic...... impedance and subtracting an acoustic inertance from the measured impedance such that the non-causality in the reflectance is minimized in the frequency domain using the Hilbert transform. The method is thus capable of estimating plane-wave quantities of the sought-for parameters by supplying only...

Gastric emptying patterns of a liquid meal in newborn infants, measured by epigastric impedance

DEFF Research Database (Denmark)

Lange, Aksel; Funch-Jensen, Peter; Thommesen, Peter

1997-01-01

time (T50) was calculated. For mature infants it was found to be 6.9 mins. For a second meal given within an hour after the first meal the half emptying time was 5.5 mins (p times were not significant different from mature infants, but the number examined was small......  Epigastric impedance was used to measure patterns of the gastric emptying of a liquid non-caloric meal (5 ml water/kg) in newborn infants. The emptying patterns consisted of two components, theemptying signal - the DC component - and a phasic 3 cycle per minutes (CPM) signal - the AC component.......A periodic change of the impedance signal, the phasic 3 CPM signal, was observed after a meal in 24 of the infants. The median frequency was 3.03 CPM in 20 mature and 2.93 CPM in 4 preterminfants. In 9 infants a phasic 3 CPM signal was observed during fasting state. The median frequency was 2.9 CPM...

A-Source Impedance Network

DEFF Research Database (Denmark)

Siwakoti, Yam Prasad; Blaabjerg, Frede; Galigekere, Veda Prakash

2016-01-01

A novel A-source impedance network is proposed in this letter. The A-source impedance network uses an autotransformer for realizing converters for any application that demand a very high dc voltage gain. The network utilizes a minimal turns ratio compared to other Magnetically Coupled Impedance S...

The BNCT facility at the HFR Petten: Quality assurance for reactor facilities in clinical trials

International Nuclear Information System (INIS)

Moss, R.; Watkins, P.; Vroegindeweij, C.; Stecher-Rasmussen, F.; Huiskamp, R.; Ravensberg, K.; Appelman, K.; Sauerwein, W.; Hideghety, K.; Gabel, D.

2001-01-01

The first clinical trial in Europe of Boron Neutron Capture Therapy (BNCT) for the treatment of glioblastoma was opened in July 1997. The trial is a Phase I study with the principal aim to establish the maximum tolerated radiation dose and the dose limiting toxicity under defined conditions. It is the first time that a clinical application could be realised on a completely multi-national scale. The treatment takes place at the High Flux Reactor (HFR) in Petten, the Netherlands, is operated by an international team of experts under the leadership of a German radiotherapist, and treats patients coming from different European countries. It has therefore been necessary to create a very specialised organisation and contractual structure with the support of administrations from different countries, who had to find and adapt solutions within existing laws that had never foreseen such a situation. Furthermore, the treatment does not take place in an hospital environment and even more so, the facility is at a nuclear research reactor. Hence, special efforts were made on quality assurance, in order that the set-up at the facility and the personnel involved complied, as closely as possible, with similar practices in conventional radiotherapy departments. (author)

An electrode polarization impedance based flow sensor for low water flow measurement

International Nuclear Information System (INIS)

Yan, Tinghu; Sabic, Darko

2013-01-01

This note describes an electrode polarization impedance based flow sensor for low water flow measurement. It consists of two pairs of stainless steel electrodes set apart and inserted into a non-conductive flow tube with each pair of electrodes placed diametrically at the opposite sides. The flow sensor is modeled as a typical four-electrode system of which two electrodes are current-carrying and the other two serve as output pick ups. The polarization impedances of the two current carrying electrodes are affected by water flows resulting in changes of differential potential between the two pick-up electrodes which are separated by the same fluid. The interrogation of the two excitation electrodes with dc biased ac signals offers significantly higher sensor sensitivities to flow. The prototype flow sensor constructed for a 20 mm diameter pipeline was able to measure water flow rate as low as tested at 1.06 l h −1 and remained sensitive at a flow rate of 25.18 l h −1 when it was driven with a sinusoidal voltage at 1000 Hz with a peak ac amplitude of 2 V and a dc offset of +8 V. The nonlinear characteristics of the sensor response indicate that the sensor is more sensitive at low flows and will not be able to measure at very high flows. Additional experiments are needed to evaluate the influences of impurities, chemical species, ions constituents, conductivity and temperature over a practical range of residential water conditions, the effects of fluctuating ground signals, measurement uncertainty, power consumption, compensation of effects and practical operations. The flow sensor (principle) presented may be used as (in) a secondary sensor in combination with an existing electronic water meter to extend the low end of measurement range in residential water metering. (technical design note)

Impeded Dark Matter

Energy Technology Data Exchange (ETDEWEB)

Kopp, Joachim; Liu, Jia [PRISMA Cluster of Excellence & Mainz Institute for Theoretical Physics,Johannes Gutenberg University,Staudingerweg 7, 55099 Mainz (Germany); Slatyer, Tracy R. [Center for Theoretical Physics, Massachusetts Institute of Technology,Cambridge, MA 02139 (United States); Wang, Xiao-Ping [PRISMA Cluster of Excellence & Mainz Institute for Theoretical Physics,Johannes Gutenberg University,Staudingerweg 7, 55099 Mainz (Germany); Xue, Wei [Center for Theoretical Physics, Massachusetts Institute of Technology,Cambridge, MA 02139 (United States)

2016-12-12

We consider dark matter models in which the mass splitting between the dark matter particles and their annihilation products is tiny. Compared to the previously proposed Forbidden Dark Matter scenario, the mass splittings we consider are much smaller, and are allowed to be either positive or negative. To emphasize this modification, we dub our scenario “Impeded Dark Matter”. We demonstrate that Impeded Dark Matter can be easily realized without requiring tuning of model parameters. For negative mass splitting, we demonstrate that the annihilation cross-section for Impeded Dark Matter depends linearly on the dark matter velocity or may even be kinematically forbidden, making this scenario almost insensitive to constraints from the cosmic microwave background and from observations of dwarf galaxies. Accordingly, it may be possible for Impeded Dark Matter to yield observable signals in clusters or the Galactic center, with no corresponding signal in dwarfs. For positive mass splitting, we show that the annihilation cross-section is suppressed by the small mass splitting, which helps light dark matter to survive increasingly stringent constraints from indirect searches. As specific realizations for Impeded Dark Matter, we introduce a model of vector dark matter from a hidden SU(2) sector, and a composite dark matter scenario based on a QCD-like dark sector.

Impeded Dark Matter

International Nuclear Information System (INIS)

Kopp, Joachim; Liu, Jia; Slatyer, Tracy R.; Wang, Xiao-Ping; Xue, Wei

2016-01-01

We consider dark matter models in which the mass splitting between the dark matter particles and their annihilation products is tiny. Compared to the previously proposed Forbidden Dark Matter scenario, the mass splittings we consider are much smaller, and are allowed to be either positive or negative. To emphasize this modification, we dub our scenario “Impeded Dark Matter”. We demonstrate that Impeded Dark Matter can be easily realized without requiring tuning of model parameters. For negative mass splitting, we demonstrate that the annihilation cross-section for Impeded Dark Matter depends linearly on the dark matter velocity or may even be kinematically forbidden, making this scenario almost insensitive to constraints from the cosmic microwave background and from observations of dwarf galaxies. Accordingly, it may be possible for Impeded Dark Matter to yield observable signals in clusters or the Galactic center, with no corresponding signal in dwarfs. For positive mass splitting, we show that the annihilation cross-section is suppressed by the small mass splitting, which helps light dark matter to survive increasingly stringent constraints from indirect searches. As specific realizations for Impeded Dark Matter, we introduce a model of vector dark matter from a hidden SU(2) sector, and a composite dark matter scenario based on a QCD-like dark sector.

Ac-conductivity and dielectric response of new zinc-phosphate glass/metal composites

Energy Technology Data Exchange (ETDEWEB)

Maaroufi, A., E-mail: maaroufi@fsr.ac.ma [University of Mohammed V, Laboratory of Composite Materials, Polymers and Environment, Department of Chemistry, Faculty of Sciences, P.B. 1014, Rabat-Agdal (Morocco); Oabi, O. [University of Mohammed V, Laboratory of Composite Materials, Polymers and Environment, Department of Chemistry, Faculty of Sciences, P.B. 1014, Rabat-Agdal (Morocco); Lucas, B. [XLIM UMR 7252 – Université de Limoges/CNRS, 123 avenue Albert Thomas, 87060 Limoges Cedex (France)

2016-07-01

The ac-conductivity and dielectric response of new composites based on zinc-phosphate glass with composition 45 mol%ZnO–55 mol%P{sub 2}O{sub 5}, filled with metallic powder of nickel (ZP/Ni) were investigated by impedance spectroscopy in the frequency range from 100 Hz to 1 MHz at room temperature. A high percolating jump of seven times has been observed in the conductivity behavior from low volume fraction of filler to the higher fractions, indicating an insulator – semiconductor phase transition. The measured conductivity at higher filler volume fraction is about 10{sup −1} S/cm and is frequency independent, while, the obtained conductivity for low filler volume fraction is around 10{sup −8} S/cm and is frequency dependent. Moreover, the elaborated composites are characterized by high dielectric constants in the range of 10{sup 5} for conductive composites at low frequencies (100 Hz). In addition, the distribution of the relaxation processes was also evaluated. The Debye, Cole-Cole, Davidson–Cole and Havriliak–Negami models in electric modulus formalism were used to model the observed relaxation phenomena in ZP/Ni composites. The observed relaxation phenomena are fairly simulated by Davidson–Cole model, and an account of the interpretation of results is given. - Highlights: • Composites of ZnO-P{sub 2}O{sub 5}/metal were investigated by impedance spectroscopy. • Original ac-conductivity behavior was discovered in ZnO-P{sub 2}O{sub 5}/metal composites. • High dielectric constant is measured in ZnO-P{sub 2}O{sub 5}/metal composites. • Dielectric constant as filler function is well interpreted with percolation theory. • Observed relaxation processes are well described using electric modulus formalism.

Observations involving broadband impedance modelling

Energy Technology Data Exchange (ETDEWEB)

Berg, J S [Stanford Linear Accelerator Center, Menlo Park, CA (United States)

1996-08-01

Results for single- and multi-bunch instabilities can be significantly affected by the precise model that is used for the broadband impedance. This paper discusses three aspects of broadband impedance modelling. The first is an observation of the effect that a seemingly minor change in an impedance model has on the single-bunch mode coupling threshold. The second is a successful attempt to construct a model for the high-frequency tails of an r.f. cavity. The last is a discussion of requirements for the mathematical form of an impedance which follow from the general properties of impedances. (author)

Peltier ac calorimeter

OpenAIRE

Jung, D. H.; Moon, I. K.; Jeong, Y. H.

2001-01-01

A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

Impact of Exhaled Breath Acetone in the Prognosis of Patients with Heart Failure with Reduced Ejection Fraction (HFrEF. One Year of Clinical Follow-up.

Directory of Open Access Journals (Sweden)

Fabiana G Marcondes-Braga

Full Text Available The identification of new biomarkers of heart failure (HF could help in its treatment. Previously, our group studied 89 patients with HF and showed that exhaled breath acetone (EBA is a new noninvasive biomarker of HF diagnosis. However, there is no data about the relevance of EBA as a biomarker of prognosis.To evaluate whether EBA could give prognostic information in patients with heart failure with reduced ejection fraction (HFrEF.After breath collection and analysis by gas chromatography-mass spectrometry and by spectrophotometry, the 89 patients referred before were followed by one year. Study physicians, blind to the results of cardiac biomarker testing, ascertained vital status of each study participant at 12 months.The composite endpoint death and heart transplantation (HT were observed in 35 patients (39.3%: 29 patients (32.6% died and 6 (6.7% were submitted to HT within 12 months after study enrollment. High levels of EBA (≥3.7μg/L, 50th percentile were associated with a progressively worse prognosis in 12-month follow-up (log-rank = 11.06, p = 0.001. Concentrations of EBA above 3.7μg/L increased the risk of death or HT in 3.26 times (HR = 3.26, 95%CI = 1.56-6.80, p = 0.002 within 12 months. In a multivariable cox regression model, the independent predictors of all-cause mortality were systolic blood pressure, respiratory rate and EBA levels.High EBA levels could be associated to poor prognosis in HFrEF patients.

Impact of Exhaled Breath Acetone in the Prognosis of Patients with Heart Failure with Reduced Ejection Fraction (HFrEF). One Year of Clinical Follow-up

Science.gov (United States)

Saldiva, Paulo H. N.; Mangini, Sandrigo; Issa, Victor S.; Ayub-Ferreira, Silvia M.; Bocchi, Edimar A.

2016-01-01

Background The identification of new biomarkers of heart failure (HF) could help in its treatment. Previously, our group studied 89 patients with HF and showed that exhaled breath acetone (EBA) is a new noninvasive biomarker of HF diagnosis. However, there is no data about the relevance of EBA as a biomarker of prognosis. Objectives To evaluate whether EBA could give prognostic information in patients with heart failure with reduced ejection fraction (HFrEF). Methods After breath collection and analysis by gas chromatography-mass spectrometry and by spectrophotometry, the 89 patients referred before were followed by one year. Study physicians, blind to the results of cardiac biomarker testing, ascertained vital status of each study participant at 12 months. Results The composite endpoint death and heart transplantation (HT) were observed in 35 patients (39.3%): 29 patients (32.6%) died and 6 (6.7%) were submitted to HT within 12 months after study enrollment. High levels of EBA (≥3.7μg/L, 50th percentile) were associated with a progressively worse prognosis in 12-month follow-up (log-rank = 11.06, p = 0.001). Concentrations of EBA above 3.7μg/L increased the risk of death or HT in 3.26 times (HR = 3.26, 95%CI = 1.56–6.80, p = 0.002) within 12 months. In a multivariable cox regression model, the independent predictors of all-cause mortality were systolic blood pressure, respiratory rate and EBA levels. Conclusions High EBA levels could be associated to poor prognosis in HFrEF patients. PMID:28030609

Digital model for harmonic interactions in AC/DC/AC systems

Energy Technology Data Exchange (ETDEWEB)

Guarini, A P; Rangel, R D; Pilotto, L A.S.; Pinto, R J; Passos, Junior, R [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

1994-12-31

The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

Measurement errors in multifrequency bioelectrical impedance analyzers with and without impedance electrode mismatch

International Nuclear Information System (INIS)

Bogónez-Franco, P; Nescolarde, L; Bragós, R; Rosell-Ferrer, J; Yandiola, I

2009-01-01

The purpose of this study is to compare measurement errors in two commercially available multi-frequency bioimpedance analyzers, a Xitron 4000B and an ImpediMed SFB7, including electrode impedance mismatch. The comparison was made using resistive electrical models and in ten human volunteers. We used three different electrical models simulating three different body segments: the right-side, leg and thorax. In the electrical models, we tested the effect of the capacitive coupling of the patient to ground and the skin–electrode impedance mismatch. Results showed that both sets of equipment are optimized for right-side measurements and for moderate skin–electrode impedance mismatch. In right-side measurements with mismatch electrode, 4000B is more accurate than SFB7. When an electrode impedance mismatch was simulated, errors increased in both bioimpedance analyzers and the effect of the mismatch in the voltage detection leads was greater than that in current injection leads. For segments with lower impedance as the leg and thorax, SFB7 is more accurate than 4000B and also shows less dependence on electrode mismatch. In both devices, impedance measurements were not significantly affected (p > 0.05) by the capacitive coupling to ground

Single stage buck-boost DC-AC neutral point clamped inverter

DEFF Research Database (Denmark)

Mo, Wei; Loh, Poh Chiang; Andrew, A.

2012-01-01

This paper proposes a new single stage buck-boost DC-AC neutral point clamped inverter topology which integrates the cascaded configurations of recently introduced inductor-capacitor-capacitor-transformer impedance source network (by Adamowicz) and classic NPC configuration. As a consequence......, it has enhanced buck-boost functionality and low output voltage distortions compared to the traditional Z-source inverter; it has continuous input current which reduces the source stress and inverter noise; it also contains two built-in capacitors which can block the DC current in the transformer...... windings thus preventing the core from saturation; lowers the voltage stresses and power losses of inverter switches and reduces the sizes of filtering devices and as well as obtains better output performance compared to the original two-level Z-source inverters. A phase disposition pulse width modulation...

Origin of Capacity Fading in Nano-Sized Co3O4Electrodes: Electrochemical Impedance Spectroscopy Study

Directory of Open Access Journals (Sweden)

Kang Jin-Gu

2008-01-01

Full Text Available Abstract Transition metal oxides have been suggested as innovative, high-energy electrode materials for lithium-ion batteries because their electrochemical conversion reactions can transfer two to six electrons. However, nano-sized transition metal oxides, especially Co3O4, exhibit drastic capacity decay during discharge/charge cycling, which hinders their practical use in lithium-ion batteries. Herein, we prepared nano-sized Co3O4with high crystallinity using a simple citrate-gel method and used electrochemical impedance spectroscopy method to examine the origin for the drastic capacity fading observed in the nano-sized Co3O4anode system. During cycling, AC impedance responses were collected at the first discharged state and at every subsequent tenth discharged state until the 100th cycle. By examining the separable relaxation time of each electrochemical reaction and the goodness-of-fit results, a direct relation between the charge transfer process and cycling performance was clearly observed.

Impedance and modulus spectroscopic study of nano hydroxyapatite

Science.gov (United States)

Jogiya, B. V.; Jethava, H. O.; Tank, K. P.; Raviya, V. R.; Joshi, M. J.

2016-05-01

Hydroxyapatite (Ca10 (PO4)6 (OH)2, HAP) is the main inorganic component of the hard tissues in bones and also important material for orthopedic and dental implant applications. Nano HAP is of great interest due to its various bio-medical applications. In the present work the nano HAP was synthesized by using surfactant mediated approach. Structure and morphology of the synthesized nano HAP was examined by the Powder XRD and TEM. Impedance study was carried out on pelletized sample in a frequency range of 100Hz to 20MHz at room temperature. The variation of dielectric constant, dielectric loss, and a.c. conductivity with frequency of applied field was studied. The Nyquist plot as well as modulus plot was drawn. The Nyquist plot showed two semicircle arcs, which indicated the presence of grain and grain boundary effect in the sample. The typical behavior of the Nyquist plot was represented by equivalent circuit having two parallel RC combinations in series.

Applications for Electrical Impedance Tomography (EIT) and Electrical Properties of the Human Body.

Science.gov (United States)

Lymperopoulos, Georgios; Lymperopoulos, Panagiotis; Alikari, Victoria; Dafogianni, Chrisoula; Zyga, Sofia; Margari, Nikoletta

2017-01-01

Electrical Impedance Tomography (EIT) is a promising application that displays changes in conductivity within a body. The basic principle of the method is the repeated measurement of surface voltages of a body, which are a result of rolling injection of known and small-volume sinusoidal AC current to the body through the electrodes attached to its surface. This method finds application in biomedicine, biology and geology. The objective of this paper is to present the applications of Electrical Impedance Tomography, along with the method's capabilities and limitations due to the electrical properties of the human body. For this purpose, investigation of existing literature has been conducted, using electronic databases, PubMed, Google Scholar and IEEE Xplore. In addition, there was a secondary research phase, using paper citations found during the first research phase. It should be noted that Electrical Impedance Tomography finds use in a plethora of medical applications, as the different tissues of the body have different conductivities and dielectric constants. Main applications of EIT include imaging of lung function, diagnosis of pulmonary embolism, detection of tumors in the chest area and diagnosis and distinction of ischemic and hemorrhagic stroke. EIT advantages include portability, low cost and safety, which the method provide, since it is a noninvasive imaging method that does not cause damage to the body. The main disadvantage of the method, which blocks its wider spread, appears in the image composition from the voltage measurements, which are conducted by electrodes placed on the periphery of the body, because the injected currents are affected nonlinearly by the general distribution of the electrical properties of the body. Furthermore, the complex impedance of the skin-electrode interface can be modelled by using a capacitor and two resistor, as a result of skin properties. In conclusion, Electrical Impedance Tomography is a promising method for the

Electrical transport properties of CoMn0.2−xGaxFe1.8O4 ferrites using complex impedance spectroscopy

Directory of Open Access Journals (Sweden)

Chien-Yie Tsay

2016-05-01

Full Text Available In this study, we report the influence of Ga content on the microstructural, magnetic, and AC impedance properties of Co-based ferrites with compositions of CoMn0.2−xGaxFe1.8O4 (x=0, 0.1, and 0.2 prepared by the solid-state reaction method. Experimental results showed that the as-prepared Co-based ferrites had a single-phase spinel structure; the Curie temperature of Co-based ferrites decreased with increasing Ga content. All ferrite samples exhibited a typical hysteresis behavior with good values of saturation magnetization at room temperature. The electrical properties of Co-based ferrites were investigated using complex impedance spectroscopy analysis in the frequency range of 100 kHz-50 MHz at temperatures of 150 to 250 oC. The impedance analysis revealed that the magnitudes of the real part (Z’ and the imaginary part (Z” of complex impedance decreased with increasing temperature. Only one semicircle was observed in each complex impedance plane plot, which revealed that the contribution to conductivity was from the grain boundaries. It was found that the relaxation time for the grain boundary (τgb also decreased with increasing temperature. The values of resistance for the grain boundary (Rgb significantly increased with increasing Ga content, which indicated that the incorporation of Ga into Co-based ferrites enhanced the electrical resistivity.

Impedance analysis of subwoofer systems

NARCIS (Netherlands)

Berkhoff, Arthur P.

The electrical impedance of four low-frequency loudspeaker systems is analyzed. The expression for this impedance is obtained directly from the acoustical analogous circuit. Formulas are derived for calculating the small-signal parameters from the frequencies of impedance minima and maxima of two

Impedance Source Power Electronic Converters

DEFF Research Database (Denmark)

Liu, Yushan; Abu-Rub, Haitham; Ge, Baoming

Impedance Source Power Electronic Converters brings together state of the art knowledge and cutting edge techniques in various stages of research related to the ever more popular impedance source converters/inverters. Significant research efforts are underway to develop commercially viable...... and technically feasible, efficient and reliable power converters for renewable energy, electric transportation and for various industrial applications. This book provides a detailed understanding of the concepts, designs, controls, and application demonstrations of the impedance source converters/inverters. Key...... features: Comprehensive analysis of the impedance source converter/inverter topologies, including typical topologies and derived topologies. Fully explains the design and control techniques of impedance source converters/inverters, including hardware design and control parameter design for corresponding...

ACS Zero Point Verification

Science.gov (United States)

Dolphin, Andrew

2005-07-01

The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.

Nonlinear Impedance of Whole Cells Near an Electrode as a Probe of Mitochondrial Activity

Directory of Open Access Journals (Sweden)

John H. Miller Jr.

2011-04-01

Full Text Available By simultaneously measuring the bulk media and electrode interface voltages of a yeast (Saccharomyces cerevisiae suspension subjected to an AC voltage, a yeast-dependent nonlinear response was found only near the current injection electrodes. Computer simulation of yeast near a current injection electrode found an enhanced voltage drop across the yeast near the electrode due to slowed charging of the electrode interfacial capacitance. This voltage drop is sufficient to induce conformation change in membrane proteins. Disruption of the mitochondrial electron transport chain is found to significantly change the measured nonlinear current response, suggesting nonlinear impedance can be used as a non-invasive probe of cellular metabolic activity.

Beam measurements of the LHC impedance and validation of the impedance model

CERN Document Server

Esteban Müller, J F; Bohl, T; Mounet, N; Shaposhnikova, E; Timko, H

2014-01-01

Different measurements of the longitudinal impedance of the LHC done with single bunches with various intensities and longitudinal emittances during measurement sessions in 2011-2012 are compared with particle simulations based on the existing LHC impedance model. The very low reactive impedance of the LHC, with Im Z=n = 0.08, is not easy to measure. The most sensitive observation is the loss of Landau damping, which shows at which energy bunches become unstable depending on their parameters. In addition, the synchrotron frequency shift due to the reactive impedance was estimated following two methods. Firstly, it was obtained from the peak-detected Schottky spectrum. Secondly, a sine modulation in the RF phase was applied to the bunches of different intensities and the modulation frequency was scanned. In both cases, the synchrotron frequency shift was of the order of the measurement precision.

The second Euratom sponsored 9000C HTR fuel irradiation experiment in the HFR Petten Project E 96.02: Pt.2. Post-irradiation examination

International Nuclear Information System (INIS)

Roettger, R.; Bueger, J. de; Schoots, T.

1977-01-01

A large variety of HTR fuel specimens, loose coated particles, coupons and compacts provided by Belgonucleaire, the Dragon Project and the KFA Juelich have been irradiated in the HFR at Petten at about 900 0 C up to a maximum fast neutron fluence of about 7x10 21 cm -2 (EDN) as a Euratom sponsored experiment. The maximum burn-ups were between 11 and 18.5% FIMA. The results of the post-irradiation examinations, comprising visual inspection, dimensional measurements, microradiography, metallography, and burn-up determinations are presented in this part 2 of the final report. The examinations have shown that the endurance limit of most of the tested fuel varieties is beyond the reached irradiation values

Microwave Impedance Measurement for Nanoelectronics

Directory of Open Access Journals (Sweden)

M. Randus

2011-04-01

Full Text Available The rapid progress in nanoelectronics showed an urgent need for microwave measurement of impedances extremely different from the 50Ω reference impedance of measurement instruments. In commonly used methods input impedance or admittance of a device under test (DUT is derived from measured value of its reflection coefficient causing serious accuracy problems for very high and very low impedances due to insufficient sensitivity of the reflection coefficient to impedance of the DUT. This paper brings theoretical description and experimental verification of a method developed especially for measurement of extreme impedances. The method can significantly improve measurement sensitivity and reduce errors caused by the VNA. It is based on subtraction (or addition of a reference reflection coefficient and the reflection coefficient of the DUT by a passive network, amplifying the resulting signal by an amplifier and measuring the amplified signal as a transmission coefficient by a common vector network analyzer (VNA. A suitable calibration technique is also presented.

The influence of a delaminated layer on the impedance spectrum of an operating solid oxide fuel cell

Energy Technology Data Exchange (ETDEWEB)

Gazzarri, J.I. [British Columbia Univ., Vancouver, BC (Canada). Dept. of Mechanical Engineering; Kesler, O. [National Research Council of Canada, Vancouver, BC (Canada). Inst. for Fuel Cell Innovation

2005-07-01

The development of a 2-dimensional finite element model of Solid Oxide Fuel Oxide (SOFC) AC impedance behavior was discussed. The model was developed to simulate the frequency response of a single cell with and without mechanical damage. Impedance spectroscopy was used in the development of a diagnostic technique to identify a delamination failure within a working SOFC. Changes in the impedance spectrum of a working cell were observed on the appearance of a delamination between 2 adjacent layers. The intent was to identify distinctive patterns in the cracked cell spectra that provide enough information about the degradation process so that it can be recognized and distinguished from other electrochemical processes and degradation modes. It was anticipated that the method will provide a useful tool for both maintenance and research purposes, providing insight into the causes of inadequate functioning. Results indicate that the presence of mechanically induced damage within the components of an SOFC can be detected by comparing the frequency response of the undamaged cell with that of a cell in which in-plane cracking or delamination has occurred. The presence of such defects manifests itself as a new semicircle in the Nyquist impedance diagram of the full cell, with a relaxation frequency of approximately 35 kHz. It was concluded that the ability to distinguish the crack-induced semicircle from the semicircles induced by electrochemical reactions depended on the difference between the characteristic relaxation times and their relative sizes. 17 refs., 1 tab.,10 figs.

Characterization of Bi4Ge3O12 single crystal by impedance spectroscopy

Directory of Open Access Journals (Sweden)

Zélia Soares Macedo

2003-12-01

Full Text Available Bi4Ge3O12 (bismuth germanate - BGO single crystals were produced by the Czochralski technique and their electrical and dielectric properties were investigated by impedance spectroscopy. The isothermal ac measurements were performed for temperatures from room temperature up to 750 °C, but only the data taken above 500 °C presented a complete semicircle in the complex impedance diagrams. Experimental data were fitted to a parallel RC equivalent circuit, and the electrical conductivity was obtained from the resistivity values. Conductivity values from 5.4 × 10(9 to 4.3 × 10-7 S/cm were found in the temperature range of 500 to 750 °C. This electrical conductivity is thermally activated, following the Arrhenius law with an apparent activation energy of (1.41 ± 0.04 eV. The dielectric properties of BGO single crystal were also studied for the same temperature interval. Permittivity values of 20 ± 2 for frequencies higher than 10³ Hz and a low-frequency dispersion were observed. Both electric and dielectric behavior of BGO are typical of systems in which the conduction mechanism dominates the dielectric response.

Superconductive AC current limiter

International Nuclear Information System (INIS)

Bekhaled, M.

1987-01-01

This patent describes an AC current limiter for a power transport line including a power supply circuit and feeding a load circuit via an overload circuit-breaker member. The limiter comprises a transformer having a primary winding connected in series between the power supply circuit and the load circuit and at least one secondary winding of superconductor material contained in a cryogenic enclosure and short-circuited on itself. The leakage reactance of the transformer as seen from the primary winding is low, and the resistance of the at least one secondary winding when in the non-superconducting state and as seen from the primary is much greater than the nominal impedance of the transformer. The improvement whereby the at least one secondary winding of the transformer comprises an active winding in association with a set of auxiliary windings. The set of auxiliary windings is constituted by an even number of series-connected auxiliary windings wound in opposite directions, with the total number of turns in one direction being equal to the total number of turns in the opposite direction, and with the thermal capacity of the secondary winding as a whole being sufficiently high to limit the expansion thereof to a value which remains small during the time it takes the circuit-breaking member to operate

Impedance and Collective Effects

CERN Document Server

Metral, E; Rumolo, R; Herr, W

2013-01-01

This document is part of Subvolume C 'Accelerators and Colliders' of Volume 21 'Elementary Particles' of Landolt-Börnstein - Group I 'Elementary Particles, Nuclei and Atoms'. It contains the Chapter '4 Impedance and Collective Effects' with the content: 4 Impedance and Collective Effects Introduction 4.1 Space Charge 4.2 Wake Fields and Impedances 4.3 Coherent Instabilities 4.4 Landau Damping 4.5 Two-Stream Effects (Electron Cloud and Ions) 4.6 Beam-Beam Effects 4.7 Numerical Modelling

Impedance source power electronic converters

CERN Document Server

Liu, Yushan; Ge, Baoming; Blaabjerg, Frede; Ellabban, Omar; Loh, Poh Chiang

2016-01-01

Impedance Source Power Electronic Converters brings together state of the art knowledge and cutting edge techniques in various stages of research related to the ever more popular impedance source converters/inverters. Significant research efforts are underway to develop commercially viable and technically feasible, efficient and reliable power converters for renewable energy, electric transportation and for various industrial applications. This book provides a detailed understanding of the concepts, designs, controls, and application demonstrations of the impedance source converters/inverters. Key features: Comprehensive analysis of the impedance source converter/inverter topologies, including typical topologies and derived topologies. Fully explains the design and control techniques of impedance source converters/inverters, including hardware design and control parameter design for corresponding control methods. Presents the latest power conversion solutions that aim to advance the role of pow...

Hybrid-Source Impedance Networks

DEFF Research Database (Denmark)

Li, Ding; Gao, Feng; Loh, Poh Chiang

2010-01-01

Hybrid-source impedance networks have attracted attention among researchers because of their flexibility in performing buck-boost energy conversion. To date, three distinct types of impedance networks can be summarized for implementing voltage-type inverters with another three types summarized...... for current-type inverters. These impedance networks can in principle be combined into two generic network entities, before multiple of them can further be connected together by applying any of the two proposed generalized cascading concepts. The resulting two-level and three-level inverters implemented using...

Low Offset AC Correlator.

Science.gov (United States)

This patent describes a low offset AC correlator avoids DC offset and low frequency noise by frequency operating the correlation signal so that low...noise, low level AC amplification can be substituted for DC amplification. Subsequently, the high level AC signal is demodulated to a DC level. (Author)

AC power supply systems

International Nuclear Information System (INIS)

Law, H.

1987-01-01

An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

Bridge Network for Measuring Very Small Impedances from 4.2 to 300 degrees K with a Null-Detector Sensitivity of 10-11 Volt

DEFF Research Database (Denmark)

Bak, Christen Kjeldahl; Dalsgaard, Erik

1967-01-01

An ac measuring technique devised primarily for measuring galvanomagnetic effects in metals is presented. The instrument may, however, be useful whenever it is desired to measure and record continuously impedances in the range 10−3 to 10−8 Omega. The sample assembly is disscussed in some detail....... Measurements with the bridge show that in the temperature range 300°K to 4.2°K the noise level changes from 30×10−11 V to 10−11 V without any zero shift, and as a result the lower limit for the impedance range changes from 10−6 Omega to less than 5×10−8 Omega. ©1967 The American Institute of Physics...

Pumping slots: impedances and power losses

Energy Technology Data Exchange (ETDEWEB)

Kurennoy, S [Maryland Univ., College Park, MD (United States). Dept. of Physics

1996-08-01

Contributions of pumping slots to the beam coupling impedances and power losses in a B-factory ring are considered. While their leading contribution is to the inductive impedance, for high-intensity machines with short bunches like e{sup +}e{sup -} B-factories the real part of the impedance and related loss factors are also important. Using an analytical approach we calculate the coupling impedances and loss factors due to slots in a ring with an arbitrary cross section of the vacuum chamber. Effects of the slot tilt on the beam impedance are also considered, and restrictions on the tilt angle are derived from limitations on the impedance increase. The power leakage through the slots is discussed briefly. The results are applied to the KEK B-factory. (author)

Bias Voltage-Dependent Impedance Spectroscopy Analysis of Hydrothermally Synthesized ZnS Nanoparticles

Science.gov (United States)

Dey, Arka; Dhar, Joydeep; Sil, Sayantan; Jana, Rajkumar; Ray, Partha Pratim

2018-04-01

In this report, bias voltage-dependent dielectric and electron transport properties of ZnS nanoparticles were discussed. ZnS nanoparticles were synthesized by introducing a modified hydrothermal process. The powder XRD pattern indicates the phase purity, and field emission scanning electron microscope image demonstrates the morphology of the synthesized sample. The optical band gap energy (E g = 4.2 eV) from UV measurement explores semiconductor behavior of the synthesized material. The electrical properties were performed at room temperature using complex impedance spectroscopy (CIS) technique as a function of frequency (40 Hz-10 MHz) under different forward dc bias voltages (0-1 V). The CIS analysis demonstrates the contribution of bulk resistance in conduction mechanism and its dependency on forward dc bias voltages. The imaginary part of the impedance versus frequency curve exhibits the existence of relaxation peak which shifts with increasing dc forward bias voltages. The dc bias voltage-dependent ac and dc conductivity of the synthesized ZnS was studied on thin film structure. A possible hopping mechanism for electrical transport processes in the system was investigated. Finally, it is worth to mention that this analysis of bias voltage-dependent dielectric and transport properties of as-synthesized ZnS showed excellent properties for emerging energy applications.

Impedance spectroscopy of p-ZnGa{sub 2}Te{sub 4}/n-Si nano-HJD

Energy Technology Data Exchange (ETDEWEB)

Fouad, S.S. [Thin film Laboratory, Department of Physics, Faculty of Education, Ain Shams University, Roxy, Cairo (Egypt); Sakr, G.B. [Nano-Science Laboratory, Physics Department, Faculty of Education, Ain Shams University, Roxy, Cairo (Egypt); Yahia, I.S., E-mail: dr_isyahia@yahoo.com [Nano-Science Laboratory, Physics Department, Faculty of Education, Ain Shams University, Roxy, Cairo (Egypt); Semiconductor Laboratory, Physics Department, Faculty of Education, Ain Shams University, Roxy, Cairo (Egypt); Department of Physics, Faculty of Science, King Khalid University, P.O. Box 9004, Abha (Saudi Arabia); Abdel-Basset, D.M. [Nano-Science Laboratory, Physics Department, Faculty of Education, Ain Shams University, Roxy, Cairo (Egypt); Yakuphanoglu, F. [Department of Physics, Faculty of Science, Firat University, Elazig (Turkey)

2013-04-15

The dielectric relaxation and alternating current mechanisms of nano-crystalline p-ZnGa{sub 2}Te{sub 4}/n-Si heterojunction diode (HJD) were investigated by complex impedance spectroscopy over a wide range of temperature (297–473 K) and a frequency range (42 Hz–5 MHz). The bulk resistance R{sub b} as well as the bulk capacitance C{sub b} were found to increase with increasing temperature. The dc conductivity exhibits a typical Arrhenius behavior. The electrical activation energy ΔE{sub σ} was determined to be (0.28 eV). The ac conductivity spectrum was found to obey Jonscher's universal power law. The frequency exponent s decreases slightly with increasing temperature. The temperature dependence of ac conductivity can be reasonably interpreted in terms of the correlated barrier hopping (CBH) model. The dielectric constant ε{sub 1}(ω) and dielectric loss ε{sub 2}(ω) were found to decrease with increasing frequency and to increase with increasing temperature. The mean value of the exponent m decreases with increasing temperature. The dielectric analysis is described by non-Debye type behavior.

Genome-Wide Identification and Expression Profiling of ATP-Binding Cassette (ABC) Transporter Gene Family in Pineapple (Ananas comosus (L.) Merr.) Reveal the Role of AcABCG38 in Pollen Development.

Science.gov (United States)

Chen, Piaojuan; Li, Yi; Zhao, Lihua; Hou, Zhimin; Yan, Maokai; Hu, Bingyan; Liu, Yanhui; Azam, Syed Muhammad; Zhang, Ziyan; Rahman, Zia Ur; Liu, Liping; Qin, Yuan

2017-01-01

Pineapple ( Ananas comosus L .) cultivation commonly relies on asexual reproduction which is easily impeded by many factors in agriculture production. Sexual reproduction might be a novel approach to improve the pineapple planting. However, genes controlling pineapple sexual reproduction are still remain elusive. In different organisms a conserved superfamily proteins known as ATP binding cassette (ABC) participate in various biological processes. Whereas, till today the ABC gene family has not been identified in pineapple. Here 100 ABC genes were identified in the pineapple genome and grouped into eight subfamilies (5 ABCAs , 20 ABCB s, 16 ABCCs , 2 ABCDs , one ABCEs , 5 ABCFs , 42 ABCGs and 9 ABCIs ). Gene expression profiling revealed the dynamic expression pattern of ABC gene family in various tissues and different developmental stages. AcABCA5, AcABCB6, AcABCC4 , AcABCC7 , AcABCC9 , AcABCG26 , AcABCG38 and AcABCG42 exhibited preferential expression in ovule and stamen. Over-expression of AcABCG38 in the Arabidopsis double mutant abcg1-2abcg16-2 partially restored its pollen abortion defects, indicating that AcABCG38 plays important roles in pollen development. Our study on ABC gene family in pineapple provides useful information for developing sexual pineapple plantation which could be utilized to improve pineapple agricultural production.

Conventional P-ω/Q-V Droop Control in Highly Resistive Line of Low-Voltage Converter-Based AC Microgrid

DEFF Research Database (Denmark)

Hou, Xiaochao; Sun, Yao; Yuan, Wenbin

2016-01-01

-ω/Q-V droop control is adopted in the low-voltage AC microgrid. As a result, the active power sharing among the distributed generators (DGs) is easily obtained without communication. More importantly, this study clears up the previous misunderstanding that conventional P-ω/Q-V droop control is only applicable...... to microgrids with highly inductive lines, and lays a foundation for the application of conventional droop control under different line impedances. Moreover, in order to guarantee the accurate reactive power sharing, a guide for designing Q-V droop gains is given, and virtual resistance is adopted to shape......In low-voltage converter-based alternating current (AC) microgrids with resistive distribution lines, the P-V droop with Q-f boost (VPD/FQB) is the most common method for load sharing. However, it cannot achieve the active power sharing proportionally. To overcome this drawback, the conventional P...

ACS Photometric Zero Point Verification

Science.gov (United States)

Dolphin, Andrew

2003-07-01

The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.

Impedance and component heating

CERN Document Server

Métral, E; Mounet, N; Pieloni, T; Salvant, B

2015-01-01

The impedance is a complex function of frequency, which represents, for the plane under consideration (longitudinal, horizontal or vertical), the force integrated over the length of an element, from a “source” to a “test” wave, normalized by their charges. In general, the impedance in a given plane is a nonlinear function of the test and source transverse coordinates, but it is most of the time sufficient to consider only the first few linear terms. Impedances can influence the motion of trailing particles, in the longitudinal and in one or both transverse directions, leading to energy loss, beam instabilities, or producing undesirable secondary effects such as excessive heating of sensitive components at or near the chamber wall, called beam-induced RF heating. The LHC performance limitations linked to impedances encountered during the 2010-2012 run are reviewed and the currently expected situation during the HL-LHC era is discussed.

Short-circuit impedance measurement

DEFF Research Database (Denmark)

Pedersen, Knud Ole Helgesen; Nielsen, Arne Hejde; Poulsen, Niels Kjølstad

2003-01-01

Methods for estimating the short-circuit impedance in the power grid are investigated for various voltage levels and situations. The short-circuit impedance is measured, preferably from naturally occurring load changes in the grid, and it is shown that such a measurement system faces different...

Frequency effects on charge ordering in Y0.5Ca0.5MnO3 by impedance spectroscopy

Science.gov (United States)

Sarwar, Tuba; Qamar, Afzaal; Nadeem, Muhammad

2015-02-01

In this work, structural and electrical properties of Y0.5Ca0.5MnO3 are investigated by employing X-ray diffraction and impedance spectroscopy, respectively. Applied ac electric field showed the charge ordering transition temperature around 265 K and below this temperature the heteromorphic behavior of the sample is discussed in the proximity of TCO. With frequency effects the volume of robust charge orbital ordering (COO) domains diminishes due to different competing phases along with Jahn Teller distortions. Comprehensive melting and collapse of charge orbital ordering occurs below TN(125 K), where a colossal drop in the value of impedance is observed. The change in profile of modulus plane plots determines the spreading of relaxation time of intermingled phases. Hopping mechanism is elaborated in terms of strong electron phonon coupling. Variable range hopping model and Arrhenius model are used to discuss the short and long range hopping between Mn3+ and Mn4+ channels assessing the activation energy Ea.

Dielectric and impedance studies of Ba0.50(Na0.25Bi0.25)(Fe0.25Nb0.25)Ti0.50O3 ceramic

Science.gov (United States)

Yadav, Anjana; Chandra, K. P.; Kulkarni, A. R.; Prasad, K.

2018-05-01

Lead-free perovskite Ba0.50(Na0.25Bi0.25)(Fe0.25Nb0.25)Ti0.50O3 was prepared using conventional ceramic technique at 1130°C/4h in air atmosphere and characterized by X-ray diffraction, scanning electron microscopy, dielectric and impedance studies. XRD analysis of the compound indicated the formation of a single-phase cubic structure. SEM study was carried out to study the quality and purity of the compound. Compound showed very high dielectric constant (33700). Impedance analysis indicated the negative temperature coefficient of resistance character of the compound. Ac conductivity data followed Jonscher's law and correlated barrier hopping successfully explained the charge carrier transport mechanism in the system.

Impedance Based Analysis and Design of Harmonic Resonant Controller for a Wide Range of Grid Impedance

DEFF Research Database (Denmark)

Kwon, Jun Bum; Wang, Xiongfei; Blaabjerg, Frede

2014-01-01

This paper investigates the effect of grid impedance variation on harmonic resonant current controllers for gridconnected voltage source converters by means of impedance-based analysis. It reveals that the negative harmonic resistances tend to be derived from harmonic resonant controllers...... in the closed-loop output admittance of converter. Such negative resistances may interact with the grid impedance resulting in steady state error or unstable harmonic compensation. To deal with this problem, a design guideline for harmonic resonant controllers under a wide range of grid impedance is proposed...

Structure and electrochemical impedance of LiNi_xMn_2_-_xO_4

International Nuclear Information System (INIS)

Ta Anh Tan; Nguyen Si Hieu; Le Ha Chi; Pham Duy Long; Dang Tran Chien; Le Dinh Trong

2016-01-01

Ni-substitution spinel LiNi_xMn_2_-_xO_4 (x = 0, 0.1, 0.2) materials were synthesized by the sol--gel method. The structure and morphology of the samples were characterized by the X-ray diffraction (XRD) and the scanning electron microscopy. The ac conduction of the materials was investigated by electrochemical impedance spectroscopy (EIS) measurements. The refinement results showed that the substitution of Ni decreased the lattice constant and Mn--O distance, while increased Li--O bond length and 16c octahedral volume. The EIS results confirmed the decrease of conductivity with increasing Ni substitution content. Based on XRD and EIS results, the relationship between the crystal structure and electrochemical behavior of the materials was discussed and explained. (author)

FLUIDIC AC AMPLIFIERS.

Science.gov (United States)

Several fluidic tuned AC Amplifiers were designed and tested. Interstage tuning and feedback designs are considered. Good results were obtained...corresponding Q’s as high as 12. Element designs and test results of one, two, and three stage amplifiers are presented. AC Modulated Carrier Systems

Superconducting fault current-limiter with variable shunt impedance

Science.gov (United States)

Llambes, Juan Carlos H; Xiong, Xuming

2013-11-19

A superconducting fault current-limiter is provided, including a superconducting element configured to resistively or inductively limit a fault current, and one or more variable-impedance shunts electrically coupled in parallel with the superconducting element. The variable-impedance shunt(s) is configured to present a first impedance during a superconducting state of the superconducting element and a second impedance during a normal resistive state of the superconducting element. The superconducting element transitions from the superconducting state to the normal resistive state responsive to the fault current, and responsive thereto, the variable-impedance shunt(s) transitions from the first to the second impedance. The second impedance of the variable-impedance shunt(s) is a lower impedance than the first impedance, which facilitates current flow through the variable-impedance shunt(s) during a recovery transition of the superconducting element from the normal resistive state to the superconducting state, and thus, facilitates recovery of the superconducting element under load.

78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A

Science.gov (United States)

2013-08-13

...] Availability of Draft Advisory Circular (AC) 90-106A and AC 20- 167A AGENCY: Federal Aviation Administration... of draft Advisory Circular (AC) 90-106A, Enhanced Flight Vision Systems and draft AC 20- 167A... Federal holidays. FOR FURTHER INFORMATION CONTACT: For technical questions concerning draft AC 90-106A...

Large-Signal Lyapunov-Based Stability Analysis of DC/AC Inverters and Inverter-Based Microgrids

Science.gov (United States)

Kabalan, Mahmoud

study. This will enable future studies to save computational effort and produce the most accurate results according to the needs of the study being performed. Moreover, the effect of grid (line) impedance on the accuracy of droop control is explored using the 5th order model. Simulation results show that traditional droop control is valid up to R/X line impedance value of 2. Furthermore, the 3rd order nonlinear model improves the currently available inverter-infinite bus models by accounting for grid impedance, active power-frequency droop and reactive power-voltage droop. Results show the 3rd order model's ability to account for voltage and reactive power changes during a transient event. Finally, the large-signal Lyapunov-based stability analysis is completed for a 3 bus microgrid system (made up of 2 inverters and 1 linear load). The thesis provides a systematic state space large-signal nonlinear mathematical modeling method of inverter-based microgrids. The inverters include the dc-side dynamics associated with dc sources. The mathematical model is then used to estimate the domain of asymptotic stability of the 3 bus microgrid. The three bus microgrid system was used as a case study to highlight the design and optimization capability of a large-signal-based approach. The study explores the effect of system component sizing, load transient and generation variations on the asymptotic stability of the microgrid. Essentially, this advancement gives microgrid designers and engineers the ability to manipulate the domain of asymptotic stability depending on performance requirements. Especially important, this research was able to couple the domain of asymptotic stability of the ac microgrid with that of the dc side voltage source. Time domain simulations were used to demonstrate the mathematical nonlinear analysis results.

Rf Discharge Impedance Measurements Using a New Method to Determine the Stray Impedances

NARCIS (Netherlands)

Bakker, L.P.; Kroesen, G.M.W.; Hoog, de F.J.

1999-01-01

The impedance of a capacitively coupled radio frequency discharge in a tubular fluorescent lamp filled with neon and mercury is measured. The stray impedances in the electrical network are determined using a new method that requires no extra instruments. The reflection of power is used to determine

Deletion of the AcMNPV core gene ac109 results in budded virions that are non-infectious

International Nuclear Information System (INIS)

Fang Minggang; Nie, Yingchao; Theilmann, David A.

2009-01-01

Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac109 is a core gene and its function in the virus life cycle is unknown. To determine its role in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac109 deletion virus (vAc 109KO ). Fluorescence and light microscopy showed that transfection of vAc 109KO results in a single-cell infection phenotype. Viral DNA replication is unaffected and the development of occlusion bodies in vAc 109KO -transfected cells evidenced progression to the very late phases of viral infection. Western blot and confocal immunofluorescence analysis showed that AC109 is expressed in the cytoplasm and nucleus throughout infection. In addition, AC109 is a structural protein as it was detected in both budded virus (BV) and occlusion derived virus in both the envelope and nucleocapsid fractions. Titration assays by qPCR and TCID 50 showed that vAc 109KO produced BV but the virions are non-infectious. The vAc 109KO BV were indistinguishable from the BV of repaired and wild type control viruses as determined by negative staining and electron microscopy.

Development of a hardware-based AC microgrid for AC stability assessment

Science.gov (United States)

Swanson, Robert R.

As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

Impedance of a nanoantenna

International Nuclear Information System (INIS)

Greffet, Jean-Jacques; Laroche, Marine; Marquier, Francois

2009-01-01

We introduce a generalized definition of the impedance of a nanoantenna that can be applied to any system. We also introduce a definition of the impedance of a two level system. Using this framework, we establish a link between the electrical engineering and the quantum optics picture of light emission.

Irradiaiton facilities for testing solid and liquid blanket breeder materials with in-situ tritium release measurements in the HFR Petten

International Nuclear Information System (INIS)

Conrad, R.; Debarberis, L.

1991-01-01

Lithium-based tritium breeder materials for solid and liquid fusion reactor blanket concepts are being tested in the High Flux Reactor (HFR) Petten with in-situ tritium release measurements since 1985, within the European Fusion Technology Programme and the BEATRIX-I programme. Ceramic breeder materials are being tested in the EXOTIC and COMPLIMENT experimental programmes and the liquid breeder material, Pb-17Li, is being tested in the LIBRETTO experimental programme. The in-pile experiments are performed with irradiation facilities developed by the Joint Research Centre (JRC) Petten. The irradiation vehicles are multi-channel rigs. The sample holders consist of independent, fully instrumented and triple contained capsules. The out-of-pile experimental equipment consist of twelve independent circuits for on-line tritium release and tritium permeation measurements and eight independent circuits for temperature control. The experimental achievements obtained so far contribute to the selection of candidate tritium breeder materials for blanket concepts of near future machines like NET, ITER and DEMO. (orig.)

Structural, dielectric and impedance properties of Ca(Fe2/3W1/3)O3 nanoceramics

International Nuclear Information System (INIS)

Choudhary, R.N.P.; Pradhan, Dillip K.; Tirado, C.M.; Bonilla, G.E.; Katiyar, R.S.

2007-01-01

The polycrystalline nanoceramics (∼60 nm) of Ca(Fe 2/3 W 1/3 )O 3 (CFW) were synthesized by mechanochemical and solid-state reaction techniques. Preliminary X-ray structural analysis of CFW suggested the formation of single-phase compound in tetragonal crystal system (distorted structure of ideal perovskite). The large distortion (∼16%) is supported by a large deviation of tolerance factor t=0.86 from unity (for ideal perovskite). The SEM micrograph shows the polycrystalline nature of the sample with different grain sizes, which are inhomogeneously distributed through the sample surface. Detailed studies of dielectric and impedance properties of the material in a wide range of frequency (1 kHz-1 MHz) and temperatures (300-630 K) show that these properties are strongly temperature and frequency dependent. The nature of variation of AC conductivity exhibits a progressive increase in AC conductivity on increasing temperature. The oxygen vacancies, space charge and mobile charge carriers play an important role in relaxation and conduction process. The relaxation process in the material was found to be of non-Debye type

Combined multichannel intraluminal impedance and pH monitoring is helpful in managing children with suspected gastro-oesophageal reflux disease.

Science.gov (United States)

Rossi, Paolo; Isoldi, Sara; Mallardo, Saverio; Papoff, Paola; Rossetti, Danilo; Dilillo, Anna; Oliva, Salvatore

2018-04-05

Gastro-oesophageal reflux is very common in the paediatric age group. There is no single and reliable test to distinguish between physiologic and pathological gastro-oesophageal reflux, and this lack of clear distinction between disease and normal can have a negative impact on the management of children. To evaluate the usefulness of 24-h oesophageal pH-impedance study in infants and children with suspected gastro-oesophageal reflux disease. Patients were classified by age groups (A-C) and reflux-related symptoms (typical and atypical). All underwent pH-impedance study. If the latter suggested an abnormal reflux, patients received therapy in accordance with NASPGHAN/ESPGHAN recommendations, while those with normal study had an additional diagnostic work-up. The efficacy of therapy was evaluated with a specific standardized questionnaire for different ages. The study was abnormal in 203/428 patients (47%) while normal in 225/428 (53%). Of those with abnormal study, 109 exhibited typical symptoms (54%), and 94 atypical (46%). The great majority of the patients with abnormal study were responsive to medical anti-reflux therapy. We confirm the utility of prolonged oesophageal pH-impedance study in detecting gastro-oesophageal reflux disease in children and in guiding therapy. Performing oesophageal pH-impedance monitoring in children with suspected gastro-oesophageal reflux disease is helpful to establish the diagnosis and avoid unnecessary therapy. Copyright © 2018 Editrice Gastroenterologica Italiana S.r.l. Published by Elsevier Ltd. All rights reserved.

Dielectric and impedance study of praseodymium substituted Mg-based spinel ferrites

Energy Technology Data Exchange (ETDEWEB)

Farid, Hafiz Muhammad Tahir, E-mail: tahirfaridbzu@gmail.com [Department of Physics, Bahauddin Zakariya, University Multan, 60800 (Pakistan); Ahmad, Ishtiaq; Ali, Irshad [Department of Physics, Bahauddin Zakariya, University Multan, 60800 (Pakistan); Ramay, Shahid M. [College of Science, Physics and Astronomy Department, King Saud University, P.O. Box 2455, 11451 Riyadh (Saudi Arabia); Mahmood, Asif [Chemical Engineering Department, College of Engineering, King Saud University, Riyadh (Saudi Arabia); Murtaza, G. [Centre for Advanced Studies in Physics, GC University, Lahore 5400 (Pakistan)

2017-07-15

Highlights: • Magnesium based spinel ferrites were successfully synthesized by sol-gel method. • Dielectric constant shows the normal spinel ferrites behavior. • The dc conductivity are found to decrease with increasing temperature. • The samples with low conductivity have high values of activation energy. • The Impedance decreases with increasing frequency of applied field. - Abstract: Spinel ferrites with nominal composition MgPr{sub y}Fe{sub 2−y}O{sub 4} (y = 0.00, 0.025, 0.05, 0.075, 0.10) were prepared by sol-gel method. Temperature dependent DC electrical conductivity and drift mobility were found in good agreement with each other, reflecting semiconducting behavior. The dielectric properties of all the samples as a function of frequency (1 MHz–3 GHz) were measured at room temperature. The dielectric constant and complex dielectric constant of these samples decreased with the increase of praseodymium concentration. In the present spinel ferrite, Cole–Cole plots were used to separate the grain and grain boundary’s effects. The substitution of praseodymium ions in Mg-based spinel ferrites leads to a remarkable rise of grain boundary’s resistance as compared to the grain’s resistance. As both AC conductivity and Cole–Cole plots are the functions of concentration, they reveal the dominant contribution of grain boundaries in the conduction mechanism. AC activation energy was lower than dc activation energy. Temperature dependence normalized AC susceptibility of spinel ferrites reveals that MgFe{sub 2}O{sub 4} exhibits multi domain (MD) structure with high Curie temperature while on substitution of praseodymium, MD to SD transitions occurs. The low values of conductivity and low dielectric loss make these materials best candidate for high frequency application.

Surface impedance tensor in amorphous wires with helical anisotropy: Magnetic hysteresis and asymmetry

International Nuclear Information System (INIS)

Makhnovskiy, D. P.; Panina, L. V.; Mapps, D. J.

2001-01-01

This article concerns the investigation of the magnetic behavior of the surface impedance tensor cflx var-sigma in CoSiB amorphous wires having a residual torsion stress and a helical anisotropy. The full tensor cflx var-sigma involving three different components is found by measuring the S 21 parameter at a required excitation with a Hewlett-Packard network/spectrum analyzer at MHz frequencies. In general, the impedance plots versus axial magnetic field H ex exhibit a hysteresis related to that for the case of static magnetization. The diagonal components of cflx var-sigma (longitudinal var-sigma zz and circular var-sigma v ar-phi v ar-phi) show a sharp peak in a narrow field interval where the domain walls form and contribute to the ac magnetization dynamics. This peak is not seen for the off-diagonal component var-sigma zv ar-phi (var-sigma v ar-phi z ) since the existence of the domain structure suppresses it. Applying a dc bias current results in a gradual transition to a nonhysteretic asymmetrical behavior with an enhanced sensitivity. The portions of the experimental plots associated with the rotational dynamic process are in qualitative agreement with the theory based on a single-domain model. [copyright] 2001 American Institute of Physics

Cascaded impedance networks for NPC inverter

DEFF Research Database (Denmark)

Li, Ding; Gao, Feng; Loh, Poh Chiang

2010-01-01

they are subject to the renewable sources. To date, three distinct types of impedance networks can be summarized for implementing a hybrid source impedance network, which can in principle be combined and cascaded before connected to a NPC inverter by proposed two ways. The resulting cascaded impedance network NPC...

Impedance of finite length resistive cylinder

Directory of Open Access Journals (Sweden)

S. Krinsky

2004-11-01

Full Text Available We determine the impedance of a cylindrical metal tube (resistor of radius a, length g, and conductivity σ attached at each end to perfect conductors of semi-infinite length. Our main interest is in the asymptotic behavior of the impedance at high frequency (k≫1/a. In the equilibrium regime, ka^{2}≪g, the impedance per unit length is accurately described by the well-known result for an infinite length tube with conductivity σ. In the transient regime, ka^{2}≫g, where the contribution of transition radiation arising from the discontinuity in conductivity is important, we derive an analytic expression for the impedance and compute the short-range wakefield. The analytic results are shown to agree with numerical evaluation of the impedance.

Factors related to outcome in heart failure with a preserved (or normal) left ventricular ejection fraction.

Science.gov (United States)

Sanderson, John E

2016-07-01

Heart failure with a preserved ejection faction (HFpEF) is a growing and expensive cause of heart failure (HF) affecting particularly the elderly. It differs in substantial ways in addition to the normal left ventricular ejection fraction, from the more easily recognized form of heart failure with a reduced ejection fraction (HFrEF or 'systolic heart failure') and unlike HFrEF there have been little advances in treatment. In part, this relates to the complexity of the pathophysiology and identifying the correct targets. In HFpEF, there appears to be widespread stiffening of the vasculature and the myocardium affecting ventricular function (both systolic and diastolic), impeding ventricular suction, and thus early diastolic filling leading to breathlessness on exertion and later atrial failure and fibrillation. Left ventricular ejection fraction tends to gradually decline and some evolve into HFrEF. Most patients also have a mixture of several co-morbidities including hypertension, diabetes, obesity, poor renal function, lack of fitness, and often poor social conditions. Therefore, many factors may influence outcome in an individual patient. In this review, the epidemiology, possible causation, pathophysiology, the influence of co-morbidities and some of the many potential predictors of outcome will be considered.

Tracking of electrochemical impedance of batteries

Science.gov (United States)

Piret, H.; Granjon, P.; Guillet, N.; Cattin, V.

2016-04-01

This paper presents an evolutionary battery impedance estimation method, which can be easily embedded in vehicles or nomad devices. The proposed method not only allows an accurate frequency impedance estimation, but also a tracking of its temporal evolution contrary to classical electrochemical impedance spectroscopy methods. Taking into account constraints of cost and complexity, we propose to use the existing electronics of current control to perform a frequency evolutionary estimation of the electrochemical impedance. The developed method uses a simple wideband input signal, and relies on a recursive local average of Fourier transforms. The averaging is controlled by a single parameter, managing a trade-off between tracking and estimation performance. This normalized parameter allows to correctly adapt the behavior of the proposed estimator to the variations of the impedance. The advantage of the proposed method is twofold: the method is easy to embed into a simple electronic circuit, and the battery impedance estimator is evolutionary. The ability of the method to monitor the impedance over time is demonstrated on a simulator, and on a real Lithium ion battery, on which a repeatability study is carried out. The experiments reveal good tracking results, and estimation performance as accurate as the usual laboratory approaches.

RHIC injection kicker impedance

International Nuclear Information System (INIS)

Mane, V.; Peggs, S.; Trbojevic, D.; Zhang, W.

1995-01-01

The longitudinal impedance of the RHIC injection kicker is measured using the wire method up to a frequency of 3 GHz. The mismatch between the 50 ohm cable and the wire and pipe system is calibrated using the TRL calibration algorithm. Various methods of reducing the impedance, such as coated ceramic pipe and copper strips are investigated

Estimating BrAC from transdermal alcohol concentration data using the BrAC estimator software program.

Science.gov (United States)

Luczak, Susan E; Rosen, I Gary

2014-08-01

Transdermal alcohol sensor (TAS) devices have the potential to allow researchers and clinicians to unobtrusively collect naturalistic drinking data for weeks at a time, but the transdermal alcohol concentration (TAC) data these devices produce do not consistently correspond with breath alcohol concentration (BrAC) data. We present and test the BrAC Estimator software, a program designed to produce individualized estimates of BrAC from TAC data by fitting mathematical models to a specific person wearing a specific TAS device. Two TAS devices were worn simultaneously by 1 participant for 18 days. The trial began with a laboratory alcohol session to calibrate the model and was followed by a field trial with 10 drinking episodes. Model parameter estimates and fit indices were compared across drinking episodes to examine the calibration phase of the software. Software-generated estimates of peak BrAC, time of peak BrAC, and area under the BrAC curve were compared with breath analyzer data to examine the estimation phase of the software. In this single-subject design with breath analyzer peak BrAC scores ranging from 0.013 to 0.057, the software created consistent models for the 2 TAS devices, despite differences in raw TAC data, and was able to compensate for the attenuation of peak BrAC and latency of the time of peak BrAC that are typically observed in TAC data. This software program represents an important initial step for making it possible for non mathematician researchers and clinicians to obtain estimates of BrAC from TAC data in naturalistic drinking environments. Future research with more participants and greater variation in alcohol consumption levels and patterns, as well as examination of gain scheduling calibration procedures and nonlinear models of diffusion, will help to determine how precise these software models can become. Copyright © 2014 by the Research Society on Alcoholism.

Impedance studies of a green blend polymer electrolyte based on PVA and Aloe-vera

Science.gov (United States)

Selvalakshmi, S.; Mathavan, T.; Vijaya, N.; Selvasekarapandian, Premalatha, M.; Monisha, S.

2016-05-01

The development of polymer electrolyte materials for energy generating and energy storage devices is a challenge today. A new type of blended green electrolyte based on Poly-vinyl alcohol (PVA) and Aloe-vera has been prepared by solution casting technique. The blending of polymers may lead to the increase in stability due to one polymer portraying itself as a mechanical stiffener and the other as a gelled matrix supported by the other. The prepared blend electrolytes were subjected to Ac impedance studies. It has been found out that the polymer film in which 1 gm of PVA was dissolved in 40 ml of Aloe-vera extract exhibits highest conductivity and its value is 3.08 × 10-4 S cm-1.

Detection of high-impedance fault in low-voltage DC distribution system via mathematical morphology

Directory of Open Access Journals (Sweden)

Yun-Sik Oh

2016-01-01

Full Text Available This study presents a method for high-impedance fault (HIF detection in a low-voltage DC (LVDC distribution system via mathematical morphology (MM, which is composed of two elementary transformations, namely, dilation and erosion. Various MM-based filters are used to detect abnormal signals of current waveform. The LVDC distribution system, including power conversion devices, such as AC/DC and DC/DC converters, is modelled with electromagnetic transient program (EMTP software to verify the proposed method. The HIF arc model in the DC system is also implemented with EMTP/MODELS, which is a symbolic language interpreter for EMTP. Simulation results show that the proposed method can be applied to detect HIF effectively in the LVDC distribution system.

Concentric artificial impedance surface for directional sound beamforming

Directory of Open Access Journals (Sweden)

Kyungjun Song

2017-03-01

Full Text Available Utilizing acoustic metasurfaces consisting of subwavelength resonant textures, we design an artificial impedance surface by creating a new boundary condition. We demonstrate a circular artificial impedance surface with surface impedance modulation for directional sound beamforming in three-dimensional space. This artificial impedance surface is implemented by revolving two-dimensional Helmholtz resonators with varying internal coiled path. Physically, the textured surface has inductive surface impedance on its inner circular patterns and capacitive surface impedance on its outer circular patterns. Directional receive beamforming can be achieved using an omnidirectional microphone located at the focal point formed by the gradient-impeding surface. In addition, the uniaxial surface impedance patterning inside the circular aperture can be used for steering the direction of the main lobe of the radiation pattern.

Tapping mode microwave impedance microscopy

KAUST Repository

Lai, K.; Kundhikanjana, W.; Peng, H.; Cui, Y.; Kelly, M. A.; Shen, Z. X.

2009-01-01

We report tapping mode microwave impedance imaging based on atomic force microscope platforms. The shielded cantilever probe is critical to localize the tip-sample interaction near the tip apex. The modulated tip-sample impedance can be accurately

Voltammetric and impedance behaviours of surface-treated nano-crystalline diamond film electrodes

International Nuclear Information System (INIS)

Liu, F. B.; Jing, B.; Cui, Y.; Di, J. J.; Qu, M.

2015-01-01

The electrochemical performances of hydrogen- and oxygen-terminated nano-crystalline diamond film electrodes were investigated by cyclic voltammetry and AC impedance spectroscopy. In addition, the surface morphologies, phase structures, and chemical states of the two diamond films were analysed by scanning probe microscopy, Raman spectroscopy, and X-ray photoelectron spectroscopy, respectively. The results indicated that the potential window is narrower for the hydrogen-terminated nano-crystalline diamond film than for the oxygen-terminated one. The diamond film resistance and capacitance of oxygen-terminated diamond film are much larger than those of the hydrogen-terminated diamond film, and the polarization resistances and double-layer capacitance corresponding to oxygen-terminated diamond film are both one order of magnitude larger than those corresponding to the hydrogen-terminated diamond film. The electrochemical behaviours of the two diamond film electrodes are discussed

Novel effect of spin dynamics with suppression of charge and orbital ordering in Nd{sub 0.5}Ca{sub 0.5}MnO{sub 3} under the influence of ac electric field

Energy Technology Data Exchange (ETDEWEB)

Sarwar, T., E-mail: sarwartuba@gmail.com [EMMG, Physics Division, PINSTECH, P.O. Nilore, Islamabad (Pakistan); Qamar, A., E-mail: afzaal.qamar@griffithuni.edu.au [Queensland Micro-Nanotechnology Centre, Griffith University, Nathan, QLD 4111 (Australia); Nadeem, M. [EMMG, Physics Division, PINSTECH, P.O. Nilore, Islamabad (Pakistan)

2017-07-15

Highlights: • Electronic & magnetic behavior of Nd{sub 0.5}Ca{sub 0.5}MnO{sub 3} is explored using impedance spectroscopy. • Under ac field, possible signature of suppression of robust CO/OO antiferromagnetism is studied. • We propose the existence of spin glass state at low temperature. • A novel tactic is used to estimate the existence of weak ferromagnetism at high temperature. - Abstract: Dynamics of spin ordering in the manganite Nd{sub 0.5}Ca{sub 0.5}MnO{sub 3} have been investigated in this paper. It was observed that the complex mixed magnetic ordering in pellets is comprised of antiferromagnetic ordering at 160 K (T{sub N}) and complete charge ordering at 250 K (T{sub CO}). Under ac field, appearance of unstable ferromagnetic correlations is observed above T{sub CO}, which is badly frustrated due to strong spin disorder induced by Jahn Teller distortions. Impedance measurements reveal the spin glass like scenario, suppressing the strong antiferromagnetic and charge ordering states below T{sub N}.

Magneto-Impedance behavior of Co-Fe-Nb-Si-B-based ribbons

Energy Technology Data Exchange (ETDEWEB)

Sarkar, Partha; Mohanta, O.; Pal, S.K.; Panda, A.K. [National Metallurgical Laboratory, Council of Scientific and Industrial Research, Jamshedpur 831007 (India); Mitra, A., E-mail: amitra@nmlindia.or [National Metallurgical Laboratory, Council of Scientific and Industrial Research, Jamshedpur 831007 (India)

2010-04-15

The giant magneto-impedance of melt spun Co{sub x}Fe{sub 72-x}Nb{sub 4}Si{sub 4}B{sub 20}(x=10, 20, 36, 50) amorphous and nanostructured ribbons have been investigated. Alloys have been optimized at the driving current amplitude, frequency and found that amorphous ribbon of nominal composition of Co{sub 36}Fe{sub 36}Nb{sub 4}Si{sub 4}B{sub 20} shown maximum GMI ratio of 13%. The behaviour of the driving current amplitude on the GMI behaviour was studied and the sample was optimized for driving current amplitude, I{sub ac}=10 mA. The frequency dependence of the GMI behaviour was studied for the ribbon sample Co{sub 36}Fe{sub 36}Nb{sub 4}Si{sub 4}B{sub 20} at frequency in the range of 100 kHz-1.2 MHz of the optimized driving current amplitude and it was found that the sample showed the maximum GMI behaviour at f=700 kHz. The optimized samples were Joule heated at the current density J=0-35 A/m{sup 2} for a period of 1 min. The GMI ratio initially increased then progressively deteriorated with J, but after a certain range it shows up to 16% of improvement in the magneto-impedance value due the increase of nanocrystalline volume fraction. The asymmetry in the GMI profile was observed for the sample Joule heated at J=1-5 A/m{sup 2} for 1 min.

Electrical impedance spectroscopy (EIS)-based evaluation of biological tissue phantoms to study multifrequency electrical impedance tomography (Mf-EIT) systems

KAUST Repository

Bera, Tushar Kanti

2016-03-18

Abstract: Electrical impedance tomography (EIT) phantoms are essential for the calibration, comparison and evaluation of the EIT systems. In EIT, the practical phantoms are typically developed based on inhomogeneities surrounded by a homogeneous background to simulate a suitable conductivity contrast. In multifrequency EIT (Mf-EIT) evaluation, the phantoms must be developed with the materials which have recognizable or distinguishable impedance variations over a wide range of frequencies. In this direction the impedance responses of the saline solution (background) and a number vegetable and fruit tissues (inhomogeneities) are studied with electrical impedance spectroscopy (EIS) and the frequency responses of bioelectrical impedance and conductivity are analyzed. A number of practical phantoms with different tissue inhomogeneities and different inhomogeneity configurations are developed and the multifrequency impedance imaging is studied with the Mf-EIT system to evaluate the phantoms. The conductivity of the vegetable inhomogeneities reconstructed from the EIT imaging is compared with the conductivity values obtained from the EIS studies. Experimental results obtained from multifrequency EIT reconstruction demonstrate that the electrical impedance of all the biological tissues inhomogenity decreases with frequency. The potato tissue phantom produces better impedance image in high frequency ranges compared to the cucumber phantom, because the cucumber impedance at high frequency becomes lesser than that of the potato at the same frequency range. Graphical Abstract: [Figure not available: see fulltext.] © 2016 The Visualization Society of Japan

A Study on evaluation of pitting characteristics of radioactive container materials and development of the program used for analyzing impedance spectrum

Energy Technology Data Exchange (ETDEWEB)

Pyun, Su Il; Moon, S. M.; Orr, S. J.; Kim, D. J.; Lee, W. J.; Jeong, I. J.; Shin, H. C.; Han, J. N.; Lee, M. H.; Lee, S. B. [Korea Advanced Institute of Science and Technology, Taejon (Korea, Republic of)

1998-01-01

Pitting corrosion of sensitized 316L stainless steel has been investigated as a function of the degree of sensitization in aqueous NaCl solution with various Cl{sup -} ion concentrations ([Cl{sup -}] = 0.005 (177.25 ppm); 0.01 (354.50 ppm); 0.05 (1772.5 ppm); 0.1 (3545 ppm); 0.5 M (17725 ppm)) at room temperature. The squared rod specimens of 316L stainless steel were thermally annealed at 700 C for various durations (0 h : non-sensitized specimen A; 8 h : moderately sensitized specimen B; 96 h : severely sensitized specimen C). The pitting corrosion resistance of the three kinds of specimens was evaluated by the potentio dynamic anodic polarization method, abrading electrode technique and ac{sup -}impedance spectroscopy. The measured potentiostatic decay current transient obtained just after interrupting the abrading action showed that the repassivation rate of the oxide film on the fresh bare surface of the specimen decreased in the order of specimens A, B and C in the early stage of the film formation. From the results of ac{sup -}impedance spectroscopy, the oxide film resistance R{sub ox} and oxide film capacitance C{sub ox} of specimens B and C in value were evaluated to be lower and higher, respectively, than those of specimen A and the repassivation rate and resistance value of the oxide film on the three kinds could be quantitatively calculated. 10 refs., 8 tabs., 31 figs.(author)

RHIC spin flipper AC dipole controller

Energy Technology Data Exchange (ETDEWEB)

Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.

2011-03-28

The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.

Fractional Order Element Based Impedance Matching

KAUST Repository

Radwan, Ahmed Gomaa

2014-06-24

Disclosed are various embodiments of methods and systems related to fractional order element based impedance matching. In one embodiment, a method includes aligning a traditional Smith chart (|.alpha.|=1) with a fractional order Smith chart (|.alpha.|.noteq.1). A load impedance is located on the traditional Smith chart and projected onto the fractional order Smith chart. A fractional order matching element is determined by transitioning along a matching circle of the fractional order Smith chart based at least in part upon characteristic line impedance. In another embodiment, a system includes a fractional order impedance matching application executed in a computing device. The fractional order impedance matching application includes logic that obtains a first set of Smith chart coordinates at a first order, determines a second set of Smith chart coordinates at a second order, and determines a fractional order matching element from the second set of Smith chart coordinates.

Electrical impedance spectroscopy (EIS)-based evaluation of biological tissue phantoms to study multifrequency electrical impedance tomography (Mf-EIT) systems

KAUST Repository

Bera, Tushar Kanti; Nagaraju, J.; Lubineau, Gilles

2016-01-01

. In this direction the impedance responses of the saline solution (background) and a number vegetable and fruit tissues (inhomogeneities) are studied with electrical impedance spectroscopy (EIS) and the frequency responses of bioelectrical impedance and conductivity

Intraesophageal impedance monitoring: clinical studies

NARCIS (Netherlands)

Conchillo Armendáriz, J.M.

2007-01-01

Electrical impedance (Z) between two electrodes is the ratio between applied voltage (U) and resulting current (I). In electrical impedance monitoring the resistance to electrical flow in an alternating current circuit is measured. Multichannel esophageal monitoring can be measured by using an

Plasma antennas driven by 5–20 kHz AC power supply

Energy Technology Data Exchange (ETDEWEB)

Zhao, Jiansen, E-mail: 67093058@qq.com; Chen, Yuli; Sun, Yang; Wu, Huafeng; Liu, Yue; Yuan, Qiumeng [Merchant Marine College, Shanghai Maritime University, Shanghai, 201306 (China)

2015-12-15

The experiments described in this work were performed with the aim of introducing a new plasma antenna that was excited by a 5–20 kHz alternating current (AC) power supply, where the antenna was transformed into a U-shape. The results show that the impedance, voltage standing-wave ratio (VSWR), radiation pattern and gain characteristics of the antenna can be controlled rapidly by varying not only the discharge power, but also by varying the discharge frequency in the range from 5 to 20 kHz. When the discharge frequency is adjusted from 10 to 12 kHz, the gain is higher within a relatively broad frequency band and the switch-on time is less than 1 ms when the discharge power is less than 5 W, meaning that the plasma antenna can be turned on and off rapidly.

Estimating the short-circuit impedance

DEFF Research Database (Denmark)

Nielsen, Arne Hejde; Pedersen, Knud Ole Helgesen; Poulsen, Niels Kjølstad

1997-01-01

A method for establishing a complex value of the short-circuit impedance from naturally occurring variations in voltage and current is discussed. It is the symmetrical three phase impedance at the fundamental grid frequency there is looked for. The positive sequence components in voltage...... and current are derived each period, and the short-circuit impedance is estimated from variations in these components created by load changes in the grid. Due to the noisy and dynamic grid with high harmonic distortion it is necessary to threat the calculated values statistical. This is done recursively...... through a RLS-algorithm. The algorithms have been tested and implemented on a PC at a 132 kV substation supplying a rolling mill. Knowing the short-circuit impedance gives the rolling mill an opportunity to adjust the arc furnace operation to keep flicker below a certain level. Therefore, the PC performs...

Journal bearing impedance descriptions for rotordynamic applications

NARCIS (Netherlands)

Childs, D.W.; Moes, H.; Leeuwen, van H.J.

1977-01-01

Bearing impedance vectors are introduced for plain journal bearings which define the bearing reaction force components as a function of the bearing motion. Impedance descriptions are developed directly for the approximate Ocvirk (short) and Sommerfeld (long) bearing solutions. The impedance vector

Impedance of porous IT-SOFC LSCF:CGO composite cathodes

DEFF Research Database (Denmark)

Nielsen, Jimmi; Jacobsen, Torben; Wandel, Marie

2011-01-01

The impedance of technological relevant LSCF:CGO composite IT-SOFC cathodes was studied over a very wide performance range. This was experimentally achieved by impedance measurements on symmetrical cells with three different microstructures in the temperature range 550–850 °C. In order to account...... for the impedance spectra of the poor performing cathodes the Finite-Length-Gerischer (FLG) impedance was derived and applied to the impedance data. The FLG impedance describes for a given microstructure the situation where the cathode is made too thin from a cathode development point of view. The moderate...... performing cathodes showed a slightly suppressed Gerischer impedance, while the impedance spectra of the well performing cathodes showed the presence of an arc due to oxygen gas diffusion. The overall impedance of the well performing cathodes could be described with a slightly suppressed Gerischer impedance...

Oxygen surface exchange kinetics measurement by simultaneous optical transmission relaxation and impedance spectroscopy: Sr(Ti,Fe)O3-x thin film case study.

Science.gov (United States)

Perry, Nicola H; Kim, Jae Jin; Tuller, Harry L

2018-01-01

We compare approaches to measure oxygen surface exchange kinetics, by simultaneous optical transmission relaxation (OTR) and AC-impedance spectroscopy (AC-IS), on the same mixed conducting SrTi 0.65 Fe 0.35 O 3-x film. Surface exchange coefficients were evaluated as a function of oxygen activity in the film, controlled by gas partial pressure and/or DC bias applied across the ionically conducting yttria-stabilized zirconia substrate. Changes in measured light transmission through the film over time (relaxations) resulted from optical absorption changes in the film corresponding to changes in its oxygen and oxidized Fe (~Fe 4+ ) concentrations; such relaxation profiles were successfully described by the equation for surface exchange-limited kinetics appropriate for the film geometry. The k chem values obtained by OTR were significantly lower than the AC-IS derived k chem values and k q values multiplied by the thermodynamic factor (bulk or thin film), suggesting a possible enhancement in k by the metal current collectors (Pt, Au). Long-term degradation in k chem and k q values obtained by AC-IS was also attributed to deterioration of the porous Pt current collector, while no significant degradation was observed in the optically derived k chem values. The results suggest that, while the current collector might influence measurements by AC-IS, the OTR method offers a continuous, in situ , and contact-free method to measure oxygen exchange kinetics at the native surfaces of thin films.

Oxygen surface exchange kinetics measurement by simultaneous optical transmission relaxation and impedance spectroscopy: Sr(Ti,Fe)O3-x thin film case study

Science.gov (United States)

Perry, Nicola H.; Kim, Jae Jin; Tuller, Harry L.

2018-01-01

Abstract We compare approaches to measure oxygen surface exchange kinetics, by simultaneous optical transmission relaxation (OTR) and AC-impedance spectroscopy (AC-IS), on the same mixed conducting SrTi0.65Fe0.35O3-x film. Surface exchange coefficients were evaluated as a function of oxygen activity in the film, controlled by gas partial pressure and/or DC bias applied across the ionically conducting yttria-stabilized zirconia substrate. Changes in measured light transmission through the film over time (relaxations) resulted from optical absorption changes in the film corresponding to changes in its oxygen and oxidized Fe (~Fe4+) concentrations; such relaxation profiles were successfully described by the equation for surface exchange-limited kinetics appropriate for the film geometry. The kchem values obtained by OTR were significantly lower than the AC-IS derived kchem values and kq values multiplied by the thermodynamic factor (bulk or thin film), suggesting a possible enhancement in k by the metal current collectors (Pt, Au). Long-term degradation in kchem and kq values obtained by AC-IS was also attributed to deterioration of the porous Pt current collector, while no significant degradation was observed in the optically derived kchem values. The results suggest that, while the current collector might influence measurements by AC-IS, the OTR method offers a continuous, in situ, and contact-free method to measure oxygen exchange kinetics at the native surfaces of thin films. PMID:29511391

Impedance analysis of acupuncture points and pathways

International Nuclear Information System (INIS)

Teplan, Michal; Kukucka, Marek; Ondrejkovicová, Alena

2011-01-01

Investigation of impedance characteristics of acupuncture points from acoustic to radio frequency range is addressed. Discernment and localization of acupuncture points in initial single subject study was unsuccessfully attempted by impedance map technique. Vector impedance analyses determined possible resonant zones in MHz region.

Modeling and Grid impedance Variation Analysis of Parallel Connected Grid Connected Inverter based on Impedance Based Harmonic Analysis

DEFF Research Database (Denmark)

Kwon, JunBum; Wang, Xiongfei; Bak, Claus Leth

2014-01-01

This paper addresses the harmonic compensation error problem existing with parallel connected inverter in the same grid interface conditions by means of impedance-based analysis and modeling. Unlike the single grid connected inverter, it is found that multiple parallel connected inverters and grid...... impedance can make influence to each other if they each have a harmonic compensation function. The analysis method proposed in this paper is based on the relationship between the overall output impedance and input impedance of parallel connected inverter, where controller gain design method, which can...

The LEP impedance model

Energy Technology Data Exchange (ETDEWEB)

Zotter, B [European Organization for Nuclear Research, Geneva (Switzerland)

1996-08-01

This report describes a number of measurements and computations of the impedance of the Large Electron Positron collider LEP at CERN. The work has been performed over several years, together with D. Brandt, K. Cornelis, A. Hofmann, G. Sabbi and many others. The agreement between measurements of single bunch instabilities on the machine and computer simulations is in general excellent and gives confidence in the impedance model used. (author)

The AC photovoltaic module is here!

Science.gov (United States)

Strong, Steven J.; Wohlgemuth, John H.; Wills, Robert H.

1997-02-01

This paper describes the design, development, and performance results of a large-area photovoltaic module whose electrical output is ac power suitable for direct connection to the utility grid. The large-area ac PV module features a dedicated, integrally mounted, high-efficiency dc-to-ac power inverter with a nominal output of 250 watts (STC) at 120 Vac, 60 H, that is fully compatible with utility power. The module's output is connected directly to the building's conventional ac distribution system without need for any dc wiring, string combiners, dc ground-fault protection or additional power-conditioning equipment. With its advantages, the ac photovoltaic module promises to become a universal building block for use in all utility-interactive PV systems. This paper discusses AC Module design aspects and utility interface issues (including islanding).

Impedance analysis of the PEP-II vacuum chamber

International Nuclear Information System (INIS)

Ng, C.K.; Weiland, T.

1995-05-01

The PEP-II high energy ring (HER) vacuum chamber consists of a copper tube with periodically spaced pumping slots. The impedance of the vacuum chamber due to the slots is analyzed. Both narrow-band and broadband impedances are considered as well as longitudinal and transverse components thereof. It is found that although the broad-band impedance is tolerable, the narrow-band impedance may exceed the instability limit given by the natural damping with no feedback system on. Traveling wave modes in the chamber are the major source of this high value narrow-band impedance. We also study the dependences of the impedance on the slot length and the geometrical cross section

A compact broadband nonsynchronous noncommensurate impedance transformer

DEFF Research Database (Denmark)

Zhurbenko, Vitaliy; Kim, Kseniya; Narenda, Kumar

2012-01-01

Nonsynchronous noncommensurate impedance transformers consist of a combination of high‐ and low‐impedance transmission lines. High‐impedance lines have narrow tracks in strip and microstrip technology, which allows for high flexibility and miniaturization of the layout in comparison...... to the traditional tapered line transformers. This flexibility of the broadband nonsynchronous noncommensurate impedance transformers is experimentally demonstrated in this article allowing the length reduction by almost three times. © 2012 Wiley Periodicals, Inc. Microwave Opt Technol Lett 54:1832–1835, 2012; View...

Impedance of SOFC electrodes: A review and a comprehensive case study on the impedance of LSM:YSZ cathodes

DEFF Research Database (Denmark)

Nielsen, Jimmi; Hjelm, Johan

2014-01-01

It was shown through a comprehensive impedance spectroscopy study that the impedance of the classic composite LSM:YSZ (lanthanum strontium manganite and yttria stabilized zirconia) solid oxide fuel cell (SOFC) cathode can be described well with porous electrode theory. Furthermore, it was illustr......It was shown through a comprehensive impedance spectroscopy study that the impedance of the classic composite LSM:YSZ (lanthanum strontium manganite and yttria stabilized zirconia) solid oxide fuel cell (SOFC) cathode can be described well with porous electrode theory. Furthermore......, it was illustrated through a literature review on SOFC electrodes that porous electrode theory not only describes the classic LSM:YSZ SOFC cathode well, but SOFC electrodes in general. The extensive impedance spectroscopy study of LSM:YSZ cathodes consisted of measurements on cathodes with three different sintering...... temperatures and hence different microstructures and varying degrees of LSM/YSZ solid state interactions. LSM based composite cathodes, where YSZ was replaced with CGO was also studied in order to acquire further knowledge on the chemical compatibility between LSM and YSZ. All impedance measurements were...

Impedance models in time domain

NARCIS (Netherlands)

Rienstra, S.W.

2005-01-01

Necessary conditions for an impedance function are derived. Methods available in the literature are discussed. A format with recipe is proposed for an exact impedance condition in time domain on a time grid, based on the Helmholtz resonator model. An explicit solution is given of a pulse reflecting

Levitação acústica

OpenAIRE

Andrade, Marco Aurélio Brizzotti; Pérez, Nicolás; Adamowski, Julio Cezar

2015-01-01

A levitação acústica pode ser uma ferramenta valiosa para auxiliar estudantes de graduação a aprender conceitos básicos de física, tais como movimento harmônico simples, ondas acústicas estacionárias, e energia potencial. Neste artigo, apresentamos o princípio de funcionamento de um levitador acústico e explicamos como aplicar as equações básicas da acústica para determinar a força de radiação acústica que atua numa esfera em uma onda estacionária. Acoustic levitation can be a valuable too...

Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

DEFF Research Database (Denmark)

Ljusev, Petar; Andersen, Michael Andreas E.

2004-01-01

This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...

Introduction to AC machine design

CERN Document Server

Lipo, Thomas A

2018-01-01

AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...

VISUALIZATION OF BIOLOGICAL TISSUE IMPEDANCE PARAMETERS

Directory of Open Access Journals (Sweden)

V. I. Bankov

2016-01-01

Full Text Available Objective. Investigation the opportunity for measurement of biological tissue impedance to visualize its parameters.Materials and methods. Studies were undertook on the experimental facility, consists of registrating measuring cell, constructed from flat inductors system, formed in oscillatory circuit, herewith investigated biological tissue is the part of this oscillatory circuit. An excitation of oscillatory circuit fulfilled by means of exciter inductor which forms impulse complex modulated electromagnetic field (ICM EMF. The measurement process and visualizations provided by set of certificated instruments: a digital oscillograph AKTAKOM ADS-2221MV, a digital generator АКТАКОМ AWG-4150 (both with software and a gauge RLC E7-22. Comparative dynamic studies of fixed volume and weight pig’s blood, adipose tissue, muscular tissue impedance were conducted by contact versus contactless methods. Contactless method in contrast to contact method gives opportunity to obtain the real morphological visualization of biological tissue irrespective of their nature.Results. Comparison of contact and contactless methods of impedance measurement shows that the inductance to capacitance ratio X(L / X(C was equal: 17 – for muscular tissue, 4 – for blood, 1 – for adipose tissue. It demonstrates the technical correspondence of both impedance registration methods. If propose the base relevance of X (L and X (C parameters for biological tissue impedance so contactless measurement method for sure shows insulating properties of adipose tissue and high conductivity for blood and muscular tissue in fixed volume-weight parameters. Registration of biological tissue impedance complex parameters by contactless method with the help of induced ICM EMF in fixed volume of biological tissue uncovers the most important informative volumes to characterize morphofunctional condition of biological tissue namely X (L / X (C.Conclusion. Contactless method of biological

Mechanical Impedance Modeling of Human Arm: A survey

Science.gov (United States)

Puzi, A. Ahmad; Sidek, S. N.; Sado, F.

2017-03-01

Human arm mechanical impedance plays a vital role in describing motion ability of the upper limb. One of the impedance parameters is stiffness which is defined as the ratio of an applied force to the measured deformation of the muscle. The arm mechanical impedance modeling is useful in order to develop a better controller for system that interacts with human as such an automated robot-assisted platform for automated rehabilitation training. The aim of the survey is to summarize the existing mechanical impedance models of human upper limb so to justify the need to have an improved version of the arm model in order to facilitate the development of better controller of such systems with ever increase in complexity. In particular, the paper will address the following issue: Human motor control and motor learning, constant and variable impedance models, methods for measuring mechanical impedance and mechanical impedance modeling techniques.

Impedance of the PEP-II DIP screen

Energy Technology Data Exchange (ETDEWEB)

Ng, C -K [Stanford Linear Accelerator Center, Menlo Park, CA (United States); Weiland, T

1996-08-01

The vacuum chamber of a storage ring normally consists of periodically spaced pumping slots. The longitudinal impedance of slots are analyzed in this paper. It is found that although the broad-band impedance is tolerable, the narrow-band impedance, as a consequence of the periodicity of the slots, may exceed the stability limit given by natural damping with no feedback system on. Based on this analysis, the PEP-II distributed-ion-pump (DIP) screen uses long grooves with hidden holes cut halfway to reduce both the broad-band and narrow-band impedances. (author)

Impedance of the PEP-II DIP screen

International Nuclear Information System (INIS)

Ng, C.K.; Weiland, T.

1995-09-01

The vacuum chamber of a storage ring normally consists of periodically spaced pumping slots. The longitudinal impedance of slots are analyzed in this paper. It is found that although the broad-band impedance is tolerable, the narrow-band impedance, as a consequence of the periodicity of the slots, may exceed the stability limit given by natural damping with no feedback system on. Based on this analysis, the PEP-II distributed-ion-pump (DIP) screen uses long grooves with hidden holes cut halfway to reduce both the broad-band and narrow-band impedances

Dielectric relaxation and AC conductivity studies of Se90Cd10−xInx glassy alloys

Directory of Open Access Journals (Sweden)

Nitesh Shukla

2016-06-01

Full Text Available Chalcogenide glassy alloys of Se90Cd10−xInx (x = 2, 4, 6, 8 are synthesized by melt quench technique. The prepared glassy alloys have been characterized by techniques such as differential scanning calorimetry (DSC, scanning electron microscopy (SEM and energy dispersive X-ray (EDAX. Dielectric properties of Se90Cd10−xInx (x = 2, 4, 6, 8 chalcogenide glassy system have been studied using impedance spectroscopic technique in the frequency range 42 Hz to 5 MHz at room temperature. It is found that the dielectric constants ɛ′, dielectric loss factor ɛ″ and loss angle Tan δ depend on frequency. ɛ′, ɛ″ and loss angle Tan δ are found to be decreasing with the In content in Se90Cd10−xInx glassy system. AC conductivity of the prepared sample has also been studied. It is found that AC conductivity increases with frequency where as it has decreasing trend with increasing In content in Se–Cd matrix. The semicircles observed in the Cole–Cole plots indicate a single relaxation process.

Elimination of the Respiratory Effect on the Thoracic Impedance Signal with Whole-body Impedance Cardiography

Czech Academy of Sciences Publication Activity Database

Jurák, Pavel; Halámek, Josef; Vondra, Vlastimil; Viščor, Ivo; Lipoldová, J.; Plachý, M.

2010-01-01

Roč. 37, - (2010), s. 1051-1054 ISSN 0276-6574 R&D Projects: GA AV ČR IAA200650801 Institutional research plan: CEZ:AV0Z20650511 Keywords : respiratory effect * thoracic impedance signal * impedance cardiography Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering http://cinc.mit.edu/archives/2010/pdf/1051.pdf

Dielectric relaxation behavior and impedance studies of Cu2+ ion doped Mg - Zn spinel nanoferrites

Science.gov (United States)

Choudhary, Pankaj; Varshney, Dinesh

2018-03-01

Cu2+ substituted Mg - Zn nanoferrites is synthesized by low temperature fired sol gel auto combustion method. The spinel nature of nanoferrites was confirmed by lab x-ray technique. Williamson - Hall (W-H) analysis estimate the average crystallite size (22.25-29.19 ± 3 nm) and micro strain induced Mg0.5Zn0.5-xCuxFe2O4 (0.0 ≤ x ≤ 0.5). Raman scattering measurements confirm presence of four active phonon modes. Red shift is observed with enhanced Cu concentration. Dielectric parameters exhibit a non - monotonous dispersion with Cu concentration and interpreted with the support of hopping mechanism and Maxwell-Wagner type of interfacial polarization. The ac conductivity of nanoferrites increases with raising the frequency. Complex electrical modulus reveals a non - Debye type of dielectric relaxation present in nanoferrites. Reactive impedance (Z″) detected an anomalous behavior and is related with resonance effect. Complex impedance demonstrates one semicircle corresponding to the intergrain (grain boundary) resistance and also explains conducting nature of nanoferrites. For x = 0.2, a large semicircle is observed revealing the ohmic nature (minimum potential drop at electrode surface). Dielectric properties were improved for nanoferrites with x = 0.2 and is due to high dielectric constant, conductivity and minimum loss value (∼0.009) at 1 MHz.

The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

International Nuclear Information System (INIS)

Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E.

2001-11-01

Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

Identification of irradiated potatoes by impedance

International Nuclear Information System (INIS)

Singh, Rita; Singh, Antaryami; Wadhawan, A.K.

1997-01-01

The electrical impedance of potatoes irradiated at 60, 90, 150 and 1000 Gy was measured using various frequencies of alternating current. The impedance of the irradiated potatoes was higher than the unirradiated potatoes particularly in the frequency range of 100 Hz to 10 kHz. The ratio of the impedance at 5 kHz to that at 50 Hz (Z5k/Z50) was found to be the best indicator for detection of radiation treatment. (author). 4 refs., 2 figs

SPATIAL VARIABILITY OF PEDOZEMS MECHANICAL IMPEDANCE

Directory of Open Access Journals (Sweden)

Zhukov A.V.

2013-04-01

Full Text Available We studied the spatial variability of pedozem mechanical impedance in ResearchRemediation Center of the Dnipropetrovsk State Agrarian University in Ordzhonikidze. Thestatistical distribution of the soil mechanical impedance within the studied area is characterized by deviation from the normal law in 0–10 and 30–50 cm layers from the surface. 2D and 3D modeling shows the structural design of the soil as locations of high mechanical impedance which found in the soils with less hardness.

AcMNPV ac143 (odv-e18) is essential for mediating budded virus production and is the 30th baculovirus core gene

International Nuclear Information System (INIS)

McCarthy, Christina B.; Theilmann, David A.

2008-01-01

Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac143 (odv-e18) is a late gene that encodes for a predicted 9.6 kDa structural protein that locates to the occlusion derived viral envelope and viral induced intranuclear microvesicles [Braunagel, S.C., He, H., Ramamurthy, P., and Summers, M.D. (1996). Transcription, translation, and cellular localization of three Autographa californica nuclear polyhedrosis virus structural proteins: ODV-E18, ODV-E35, and ODV-EC27. Virology 222, 100-114.]. In this study we demonstrate that ac143 is actually a previously unrecognized core gene and that it is essential for mediating budded virus production. To examine the role of ac143 in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac143 knockout (KO) virus (AcBAC ac142REP-ac143KO ). Fluorescence and light microscopy showed that infection by AcBAC ac142REP-ac143KO is limited to a single cell and titration assays confirmed that AcBAC ac142REP-ac143KO was unable to produce budded virus (BV). Progression to very late phases of the viral infection was evidenced by the development of occlusion bodies in the nuclei of transfected cells. This correlated with the fact that viral DNA replication was unaffected in AcBAC ac142REP-ac143KO transfected cells. The entire ac143 promoter, which includes three late promoter motifs, is contained within the ac142 open reading frame. Different deletion mutants of this region showed that the integrity of the ac142-ac143 core gene cluster was required for the bacmids to display wild-type patterns of viral replication, BV production and RNA transcription

Recombination rates in heterojunction silicon solar cells analyzed by impedance spectroscopy at forward bias and under illumination

Energy Technology Data Exchange (ETDEWEB)

Mora-Sero, Ivan; Luo, Yan; Garcia-Belmonte, Germa; Bisquert, Juan [Departament de Fisica, Universitat Jaume I, E-12071 Castello (Spain); Munoz, Delfina; Voz, Cristobal; Puigdollers, Joaquim; Alcubilla, Ramon [Departament d' Enginyeria Electronica, Universitat Politecnica de Catalunya, E-08034 Barcelona (Spain)

2008-04-15

Impedance spectroscopy (at forward bias and under illumination) of solar cells comprised thin hydrogenated amorphous silicon (a-Si:H) films deposited on crystalline silicon (c-Si) wafers was analyzed in terms of ac equivalent circuits. Shockley-Read-Hall recombination at states on the device interfaces governs the cell dynamic response. Recombination process was modeled by means of simple RC circuits which allow to determine the capture rate of electrons and holes. Carrier lifetime is found to be stated by the electron capture time {tau}{sub SRH}{approx}{tau}{sub n}, and it results in the range of 300 {mu}s. The Al-annealed back contact was regarded as the dominating recombination interface. (author)

Electrical and Dielectric Properties of Polyaniline and Polyaniline/Montmorillonite Nanocomposite Prepared by Solid Reaction Using Spectroscopy Impedance

Directory of Open Access Journals (Sweden)

Imene Bekri-Abbes

2015-01-01

Full Text Available The combination of two components with uniform distribution in nanoscale is expected to facilitate wider applications of the material. In this study, polyaniline (PAn and polyaniline/montmorillonite (Mt nanocomposite were prepared by solid reaction using persulfate of ammonium as oxidant. The phase composition and morphology of the nanocomposite were characterized by FTIR, UV-visible spectroscopy, X-ray diffractometer, thermal gravimetric analysis, and scanning electron microscopy. The electrical and dielectric properties were determined using spectroscopy impedance. The analysis of UV-visible and FTIR spectroscopy demonstrated that aniline chloride has been polymerized into PAn in its conducting emeraldine form. Thermogravimetric analysis suggested that PAn chains intercalated in the clay host are more thermally stable than those of free PAn prepared by solid-solid reaction. Electrical measurements were carried out using the complex impedance technique in the frequency range of 10−2 to 104 Hz at different temperatures. The ac conductivity data of different nanocomposites were analyzed as a function of frequency and temperature. It has been found that the incorporation of inorganic clay phase into polyaniline matrix has an effect on the electrical and dielectric properties of the nanomaterial.

Small Signal Loudspeaker Impedance Emulator

DEFF Research Database (Denmark)

Iversen, Niels Elkjær; Knott, Arnold

2014-01-01

Specifying the performance of audio amplifiers is typically done by playing sine waves into a pure ohmic load. However real loudspeaker impedances are not purely ohmic but characterized by the mechanical resonance between the mass of the diaphragm and the compliance of its suspension which vary...... from driver to driver. Therefore, a loudspeaker emulator capable of adjusting its impedance to that of a given driver is desired for measurement purposes. This paper proposes a loudspeaker emulator circuit for small signals. Simulations and experimental results are compared and show that it is possible...... to emulate the loudspeaker impedance with an electric circuit and that its resonance frequency can be changed by tuning two resistors....

Small-signal Loudspeaker Impedance Emulator

DEFF Research Database (Denmark)

Knott, Arnold; Iversen, Niels Elkjær

2014-01-01

Specifying the performance of audio ampliers is typically done by playing sine waves into a pure ohmic load. However real loudspeaker impedances are not purely ohmic but characterised by the mechanical resonance between the mass of the diaphragm and the compliance of its' suspension which vary from...... driver to driver. Therefore a loudspeaker emulator capable of adjusting its' impedance to a given driver is in need for measurement purposes. This paper proposes a loudspeaker emulator circuit for small signals. Simulations and experimental results are compared and show that it is possible to emulate...... the loudspeaker impedance with an electric circuit and that its' resonance frequency can be changed by tuning two resistors....

Innovative application of AC-voltammetry in the characterization of oxides nanolayers formed on metals, under the effect of AC-perturbations

Energy Technology Data Exchange (ETDEWEB)

Bueno, V.; Lazzari, L.; Ormellesse, M. [Politecnico di Milano, Milan (Italy). Dept. of Chemistry, Materials and Chemical Engineering; Spinelli, P. [Politecnico di Torino, Torino (Italy). Dept. of Materials Science and Chemical Engineering

2008-07-01

Stray AC-currents have been reported to cause many cases of unwanted corrosion on metallic structures. This study characterized the formation and stability of the surface oxide film formed on mild steel under the effect of AC voltage in a very basic environment. The response of the system to DC signals was examined, along with its reversibility to AC perturbations. SEM analysis was used to complement AC-Voltammetry. Reaction mechanisms responsible for the AC-corrosion were formulated. AC-Voltammetry involves the application of a controlled sinusoidal voltage onto a solid working electrode while it is being swept in a DC-voltage range, with the faradaic or capacitative components of the resulting AC-current being recorded. The innovative aspect is the application of AC-V to characterize its nano-surface while it is being affected by AC-signals. It was concluded that the AC-V can be useful for the study of redox processes occurring at the surface of a reactive electrode and for the application of a considerable AC perturbation to the electrode in a potentiostatically controlled way. According to the electrochemistry of the double layer, there are 3 main reactions in the NaOH 1M media that are not reversible to DC nor to AC perturbations in the range of cathodic protection of mild steel. When designing metallic systems susceptible to stray currents, the AC-V could quantify the final faradaic, resistive and capacitative responses. 6 refs., 1 fig.

Impedance Modeling of Solid Oxide Fuel Cell Cathodes

DEFF Research Database (Denmark)

Mortensen, Jakob Egeberg; Søgaard, Martin; Jacobsen, Torben

2010-01-01

A 1-dimensional impedance model for a solid oxide fuel cell cathode is formulated and applied to a cathode consisting of 50/50 wt% strontium doped lanthanum cobaltite and gadolinia doped ceria. A total of 42 impedance spectra were recorded in the temperature range: 555-852°C and in the oxygen...... partial pressure range 0.028-1.00 atm. The recorded impedance spectra were successfully analyzed using the developed impedance model in the investigated temperature and oxygen partial pressure range. It is also demonstrated that the model can be used to predict how impedance spectra evolve with different...

High voltage AC/AC electrochemical capacitor operating at low temperature in salt aqueous electrolyte

Science.gov (United States)

Abbas, Qamar; Béguin, François

2016-06-01

We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.

Transverse impedance measurement in RHIC and the AGS

Energy Technology Data Exchange (ETDEWEB)

Biancacci, Nicolo [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Blaskiewicz, M. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Dutheil, Y. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Liu, C. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Mernick, M. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Minty, M. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; White, S. M. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.

2014-05-12

The RHIC luminosity upgrade program aims for an increase of the polarized proton luminosity by a factor 2. To achieve this goal a significant increase in the beam intensity is foreseen. The beam coupling impedance could therefore represent a source of detrimental effects for beam quality and stability at high bunch intensities. For this reason it is essential to quantify the accelerator impedance budget and the major impedance sources, and possibly cure them. In this MD note we summarize the results of the 2013 transverse impedance measurements in the AGS and RHIC. The studies have been performed measuring the tune shift as a function of bunch intensity and deriving the total accelerator machine transverse impedance. For RHIC, we could obtain first promising results of impedance localization measurements as well.

AcEST: DK954361 [AcEST

Lifescience Database Archive (English)

Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac

21 CFR 886.4440 - AC-powered magnet.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...

Beam pipe impedances in the TRIUMF KAON factory

International Nuclear Information System (INIS)

Baartman, R.; Oram, C.J.

1989-09-01

The standard formalism for estimating longitudinal beam pipe impedances is given. Estimates of realistically obtainable impedances are developed. We show that where the impedance is critical an impedance divided by mode number of 1-2 Ω should be the design goal for the beam pipe group. However for machine design criteria and planning purposes 5 Ω should continue to be adopted so that sufficient contingency is present in the design

Results of polarization resistance and impedance of steel bars embedded in carbonated concrete contaminated with chlorides

International Nuclear Information System (INIS)

Andrade, C.; Alonso, C.; Gonzalez, J.A.

1989-01-01

Laboratory results of the corrosion rate of steel embedded in carbonated concrete contaminated with chlorides determined through the Polarization Resistance method are presented here as examples of the possibilities offered by this technique in order to monitor the reinforcement corrosion process. The Rp technique has the advantages of fast response, simple and relatively accurate. Contrasts with gravimetric losses are presented. The A.C. Impedance measurements determined on the same specimens are also presented. The difficulties found in the interpretation of the results are stressed. R T values cannot easily be obtained. Several electrical circuits which may model the behaviour of the steel/concrete system are discussed. Finally, comments on the basic criteria to interpret results of both techniques are given. (author) 4 refs., 6 figs

Facilitatory effect of AC-iontophoresis of lidocaine hydrochloride on the permeability of human enamel and dentine in extracted teeth.

Science.gov (United States)

Ikeda, Hideharu; Suda, Hideaki

2013-04-01

The objectives of the present study were to quantitatively evaluate chemical permeability through human enamel/dentine using conductometry and to clarify if alternating current (AC) iontophoresis facilitates such permeability. Electrical impedance of different concentrations of lidocaine hydrochloride was measured using a bipolar platinum impedance probe. A quadratic curve closely fitted to the response functions between conductance and lidocaine hydrochloride. For analysis of the passage of lidocaine hydrochloride through human enamel/dentine, eight premolars that were extracted for orthodontic treatment were sectioned at the cemento-enamel junction. The tooth crowns were held between two chambers with a double O-ring. The enamel-side chamber was filled with lidocaine hydrochloride, and the pulp-side chamber was filled with extrapure water. Two platinum plate electrodes were set at the end of each chamber to pass alternating current. A simulated interstitial pulp pressure was applied to the pulp-side chamber. The change in the concentration of lidocaine hydrochloride in the pulp-side chamber was measured every 2min using a platinum recording probe positioned at the centre of the pulp-side chamber. Passive entry without iontophoresis was used as a control. The level of lidocaine hydrochloride that passed through enamel/dentine against the dentinal fluid flow increased with time. Electrical conductance (G, mho) correlated closely to the concentration (x, mmol/L) of lidocaine hydrochloride (G=2.16x(2)+0.0289x+0.000376, r(2)=0.999). Lidocaine hydrochloride can pass through enamel/dentine. Conductometry showed that the level of lidocaine hydrochloride that passed through enamel/dentine was increased by AC iontophoresis. Copyright © 2012 Elsevier Ltd. All rights reserved.

Modeling degradation in SOEC impedance spectra

DEFF Research Database (Denmark)

Jensen, Søren Højgaard; Hauch, Anne; Knibbe, Ruth

2013-01-01

Solid oxide cell (SOC) performance is limited by various processes. One way to investigate these processes is by electrochemical impedance spectroscopy. In order to quantify and characterize the processes, an equivalent circuit can be used to model the SOC impedance spectra (IS). Unfortunately......, the optimal equivalent circuit is often unknown and to complicate matters further, several processes contribute to the SOC impedance - making detailed process characterization difficult. In this work we analyze and model a series of IS measured during steam electrolysis operation of an SOC. During testing......, degradation is only observed in the Ni/YSZ electrode and not in the electrolyte or the LSM/YSZ electrode. A batch fit of the differences between the IS shows that a modified Gerischer element provides a better fit to the Ni/YSZ electrode impedance than the frequently used RQ element - albeit neither...

Structural, morphological, impedance and magnetic studies of nanostructured LiNi0.45M0.1Mn0.45O2 (MCu and Al cathode materials for lithium-ion batteries

Directory of Open Access Journals (Sweden)

N. Murali

2017-12-01

Full Text Available Layered structure LiNi0.45M0.1Mn0.45O2 (MCu and Al cathode materials for lithium-ion batteries are synthesized by sol–gel auto combustion method. The structural, morphological, electrical and magnetic properties are examined by X-ray diffraction (XRD, field effect scanning electron microscope FESEM, FT-IR, EIS and ESR. XRD data revealed the rhombohedral and α-NaFeO2 structure with a space group R-3m. The electrical conductivity, dielectric constant, and dielectric loss are measured in the room temperature at a frequency ranging from 20 Hz to 1 MHz. The electrical conductivity of the compound is measured by AC impedance. An effective improvement in the electrical conductivity of order 5.42 × 10−6 S/cm is observed for the copper doped LNMO compounds. ESR spectra is recorded at room temperature on a Bruker EMX model X-band spectrometer operating at a frequency of 9.50 GHz. The critical dopants of Cu, with minimum g-factor and maximum line-width (W are observed. Keywords: Sol–gel, FESEM, AC impedance, ESR

Geometric beam coupling impedance of LHC secondary collimators

Science.gov (United States)

Frasciello, Oscar; Tomassini, Sandro; Zobov, Mikhail; Salvant, Benoit; Grudiev, Alexej; Mounet, Nicolas

2016-02-01

The High Luminosity LHC project is aimed at increasing the LHC luminosity by an order of magnitude. One of the key ingredients to achieve the luminosity goal is the beam intensity increase. In order to keep beam instabilities under control and to avoid excessive power losses a careful design of new vacuum chamber components and an improvement of the present LHC impedance model are required. Collimators are among the major impedance contributors. Measurements with beam have revealed that the betatron coherent tune shifts were higher by about a factor of 2 with respect to the theoretical predictions based on the LHC impedance model up to 2012. In that model the resistive wall impedance has been considered as the dominating impedance contribution for collimators. By carefully simulating also their geometric impedance we have contributed to the update of the LHC impedance model, reaching also a better agreement between the measured and simulated betatron tune shifts. During the just ended LHC Long Shutdown I (LSI), TCS/TCT collimators were replaced by new devices embedding BPMs and TT2-111R ferrite blocks. We present here preliminary estimations of their broad-band impedance, showing that an increase of about 20% is expected in the kick factors with respect to previous collimators without BPMs.

Sound Propagation An impedance Based Approach

CERN Document Server

Kim, Yang-Hann

2010-01-01

In Sound Propagation: An Impedance Based Approach , Professor Yang-Hann Kim introduces acoustics and sound fields by using the concept of impedance. Kim starts with vibrations and waves, demonstrating how vibration can be envisaged as a kind of wave, mathematically and physically. One-dimensional waves are used to convey the fundamental concepts. Readers can then understand wave propagation in terms of characteristic and driving point impedance. The essential measures for acoustic waves, such as dB scale, octave scale, acoustic pressure, energy, and intensity, are explained. These measures are

Broadband electrical impedance matching for piezoelectric ultrasound transducers.

Science.gov (United States)

Huang, Haiying; Paramo, Daniel

2011-12-01

This paper presents a systematic method for designing broadband electrical impedance matching networks for piezoelectric ultrasound transducers. The design process involves three steps: 1) determine the equivalent circuit of the unmatched piezoelectric transducer based on its measured admittance; 2) design a set of impedance matching networks using a computerized Smith chart; and 3) establish the simulation model of the matched transducer to evaluate the gain and bandwidth of the impedance matching networks. The effectiveness of the presented approach is demonstrated through the design, implementation, and characterization of impedance matching networks for a broadband acoustic emission sensor. The impedance matching network improved the power of the acquired signal by 9 times.

Effect of Electrode Belt and Body Positions on Regional Pulmonary Ventilation- and Perfusion-Related Impedance Changes Measured by Electric Impedance Tomography.

Directory of Open Access Journals (Sweden)

Elin Ericsson

Full Text Available Ventilator-induced or ventilator-associated lung injury (VILI/VALI is common and there is an increasing demand for a tool that can optimize ventilator settings. Electrical impedance tomography (EIT can detect changes in impedance caused by pulmonary ventilation and perfusion, but the effect of changes in the position of the body and in the placing of the electrode belt on the impedance signal have not to our knowledge been thoroughly evaluated. We therefore studied ventilation-related and perfusion-related changes in impedance during spontaneous breathing in 10 healthy subjects in five different body positions and with the electrode belt placed at three different thoracic positions using a 32-electrode EIT system. We found differences between regions of interest that could be attributed to changes in the position of the body, and differences in impedance amplitudes when the position of the electrode belt was changed. Ventilation-related changes in impedance could therefore be related to changes in the position of both the body and the electrode belt. Perfusion-related changes in impedance were probably related to the interference of major vessels. While these findings give us some insight into the sources of variation in impedance signals as a result of changes in the positions of both the body and the electrode belt, further studies on the origin of the perfusion-related impedance signal are needed to improve EIT further as a tool for the monitoring of pulmonary ventilation and perfusion.

Impedance interactions in bidirectional cascaded converter

DEFF Research Database (Denmark)

Tian, Yanjun; Loh, Poh Chiang; Chen, Zhe

2016-01-01

A cascaded converter is built by connecting one elementary converter to another. Output impedance of one converter will therefore interact with input impedance of the other converter. This interaction will change when power flow reverses. To compare this difference, an investigation is performed...

Impedance of accelerator components

International Nuclear Information System (INIS)

Corlett, J.N.

1996-05-01

As demands for high luminosity and low emittance particle beams increase, an understanding of the electromagnetic interaction of these beams with their vacuum chamber environment becomes more important in order to maintain the quality of the beam. This interaction is described in terms of the wake field in time domain, and the beam impedance in frequency domain. These concepts are introduced, and related quantities such as the loss factor are presented. The broadband Q = 1 resonator impedance model is discussed. Perturbation and coaxial wire methods of measurement of real components are reviewed

Y-Source Impedance Network

DEFF Research Database (Denmark)

Siwakoti, Yam Prasad; Loh, Poh Chiang; Blaabjerg, Frede

2014-01-01

This letter introduces a new versatile Y-shaped impedance network for realizing converters that demand a very high-voltage gain, while using a small duty ratio. To achieve that, the proposed network uses a tightly coupled transformer with three windings, whose obtained gain is presently not matched...... by existing networks operated at the same duty ratio. The proposed impedance network also has more degrees of freedom for varying its gain, and hence, more design freedom for meeting requirements demanded from it. This capability has been demonstrated by mathematical derivation, and proven in experiment...

Structural, morphological, dielectric and impedance spectroscopy of lead-free Bi(Zn{sub 2/3}Ta{sub 1/3})O{sub 3} electronic material

Energy Technology Data Exchange (ETDEWEB)

Halder, S.; Bhuyan, S.; Das, S.N.; Sahoo, S.; Choudhary, R.N.P.; Parida, K. [Siksha ' O' Anusandhan University, Bhubaneswar (India); Das, P. [Midnapore College, Department of Physics, Midnapore, West Bengal (India)

2017-12-15

A lead-free dielectric material [Bi(Zn{sub 2/3}Ta{sub 1/3})O{sub 3}] has been prepared using a solid state reaction technique at high-temperature. The resistive, conducting and capacitive characteristics of the prepared electronic material have been studied in different experimental conditions. The determination of basic crystal parameters and reflection indices confirm the development of polycrystalline compound with orthorhombic crystal structure. The study of frequency-temperature dependence of ac conductivity illustrates the nature and conduction mechanism of the material. On the basis of observed impedance data and detailed dielectric analysis, the existence of non-Debye type relaxation has been affirmed. The electronic charge carriers of compound have short range order that has been validated from the complex modulus and impedance spectrum. The detailed studies of resistive, capacitive, microstructural characteristics of the prepared material provide some useful data for considering the material as an electronic component for fabrication of devices. (orig.)

MVAC Submarine cable, impedance measurements and analysis

DEFF Research Database (Denmark)

Arentsen, Martin Trolle; Expethit, Adrian; Pedersen, Morten Virklund

2017-01-01

influence the losses. Secondly, cable parameters such as component impedances, positive-, zero-sequence impedances and losses are measured for varying currents and frequencies. Zero sequence is measured for two setups, one with armour grounded, and with armour open to match CIGREs formula assumption......-sequence impedance is found between the measurements and the CIGRÉ formulas. It is concluded that the formulas are not accurate for the specific cable under test....

Simultaneous distribution of AC and DC power

Science.gov (United States)

Polese, Luigi Gentile

2015-09-15

A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

Isolation of MA-ACS Gene Family and Expression Study of MA-ACS1 Gene in Musa acuminata Cultivar Pisang Ambon Lumut

Directory of Open Access Journals (Sweden)

LISTYA UTAMI KARMAWAN

2009-03-01

Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.

Universality of ac conduction in disordered solids

DEFF Research Database (Denmark)

Dyre, Jeppe; Schrøder, Thomas

2000-01-01

The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

PHEMT Distributed Power Amplifier Adopting Broadband Impedance Transformer

DEFF Research Database (Denmark)

Narendra, K.; Limiti, E.; Paoloni, C.

2013-01-01

A non-uniform drain line distributed power amplifier (DPA) employing a broadband impedance transformer is presented. The DPA is based on GaAs PHEMT technology. The impedance transformer employs asymmetric coupled lines and transforms a low output impedance of the amplifier to a standard 50 Ω...

Optical approximation in the theory of geometric impedance

International Nuclear Information System (INIS)

Stupakov, G.; Bane, K.L.F.; Zagorodnov, I.

2007-02-01

In this paper we introduce an optical approximation into the theory of impedance calculation, one valid in the limit of high frequencies. This approximation neglects diffraction effects in the radiation process, and is conceptually equivalent to the approximation of geometric optics in electromagnetic theory. Using this approximation, we derive equations for the longitudinal impedance for arbitrary offsets, with respect to a reference orbit, of source and test particles. With the help of the Panofsky-Wenzel theorem we also obtain expressions for the transverse impedance (also for arbitrary offsets). We further simplify these expressions for the case of the small offsets that are typical for practical applications. Our final expressions for the impedance, in the general case, involve two dimensional integrals over various cross-sections of the transition. We further demonstrate, for several known axisymmetric examples, how our method is applied to the calculation of impedances. Finally, we discuss the accuracy of the optical approximation and its relation to the diffraction regime in the theory of impedance. (orig.)

A new approach to electrical impedance imaging technique

International Nuclear Information System (INIS)

Afroj Quadir, K.; Nasir, F.; Rahman, M.; Rabbani, K.S.

2004-09-01

It is possible to obtain a 2 dimensional (2D) image of a volume conductor, to locate a few widely separated objects, by driving ac constant currents through two orthogonal pairs of electrodes and measuring the resulting potential differences between several diagonally placed electrodes at the centre and back-projecting their impedance values along equi-potential lines. This has been termed as Pigeon Hole Imaging (PHI). Experimental verification has been attempted using a small insulating object placed at different locations in a saline filled 2D phantom. For a 6 x 6 matrix, the image in 16 pixels in close proximity of the diagonal along which electrodes are arranged, coincide with the object positions, while they do nt for the remaining 20 pixels. We applied a new technique where image smearing patterns have been used to correct the images in 14 of these pixels while 6 pixels near the two opposite comers still remain uncertain. Thus 30 pixels out of 36 give the right object position which may be termed a success. The concept may be extended further to higher order matrices by increasing the number of diagonal electrodes. The present work mainly concentrates on the feasibility of localization of a single small object in one matrix position of the image. (author)

FDTD modeling of thin impedance sheets

Science.gov (United States)

Luebbers, Raymond J.; Kunz, Karl S.

1991-01-01

Thin sheets of resistive or dielectric material are commonly encountered in radar cross section calculations. Analysis of such sheets is simplified by using sheet impedances. In this paper it is shown that sheet impedances can be modeled easily and accurately using Finite Difference Time Domain (FDTD) methods.

Quadratic Boost A-Source Impedance Network

DEFF Research Database (Denmark)

Siwakoti, Yam Prasad; Blaabjerg, Frede; Chub, Andrii

2016-01-01

A novel quadratic boost A-source impedance network is proposed to realize converters that demand very high voltage gain. To satisfy the requirement, the network uses an autotransformer where the obtained gain is quadratically dependent on the duty ratio and is unmatched by any existing impedance...

Flow reversal at low voltage and low frequency in a microfabricated ac electrokinetic pump

DEFF Research Database (Denmark)

Gregersen, Misha Marie; Olesen, Laurits Højgaard; Brask, Anders

2007-01-01

measured in a regime, where both the applied voltage and the frequency are low, Vrms1.5 V and f20 kHz, compared to previously investigated parameter ranges. The impedance spectrum has been thoroughly measured and analyzed in terms of an equivalent circuit diagram to rule out trivial circuit explanations......Microfluidic chips have been fabricated in Pyrex glass to study electrokinetic pumping generated by a low-voltage ac bias applied to an in-channel asymmetric metallic electrode array. A measurement procedure has been established and followed carefully resulting in a high degree of reproducibility...... of the measurements over several days. A large coverage fraction of the electrode array in the microfluidic channels has led to an increased sensitivity allowing for pumping measurements at low bias voltages. Depending on the ionic concentration a hitherto unobserved reversal of the pumping direction has been...

Microfluidic device for cell capture and impedance measurement.

Science.gov (United States)

Jang, Ling-Sheng; Wang, Min-How

2007-10-01

This work presents a microfluidic device to capture physically single cells within microstructures inside a channel and to measure the impedance of a single HeLa cell (human cervical epithelioid carcinoma) using impedance spectroscopy. The device includes a glass substrate with electrodes and a PDMS channel with micro pillars. The commercial software CFD-ACE+ is used to study the flow of the microstructures in the channel. According to simulation results, the probability of cell capture by three micro pillars is about 10%. An equivalent circuit model of the device is established and fits closely to the experimental results. The circuit can be modeled electrically as cell impedance in parallel with dielectric capacitance and in series with a pair of electrode resistors. The system is operated at low frequency between 1 and 100 kHz. In this study, experiments show that the HeLa cell is successfully captured by the micro pillars and its impedance is measured by impedance spectroscopy. The magnitude of the HeLa cell impedance declines at all operation voltages with frequency because the HeLa cell is capacitive. Additionally, increasing the operation voltage reduces the magnitude of the HeLa cell because a strong electric field may promote the exchange of ions between the cytoplasm and the isotonic solution. Below an operating voltage of 0.9 V, the system impedance response is characteristic of a parallel circuit at under 30 kHz and of a series circuit at between 30 and 100 kHz. The phase of the HeLa cell impedance is characteristic of a series circuit when the operation voltage exceeds 0.8 V because the cell impedance becomes significant.

Pixel-based CTE Correction of ACS/WFC: Modifications To The ACS Calibration Pipeline (CALACS)

Science.gov (United States)

Smith, Linda J.; Anderson, J.; Armstrong, A.; Avila, R.; Bedin, L.; Chiaberge, M.; Davis, M.; Ferguson, B.; Fruchter, A.; Golimowski, D.; Grogin, N.; Hack, W.; Lim, P. L.; Lucas, R.; Maybhate, A.; McMaster, M.; Ogaz, S.; Suchkov, A.; Ubeda, L.

2012-01-01

The Advanced Camera for Surveys (ACS) was installed on the Hubble Space Telescope (HST) nearly ten years ago. Over the last decade, continuous exposure to the harsh radiation environment has degraded the charge transfer efficiency (CTE) of the CCDs. The worsening CTE impacts the science that can be obtained by altering the photometric, astrometric and morphological characteristics of sources, particularly those farthest from the readout amplifiers. To ameliorate these effects, Anderson & Bedin (2010, PASP, 122, 1035) developed a pixel-based empirical approach to correcting ACS data by characterizing the CTE profiles of trails behind warm pixels in dark exposures. The success of this technique means that it is now possible to correct full-frame ACS/WFC images for CTE degradation in the standard data calibration and reduction pipeline CALACS. Over the past year, the ACS team at STScI has developed, refined and tested the new software. The details of this work are described in separate posters. The new code is more effective at low flux levels (repair ACS electronics) and pixel-based CTE correction. In addition to the standard cosmic ray corrected, flat-fielded and drizzled data products (crj, flt and drz files) there are three new equivalent files (crc, flc and drc) which contain the CTE-corrected data products. The user community will be able to choose whether to use the standard or CTE-corrected products.

Impedance coordinative control for cascaded converter in bidirectional application

DEFF Research Database (Denmark)

Tian, Yanjun; Loh, Poh Chiang; Deng, Fujin

2016-01-01

A two-stage cascaded converter is formed by connecting two sub-converters in series. Output impedance of one sub-converter will therefore interact with input impedance of the other sub-converter. Such interaction may affect the system dynamics and stability, especially when one sub......-converter is constant-power-controlled, and hence has different impedance characteristics when its power reverses. To lessen such constant-power effects, a control scheme that can coordinate impedance behaviors of the two sub-converters is proposed. The idea is to reshape the lowfrequency negative impedance...

SUN2 Modulates HIV-1 Infection and Latency through Association with Lamin A/C To Maintain the Repressive Chromatin.

Science.gov (United States)

Sun, Wei-Wei; Jiao, Shi; Sun, Li; Zhou, Zhaocai; Jin, Xia; Wang, Jian-Hua

2018-05-01

The postintegrational latency of HIV-1 is characterized by reversible silencing of long terminal repeat (LTR)-driven transcription of the HIV genome. It is known that the formation of repressive chromatin at the 5'-LTR of HIV-1 proviral DNA impedes viral transcription by blocking the recruitment of positive transcription factors. How the repressive chromatin is formed and modulated during HIV-1 infection remains elusive. Elucidation of which chromatin reassembly factor mediates the reorganization of chromatin is likely to facilitate the understanding of the host's modulation of HIV-1 transcription and latency. Here we revealed that "Sad1 and UNC84 domain containing 2" (SUN2), an inner nuclear membrane protein, maintained the repressive chromatin and inhibited HIV LTR-driven transcription of proviral DNA through an association with lamin A/C. Specifically, lamin A/C tethered SUN2 to the nucleosomes 1 and 2 of the HIV-1 5'-LTR to block the initiation and elongation of HIV-1 transcription. SUN2 knockdown converted chromatin to an active form and thus enhanced the phosphorylation of RNA polymerase II and its recruitment to the 5'-LTR HIV-1 proviral DNA, leading to reactivation of HIV-1 from latency. Conversely, the exogenous factors such as tumor necrosis factor alpha (TNF-α) induced reactivation, and the replication of HIV-1 led to the disassociation between SUN2 and lamin A/C, suggesting that disruption of the association between SUN2 and lamin A/C to convert the repressive chromatin to the active form might be a prerequisite for the initiation of HIV-1 transcription and replication. Together, our findings indicate that SUN2 is a novel chromatin reassembly factor that helps to maintain chromatin in a repressive state and consequently inhibits HIV-1 transcription. IMPORTANCE Despite the successful use of scores of antiretroviral drugs, HIV latency poses a major impediment to virus eradication. Elucidation of the mechanism of latency facilitates the discovery of new

Line impedance estimation using model based identification technique

DEFF Research Database (Denmark)

Ciobotaru, Mihai; Agelidis, Vassilios; Teodorescu, Remus

2011-01-01

The estimation of the line impedance can be used by the control of numerous grid-connected systems, such as active filters, islanding detection techniques, non-linear current controllers, detection of the on/off grid operation mode. Therefore, estimating the line impedance can add extra functions...... into the operation of the grid-connected power converters. This paper describes a quasi passive method for estimating the line impedance of the distribution electricity network. The method uses the model based identification technique to obtain the resistive and inductive parts of the line impedance. The quasi...

Modelling a coal subcrop using the impedance method

Energy Technology Data Exchange (ETDEWEB)

Wilson, G.A.; Thiel, D.V.; O' Keefe, S.G. [Griffith University, Nathan, Qld. (Australia). School of Microelectronic Engineering

2000-07-01

An impedance model was generated for two coal subcrops in the Biloela and Middlemount areas (Queensland, Australia). The model results were compared with actual surface impedance data. It was concluded that the impedance method satisfactorily modelled the surface response of the coal subcrops in two dimensions. There were some discrepancies between the field data and the model results, due to factors such as the method of discretization of the solution space in the impedance model and the lack of consideration of the three-dimensional nature of the coal outcrops. 10 refs., 8 figs.

AcMNPV

African Journals Online (AJOL)

USER

2010-08-16

Aug 16, 2010 ... biosynthesis pathway and plays an important role in insect growth and .... Construction and propagation of recombined AcMNPV. The recombined ... infected by virus increased with incubation time (Figure. 3). The growth of ...

Transverse Impedance Model of the CERN-PSB

OpenAIRE

Zannini, Carlo; Iadarola, Giovanni; Jones, Bryan; Li, Kevin; Rijoff, Tatiana; Rumolo, Giovanni

2015-01-01

In the framework of the PS-Booster upgrade project an accurate impedance model is needed in order to determine the effect on the beam stability and assess the impact of the new devices before installation in the machine. This paper describes the PSB impedance model which includes resistive wall, indirect space charge, flanges, step transitions, ejection kicker including cables, injection kickers and cavities. Each impedance contribution has been computed for different energies in the PSB cycl...

Modeling and reliability analysis of three phase z-source AC-AC converter

Directory of Open Access Journals (Sweden)

Prasad Hanuman

2017-12-01

Full Text Available This paper presents the small signal modeling using the state space averaging technique and reliability analysis of a three-phase z-source ac-ac converter. By controlling the shoot-through duty ratio, it can operate in buck-boost mode and maintain desired output voltage during voltage sag and surge condition. It has faster dynamic response and higher efficiency as compared to the traditional voltage regulator. Small signal analysis derives different control transfer functions and this leads to design a suitable controller for a closed loop system during supply voltage variation. The closed loop system of the converter with a PID controller eliminates the transients in output voltage and provides steady state regulated output. The proposed model designed in the RT-LAB and executed in a field programming gate array (FPGA-based real-time digital simulator at a fixedtime step of 10 μs and a constant switching frequency of 10 kHz. The simulator was developed using very high speed integrated circuit hardware description language (VHDL, making it versatile and moveable. Hardware-in-the-loop (HIL simulation results are presented to justify the MATLAB simulation results during supply voltage variation of the three phase z-source ac-ac converter. The reliability analysis has been applied to the converter to find out the failure rate of its different components.

Impedance Spectroscopy of Dielectrics and Electronic Conductors

DEFF Research Database (Denmark)

Bonanos, Nikolaos; Pissis, Polycarpos; Macdonald, J. Ross

2013-01-01

Impedance spectroscopy is used for the characterization of materials, such as electroceramics, solid and liquid electrochemical cells, dielectrics and also fully integrated devices, such as fuel cells. It consists of measuring the electrical impedance - or a closely related property, such as admi......Impedance spectroscopy is used for the characterization of materials, such as electroceramics, solid and liquid electrochemical cells, dielectrics and also fully integrated devices, such as fuel cells. It consists of measuring the electrical impedance - or a closely related property......, such as admittance or dielectric constant - as a function of frequency and comparing the results with expectations based on physical, chemical, and microstructural models. This article reviews the principles and practical aspects of the technique, the representations of the results, the analysis of data......, and procedures for the correction of measurement errors. The applications of impedance spectroscopy are illustrated with examples from electroceramics and polymer-based dielectric systems. The way in which the technique is applied to the two classes of materials is compared with reference to the different models...

Broadband impedance of the NESTOR storage ring

International Nuclear Information System (INIS)

Androsov, V.P.; Gladkikh, P.I.; Gvozd, A.M.; Karnaukhov, I.M.; Telegin, Yu.N.

2011-01-01

The contributions from lossy and inductive vacuum chamber components to the broadband impedance of the NESTOR storage ring are obtained by using both low-frequency analytical approaches and computer simulations. As was expected considering the small ring circumference (15.44m), the main contributions both to the longitudinal impedance Z || /n and the loss factor k loss come from the RF-cavity. Cavity impedance was also estimated with CST Microwave Studio (CST Studio Suite TM 2006) by simulating coaxial wire method commonly used for impedance measurements. Both estimates agree well. Finally, we performed the simulations of a number of inductive elements with CST Particle Studio 2010 by using wake field solver. We have also evaluated the bunch length in NESTOR taking the conservative estimate of 3 Ohm for the ring broadband impedance and have found that the bunch length s z = 0.5 cm could be obtained in steady state operation mode for the designed bunch current of 10 mA and RF-voltage of 250 kV.

Advanced impedance modeling of solid oxide electrochemical cells

DEFF Research Database (Denmark)

Graves, Christopher R.; Hjelm, Johan

2014-01-01

Impedance spectroscopy is a powerful technique for detailed study of the electrochemical and transport processes that take place in fuel cells and electrolysis cells, including solid oxide cells (SOCs). Meaningful analysis of impedance measurements is nontrivial, however, because a large number...... techniques to provide good guesses for the modeling parameters, like transforming the impedance data to the distribution of relaxation times (DRT), together with experimental parameter sensitivity studies, is the state-of-the-art approach to achieve good EC model fits. Here we present new impedance modeling...... electrode and 2-D gas transport models which have fewer unknown parameters for the same number of processes, (ii) use of a new model fitting algorithm, “multi-fitting”, in which multiple impedance spectra are fit simultaneously with parameters linked based on the variation of measurement conditions, (iii...

Determination of beam coupling impedance in the frequency domain

Energy Technology Data Exchange (ETDEWEB)

Niedermayer, Uwe

2016-07-01

The concept of beam coupling impedance describes the electromagnetic interaction of uniformly moving charged particles with their surrounding structures in the Frequency Domain (FD). In synchrotron accelerators, beam coupling impedances can lead to beam induced component heating and coherent beam instabilities. Thus, in order to ensure the stable operation of a synchrotron, its impedances have to be quantified and their effects have to be controlled. Nowadays, beam coupling impedances are mostly obtained by Fourier transform of wake potentials, which are the results of Time Domain (TD) simulations. However, at low frequencies, low beam velocity, or for dispersive materials, TD simulations become unhandy. In this area, analytical calculations of beam coupling impedance in the FD, combined with geometry approximations, are still widely used. This thesis describes the development of two electromagnetic field solvers to obtain the beam coupling impedance directly in the FD, where the beam velocity is only a parameter and dispersive materials can be included easily. One solver is based on the Finite Integration Technique (FIT) on a staircase mesh. It is implemented both in 2D and 3D. However, the staircase mesh is inefficient on curved structures, which is particularly problematic for the modeling of a dipole source, that is required for the computation of the transverse beam coupling impedance. This issue is overcome by the second solver developed in this thesis, which is based on the Finite Element Method (FEM) on an unstructured triangular mesh. It is implemented in 2D and includes an optional Surface Impedance Boundary Condition (SIBC). Thus, it is well suited for the computation of longitudinal and transverse impedances of long beam pipe structures of arbitrary cross-section. Besides arbitrary frequency and beam velocity, also dispersive materials can be chosen, which is crucial for the computation of the impedance of ferrite kicker magnets. Numerical impedance

Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

Energy Technology Data Exchange (ETDEWEB)

Ljusev, P.; Andersen, Michael A.E.

2005-07-01

This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)

Proportional-Integral-Resonant AC Current Controller

Directory of Open Access Journals (Sweden)

STOJIC, D.

2017-02-01

Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.

Loudspeaker impedance emulator for multi resonant systems

DEFF Research Database (Denmark)

Iversen, Niels Elkjær; Knott, Arnold

2015-01-01

Specifying the performance of audio amplifiers is typically done by playing sine waves into a pure ohmic load. However real loudspeaker impedances are not purely ohmic but characterised by its electrical, mechanical and acoustical properties. Therefore a loudspeaker emulator capable of adjusting...... its impedance to that of a given loudspeaker is desired for measurement purposes. An adjustable RLC based emulator is implemented with switch controlled capacitors, air gap controlled inductors and potentiometers. Calculations and experimental results are compared and show that it is possible...... to emulate the loudspeaker impedance infinite baffle-, closed box- and the multi resonant vented box-loudspeaker by tuning the component values in the proposed circuit. Future work is outlined and encourage that the proposed impedance emulator is used as part of a control circuit in a switch-mode based...

Impedance of a slotted-pipe kicker

Energy Technology Data Exchange (ETDEWEB)

Zhou, Feng [Academia Sinica, Beijing, BJ (China). Inst. of High Energy Physics

1996-08-01

This paper introduces the principle of a new slotted kicker simply, which is made by using vacuum pipe itself with proper slits as current conductors, and then, presents a rough estimation of its longitudinal and transverse impedance, respectively. Calculation shows that its impedance is reduced significantly compared to our present air-coil kicker. (author)

Impedance-matched Marx generators

Directory of Open Access Journals (Sweden)

W. A. Stygar

2017-04-01

Full Text Available We have conceived a new class of prime-power sources for pulsed-power accelerators: impedance-matched Marx generators (IMGs. The fundamental building block of an IMG is a brick, which consists of two capacitors connected electrically in series with a single switch. An IMG comprises a single stage or several stages distributed axially and connected in series. Each stage is powered by a single brick or several bricks distributed azimuthally within the stage and connected in parallel. The stages of a multistage IMG drive an impedance-matched coaxial transmission line with a conical center conductor. When the stages are triggered sequentially to launch a coherent traveling wave along the coaxial line, the IMG achieves electromagnetic-power amplification by triggered emission of radiation. Hence a multistage IMG is a pulsed-power analogue of a laser. To illustrate the IMG approach to prime power, we have developed conceptual designs of two ten-stage IMGs with LC time constants on the order of 100 ns. One design includes 20 bricks per stage, and delivers a peak electrical power of 1.05 TW to a matched-impedance 1.22-Ω load. The design generates 113 kV per stage and has a maximum energy efficiency of 89%. The other design includes a single brick per stage, delivers 68 GW to a matched-impedance 19-Ω load, generates 113 kV per stage, and has a maximum energy efficiency of 90%. For a given electrical-power-output time history, an IMG is less expensive and slightly more efficient than a linear transformer driver, since an IMG does not use ferromagnetic cores.

Impedance-matched Marx generators

Science.gov (United States)

Stygar, W. A.; LeChien, K. R.; Mazarakis, M. G.; Savage, M. E.; Stoltzfus, B. S.; Austin, K. N.; Breden, E. W.; Cuneo, M. E.; Hutsel, B. T.; Lewis, S. A.; McKee, G. R.; Moore, J. K.; Mulville, T. D.; Muron, D. J.; Reisman, D. B.; Sceiford, M. E.; Wisher, M. L.

2017-04-01

We have conceived a new class of prime-power sources for pulsed-power accelerators: impedance-matched Marx generators (IMGs). The fundamental building block of an IMG is a brick, which consists of two capacitors connected electrically in series with a single switch. An IMG comprises a single stage or several stages distributed axially and connected in series. Each stage is powered by a single brick or several bricks distributed azimuthally within the stage and connected in parallel. The stages of a multistage IMG drive an impedance-matched coaxial transmission line with a conical center conductor. When the stages are triggered sequentially to launch a coherent traveling wave along the coaxial line, the IMG achieves electromagnetic-power amplification by triggered emission of radiation. Hence a multistage IMG is a pulsed-power analogue of a laser. To illustrate the IMG approach to prime power, we have developed conceptual designs of two ten-stage IMGs with L C time constants on the order of 100 ns. One design includes 20 bricks per stage, and delivers a peak electrical power of 1.05 TW to a matched-impedance 1.22 -Ω load. The design generates 113 kV per stage and has a maximum energy efficiency of 89%. The other design includes a single brick per stage, delivers 68 GW to a matched-impedance 19 -Ω load, generates 113 kV per stage, and has a maximum energy efficiency of 90%. For a given electrical-power-output time history, an IMG is less expensive and slightly more efficient than a linear transformer driver, since an IMG does not use ferromagnetic cores.

Polymer microchip impedance spectroscopy through two parallel planar embedded microelectrodes: Understanding the impedance contribution of the surrounding polymer on the measurement accuracy

International Nuclear Information System (INIS)

Kechadi, Mohammed; Gamby, Jean; Chaal, Lila; Girault, Hubert; Saidani, Boualem; Tribollet, Bernard

2013-01-01

The present work describes a new methodology for contact free impedance of a solution in a polymer microchip taking into account the role played by the surrounding polymer on the impedance accuracy. Measurements were carried out using a photoablated polyethylene terephthalate (PET) microchannel above two embedded microband electrodes. The impedance diagrams exhibit a loop from high frequencies to medium frequencies (1 MHz–100 Hz) and a capacitive behavior at low frequencies (100–1 Hz). The impedance diagrams were corrected by eliminating from the global microchip response the contribution of the impedance of the PET layer between the two microband electrodes. This operation enables a clear observation of the impedance in the microchannel solution, including the bulk solution contribution and the interfacial capacitance related to the surface roughness of the photoablated microchannel. Models for the impedance of solutions of varying conductivity showed that the capacitance of the polymer–solution interface can be modeled by a constant phase element (CPE) with an exponent of 0.5. The loop diameter was found to be proportional to the microchannel resistivity, allowing a cell constant around 4.93 × 10 5 m −1 in contactless microelectrodes configuration

Electrochemical impedance measurement of a carbon nanotube probe electrode

International Nuclear Information System (INIS)

Inaba, Akira; Takei, Yusuke; Kan, Tetsuo; Shimoyama, Isao; Matsumoto, Kiyoshi

2012-01-01

We measured and analyzed the electrochemical impedance of carbon nanotube (CNT) probe electrodes fabricated through the physical separation of insulated CNT bridges. The fabricated CNT electrodes were free-standing CNTs that were completely covered with an insulator, except for their tips. Typical dimensions of the nanoelectrodes were 1–10 nm in CNT diameter, 80–300 nm in insulator diameter, 0.5–4 μm in exposed CNT length and 1–10 μm in probe length. The electrochemical impedance at frequencies ranging from 40 Hz to 1 MHz was measured in physiological saline. The measured impedance of the CNT electrode was constant at 32 MΩ at frequencies below 1 kHz and was inversely proportional to frequency at frequencies above 10 kHz. By means of comparison with the parasitic capacitive impedance of the insulator membrane, we confirmed that the electrode was sufficiently insulated such that the measured constant impedance was given by the exposed CNT tip. Consequently, we can use the CNT electrode for highly localized electrochemical impedance measurements below 1 kHz. Considering an equivalent circuit and the nanoscopic dimensions of the CNT electrode, we demonstrated that the constant impedance was governed by diffusion impedance, whereas the solution resistance, charge-transfer resistance and double-layer capacitance were negligible. (paper)

Unified Impedance Model of Grid-Connected Voltage-Source Converters

DEFF Research Database (Denmark)

Wang, Xiongfei; Harnefors, Lennart; Blaabjerg, Frede

2018-01-01

This paper proposes a unified impedance model of grid-connected voltage-source converters for analyzing dynamic influences of the Phase-Locked Loop (PLL) and current control. The mathematical relations between the impedance models in the different domains are first explicitly revealed by means...... of complex transfer functions and complex space vectors. A stationary (αβ-) frame impedance model is then proposed, which not only predicts the stability impact of the PLL, but reveals also its frequency coupling effect explicitly. Furthermore, the impedance shaping effect of the PLL on the current control...... results and theoretical analysis confirm the effectiveness of the stationary-frame impedance model....

Low ac loss geometries in YBCO coated conductors

International Nuclear Information System (INIS)

Duckworth, R.C.; List, F.A.; Paranthaman, M.P.; Rupich, M.W.; Zhang, W.; Xie, Y.Y.; Selvamanickam, V.

2007-01-01

Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders

Low ac loss geometries in YBCO coated conductors

Energy Technology Data Exchange (ETDEWEB)

Duckworth, R.C. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States)], E-mail: duckworthrc@ornl.gov; List, F.A.; Paranthaman, M.P. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States); Rupich, M.W.; Zhang, W. [American Superconductor, Two Technology Drive, Westborough, MA 01581 (United States); Xie, Y.Y.; Selvamanickam, V. [SuperPower, 450 Duane Ave, Schenectady, NY 12304 (United States)

2007-10-01

Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders.

Superconducting active impedance converter

International Nuclear Information System (INIS)

Ginley, D.S.; Hietala, V.M.; Martens, J.S.

1993-01-01

A transimpedance amplifier for use with high temperature superconducting, other superconducting, and conventional semiconductors allows for appropriate signal amplification and impedance matching to processing electronics. The amplifier incorporates the superconducting flux flow transistor into a differential amplifier configuration which allows for operation over a wide temperature range, and is characterized by high gain, relatively low noise, and response times less than 200 picoseconds over at least a 10-80 K. temperature range. The invention is particularly useful when a signal derived from either far-IR focal plane detectors or from Josephson junctions is to be processed by higher signal/higher impedance electronics, such as conventional semiconductor technology. 12 figures

Impedance pattern of vaginal and vestibular mucosa in cyclic goats

Directory of Open Access Journals (Sweden)

Ivo Křivánek

2008-01-01

Full Text Available The changes of vaginal and vestibular impedance during the oestrous cycle in goats were examined. The onset of oestrus was teased with a buck once a day during the experiment. Impedance was mea­sured by a four-terminal method. The vaginal impedance was recorded under slight pressure of electrodes to the vaginal dorsal wall at the cervix. The vestibular impedance was recorded under slight pressure of electrodes to the vestibular dorsal wall 5 cm from the vulva and at the vulva. The im­pe­dan­ce was measured once a day from 4 days before the expected oestrus to 6 days after onset of oestrus. The vaginal impedance at the cervix decreased during pro-oestrus (P < 0.01 and increased du­ring oestrus (P < 0.01. The vestibular impedance 5 cm from the vulva decreased during pro-oestrus (P < 0.01 and increased after oestrus (P < 0.01. The decrease of vaginal impedance during peri-oestrus was nearly twofold in comparison with the vestibular impedance 5 cm from the vulva. No sig­ni­fi­cant decrease of the vestibular impedance at the vulva was found during the oestrous cycle. The results indicate that the vaginal impedance at the cervix and vestibular impedance 5 cm from the vulva measured by means of a four-terminal method during the oestrous cycle display cyclic changes that are closely related to the oestrous behaviour of goats.

Analysis and implementation of power management and control strategy for six-phase multilevel ac drive system in fault condition

Directory of Open Access Journals (Sweden)

Sanjeevikumar Padmanaban

2016-03-01

Full Text Available This research article exploits the power management algorithm in post-fault conditions for a six-phase (quad multilevel inverter. The drive circuit consists of four 2-level, three-phase voltage source inverter (VSI supplying a six-phase open-end windings motor or/impedance load, with circumstantial failure of one VSI investigated. A simplified level-shifted pulse-width modulation (PWM algorithm is developed to modulate each couple of three-phase VSI as 3-level output voltage generators in normal operation. The total power of the whole ac drive is shared equally among the four isolated DC sources. The developed post-fault algorithm is applied when there is a fault by one VSI and the load is fed from the remaining three healthy VSIs. In faulty conditions the multilevel outputs are reduced from 3-level to 2-level, but still the system propagates with degraded power. Numerical simulation modelling and experimental tests have been carried out with proposed post-fault control algorithm with three-phase open-end (asymmetrical induction motor/R-L impedance load. A complete set of simulation and experimental results provided in this paper shows close agreement with the developed theoretical background.

Transverse impedance of a periodic array of cavities

Directory of Open Access Journals (Sweden)

A. V. Fedotov

1999-06-01

Full Text Available We examine the transverse impedance of a periodic array of cavities in a beam pipe at high frequency. The calculation is an extension of a previous one for the longitudinal impedance of a periodic array of azimuthally symmetric pillboxes, for which only TM modes were needed. In the present case, we must include TE modes as well. In addition, we extend the applicability of the previous calculation by including an extra term in the coupling kernel so that the results are valid for all values of the ratio of the cavity length to the period of the structure (all values of the ratio of iris thickness to structure period. In spite of the presence of TE modes, we find that the high frequency limit of the transverse impedance is simply (2/ka^{2} times the corresponding limit of the longitudinal impedance, just as it is for the resistive wall impedances, a relation which occurs frequently for azimuthally symmetric structures. Finally, we present numerical results as well as approximate expressions for the impedance per period, valid for all ratios of cavity length to structure period.

Development on electromagnetic impedance function modeling and its estimation

Energy Technology Data Exchange (ETDEWEB)

Sutarno, D., E-mail: Sutarno@fi.itb.ac.id [Earth Physics and Complex System Division Faculty of Mathematics and Natural Sciences Institut Teknologi Bandung (Indonesia)

2015-09-30

Today the Electromagnetic methods such as magnetotellurics (MT) and controlled sources audio MT (CSAMT) is used in a broad variety of applications. Its usefulness in poor seismic areas and its negligible environmental impact are integral parts of effective exploration at minimum cost. As exploration was forced into more difficult areas, the importance of MT and CSAMT, in conjunction with other techniques, has tended to grow continuously. However, there are obviously important and difficult problems remaining to be solved concerning our ability to collect process and interpret MT as well as CSAMT in complex 3D structural environments. This talk aim at reviewing and discussing the recent development on MT as well as CSAMT impedance functions modeling, and also some improvements on estimation procedures for the corresponding impedance functions. In MT impedance modeling, research efforts focus on developing numerical method for computing the impedance functions of three dimensionally (3-D) earth resistivity models. On that reason, 3-D finite elements numerical modeling for the impedances is developed based on edge element method. Whereas, in the CSAMT case, the efforts were focused to accomplish the non-plane wave problem in the corresponding impedance functions. Concerning estimation of MT and CSAMT impedance functions, researches were focused on improving quality of the estimates. On that objective, non-linear regression approach based on the robust M-estimators and the Hilbert transform operating on the causal transfer functions, were used to dealing with outliers (abnormal data) which are frequently superimposed on a normal ambient MT as well as CSAMT noise fields. As validated, the proposed MT impedance modeling method gives acceptable results for standard three dimensional resistivity models. Whilst, the full solution based modeling that accommodate the non-plane wave effect for CSAMT impedances is applied for all measurement zones, including near-, transition

Wearable impedance monitoring system for dialysis patients.

Science.gov (United States)

Bonnet, S; Bourgerette, A; Gharbi, S; Rubeck, C; Arkouche, W; Massot, B; McAdams, E; Montalibet, A; Jallon, P

2016-08-01

This paper describes the development and the validation of a prototype wearable miniaturized impedance monitoring system for remote monitoring in home-based dialysis patients. This device is intended to assess the hydration status of dialysis patients using calf impedance measurements. The system is based on the low-power AD8302 component. The impedance calibration procedure is described together with the Cole parameter estimation and the hydric volume estimation. Results are given on a test cell to validate the design and on preliminary calf measurements showing Cole parameter variations during hemodialysis.

Progress in neutron beam development at the HFR Petten (feasibility study for a BNCT facility)

International Nuclear Information System (INIS)

Constantine, G.; Moss, R.L.; Watkins, P.R.D.; Perks, C.A.; Delafield, H.J.; Ross, D.; Voorbraak, W.P.; Paardekooper, A.; Freudenreich, W.E.; Stecher-Rasmussen, F.

1990-08-01

Boron Neutron Capture Therapy, using intermediate energy neutrons to achieve the deep penetration essential for treating brain tumours, can be implemented with a filtered reactor neutron beam. This is designed to minimize the mean energy of the neutrons to keep proton recoil damage to the scalp within normal tissue tolerance limits whilst delivering the required thermal neutron fluence to the tumour over a reasonably short period. This can only be realized in conjunction with a high power density reactor. At the Joint Research Centre Petten an optimized neutron filter is currently being built for installation into the HB11 beam tube of the High Flux Reactor HFR. Part of the development leading to this design has been an extensive study of broad spectrum, filtered beam performance on the HB7 beam tube facility. A wide range of calculations was performed using the Monte Carlo code, MCPN, supported by validation experiments in which several filter configuration incorporating aluminium, sulphur, liquid argon, titanium and cadmium were installed for low power measurements of the neutron fluence rate, neutron spectra and beam gamma-ray contamination. The measurements were carried out within a successful European collaboration. Evaluations were made of the reactor core edge and unfiltered beam spectra, for comparison with MCNP calculations. Multi-foil activation methods and also gamma dose determination in the filtered beam using thermo-luminescent detectors were performed by the ECN. The Harwell/ Birmingham University collaborators undertook the neutron spectrum measurements in the filtered beam. proton recoil spectrometry was used above 30 keV, combined with a multi-sphere and BF 3 chamber response modification technique. Subsequent spectrum adjustment was carried out with the SENSAK code. The agreement between the calculated and measured spectra has given confidence in the reactor and filter modelling methods used to design the HB11 therapy facility. (author). 12 refs

Unraveling surface and bulk trap states in lead halide perovskite solar cells using impedance spectroscopy

Science.gov (United States)

Han, Changfeng; Wang, Kai; Zhu, Xixiang; Yu, Haomiao; Sun, Xiaojuan; Yang, Qin; Hu, Bin

2018-03-01

Organic-inorganic hybrid perovskites (OIHPs) have been widely recognized as an excellent candidate for next-generation photovoltaic materials because of their highly efficient power conversion. Acquiring a complete understanding of trap states and dielectric properties in OIHP-based solar cells at the steady state is highly desirable in order to further explore and improve their optoelectronic functionalities and properties. We report CH3NH3PbI3-x Cl x -based planar solar cells with a power conversion efficiency (PCE) of 15.8%. The illumination intensity dependence of the current density-voltage (J-V) revealed the presence of trap-assisted recombination at low fluences. Non-destructive ac impedance spectroscopy (ac-IS) was applied to characterize the device at the steady state. The capacitance-voltage (C-V) spectra exhibited some distinct variations at a wide range of ac modulation frequencies with and without photo-excitations. Since the frequency-dependent chemical capacitance ({{C}μ }) is concerned with the surface and bulk related density of states (DOS) in CH3NH3PbI3-x Cl x , we verified this by fitting the corresponding DOS by a Gaussian distribution function. We ascertained that the electronic sub-gap trap states present in the solution processed CH3NH3PbI3-x Cl x and their distribution differs from the surface to the bulk. In fact, we demonstrated that both surfaces that were adjacent to the electron and hole transport layers featured analogous DOS. Despite this, photo- and bias-induced giant dielectric responses (i.e. both real and imaginary parts) were detected. A remarkable reduction of {{C}μ } at higher frequencies (i.e. more than 100 kHz) was ascribed to the effect of dielectric loss in CH3NH3PbI3-x Cl x .

Study on electrical impedance matching for broadband ultrasonic transducer

Energy Technology Data Exchange (ETDEWEB)

Kim, Geon Woo [University of Science and Technology, Daejeon (Korea, Republic of); Kim, Ki Bok [Korea Research Institute of Standards and Science, Center for Safety Measurement, Daejeon (Korea, Republic of); Baek, Kwang Sae [Elache Co., Busan (Korea, Republic of)

2017-02-15

Ultrasonic transducers with high resolution and resonant frequency are required to detect small defects (less than hundreds of μm) by ultrasonic testing. The resonance frequency and resolution of an ultrasonic transducer are closely related to the thickness of piezo-electric materials, backing materials, and the electric impedance matching technique. Among these factors, electrical impedance matching plays an important role because it can reduce the loss and reflection of ultrasonic energy differences in electrical impedance between an ultrasonic transducer and an ultrasonic defects detecting system. An LC matching circuit is the most frequently used electric matching method. It is necessary for the electrical impedance of an ultrasonic transducer to correspond to approximately 50 Ω to compensate the difference in electrical impedance between both connections. In this study, a 15 MHz immersion ultrasonic transducer was fabricated and an LC electrical impedance circuit was applied to that for having broad-band frequency characteristic.

Large polaron tunneling, magnetic and impedance analysis of magnesium ferrite nanocrystallite

Energy Technology Data Exchange (ETDEWEB)

Mahato, Dev K., E-mail: drdevkumar@yahoo.com [Department of Physics, National Institute of Technology Patna, Patna 800 005 (India); Majumder, Sumit [Department of Physics, Jadavpur University, Kolkata 700032 (India); Surface Physics and Material Science Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Banerjee, S. [Surface Physics and Material Science Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)

2017-08-15

{sub s}) may mainly result from the improvement of crystallinity and decrease of concentration of oxygen vacancies. Electrical properties were studied by ac conductivity, impedance and electric modulus measurements. The conduction in MFO is due to overlapping large polaron hopping mechanism.

AC conductivity and dielectric behavior of bulk Furfurylidenemalononitrile

Science.gov (United States)

El-Nahass, M. M.; Ali, H. A. M.

2012-06-01

AC conductivity and dielectric behavior for bulk Furfurylidenemalononitrile have been studied over a temperature range (293-333 K) and frequency range (50-5×106 Hz). The frequency dependence of ac conductivity, σac, has been investigated by the universal power law, σac(ω)=Aωs. The variation of the frequency exponent (s) with temperature was analyzed in terms of different conduction mechanisms, and it was found that the correlated barrier hopping (CBH) model is the predominant conduction mechanism. The temperature dependence of σac(ω) showed a linear increase with the increase in temperature at different frequencies. The ac activation energy was determined at different frequencies. Dielectric data were analyzed using complex permittivity and complex electric modulus for bulk Furfurylidenemalononitrile at various temperatures.

A Dynamic Consensus Algorithm to Adjust Virtual Impedance Loops for Discharge Rate Balancing of AC Microgrid Energy Storage Units

DEFF Research Database (Denmark)

Guan, Yajuan; Meng, Lexuan; Li, Chendan

2018-01-01

A dynamic consensus algorithm (DCA)-based coordinated secondary control with an autonomous current-sharing control strategy is proposed in this paper for balancing the discharge rate of energy storage systems (ESSs) in an islanded AC microgrid. The DCA is applied for information sharing between......, the proposed approach can provide higher system reliability, expandability, and flexibility due to its distributed control architecture. The proposed controller can effectively prevent operation failure caused by over-current and unintentional outage of DGs by means of balanced discharge rate control. It can...... also provide fast response and accurate current sharing performance. A generalizable linearized state-space model for n-DG network in the z-domain is also derived and proposed in this paper; the model includes electrical, controller, and communication parts. The system stability and parameter...

Frequency and voltage dependent profile of dielectric properties, electric modulus and ac electrical conductivity in the PrBaCoO nanofiber capacitors

Directory of Open Access Journals (Sweden)

S. Demirezen

Full Text Available In this study, praseodymium barium cobalt oxide nanofiber interfacial layer was sandwiched between Au and n-Si. Frequency and voltage dependence of ε′, ε′, tanδ, electric modulus (M′ and M″ and σac of PrBaCoO nanofiber capacitor have been investigated by using impedance spectroscopy method. The obtained experimental results show that the values of ε′, ε′, tanδ, M′, M″ and σac of the PrBaCoO nanofiber capacitor are strongly dependent on frequency of applied bias voltage. The values of ε′, ε″ and tanδ show a steep decrease with increasing frequency for each forward bias voltage, whereas the values of σac and the electric modulus increase with increasing frequency. The high dispersion in ε′ and ε″ values at low frequencies may be attributed to the Maxwell–Wagner and space charge polarization. The high values of ε′ may be due to the interfacial effects within the material, PrBaCoO nanofibers interfacial layer and electron effect. The values of M′ and M″ reach a maximum constant value corresponding to M∞ ≈ 1/ε∞ due to the relaxation process at high frequencies, but both the values of M′ and M″ approach almost to zero at low frequencies. The changes in the dielectric and electrical properties with frequency can be also attributed to the existence of Nss and Rs of the capacitors. As a result, the change in the ε′, ε″, tanδ, M′, M″ and ac electric conductivity (σac is a result of restructuring and reordering of charges at the PrBaCoO/n-Si interface under an external electric field or voltage and interface polarization. Keywords: Thin films, Electrical properties, Interface/interphase

Concentration Impedance in Testing of Solid Oxide Cells Revisited

DEFF Research Database (Denmark)

Mogensen, Mogens Bjerg; Ebbesen, Sune Dalgaard; Jensen, Søren Højgaard

2017-01-01

The concentration impedance originating from diffusion and reactant conversion impedance of the Ni-YSZ supported fuel electrode in solid oxide cell has been treated many times during the latest couple of decades. In spite of this, the separation of the diffusion impedance from the conversion...

Assay Methods for ACS Activity and ACS Phosphorylation by MAP Kinases In Vitro and In Vivo.

Science.gov (United States)

Han, Xiaomin; Li, Guojing; Zhang, Shuqun

2017-01-01

Ethylene, a gaseous phytohormone, has profound effects on plant growth, development, and adaptation to the environment. Ethylene-regulated processes begin with the induction of ethylene biosynthesis. There are two key steps in ethylene biosynthesis. The first is the biosynthesis of 1-aminocyclopropane-1-carboxylic acid (ACC) from S-Adenosyl-Methionine (SAM), a common precursor in many metabolic pathways, which is catalyzed by ACC synthase (ACS). The second is the oxidative cleavage of ACC to form ethylene under the action of ACC oxidase (ACO). ACC biosynthesis is the committing and generally the rate-limiting step in ethylene biosynthesis. As a result, characterizing the cellular ACS activity and understanding its regulation are important. In this chapter, we detail the methods used to measure, (1) the enzymatic activity of both recombinant and native ACS proteins, and (2) the phosphorylation of ACS protein by mitogen-activated protein kinases (MAPKs) in vivo and in vitro.

Assessment of chest impedance in relation to phonocardiography

DEFF Research Database (Denmark)

Zimmermann, Niels Henrik; Møller, Henrik; Hammershøi, Dorte

2010-01-01

the surface of the skin to the transducer. If the impedance of the skin is known, it may be possible to optimize the transducer to achieve an improved signal for a certain frequency range, while attenuating disturbing noise. Further, from a classical stethoscope it is known, that the sound picked up...... by the stethoscope can be influenced by changing the pressure on the chest piece of the stethoscope. A high pressure will stretch the skin similar to a drum skin, and attenuate lower frequencies, while lighter pressure will broaden the frequency range. By using an impedance tube (also known as standing wave tube......), it is possible to measure the impedance of the surface of the skin and at the same time investigate the influence of different pressures and diameters of a transducer. The impedance tube is made specifically with the purpose of measuring chest impedances in the frequency range from 50 Hz to 5 kHz. An MLS...

Possibilities of electrical impedance tomography in gynecology

International Nuclear Information System (INIS)

Trokhanova O V; Chijova Y A; Okhapkin M B; Korjenevsky A V; Tuykin T S

2013-01-01

The paper describes results of comprehensive EIT diagnostics of mammary glands and cervix. The data were obtained from examinations of 170 patients by EIT system MEM (multi-frequency electrical impedance mammograph) and EIT system GIT (gynecological impedance tomograph). Mutual dependence is discussed.

Entrance and Exit CSR Impedance for Non-Ultrarelativistic Beam

Energy Technology Data Exchange (ETDEWEB)

Li, Rui; Tsai, Cheng Ying [SLAC National Accelerator Lab., Menlo Park, CA (United States); Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States)

2017-05-01

For a high-brightness electron beam being transported through beamlines involving bending systems, the coherent synchrotron radiation (CSR) and longitudinal space charge (LSC) interaction could often cause microbunching instability. The semi-analytical Vlasov solver for microbunching gain* depends on the impedances for the relevant collective effects. The existing results for CSR impedances are usually obtained for the ultrarelativistic limit. To extend the microbunching analysis to cases of low energies, such as the case of an ERL merger, or to density modulations at extremely small wavelength, it is necessary to extend the impedance analysis to the non-ultrarelativistic regime. In this study, we present the impedance analysis for the transient CSR interaction in the non-ultrarelativistic regime, for transients including both entrance to and exit from a magnetic dipole. These impedance results will be compared to their ultra-relativistic counterparts**, and the corresponding wakefield obtained from the impedance for low-energy beams will be compared with the existing results of transient CSR wakefield for general beam energies***.

Investigation of conduction and relaxation phenomena in BaZrxTi1-xO3 (x=0.05) by impedance spectroscopy

Science.gov (United States)

Mahajan, Sandeep; Haridas, Divya; Ali, S. T.; Munirathnam, N. R.; Sreenivas, K.; Thakur, O. P.; Prakash, Chandra

2014-10-01

In present study we have prepared ferroelectric BaZrxTi1-xO3 (x=0.05) ceramic by conventional solid state reaction route and studied its electrical properties as a function of temperature and frequency. X-ray diffraction (XRD) analysis shows single-phase formation of the compound with orthorhombic crystal structure at room temperature. Impedance and electric modulus spectroscopy analysis in the frequency range of 40 Hz-1 MHz at high temperature (200-600 °C) suggests two relaxation processes with different time constant are involved which are attributed to bulk and grain boundary effects. Frequency dependent dielectric plot at different temperature shows normal variation with frequency while dielectric loss (tanδ) peak was found to obey an Arrhenius law with activation energy of 1.02 eV. The frequency-dependent AC conductivity data were also analyzed in a wide temperature range. In present work we have studied the role of grain and grain boundaries on the electrical behaviour of Zr-doped BaTiO3 and their dependence on temperature and frequency by complex impedance and modulus spectroscopy (CIS) technique in a wide frequency (40 Hz-1 MHz) and high temperature range.

Microelectrical Impedance Spectroscopy for the Differentiation between Normal and Cancerous Human Urothelial Cell Lines: Real-Time Electrical Impedance Measurement at an Optimal Frequency

Directory of Open Access Journals (Sweden)

Yangkyu Park

2016-01-01

Full Text Available Purpose. To distinguish between normal (SV-HUC-1 and cancerous (TCCSUP human urothelial cell lines using microelectrical impedance spectroscopy (μEIS. Materials and Methods. Two types of μEIS devices were designed and used in combination to measure the impedance of SV-HUC-1 and TCCSUP cells flowing through the channels of the devices. The first device (μEIS-OF was designed to determine the optimal frequency at which the impedance of two cell lines is most distinguishable. The μEIS-OF trapped the flowing cells and measured their impedance at a frequency ranging from 5 kHz to 1 MHz. The second device (μEIS-RT was designed for real-time impedance measurement of the cells at the optimal frequency. The impedance was measured instantaneously as the cells passed the sensing electrodes of μEIS-RT. Results. The optimal frequency, which maximized the average difference of the amplitude and phase angle between the two cell lines (p<0.001, was determined to be 119 kHz. The real-time impedance of the cell lines was measured at 119 kHz; the two cell lines differed significantly in terms of amplitude and phase angle (p<0.001. Conclusion. The μEIS-RT can discriminate SV-HUC-1 and TCCSUP cells by measuring the impedance at the optimal frequency determined by the μEIS-OF.

Impedance analysis on organic ultrathin layers

Energy Technology Data Exchange (ETDEWEB)

Bom, Sidhant; Wagner, Veit [Jacobs University Bremen, School of Engineering and Science, Campus Ring 8, 28759 Bremen (Germany)

2008-07-01

Impedance spectroscopy is a standard technique for thin film analysis to obtain important information as thicknesses, diffusion properties of mobile ions and leakage currents. The measured electrical impedance of a sample is modeled by a physical equivalent circuit of resistors and capacitors. In the present work this information is obtained as a function of frequency also for ultrathin organic layers in the monolayer regime. A series of semiconducting and insulating polymers (regioregular poly-3-hexylthiophene (rr-P3HT), polymethylmethacrylate (PMMA)) and self assembled monolayers (octadecyltrichlorosilane (OTS), hexamethyldisilazane (HMDS), thiolated phospholipids) were deposited either on highly n-doped silicon wafers or on gold surfaces. E.g. ultrathin layers were obtained by dip coating a silicon wafer in rr-P3HT solution in chloroform. The thickness of 2 nm determined for this system by impedance measurement agrees well with the atomic force microscopy analysis and corresponds to a single layer of polymer chains. The leakage current is seen as an ohmic contribution at low frequencies and allows a systematic optimization of process parameters. In summary, impedance spectroscopy allows very fast and convenient analysis of thin organic layers even down to the monolayer regime.

Quantification of coating aging using impedance measurements

NARCIS (Netherlands)

Westing, E.P.M. van; Weijde, D.H. van der; Vreijling, M.P.W.; Ferrari, G.M.; Wit, J.H.W. de

1998-01-01

This chapter shows the application results of a novel approach to quantify the ageing of organic coatings using impedance measurements. The ageing quantification is based on the typical impedance behaviour of barrier coatings in immersion. This immersion behaviour is used to determine the limiting

Mechanical impedance of the human body in vertical direction.

Science.gov (United States)

Holmlund, P; Lundström, R; Lindberg, L

2000-08-01

The mechanical impedance of the human body in sitting posture and vertical direction was measured during different experimental conditions, such as vibration level (0.5-1.4 m/s2), frequency (2-100 Hz), body weight (57-92 kg), relaxed and erect upper body posture. The outcome shows that impedance increases with frequency up to a peak at about 5 Hz after which it decreases in a complex manner which includes two additional peaks. The frequency at which the first and second impedance peak occurs decreases with higher vibration level. Erect, compared with relaxed body posture resulted in higher impedance magnitudes and with peaks located at somewhat higher frequencies. Heavy persons show higher impedance magnitudes and peaks at lower frequencies.

Electrical Impedance Measurements of PZT Nanofiber Sensors

Directory of Open Access Journals (Sweden)

Richard Galos

2017-01-01

Full Text Available Electrical impedance measurements of PZT nanofiber sensors were performed using a variety of methods over a frequency spectrum ranging from DC to 1.8 GHz. The nanofibers formed by electrospinning with diameters ranging from 10 to 150 nm were collected and integrated into sensors using microfabrication techniques. Special matching circuits with ultrahigh input impedance were fabricated to produce low noise, measurable sensor outputs. Material properties including resistivity and dielectric constant are derived from the impedance measurements. The resulting material properties are also compared with those of individual nanofibers being tested using conductive AFM and Scanning Conductive Microscopy.

Laboratory scale tests of electrical impedence tomography

International Nuclear Information System (INIS)

Binley, A; Daily, W; LaBredcque, D; Ramirez, A.

1998-01-01

Electrical impedance tomographs (magnitude and phase) of known, laboratory-scale targets are reported. Three methods are used to invert electrical impedance data and their tomographs compared. The first method uses an electrical resistance tomography (ERT) algonthm (designed for DC resistivity inversion) to perform impedance magnitude inversion and a linearized perturbation approach (PA) to invert the imaginary part. The second approximate method compares ERT magnitude inversions at two frequencies and uses the frequency effect (FE) to compute phase tomographs. The third approach, electrrcal impedance tomography (EIT), employs fully complex algebra to account for the real and imaginary components of electrical impedance data. The EIT approach provided useful magnitude and phase images for the frequency range of 0.0625 to 64 Hz; images for higher frequencies were not reliable. Comparisons of the ERT and EIT magnitude images show that both methods provided equivalent results for the water blank, copper rod and PVC rod targets. The EIT magnitude images showed better spatial resolutron for a sand-lead mixture target. Phase images located anomalies of both high and low contrast IP and provided better spatial resolution than the magnitude images. When IP was absent from the data, the EIT algorithm reconstructed phase values consistent with the data noise levels

RNA interference suppression of mucin 5AC (MUC5AC reduces the adhesive and invasive capacity of human pancreatic cancer cells

Directory of Open Access Journals (Sweden)

Yamada Nobuya

2010-05-01

Full Text Available Abstract Background MUC5AC is a secretory mucin normally expressed in the surface muconous cells of stomach and bronchial tract. It has been known that MUC5AC de novo expression occurred in the invasive ductal carcinoma and pancreatic intraepithelial neoplasm with no detectable expression in normal pancreas, however, its function remains uncertain. Here, we report the impact of MUC5AC on the adhesive and invasive ability of pancreatic cancer cells. Methods We used two MUC5AC expressing cell lines derived from human pancreatic cancer, SW1990 and BxPC3. Small-interfering (si RNA directed against MUC5AC were used to assess the effects of MUC5AC on invasion and adhesion of pancreas cancer cells in vitro and in vivo. We compared parental cells (SW1990 and BxPC3 with MUC5AC suppressed cells by si RNA (si-SW1990 and si-BxPC3. Results MUC5AC was found to express in more than 80% of pancreatic ductal carcinoma specimens. Next we observed that both of si-SW1990 and si-BxPC3 showed significantly lower adhesion and invasion to extracellular matrix components compared with parental cell lines. Expression of genes associated with adhesion and invasion including several integerins, matrix metalloproteinase (MMP -3 and vascular endothelial growth factor (VEGF were down-regulated in both MUC5AC suppressed cells. Furthermore, production of VEGF and phosphorylation of VEGFR-1 were significantly reduced by MUC5AC down regulation. Both of si-SW1990 and si-BxPC3 attenuated activation of Erk1/2. In vivo, si-SW1990 did not establish subcutaneous tumor in nude mice. Conclusions Knockdown of MUC5AC reduced the ability of pancreatic cancer cells to adhesion and invasion, suggesting that MUC5AC might contribute to the invasive motility of pancreatic cancer cells by enhancing the expression of integrins, MMP-3, VEGF and activating Erk pathway.

Gamma-irradiation produces active chlorine species (ACS) in physiological solutions: Secoisolariciresinol diglucoside (SDG) scavenges ACS - A novel mechanism of DNA radioprotection.

Science.gov (United States)

Mishra, Om P; Popov, Anatoliy V; Pietrofesa, Ralph A; Christofidou-Solomidou, Melpo

2016-09-01

Secoisolariciresinol diglucoside (SDG), the main lignan in whole grain flaxseed, is a potent antioxidant and free radical scavenger with known radioprotective properties. However, the exact mechanism of SDG radioprotection is not well understood. The current study identified a novel mechanism of DNA radioprotection by SDG in physiological solutions by scavenging active chlorine species (ACS) and reducing chlorinated nucleobases. The ACS scavenging activity of SDG was determined using two highly specific fluoroprobes: hypochlorite-specific 3'-(p-aminophenyl) fluorescein (APF) and hydroxyl radical-sensitive 3'-(p-hydroxyphenyl) fluorescein (HPF). Dopamine, an SDG structural analog, was used for proton (1)H NMR studies to trap primary ACS radicals. Taurine N-chlorination was determined to demonstrate radiation-induced generation of hypochlorite, a secondary ACS. DNA protection was assessed by determining the extent of DNA fragmentation and plasmid DNA relaxation following exposure to ClO(-) and radiation. Purine base chlorination by ClO(-) and γ-radiation was determined by using 2-aminopurine (2-AP), a fluorescent analog of 6-aminopurine. Chloride anions (Cl(-)) consumed >90% of hydroxyl radicals in physiological solutions produced by γ-radiation resulting in ACS formation, which was detected by (1)H NMR. Importantly, SDG scavenged hypochlorite- and γ-radiation-induced ACS. In addition, SDG blunted ACS-induced fragmentation of calf thymus DNA and plasmid DNA relaxation. SDG treatment before or after ACS exposure decreased the ClO(-) or γ-radiation-induced chlorination of 2-AP. Exposure to γ-radiation resulted in increased taurine chlorination, indicative of ClO(-) generation. NMR studies revealed formation of primary ACS radicals (chlorine atoms (Cl) and dichloro radical anions (Cl2¯)), which were trapped by SDG and its structural analog dopamine. We demonstrate that γ-radiation induces the generation of ACS in physiological solutions. SDG treatment scavenged

Impedance spectroscopy studies on lead free (Ba0.85Ca0.15(Ti0.9Zr0.1O3 ceramics

Directory of Open Access Journals (Sweden)

Ahcène Chaouchi

2012-12-01

Full Text Available The AC complex impedance spectroscopy technique has been used to obtain the electrical parameters of polycrystalline sample of (Ba0.85Ca0.15(Ti0.9Zr0.1O3 in a wide frequency range at different temperatures. This sample was prepared by a high temperature solid-state reaction technique and single phase formation was confirmed by X-ray diffraction technique. This study was carried out by the means of simultaneous analysis of impedance, modulus, and electrical conductivity. The Cole-Cole (Nyquist plots suggest that the grains and grain boundaries are responsible in the conduction mechanism of the material at high temperature. The ColeCole (Nyquist plot studies revealed the presence of grain and grain boundary effect at 485 °C. On the other hand, it showed only the presence of grain boundary component of the resistivity at 535 °C. Complex impedance analysis indicated the presence of non-Debye type dielectric relaxation. The bulk resistance of the material decreases with rise in temperature similar to a semiconductor, and the Cole-Cole (Nyquist plot showed the negative temperature coefficient of resistance (NTCR character of (Ba0.85Ca0.15(Ti0.9Zr0.1O3. The value of activation energy is found to be 0.7433 eV, which suggests that the conduction may be the result of defect and charge carriers present in the materials.

PREFACE: XV International Conference on Electrical Bio-Impedance (ICEBI) & XIV Conference on Electrical Impedance Tomography (EIT)

Science.gov (United States)

Pliquett, Uwe

2013-04-01

Over recent years advanced measurement methods have facilitated outstanding achievements not only in medical instrumentation but also in biotechnology. Impedance measurement is a simple and innocuous way to characterize materials. For more than 40 years biological materials, most of them based on cells, have been characterized by means of electrical impedance for quality control of agricultural products, monitoring of biotechnological or food processes or in health care. Although the list of possible applications is long, very few applications successfully entered the market before the turn of the century. This was, on the one hand, due to the low specificity of electrical impedance with respect to other material properties because it is influenced by multiple factors. On the other hand, equipment and methods for many potential applications were not available. With the appearance of microcontrollers that could be easily integrated in applications at the beginning of the 1980s, impedance measurement advanced as a valuable tool in process optimization and lab automation. However, established methods and data processing were mostly used in a new environment. This has changed significantly during the last 10 years with a dramatic growth of the market for medical instrumentation and also for biotechnological applications. Today, advanced process monitoring and control require fast and highly parallel electrical characterization which in turn yields incredible data volumes that must be handled in real time. Many newer developments require miniaturized but precise sensing methods which is one of the main parts of Lab-on-Chip technology. Moreover, biosensors increasingly use impedometric transducers, which are not compatible with the large expensive measurement devices that are common in the laboratory environment. Following the achievements in the field of bioimpedance measurement, we will now witness a dramatic development of new electrode structures and electronics

Hopping models and ac universality

DEFF Research Database (Denmark)

Dyre, Jeppe; Schrøder, Thomas

2002-01-01

Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....

Development of impedance matching technologies for ICRF antenna arrays

International Nuclear Information System (INIS)

Pinsker, R.I.

1998-01-01

All high-power ion cyclotron range of frequency (ICRF) heating systems include devices for matching the input impedance of the antenna array to the generator output impedance. For most types of antennas used, the input impedance is strongly time dependent on timescales as rapid as 10 -1 s, while the radio frequency (RF) generators used are capable of producing full power only into a stationary load impedance. Hence, the dynamic response of the matching method is of great practical importance. In this paper, world-wide developments in this field over the past decade are reviewed. These techniques may be divided into several classes. The edge plasma parameters that determine the antenna array's input impedance may be controlled to maintain a fixed load impedance. The frequency of the RF source can be feedback controlled to compensate for changes in the edge plasma conditions, or fast variable tuning elements in the transmission line between the generator output and the antenna input connections can provide the necessary time-varying impedance transformation. In 'lossy passive schemes', reflected power due to the time-varying impedance of the antenna array is diverted to a dummy load. Each of these techniques can be applied to a pre-existing antenna system. If a new antenna is to be designed, recent advances allow the antenna array to have the intrinsic property of presenting a constant load to the feeding transmission lines despite the varying load seen by each antenna in the array. (author)

Development of impedance matching technologies for ICRF antenna arrays

International Nuclear Information System (INIS)

Pinsker, R.I.

1998-03-01

All high power ICRF heating systems include devices for matching the input impedance of the antenna array to the generator output impedance. For most types of antennas used, the input impedance is strongly time-dependent on timescales as rapid as 10-4 s, while the rf generators used are capable of producing full power only into a stationary load impedance. Hence, the dynamic response of the matching method is of great practical importance. In this paper, world-wide developments in this field over the past decade are reviewed. These techniques may be divided into several classes. The edge plasma parameters that determine the antenna array's input impedance may be controlled to maintain a fixed load impedance. The frequency of the rf source can be feedback controlled to compensate for changes in the edge plasma conditions, or fast variable tuning elements in the transmission line between the generator output and the antenna input connections can provide the necessary time-varying impedance transformation. In lossy passive schemes, reflected power due to the time-varying impedance of the antenna array is diverted to a dummy load. Each of these techniques can be applied to a pre-existing antenna system. If a new antenna is to be designed, recent advances allow the antenna array to have the intrinsic property of presenting a constant load to the feeding transmission lines despite the varying load seen by each antenna in the array

Real-Time Thevenin Impedance Computation

DEFF Research Database (Denmark)

Sommer, Stefan Horst; Jóhannsson, Hjörtur

2013-01-01

operating state, and strict time constraints are difficult to adhere to as the complexity of the grid increases. Several suggested approaches for real-time stability assessment require Thevenin impedances to be determined for the observed system conditions. By combining matrix factorization, graph reduction......, and parallelization, we develop an algorithm for computing Thevenin impedances an order of magnitude faster than previous approaches. We test the factor-and-solve algorithm with data from several power grids of varying complexity, and we show how the algorithm allows realtime stability assessment of complex power...

Electrical Impedance Tomography Technology

Data.gov (United States)

National Aeronautics and Space Administration — The goal for the Electrical Impedance Tomography Technology (EITT) project is to develop a reliable portable, lightweight device providing two-dimensional...

Coupling slots without shunt impedance drop

International Nuclear Information System (INIS)

Balleyguier, P.

1996-01-01

It is well known that coupling slots between adjacent cells in a π-mode structure reduce shunt impedance per unit length with respect to single cell cavities. To design optimized coupling slots, one has to answer the following question: for a given coupling factor, what shape, dimension, position and number of slots lead to the lowest shunt impedance drop? A numerical study using the 3D code MAFIA has been carried out. The aim was to design the 352 MHz cavities for the high intensity proton accelerator of the TRISPAL project. The result is an unexpected set of four 'petal' slots. Such slots should lead to a quasi-negligible drop in shunt impedance: about -1% on average, for particle velocity from 0.4 c to 0.8 c. (author)

Impedance calculations for 2-D and 3-D structures and the impedance budget of 7-GeV APS [Advanced Photon Source] storage ring

International Nuclear Information System (INIS)

Chou, W.; Jin, Y.

1989-01-01

For the storage ring of the 7-GeV Advanced Photon Source (APS), we numerically calculate the longitudinal and the transverse coupling impedances of various kinds of two- and three-dimensional structures. It is shown that the RF cavities are the main contributors to the longitudinal impedance, whereas the transitions between the chamber and the insertion device section dominate the transverse one. Several different numerical approaches are adopted. It is argued that the broadband resonator model may not be appropriate to model the longitudinal impedance. Several interesting phenomena of general interest, including a composition rule and the negative transverse impedance, are discussed. Based on our numerical results and other results available, the impedance budget of the storage ring is established. 9 refs., 8 figs., 1 tab

Transport AC losses in YBCO coated conductors

Energy Technology Data Exchange (ETDEWEB)

Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)

2007-09-15

Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.

Detection of irradiated potatoes by impedance measurement

International Nuclear Information System (INIS)

Hayashi, T.; Todoriki, S.; Otobe, K.; Sugiyama, J.

1996-01-01

Potato is one of the major food items to be treated with ionising radiation and potatoes are irradiated on a large scale in several countries. Every year around 15,000 t of potatoes are irradiated at doses of 60 to 150 Gy (average dose is about 100 Gy) in Japan. Although various methods to detect irradiated potatoes have been investigated, no established method has been reported. Measuring electrical conductivity or impedance of potatoes has been reported as a promising method for the detection of irradiated potatoes. In previous studies it has been found that the ratio of impedance magnitude at 50 kHz to that at 5 kHz, measured immediately after puncturing a potato tuber, is dependent upon the dose applied to the tuber, independent of storage temperature and stable during storage after irradiation. The aim of this study was to establish the optimum conditions for impedance measurement and to examine the applicability of the impedance measuring method to various cultivars (cv.) of potatoes. (author)

A Batteryless Sensor ASIC for Implantable Bio-Impedance Applications.

Science.gov (United States)

Rodriguez, Saul; Ollmar, Stig; Waqar, Muhammad; Rusu, Ana

2016-06-01

The measurement of the biological tissue's electrical impedance is an active research field that has attracted a lot of attention during the last decades. Bio-impedances are closely related to a large variety of physiological conditions; therefore, they are useful for diagnosis and monitoring in many medical applications. Measuring living tissues, however, is a challenging task that poses countless technical and practical problems, in particular if the tissues need to be measured under the skin. This paper presents a bio-impedance sensor ASIC targeting a battery-free, miniature size, implantable device, which performs accurate 4-point complex impedance extraction in the frequency range from 2 kHz to 2 MHz. The ASIC is fabricated in 150 nm CMOS, has a size of 1.22 mm × 1.22 mm and consumes 165 μA from a 1.8 V power supply. The ASIC is embedded in a prototype which communicates with, and is powered by an external reader device through inductive coupling. The prototype is validated by measuring the impedances of different combinations of discrete components, measuring the electrochemical impedance of physiological solution, and performing ex vivo measurements on animal organs. The proposed ASIC is able to extract complex impedances with around 1 Ω resolution; therefore enabling accurate wireless tissue measurements.

Expression Study of LeGAPDH, LeACO1, LeACS1A, and LeACS2 in Tomato Fruit (Solanum lycopersicum

Directory of Open Access Journals (Sweden)

Pijar Riza Anugerah

2015-10-01

Full Text Available Tomato is a climacteric fruit, which is characterized by ripening-related increase of respiration and elevated ethylene synthesis. Ethylene is the key hormone in ripening process of climacteric fruits. The objective of this research is to study the expression of three ethylene synthesis genes: LeACO1, LeACS1A, LeACS2, and a housekeeping gene LeGAPDH in ripening tomato fruit. Specific primers have been designed to amplify complementary DNA fragment of LeGAPDH (143 bp, LeACO1 (240 bp, LeACS1A (169 bp, and LeACS2 (148 bp using polymerase chain reaction. Nucleotide BLAST results of the complementary DNA fragments show high similarity with LeGAPDH (NM_001247874.1, LeACO1 (NM_001247095.1, LeACS1A (NM_001246993.1, LeACS2 (NM_001247249.1, respectively. Expression study showed that LeACO1, LeACS1A, LeACS2, and LeGAPDH genes were expressed in ripening tomato fruit. Isolation methods, reference sequences, and primers used in this study can be used in future experiments to study expression of genes responsible for ethylene synthesis using quantitative polymerase chain reaction and to design better strategy for controlling fruit ripening in agroindustry.

CSR Impedance for Non-Ultrarelativistic Beams

International Nuclear Information System (INIS)

Li, Rui; Tsai, Cheng Y.

2015-09-01

For the analysis of the coherent synchrotron radiation (CSR)-induced microbunching gain in the low energy regime, such as when a high-brightness electron beam is transported through a low-energy merger in an energy-recovery linac (ERL) design, it is necessary to extend the CSR impedance expression in the ultrarelativistic limit to the non-ultrarelativistic regime. This paper presents our analysis of CSR impedance for general beam energies.

Electrical impedance tomography

Science.gov (United States)

Lobo, Beatriz; Hermosa, Cecilia; Abella, Ana

2018-01-01

Continuous assessment of respiratory status is one of the cornerstones of modern intensive care unit (ICU) monitoring systems. Electrical impedance tomography (EIT), although with some constraints, may play the lead as a new diagnostic and guiding tool for an adequate optimization of mechanical ventilation in critically ill patients. EIT may assist in defining mechanical ventilation settings, assess distribution of tidal volume and of end-expiratory lung volume (EELV) and contribute to titrate positive end-expiratory pressure (PEEP)/tidal volume combinations. It may also quantify gains (recruitment) and losses (overdistention or derecruitment), granting a more realistic evaluation of different ventilator modes or recruitment maneuvers, and helping in the identification of responders and non-responders to such maneuvers. Moreover, EIT also contributes to the management of life-threatening lung diseases such as pneumothorax, and aids in guiding fluid management in the critical care setting. Lastly, assessment of cardiac function and lung perfusion through electrical impedance is on the way. PMID:29430443

Frequency effects on charge ordering in Y{sub 0.5}Ca{sub 0.5}MnO{sub 3} by impedance spectroscopy

Energy Technology Data Exchange (ETDEWEB)

Sarwar, Tuba, E-mail: sarwartuba@gmail.com [EMMG, Physics Division, PINSTECH, P. O. Nilore, Islamabad (Pakistan); DPAM, PIEAS, P. O. Nilore, Islamabad (Pakistan); Qamar, Afzaal [Queensland Micro-Nanotechnology Centre, Griffith University, Nathan, QLD 4111 (Australia); Nadeem, Muhammad [EMMG, Physics Division, PINSTECH, P. O. Nilore, Islamabad (Pakistan)

2015-02-01

In this work, structural and electrical properties of Y{sub 0.5}Ca{sub 0.5}MnO{sub 3} are investigated by employing X-ray diffraction and impedance spectroscopy, respectively. Applied ac electric field showed the charge ordering transition temperature around 265 K and below this temperature the heteromorphic behavior of the sample is discussed in the proximity of T{sub CO}. With frequency effects the volume of robust charge orbital ordering (COO) domains diminishes due to different competing phases along with Jahn Teller distortions. Comprehensive melting and collapse of charge orbital ordering occurs below T{sub N}(125 K), where a colossal drop in the value of impedance is observed. The change in profile of modulus plane plots determines the spreading of relaxation time of intermingled phases. Hopping mechanism is elaborated in terms of strong electron phonon coupling. Variable range hopping model and Arrhenius model are used to discuss the short and long range hopping between Mn{sup 3+} and Mn{sup 4+} channels assessing the activation energy E{sub a}. - Highlights: • Present study contains a detailed investigation over the electrical and structural properties of Y{sub 0.5}Ca{sub 0.5}MnO{sub 3} especially its behavior across the charge ordering transition. • Impedance measurements illustrate the comprehensive melting and collapse of robust charge orbital ordering with colossal drop in impedance. • In T{sub N}

Dicty_cDB: FC-AC21 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ

Impedance of Surface Footings on Layered Ground

DEFF Research Database (Denmark)

Andersen, Lars; Clausen, Johan

2008-01-01

is discussed. Based on the Green's function for a stratified half-space, the impedance of a surface footing with arbitrary shape is computed. A wind turbine foundation is analysed in the frequency range 0-3 Hz. Analyses show that soil stratification may lead to significant changes in the impedance related...

Ac-electrical conductivity of poly(propylene) before and after X-ray irradiation

International Nuclear Information System (INIS)

Gaafar, M.

2001-01-01

Study on the ac-electrical conductivity of poly(propylene), before and after X-ray irradiation within the temperature range 300-360 K are reported. The measurements have been performed in a wide range of frequencies (from 0 to 10 5 Hz) and under the effect of different X-ray irradiation doses (from 0 to 15 Gy). Cole-Cole diagrams have been used to show the frequency dependence of the complex impedance at different temperatures. The results exhibit semicircles which are consistent with existing equivalent circuit model. Analysis of the results reveal semiconducting features based mainly on a hopping mechanism. The study shows a pronounced effect of X-ray irradiation on the electrical conductivity at zero frequency σ DC . At the early stage of irradiation, σ DC increased as a result of free radical formation. As the irradiation progressed, it decreased as a result of crosslinking, then it increased again due to irradiation induced degradation, which motivates the generation of mobile free radicals. The study shows that this polymer is one among other polymers which its electrical conductivity is modified by irradiation

Ac-electrical conductivity of poly(propylene) before and after X-ray irradiation

Science.gov (United States)

Gaafar, M.

2001-05-01

Study on the ac-electrical conductivity of poly(propylene), before and after X-ray irradiation within the temperature range 300-360 K are reported. The measurements have been performed in a wide range of frequencies (from 0 to 10 5 Hz) and under the effect of different X-ray irradiation doses (from 0 to 15 Gy). Cole-Cole diagrams have been used to show the frequency dependence of the complex impedance at different temperatures. The results exhibit semicircles which are consistent with existing equivalent circuit model. Analysis of the results reveal semiconducting features based mainly on a hopping mechanism. The study shows a pronounced effect of X-ray irradiation on the electrical conductivity at zero frequency σDC. At the early stage of irradiation, σDC increased as a result of free radical formation. As the irradiation progressed, it decreased as a result of crosslinking, then it increased again due to irradiation induced degradation, which motivates the generation of mobile free radicals. The study shows that this polymer is one among other polymers which its electrical conductivity is modified by irradiation.

THERMIONIC AC GENERATION

Science.gov (United States)

is shown that the maximum ac efficiency is equal to approximately 70% of the corresponding dc value. An illustrative example, including a proposed design for a rather unconventional transformer, is appended. (Author)

Time-domain representation of frequency-dependent foundation impedance functions

Science.gov (United States)

Safak, E.

2006-01-01

Foundation impedance functions provide a simple means to account for soil-structure interaction (SSI) when studying seismic response of structures. Impedance functions represent the dynamic stiffness of the soil media surrounding the foundation. The fact that impedance functions are frequency dependent makes it difficult to incorporate SSI in standard time-history analysis software. This paper introduces a simple method to convert frequency-dependent impedance functions into time-domain filters. The method is based on the least-squares approximation of impedance functions by ratios of two complex polynomials. Such ratios are equivalent, in the time-domain, to discrete-time recursive filters, which are simple finite-difference equations giving the relationship between foundation forces and displacements. These filters can easily be incorporated into standard time-history analysis programs. Three examples are presented to show the applications of the method.

21 CFR 880.6320 - AC-powered medical examination light.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered medical examination light. 880.6320... Miscellaneous Devices § 880.6320 AC-powered medical examination light. (a) Identification. An AC-powered medical examination light is an AC-powered device intended for medical purposes that is used to illuminate body...

Reliability of impedance cardiography in measuring central haemodynamics

DEFF Research Database (Denmark)

Mehlsen, J; Bonde, J; Stadeager, C

1991-01-01

The purpose of the study described here was to investigate the reliability of impedance cardiography (IC) in measuring cardiac output (CO) and central blood volume. Absolute values and changes in these variables obtained by impedance cardiography and by isotope- or thermodilution techniques were...... suitable for repeated measurements in studies on the haemodynamic effects of physiological or pharmacological intervention. Impedance cardiography is sufficiently reliable for comparison of absolute values of CO between different groups of patients. We cannot recommend impedance cardiography...... healthy subjects and in 25 unmedicated patients with ischaemic heart disease. We obtained significant correlations between absolute values (y = 0.68x + 1.48) and changes (y = 1.00x + 0.0003) in CO measured by IC and isotope- or thermodilution. IC significantly overestimated absolute values of CO (P less...

Impedance of Surface Footings on Layered Ground

DEFF Research Database (Denmark)

Andersen, Lars; Clausen, Johan Christian

2005-01-01

is discussed. Based on the Green's function for a stratified half-space, the impedance of a surface footing with arbitrary shape is computed. A wind turbine foundation is analysed in the frequency range 0 to 3 Hz. Analyses show that soil stratification may lead to a significant changes in the impedance related...

Ac-dc converter firing error detection

International Nuclear Information System (INIS)

Gould, O.L.

1996-01-01

Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal

Impedance spectroscopic and dielectric analysis of Ba0.7Sr0.3TiO3 thin films

International Nuclear Information System (INIS)

Rouahi, A.; Kahouli, A.; Sylvestre, A.; Defaÿ, E.; Yangui, B.

2012-01-01

Highlights: ► The material exhibits the contribution of both grain and grain boundaries in the electric response of Ba 0.7 Sr 0.3 TiO 3 . ► The plot of normalized complex dielectric modulus and impedance as a function of frequency exhibits both short and long-range conduction in the film. ► The frequency dependence of ac conductivity exhibits a polaron hopping mechanism with activation energy of 0.38 eV. ► The complex dielectric modulus analysis confirmed the presence of a non-Debye type of conductivity relaxation deduced from the KWW function. - Abstract: Polycrystalline Ba 0.7 Sr 0.3 TiO 3 thin film with Pt/BST/Pt/TiO 2 /SiO 2 structure was prepared by ion beam sputtering. The film was post annealed at 700 °C. The dielectric and electric modulus properties were studied by impedance spectroscopy over a wide frequency range [0.1–10 5 Hz] at different temperatures [175–350 °C]. The Nyquist plots (Z″ vs . Z′) show the contribution of both grain and grain boundaries at higher temperature on the electric response of BST thin films. Moreover, the resistance of grains decreases with the rise in temperature and the material exhibits a negative temperature coefficient of resistance. The electric modulus plot indicates the non-Debye type of dielectric relaxation. The values of the activation energy computed from both plots of Z″ and M″ are 0.86 eV and 0.81 eV respectively, which reveals that the species responsible for conduction are the same. The scaling behavior of M ″ /M ″ max shows the temperature independent nature of relaxation time. The plot of normalized complex dielectric modulus and impedance as a function of frequency exhibits both short and long-range conduction in the film.

Numerical simulation on the energy spectrum of the electron beam generated by low-impedance diode and the influence of external magnetic field on diode impedance

International Nuclear Information System (INIS)

Liu Guozhi

2003-01-01

The energy spectrum of the electron beam generated by low-impedance diode and the influence of external magnetic field on the impedance of diode are studied numerically in this paper. The results show that the beam generated by the diode has an energy spread, even with constant applied voltage. Additionally, external magnetic field has great but reverse influence on the impedance of low-impedance diode, which is, according to the author's analysis, the result of the change of the electron's track due to external magnetic field. If the beam current is less than the critical one for self-pinch, the impedance will be constant with the variation of external magnetic field

Transcranial Alternating Current Stimulation (tACS Mechanisms and Protocols

Directory of Open Access Journals (Sweden)

Amir V. Tavakoli

2017-09-01

Full Text Available Perception, cognition and consciousness can be modulated as a function of oscillating neural activity, while ongoing neuronal dynamics are influenced by synaptic activity and membrane potential. Consequently, transcranial alternating current stimulation (tACS may be used for neurological intervention. The advantageous features of tACS include the biphasic and sinusoidal tACS currents, the ability to entrain large neuronal populations, and subtle control over somatic effects. Through neuromodulation of phasic, neural activity, tACS is a powerful tool to investigate the neural correlates of cognition. The rapid development in this area requires clarity about best practices. Here we briefly introduce tACS and review the most compelling findings in the literature to provide a starting point for using tACS. We suggest that tACS protocols be based on functional brain mechanisms and appropriate control experiments, including active sham and condition blinding.

Iterative Reconstruction Methods for Hybrid Inverse Problems in Impedance Tomography

DEFF Research Database (Denmark)

Hoffmann, Kristoffer; Knudsen, Kim

2014-01-01

For a general formulation of hybrid inverse problems in impedance tomography the Picard and Newton iterative schemes are adapted and four iterative reconstruction algorithms are developed. The general problem formulation includes several existing hybrid imaging modalities such as current density...... impedance imaging, magnetic resonance electrical impedance tomography, and ultrasound modulated electrical impedance tomography, and the unified approach to the reconstruction problem encompasses several algorithms suggested in the literature. The four proposed algorithms are implemented numerically in two...

Impedance measurements of components for the ALS

International Nuclear Information System (INIS)

Corlett, J.N.; Rimmer, R.A.

1993-05-01

The high current and short bunch length of the ALS beam make the machine susceptible to beam instabilities over a frequency range extending to 13 GHz and beyond. All components of the storage ring have been carefully designed to minimize the impedance presented to the beam, and assemblies have been laid out to avoid resonant enclosures between components. Novel bellows shields allowing considerable mechanical movement while maintaining a low impedance are described. Results are presented of impedance measurements of ALS components and assemblies of components, using a precision coaxial wire technique in frequency domain, extending to frequencies beyond cut-off. All measurements were performed at the Lambertson Beam Electrodynamics Laboratory of the Center for Beam Physics at LBL

Bunch length and impedance measurements in SPEAR

International Nuclear Information System (INIS)

Bane, K.; Donald, M.; Hofmann, A.; Jowett, J.; Lockman, W.; Morton, P.; Stege, R.; Spence, W.; Wilson, P.

1988-05-01

Subsequent to an extensive smoothing of the vacuum chamber a comprehensive study of the SPEAR impedance was undertaken. Bunch length, synchrotron quadrupole mode frequency, and parasitic mode loss were measured as functions of beam current. The results showed that, although the gross longitudinal impedance had indeed been reduced, the 'capacitive' component had also decreased relative to the 'inductive'--to the extent that previously compensated potential well distortion now induced bunch lengthening at low currents, and the turbulent threshold had actually been lowered. A specially designed multi-cell disc-loaded 'capacitor' cavity was shown to be capable of removing this effect by restoring the original compensation. A model of the new SPEAR impedance is also obtained. 7 refs., 6 figs

Bunch length and impedance measurements in SPEAR

International Nuclear Information System (INIS)

Bane, K.; Donald, M.; Morton, P.; Stege, R.; Spence, W.; Wilson, P.; Hofmann, A.; Jowett, J.; Lockman, W.

1988-01-01

Subsequent to an extensive smoothing of the vacuum chamber a comprehensive study of the SPEAR impedance was undertaken. Bunch length, synchrotron quadrupole mode frequency, and parasitic mode loss were measured as functions of beam current. This paper shows that although the gross longitudinal impedance had indeed been reduced, the capacitive component had also decreased relative to the inductive - to the extent that previously compensated potential well distortion now induced bunch lengthening at low currents, and the turbulent threshold had actually been lowered. A specially designed multi-cell disc-loaded capacitor cavity was shown to be capable of removing this effect by restoring the original compensation. A model of the new SPEAR impedance is also obtained

RHIC ABORT KICKER WITH REDUCED COUPLING IMPEDANCE

International Nuclear Information System (INIS)

HAHN, H.; DAVINO, D.

2002-01-01

Kicker magnets typically represent the most important contributors to the transverse impedance budget of accelerators and storage rings. Methods of reducing the impedance value of the SNS extraction kicker presently under construction and, in view of a future performance upgrade, that of the RHIC abort kicker have been thoroughly studied at this laboratory. In this paper, the investigation of a potential improvement from using ferrite different from the BNL standard CMD5005 is reported. Permeability measurements of several ferrite types have been performed. Measurements on two kicker magnets using CMD5005 and C2050 suggest that the impedance of a magnet without external resistive damping, such as the RHIC abort kicker, would benefit

Identification of Critical Transmission Limits in Injection Impedance Plane

DEFF Research Database (Denmark)

Jóhannsson, Hjörtur; Østergaard, Jacob; Nielsen, Arne Hejde

2012-01-01

In this paper, equations are derived that describe the mapping of critical boundaries and characteristic lines from the three dimensionalPQV-surface into the two-dimensional injection impedance plane (load impedance plane for both positive and negativeresistance). The expressions derived....... The situational awareness method will bedescribed in a later paper, where this paper focuses on the derivations of some system characteristics in the injection (or load)impedance plane. The critical lines from the PQV-surface that are mapped into the impedance plane are the ones representing theconditions where...... the partial derivatives of the variables P,Q and V in respect to each other become zero. In addition to the mappingof the critical lines, some characteristic lines are mapped as well. These include the mapping of the lines of constant P,Q,Vand d from the PQV-surface into the impedance plane. All of the mapped...

impedance calculations of induction machine rotor conductors.

African Journals Online (AJOL)

Dr Obe

computed. The parallel R-L network shown in figure 3 is used in the modeling of the rotor bars. The network total impedance is given by,. (19). Where,. 5. simulation Results. MATLAB m-file for the calculation of the total impedance of the rectangular and trapezoidal rotor bars is developed [10]. The parameters of the bars.

ZBASE User's Guide Version 1.1 an Impedance Data Base Program

CERN Document Server

Brüning, Oliver Sim

1996-01-01

The development of an impedance data base program was motivated by the changing impedance budgets in the LEP and LHC machines and the resulting need to recalculate the instability thresholds for different parameters. For LEP, the changes are implied by the LEP-II upgrade and for the LHC, the impedance data for most items is still being calculated and continues to change as the geometries of the impedance components converge to a final design. The development of the {\\bf ZBASE} program was guided by four goals. First, the data base program should collect the impedance information in a central place and in a standard format which allows easy access. Second, it should include information required for estimating the impact of the impedance on the beam dynamics. Third, the program should provide a user friendly graphical interface and fourth, it should provide an interface to the programs that are used for calculating the impedance data. Collecting not only the impedance data but also the input files for the progr...

Modern Trends in Imaging XI: Impedance Measurements in the Biomedical Sciences

Directory of Open Access Journals (Sweden)

Frederick D. Coffman

2012-01-01

Full Text Available Biological organisms and their component organs, tissues and cells have unique electrical impedance properties. Impedance properties often change with changes in structure, composition, and metabolism, and can be indicative of the onset and progression of disease states. Over the past 100 years, instruments and analytical methods have been developed to measure the impedance properties of biological specimens and to utilize these measurements in both clinical and basic science settings. This chapter will review the applications of impedance measurements in the biomedical sciences, from whole body analysis to impedance measurements of single cells and cell monolayers, and how cellular impedance measuring instruments can now be used in high throughput screening applications.

Different radiation impedance models for finite porous materials

DEFF Research Database (Denmark)

Nolan, Melanie; Jeong, Cheol-Ho; Brunskog, Jonas

2015-01-01

The Sabine absorption coefficients of finite absorbers are measured in a reverberation chamber according to the international standard ISO 354. They vary with the specimen size essentially due to diffraction at the specimen edges, which can be seen as the radiation impedance differing from...... the infinite case. Thus, in order to predict the Sabine absorption coefficients of finite porous samples, one can incorporate models of the radiation impedance. In this study, different radiation impedance models are compared with two experimental examples. Thomasson’s model is compared to Rhazi’s method when...

Electrochemical Characterization of a PEMEC Using Impedance Spectroscopy

DEFF Research Database (Denmark)

Elsøe, Katrine; Grahl-Madsen, L.; Hjelm, Johan

2017-01-01

In this study, electrochemical impedance spectroscopy (EIS) is applied in combination with cyclic voltammetry (CV) and current density – cell voltage curves (iV-curves) to investigate the processes contributing to the total impedance of a polymer electrolyte membrane electrolysis cell (PEMEC). i......V-curves were linear above 0.35 A cm−2 implying ohmic processes to be performance limiting, however the impedance spectra showed three arcs indicating three electrochemical reactions at these conditions not to be purely ohmic, but also to have capacitive properties. A hypothesis that the composite Ir...

Characterisation of AC1: a naturally decaffeinated coffee

Directory of Open Access Journals (Sweden)

Luciana Benjamim Benatti

2012-01-01

Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.

A multi-channel AC power supply controller

International Nuclear Information System (INIS)

Su Hong; Li Xiaogang; Ma Xiaoli; Zhou Bo; Yin Weiwei

2003-01-01

A multi-channel ac power supply controller developed recently by authors is introduced briefly in this paper. This controller is a computer controlled multi-electronic-switch device. This controller was developed for the automatic control and monitoring system of a 220 V ac power supply system, it is a key front-end device of the automatic control and monitoring system. There is an electronic switch in each channel, the rated load power is ≤1 kW/each channel. Another function is to sample the 220 V ac output voltage so that computer can monitor the operation state of each electronic switch. Through these switches, the 220 V ac power supply is applied to some device or apparatus that need to be powered by 220 V ac power supply. In the design, a solid-state relay was employed as an electronic switch. This controller can be connected in cascade mode. There are 8 boxes at most can be connected in cascade mode. The length of control word is 8 bit, which contains addressing information and electronic switch state setting information. The sampling output of the controller is multiplexed. It is only one bit that indicates the operating state of an electronic switch. This controller has been used in an automatic control and monitoring system for 220 V ac power supply system

Bioinformatics and Astrophysics Cluster (BinAc)

Science.gov (United States)

Krüger, Jens; Lutz, Volker; Bartusch, Felix; Dilling, Werner; Gorska, Anna; Schäfer, Christoph; Walter, Thomas

2017-09-01

BinAC provides central high performance computing capacities for bioinformaticians and astrophysicists from the state of Baden-Württemberg. The bwForCluster BinAC is part of the implementation concept for scientific computing for the universities in Baden-Württemberg. Community specific support is offered through the bwHPC-C5 project.

Impedance computations and beam-based measurements: A problem of discrepancy

Science.gov (United States)

Smaluk, Victor

2018-04-01

High intensity of particle beams is crucial for high-performance operation of modern electron-positron storage rings, both colliders and light sources. The beam intensity is limited by the interaction of the beam with self-induced electromagnetic fields (wake fields) proportional to the vacuum chamber impedance. For a new accelerator project, the total broadband impedance is computed by element-wise wake-field simulations using computer codes. For a machine in operation, the impedance can be measured experimentally using beam-based techniques. In this article, a comparative analysis of impedance computations and beam-based measurements is presented for 15 electron-positron storage rings. The measured data and the predictions based on the computed impedance budgets show a significant discrepancy. Three possible reasons for the discrepancy are discussed: interference of the wake fields excited by a beam in adjacent components of the vacuum chamber, effect of computation mesh size, and effect of insufficient bandwidth of the computed impedance.

Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium

Energy Technology Data Exchange (ETDEWEB)

Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others

2014-10-01

Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)

Wave impedance selection for passivity-based bilateral teleoperation

Science.gov (United States)

D'Amore, Nicholas John

When a task must be executed in a remote or dangerous environment, teleoperation systems may be employed to extend the influence of the human operator. In the case of manipulation tasks, haptic feedback of the forces experienced by the remote (slave) system is often highly useful in improving an operator's ability to perform effectively. In many of these cases (especially teleoperation over the internet and ground-to-space teleoperation), substantial communication latency exists in the control loop and has the strong tendency to cause instability of the system. The first viable solution to this problem in the literature was based on a scattering/wave transformation from transmission line theory. This wave transformation requires the designer to select a wave impedance parameter appropriate to the teleoperation system. It is widely recognized that a small value of wave impedance is well suited to free motion and a large value is preferable for contact tasks. Beyond this basic observation, however, very little guidance exists in the literature regarding the selection of an appropriate value. Moreover, prior research on impedance selection generally fails to account for the fact that in any realistic contact task there will simultaneously exist contact considerations (perpendicular to the surface of contact) and quasi-free-motion considerations (parallel to the surface of contact). The primary contribution of the present work is to introduce an approximate linearized optimum for the choice of wave impedance and to apply this quasi-optimal choice to the Cartesian reality of such a contact task, in which it cannot be expected that a given joint will be either perfectly normal to or perfectly parallel to the motion constraint. The proposed scheme selects a wave impedance matrix that is appropriate to the conditions encountered by the manipulator. This choice may be implemented as a static wave impedance value or as a time-varying choice updated according to the

DSC, Raman and impedance spectroscopy studies on the xB2O3 - (90 - x)TeO2 - 10TiO2 (where x = 0 to 50 mol%) glass system

Science.gov (United States)

Sripada, Suresh; Rani, D. Esther Kalpana; Upender, G.; Pavani, P. Gayathri

2013-03-01

Titanium boro tellurite glasses in the xB2O3 -(90- x) TeO2 - 10TiO2 (where x = 0 to 50 mol%) system were prepared by using the conventional melt-quenching technique. Glass transition temperatures were measured with differential scanning calorimetry (DSC) and found to be in the range of 300-370 °C. The Raman spectra showed a cleavage of the continuous TeO4 (tbp) network by breaking of the Te-O-Te linkages. The relative transition of TeO4 - groups to TeO3 - groups is accompanied by a change in the oxygen coordination of the boron from 3 to 4 (BO3 - to BO4 -). The impedance plots Z″( ω) versus Z'( ω) for all the glass samples were recorded and found to exhibit a single circle. The AC conductivity of all glass samples was studied in the frequency range from 100 Hz to 1 MHz and in the temperature range from room temperature (RT) to 375 °C. The AC conductivity decreased by about one order in magnitude with increasing B2O3 content. The conductivity was found to be on the order of 10-4.5 to 10-6 (Ωcm)-1 at 375 °C and 1 MHz for 10 mol% and 50 mol% B2O3 contents, respectively. The relaxation behavior in these glass samples is discussed based on the complex modulus and impedance data.

Novel effect of spin dynamics with suppression of charge and orbital ordering in Nd0.5Ca0.5MnO3 under the influence of ac electric field

Science.gov (United States)

Sarwar, T.; Qamar, A.; Nadeem, M.

2017-07-01

Dynamics of spin ordering in the manganite Nd0.5Ca0.5MnO3 have been investigated in this paper. It was observed that the complex mixed magnetic ordering in pellets is comprised of antiferromagnetic ordering at 160 K (TN) and complete charge ordering at 250 K (TCO). Under ac field, appearance of unstable ferromagnetic correlations is observed above TCO, which is badly frustrated due to strong spin disorder induced by Jahn Teller distortions. Impedance measurements reveal the spin glass like scenario, suppressing the strong antiferromagnetic and charge ordering states below TN.

Raman and impedance spectroscopy methods of P{sub 2}O{sub 5}–Li{sub 2}O–Al{sub 2}O{sub 3} glass system doped with MgO

Energy Technology Data Exchange (ETDEWEB)

Jlassi, I., E-mail: ifa.jlassi@fst.rnu.tn [Laboratoire Physico-chimie des Matériaux Minéraux et leurs Applications, Centre National de Recherches en Sciences des Matériaux, B.P. 95, Hammam-Lif 2050 (Tunisia); Département de Physique, Faculté des Sciences de Tunis, Université de Tunis ElManar, Campus Universitaire Farhat Hachad, ElManar 2092 (Tunisia); Sdiri, N. [Laboratoire Physico-chimie des Matériaux Minéraux et leurs Applications, Centre National de Recherches en Sciences des Matériaux, B.P. 95, Hammam-Lif 2050 (Tunisia); Elhouichet, H. [Laboratoire Physico-chimie des Matériaux Minéraux et leurs Applications, Centre National de Recherches en Sciences des Matériaux, B.P. 95, Hammam-Lif 2050 (Tunisia); Département de Physique, Faculté des Sciences de Tunis, Université de Tunis ElManar, Campus Universitaire Farhat Hachad, ElManar 2092 (Tunisia); Ferid, M. [Laboratoire Physico-chimie des Matériaux Minéraux et leurs Applications, Centre National de Recherches en Sciences des Matériaux, B.P. 95, Hammam-Lif 2050 (Tunisia)

2015-10-05

Highlights: • We have prepared a new lithium diphosphate glasses doped MgO. • Investigate structural and electrical properties at room temperature. • Investigate relation between structure and electrical conductivity of the glass. - Abstract: Lithium diphosphate glasses doped MgO was prepared via a melt quenching technique. The samples were characterized by X-ray diffraction (XRD), Raman and impedance spectroscopy. XRD spectra reflected the amorphous nature of the glasses Raman spectra show structural network modifications with the composition variations of the studied glasses. Raman spectra of the studied glasses contain also typical phosphate glasses bands. Thus the band at ∼698 cm{sup −1} assigned to symmetric stretching vibrations of P−O−P groups and that from ∼1168 cm{sup −1} is attributed to symmetric stretching motions of the non-bridging oxygen (NBO) atoms bonded to phosphorous atoms (PO{sub 2}) in phosphate tetrahedron. Electric properties were investigated using complex impedance spectroscopy in a frequency range from 40 Hz to 6 MHz at room temperature. The impedance spectra were analyzed in terms of equivalent circuits involving resistors, capacitors and constant phase elements (CPE). Constant-phase elements (CPE) are used in equivalent electrical circuits for the fitting of experimental impedance data. The AC conductivity exhibited a Jonscher’s universal power law according with the relation σ(ω) = σ(0) + Aω{sup s} and it is observed that as the MgO content increases, frequency exponent (s) decreases.

Evaluation of ring impedance of the Photon Factory storage ring

International Nuclear Information System (INIS)

Kiuchi, T.; Izawa, M.; Tokumoto, S.; Hori, Y.; Sakanaka, S.; Kobayashi, M.; Kobayakawa, H.

1992-05-01

The loss parameters of the ducts in the Photon Factory (PF) storage ring were evaluated using the wire method and the code TBCI. Both the measurement and the calculation were done for a different bunch length (σ) ranging from 23 to 80 ps. The PF ring impedance was estimated to be |Z/n|=3.2 Ω using the broadband impedance model. The major contribution to the impedance comes from the bellows and the gate valve sections. Improvements of these components will lower the ring impedance by half. (author)

Impedance Discontinuity Reduction Between High-Speed Differential Connectors and PCB Interfaces

Science.gov (United States)

Navidi, Sal; Agdinaoay, Rodell; Walter, Keith

2013-01-01

High-speed serial communication (i.e., Gigabit Ethernet) requires differential transmission and controlled impedances. Impedance control is essential throughout cabling, connector, and circuit board construction. An impedance discontinuity arises at the interface of a high-speed quadrax and twinax connectors and the attached printed circuit board (PCB). This discontinuity usually is lower impedance since the relative dielectric constant of the board is higher (i.e., polyimide approx. = 4) than the connector (Teflon approx. = 2.25). The discontinuity can be observed in transmit or receive eye diagrams, and can reduce the effective link margin of serial data networks. High-speed serial data network transmission improvements can be made at the connector-to-board interfaces as well as improving differential via hole impedances. The impedance discontinuity was improved by 10 percent by drilling a 20-mil (approx. = 0.5-mm) hole in between the pin of a differential connector spaced 55 mils (approx. = 1.4 mm) apart as it is attached to the PCB. The effective dielectric constant of the board can be lowered by drilling holes into the board material between the differential lines in a quadrax or twinax connector attachment points. The differential impedance is inversely proportional to the square root of the relative dielectric constant. This increases the differential impedance and thus reduces the above described impedance discontinuity. The differential via hole impedance can also be increased in the same manner. This technique can be extended to multiple smaller drilled holes as well as tapered holes (i.e., big in the middle followed by smaller ones diagonally).

Transition towards DC micro grids: From an AC to a hybrid AC and DC energy infrastructure

Directory of Open Access Journals (Sweden)

Evi Ploumpidou

2017-12-01

Full Text Available Our electricity is predominantly powered by alternating current (AC, ever since the War of Currents ended in the favor of Nicola Tesla at the end of the 19th century. However, lots of the appliances we use, such as electronics and lights with light-emitting diode (LED technology, work internally on direct current (DC and it is projected that the number of these appliances will increase in the near future. Another contributor to the increase in DC consumption is the ongoing electrification of mobility (Electric Vehicles (EVs. At the same time, photovoltaics (PV generate DC voltages, while the most common storage technologies also use DC. In order to integrate all these appliances and technologies to the existing AC grid, there is a need for converters which introduce power losses. By distributing DC power to DC devices instead of converting it to AC first, it is possible to avoid substantial energy losses that occur every time electricity is converted. This situation initiated the concept for the implementation of the DC-Flexhouse project. A prototype DC installation will be developed and tested in one of the buildings of the developing living lab area called the District of Tomorrow (De Wijk van Morgen which is located in Heerlen, the Netherlands. A neighborhood cooperative (Vrieheide cooperatie is also part of the consortium in order to address the aspect of social acceptance. Although DC seems to be a promising solution for a more sustainable energy system, the business case is still debatable due to both technology- and market-related challenges. The current energy infrastructure is predominantly based on AC, manufacturers produce devices based on AC standards and people are using many AC products across a long life span. This Smart Energy Buildings & Cities (SEB&C PDEng project is a contribution to the DC-Flexhouse project. The aim is to analyze the challenges in the transition to DC micro grids, assess the market potential of DC

Dose effect comparisons between HFR and BMRR irradiated dogs with respect to healthy tissue tolerance

International Nuclear Information System (INIS)

Huiskamp, R.; Philipp, K.H.I.; Gavin, P.R.; Wheeler, F.J.; Siefert, A.

1993-01-01

Epithermal neutron beams are being developed for the application of boron neutron capture therapy (BNCT) of deep seated tumors, like glioblastoma and astrocytomas, through the intact skin. Epithermal neutrons will be moderated by the tissue mass between skin and tumour to produce the thermal neutrons necessary for the 10 B(n,α) 7 Li reaction in the target tissue. Although the neutron capture cross-sections of elements in normal tissue are several orders of magnitude lower that for boron, the high abundance of hydrogen and nitrogen will cause a significant contribution to the total absorbed radiation dose through the 1 H(n,γ) 2 H and the 14 N(n,p) 14 C reaction, respectively. Due to inevitable incomplete filtration, an epithermal beam will also contain a fast neutron component, i.e. neutrons with energies ≥ 10 keV, and a γ-photon component originating from the reactor and produced in structural and filter materials. Therefore, the resultant radiation consists of a complex of low and high LET radiation of which the constitutents vary rapidly with depth in tissue. Based on the ongoing canine healthy tissue tolerance study at the Brookhaven Medical Research Reactor (BMRR) using the epithermal beam without BSH, the relative biological effectiveness (RBE) of the fast neutron beam component has been determined for skin reactions. In addition, a open-quotes compound factorclose quotes, i.e geometry x RBE, for the 10 B(n,α) 7 Li reaction was derived for dogs irradiated at the BMRR with the epithermal beam and BSH (Gavin et al.). Currently, a healthy tissue tolerance study with BSH is being carried out at the HB11 epithermal beam of the High Flux Reactor at Petten. The present paper describes preliminary dose effect comparisons between High Flux Reactor (HFR) and BMRR irradiated dogs with respect to healthy tissue tolerance in order to refine the BSH compound factors and the fast neutron RBE for skin and brain

Electrical impedance spectroscopy and diagnosis of tendinitis

International Nuclear Information System (INIS)

Yoon, Kisung; Lee, Kyeong Woo; Kim, Sang Beom; Lee, Jong Hwa; Han, Tai Ryoon; Jung, Dong Keun; Roh, Mee Sook

2010-01-01

There have been a number of studies that investigate the usefulness of bioelectric signals in diagnoses and treatment in the medical field. Tendinitis is a musculoskeletal disorder with a very high rate of occurrence. This study attempts to examine whether electrical impedance spectroscopy (EIS) can detect pathological changes in a tendon and find the exact location of the lesion. Experimental tendinitis was induced by injecting collagenase into one side of the patellar tendons in rabbits, while the other side was used as the control. After measuring the impedance in the tendinitis and intact tendon tissue, the dissipation factor was computed. The real component of impedance and the dissipation factor turned out to be lower in tendinitis than in intact tissues. Moreover, the tendinitis dissipation factor spectrum showed a clear difference from that of the intact tendon, indicating its usefulness as a tool for detecting the location of the lesion. Pathologic findings from the tissues that were obtained after measuring the impedance confirmed the presence of characteristics of tendinitis. In conclusion, EIS is a useful method for diagnosing tendinitis and detecting the lesion location in invasive treatment

Measurement scheme of kicker impedances via beam-induced voltages of coaxial cables

Energy Technology Data Exchange (ETDEWEB)

Shobuda, Yoshihiro, E-mail: yoshihiro.shobuda@j-parc.jp [J-PARC Center, JAEA and KEK, 2-4 Shirakata Shirane, Tokaimura, Nakagun, Ibaraki 319-1195 (Japan); Irie, Yoshiro [KEK, High Energy Accelerator Research Organization, 1-1 Oho, Tsukuba, Ibaraki 305-0801 (Japan); Toyama, Takeshi; Kamiya, Junichiro [J-PARC Center, JAEA and KEK, 2-4 Shirakata Shirane, Tokaimura, Nakagun, Ibaraki 319-1195 (Japan); Watanabe, Masao [Ministry of Education, Culture, Sports, Science and Technology, 3-2-2 Kasumigaseki, Chiyoda, Tokyo 100-8959 (Japan)

2013-06-11

A new theory, which satisfies the causality condition, is developed to describe impedances of kicker magnets with coaxial cables. The theoretical results well describe measurement results, which are obtained by standard wire methods. On the other hand, when beams pass through the kicker, voltages are induced at the terminals of coaxial cables. In other words, by analyzing the voltages, the kicker impedance for the beams can be obtained. The observed impedances are consistent with the theoretical results. The theory describes the impedance for non-relativistic beams, as well. The theoretical, simulation and measurement results indicate that the horizontal kicker impedance is drastically reduced by the non-relativistic effect. -- Highlights: ► We develop an innovative method to measure kicker impedance including power cable. ► By analyzing voltages at the ends of coaxial cables, the impedance is derived. ► The horizontal impedance is reduced as the beam becomes non-relativistic.

Electric and dielectric behavior of copper-chromium layered double hydroxide intercalated with dodecyl sulfate anions using impedance spectroscopy

Science.gov (United States)

Elhatimi, Wafaa; Bouragba, Fatima Zahra; Lahkale, Redouane; Sadik, Rachid; Lebbar, Nacira; Siniti, Mostapha; Sabbar, Elmouloudi

2018-05-01

The Cu2Cr-DS-LDH hybrid was successfully prepared by the anion exchange method at room temperature. The structure, the chemical composition and the physico-chemical properties of the sample were determined using powder X-ray diffraction (PXRD), Fourier transform infrared spectroscopy (FT-IR), thermogravimetric analysis (TGA) and inductively coupled plasma (ICP). In this work, the electrical and dielectric properties investigated are determined using impedance spectroscopy (IS) in a frequency range of 1 Hz to 1 MHz. Indeed, the Nyquist diagram modelized by an electrical equivalent circuit showed three contributions attributed respectively to the polarization of grains, grains boundaries and interface electrode-sample. This modelization allowed us to determine the intrinsic electrical parameters of the hybrid (resistance, pseudo-capacitance and relaxation time). The presence of the non-Debye relaxation phenomena was confirmed by the frequency analysis of impedance. Moreover, the evolution of the alternating current conductivity (σac) studied obeys the double power law of Jonscher. The ionic conduction of this material was generated through a jump movement by translation of the charge carriers. As for the dielectric behavior of the material, the evolution of dielectric constant as a function of frequency shows relatively high values in a frequency range between 10 Hz and 1 KHz. The low values of the loss tangent obtained in this frequency zone can valorize this LDH hybrid.

A contribution to the computation of the impedance in acceleration resonators

International Nuclear Information System (INIS)

Liu, Cong

2016-05-01

This thesis is focusing on the numerical computation of the impedance in acceleration resonators and corresponding components. For this purpose, a dedicated solver based on the Finite Element Method (FEM) has been developed to compute the broadband impedance in accelerating components. In addition, various numerical approaches have been used to calculate the narrow-band impedance in superconducting radio frequency (RF) cavities. From that an overview of the calculated results as well as the comparisons between the applied numerical approaches is provided. During the design phase of superconducting RF accelerating cavities and components, a challenging and difficult task is the determination of the impedance inside the accelerators with the help of proper computer simulations. Impedance describes the electromagnetic interaction between the particle beam and the accelerators. It can affect the stability of the particle beam. For a superconducting RF accelerating cavity with waveguides (beam pipes and couplers), the narrow-band impedance, which is also called shunt impedance, corresponds to the eigenmodes of the cavity. It depends on the eigenfrequencies and its electromagnetic field distribution of the eigenmodes inside the cavity. On the other hand, the broadband impedance describes the interaction of the particle beam in the waveguides with its environment at arbitrary frequency and beam velocity. With the narrow-band and broadband impedance the detailed knowledges of the impedance for the accelerators can be given completely. In order to calculate the broadband longitudinal space charge impedance for acceleration components, a three-dimensional (3D) solver based on the FEM in frequency domain has been developed. To calculate the narrow-band impedance for superconducting RF cavities, we used various numerical approaches. Firstly, the eigenmode solver based on Finite Integration Technique (FIT) and a parallel real-valued FEM (CEM3Dr) eigenmode solver based on

A contribution to the computation of the impedance in acceleration resonators

Energy Technology Data Exchange (ETDEWEB)

Liu, Cong

2016-05-15

This thesis is focusing on the numerical computation of the impedance in acceleration resonators and corresponding components. For this purpose, a dedicated solver based on the Finite Element Method (FEM) has been developed to compute the broadband impedance in accelerating components. In addition, various numerical approaches have been used to calculate the narrow-band impedance in superconducting radio frequency (RF) cavities. From that an overview of the calculated results as well as the comparisons between the applied numerical approaches is provided. During the design phase of superconducting RF accelerating cavities and components, a challenging and difficult task is the determination of the impedance inside the accelerators with the help of proper computer simulations. Impedance describes the electromagnetic interaction between the particle beam and the accelerators. It can affect the stability of the particle beam. For a superconducting RF accelerating cavity with waveguides (beam pipes and couplers), the narrow-band impedance, which is also called shunt impedance, corresponds to the eigenmodes of the cavity. It depends on the eigenfrequencies and its electromagnetic field distribution of the eigenmodes inside the cavity. On the other hand, the broadband impedance describes the interaction of the particle beam in the waveguides with its environment at arbitrary frequency and beam velocity. With the narrow-band and broadband impedance the detailed knowledges of the impedance for the accelerators can be given completely. In order to calculate the broadband longitudinal space charge impedance for acceleration components, a three-dimensional (3D) solver based on the FEM in frequency domain has been developed. To calculate the narrow-band impedance for superconducting RF cavities, we used various numerical approaches. Firstly, the eigenmode solver based on Finite Integration Technique (FIT) and a parallel real-valued FEM (CEM3Dr) eigenmode solver based on

ACS and STEMI treatment: gender-related issues.

Science.gov (United States)

Chieffo, Alaide; Buchanan, Gill Louise; Mauri, Fina; Mehilli, Julinda; Vaquerizo, Beatriz; Moynagh, Anouska; Mehran, Roxana; Morice, Marie-Claude

2012-08-01

Cardiovascular disease is the leading cause of death amongst women, with acute coronary syndromes (ACS) representing a significant proportion. It has been reported that in women presenting with ACS there is underdiagnosis and consequent undertreatment leading to an increase in hospital and long-term mortality. Several factors have to be taken into account, including lack of awareness both at patient and at physician level. Women are generally not aware of the cardiovascular risk and symptoms, often atypical, and therefore wait longer to seek medical attention. In addition, physicians often underestimate the risk of ACS in women leading to a further delay in accurate diagnosis and timely appropriate treatment, including cardiac catheterisation and primary percutaneous coronary intervention, with consequent delayed revascularisation times. It has been acknowledged by the European Society of Cardiology that gender disparities do exist, with a Class I, Level of Evidence B recommendation that both genders should be treated in the same way when presenting with ACS. However, there is still a lack of awareness and the mission of Women in Innovation, in association with Stent for Life, is to change the perception of women with ACS and to achieve prompt diagnosis and treatment.

A new method for calculation of low-frequency coupling impedance

International Nuclear Information System (INIS)

Kurennoy, S.S.; Stupakov, G.V.

1993-05-01

In high-energy proton accelerators and storage rings the bunch length is typically at least a few times larger than the radius of the vacuum chamber. For example, the SSC will have an rms bunch length above 6 cm and a beam-pipe radius below 2 cm. The main concern for beam stability in such a machine is the low-frequency impedance, i.e., the coupling impedance at frequencies wen below the cut-off frequency of the vacuum chamber. In the present paper we develop a new analytical approach for calculation of the low-frequency impedance of axisymmetric structures that allows us to give quick and reliable estimates of contributions to the impedance from various chamber discontinuities. Simple formulae for the longitudinal impedance of some typical discontinuities are obtained

Microgrid Reactive and Harmonic Power Sharing Using Enhanced Virtual Impedance

DEFF Research Database (Denmark)

He, Jinwei; Wei Li, Yun; Guerrero, Josep M.

2013-01-01

To address the load sharing problem in islanding microgrids, this paper proposes an improved approach which regulates the distributed generation (DG) unit interfacing virtual impedance at fundamental and selected harmonic frequencies. In contrast to the conventional virtual impedance control where...... only a line current feed-forward term is added to the DG voltage reference, the proposed virtual impedances at fundamental and harmonic frequencies are realized using DG line current and point of common coupling (PCC) voltage feed-forward terms, respectively. With this modification, the mismatched DG...... feeder impedances can be properly compensated, resulting in accurate reactive and harmonic power sharing at the same time. In addition, this paper shows that the microgrid PCC harmonic voltages can be mitigated by reducing the magnitude of DG unit equivalent harmonic impedance. Finally, an improved...

A comparison study of electrodes for neonate electrical impedance tomography

International Nuclear Information System (INIS)

Rahal, Mohamad; Demosthenous, Andreas; Khor, Joo Moy; Tizzard, Andrew; Bayford, Richard

2009-01-01

Electrical impedance tomography (EIT) is an imaging technique that has the potential to be used for studying neonate lung function. The properties of the electrodes are very important in multi-frequency EIT (MFEIT) systems, particularly for neonates, as the skin cannot be abraded to reduce contact impedance. In this work, the impedance of various clinical electrodes as a function of frequency is investigated to identify the optimum electrode type for this application. Six different types of self-adhesive electrodes commonly used in general and neonatal cardiology have been investigated. These electrodes are Ag/AgCl electrodes from the Ambu® Cardiology Blue sensors range (BR, NF and BRS), Kendall (KittyCat(TM) and ARBO®) and Philips 13953D electrodes. In addition, a textile electrode without gel from Textronics was tested on two subjects to allow comparison with the hydrogel-based electrodes. Two- and four-electrode measurements were made to determine the electrode-interface and tissue impedances, respectively. The measurements were made on the back of the forearm of six healthy adult volunteers without skin preparation with 2.5 cm electrode spacing. Impedance measurements were carried out using a Solartron SI 1260 impedance/gain-phase analyser with a frequency range from 10 Hz to 1 MHz. For the electrode-interface impedance, the average magnitude decreased with frequency, with an average value of 5 kΩ at 10 kHz and 337 Ω at 1 MHz; for the tissue impedance, the respective values were 987 Ω and 29 Ω. Overall, the Ambu BRS, Kendall ARBO® and Textronics textile electrodes gave the lowest electrode contact impedance at 1 MHz. Based on the results of the two-electrode measurements, simple RC models for the Ambu BRS and Kendall-ARBO and Textronics textile electrodes have been derived for MFEIT applications

Esophageal acid exposure decreases intraluminal baseline impedance levels

NARCIS (Netherlands)

Kessing, Boudewijn F.; Bredenoord, Albert J.; Weijenborg, Pim W.; Hemmink, Gerrit J. M.; Loots, Clara M.; Smout, A. J. P. M.

2011-01-01

Intraluminal baseline impedance levels are determined by the conductivity of the esophageal wall and can be decreased in gastroesophageal reflux disease (GERD) patients. The aim of this study was to investigate the baseline impedance in GERD patients, on and off proton pump inhibitor (PPI), and in

Impedance Analysis of SOGI-FLL-Based Grid Synchronization

DEFF Research Database (Denmark)

Yi, Hao; Wang, Xiongfei; Blaabjerg, Frede

2017-01-01

The latest research has pointed out that the Phase-Locked Loop (PLL) plays an important role in shaping the impedance of grid-connected converters, yet most of the works so far merely focus on the synchronous reference-frame PLL. Alternatively, this letter presents the impedance analysis...

[Impedance between modiolus and different walls of scala tympani].

Science.gov (United States)

Du, Qiang; Wang, Zhengmin

2008-10-01

To compare the impedance between the modiolus and the inner wall of scala tympani with that between the modiolus and the outer wall of scala tympani. The impedances between the modiolus and the inner wall of scala tympani and the impedance between the modiolus and the outer wall of scala tympani were measured, calculated and compared under different stimulating rates 0.1, 1.0, 10.0 kHz. The impedance between the modiolus and the inner wall of scala tympani is less than that between the modiolus and the outer wall of scala tympani (P < 0.05). To effectively stimulate the residual neurons in the spiral ganglion, the electrodes should be kept close to the inner wall of scale tympani.

Interdigitated electrodes as impedance and capacitance biosensors: A review

Science.gov (United States)

Mazlan, N. S.; Ramli, M. M.; Abdullah, M. M. A. B.; Halin, D. S. C.; Isa, S. S. M.; Talip, L. F. A.; Danial, N. S.; Murad, S. A. Z.

2017-09-01

Interdigitated electrodes (IDEs) are made of two individually addressable interdigitated comb-like electrode structures. IDEs are one of the most favored transducers, widely utilized in technological applications especially in the field of biological and chemical sensors due to their inexpensive, ease of fabrication process and high sensitivity. In order to detect and analyze a biochemical molecule or analyte, the impedance and capacitance signal need to be obtained. This paper investigates the working principle and influencer of the impedance and capacitance biosensors. The impedance biosensor depends on the resistance and capacitance while the capacitance biosensor influenced by the dielectric permittivity. However, the geometry and structures of the interdigitated electrodes affect both impedance and capacitance biosensor. The details have been discussed in this paper.

Analytical model of impedance in elliptical beam pipes

CERN Document Server

Pesah, Arthur Chalom

2017-01-01

Beam instabilities are among the main limitations in building higher intensity accelerators. Having a good impedance model for every accelerators is necessary in order to build components that minimize the probability of instabilities caused by the interaction beam-environment and to understand what piece to change in case of intensity increasing. Most of accelerator components have their impedance simulated with finite elements method (using softwares like CST Studio), but simple components such as circular or flat pipes are modeled analytically, with a decreasing computation time and an increasing precision compared to their simulated model. Elliptical beam pipes, while being a simple component present in some accelerators, still misses a good analytical model working for the hole range of velocities and frequencies. In this report, we present a general framework to study the impedance of elliptical pipes analytically. We developed a model for both longitudinal and transverse impedance, first in the case of...

Bioelectrical impedance analysis for bovine milk: Preliminary results

Science.gov (United States)

Bertemes-Filho, P.; Valicheski, R.; Pereira, R. M.; Paterno, A. S.

2010-04-01

This work reports the investigation and analysis of bovine milk quality by using biological impedance measurements using electrical impedance spectroscopy (EIS). The samples were distinguished by a first chemical analysis using Fourier transform midinfrared spectroscopy (FTIR) and flow citometry. A set of milk samples (100ml each) obtained from 17 different cows in lactation with and without mastitis were analyzed with the proposed technique using EIS. The samples were adulterated by adding distilled water and hydrogen peroxide in a controlled manner. FTIR spectroscopy and flow cytometry were performed, and impedance measurements were made in a frequency range from 500Hz up to 1MHz with an implemented EIS system. The system's phase shift was compensated by measuring saline solutions. It was possible to show that the results obtained with the Bioelectrical Impedance Analysis (BIA) technique may detect changes in the milk caused by mastitis and the presence of water and hydrogen peroxide in the bovine milk.

Mechanism transition of cell-impedance-controlled lithium transport through Li1-δMn2O4 composite electrode caused by surface-modification and temperature variation

International Nuclear Information System (INIS)

Jung, Kyu-Nam; Pyun, Su-Il

2007-01-01

The mechanism transition of lithium transport through a Li 1-δ Mn 2 O 4 composite electrode caused by the surface-modification and temperature variation was investigated using the galvanostatic intermittent titration technique (GITT), electrochemical impedance spectroscopy (EIS) and the potentiostatic current transient technique. From the analyses of the ac-impedance spectra, experimentally measured from unmodified Li 1-δ Mn 2 O 4 and surface-modified Li 1-δ Mn 2 O 4 with MgO composite electrodes, the internal cell resistance of the MgO-modified Li 1-δ Mn 2 O 4 electrode was determined to be much smaller in value than that of the unmodified electrode over the whole potential range. Moreover, from the analysis of the anodic current transients measured on the MgO-modified Li 1-δ Mn 2 O 4 electrode, it was found that the cell-impedance-controlled constraint at the electrode surface is changed to a diffusion-controlled constraint, which is characterised by a large potential step and simultaneously by a small amount of lithium transferred during lithium transport. This strongly suggests that the internal cell resistance plays a significant role in determining the cell-impedance-controlled lithium transport through the MgO-modified Li 1-δ Mn 2 O 4 electrode. Furthermore, from the temperature dependence of the internal cell resistance and diffusion resistance in the unmodified Li 1-δ Mn 2 O 4 composite electrode measured by GITT and EIS, it was concluded that which mechanism of lithium transport will be operative strongly depends on the diffusion resistance as well as on the internal cell resistance

Should fee-for-service be for all guideline-advocated acute coronary syndrome (ACS) care? Observations from the Snapshot ACS study.

Science.gov (United States)

Briffa, Thomas G; Hammett, Christopher J; Cross, David B; Macisaac, Andrew I; Rankin, James M; Board, Neville; Carr, Bridie; Hyun, Karice K; French, John; Brieger, David B; Chew, Derek P

2015-09-01

The aim of the present study was to explore the association of health insurance status on the provision of guideline-advocated acute coronary syndrome (ACS) care in Australia. Consecutive hospitalisations of suspected ACS from 14 to 27 May 2012 enrolled in the Snapshot study of Australian and New Zealand patients were evaluated. Descriptive and logistic regression analysis was performed to evaluate the association of patient risk and insurance status with the receipt of care. In all, 3391 patients with suspected ACS from 247 hospitals (23 private) were enrolled in the present study. One-third of patients declared private insurance coverage; of these, 27.9% (304/1088) presented to private facilities. Compared with public patients, privately insured patients were more likely to undergo in-patient echocardiography and receive early angiography; furthermore, in those with a discharge diagnosis of ACS, there was a higher rate of revascularisation (P fee-for-service. In contrast, proportionately fewer privately insured ACS patients were discharged on selected guideline therapies and were referred to a secondary prevention program (P = 0.056), neither of which directly attracts a fee. Typically, as GRACE (the Global Registry of Acute Coronary Events) risk score rose, so did the level of ACS care; however, propensity-adjusted analyses showed lower in-hospital adverse events among the insured group (odds ratio 0.68; 95% confidence interval 0.52-0.88; P = 0.004). Fee-for-service reimbursement may explain differences in the provision of selected guideline-advocated components of ACS care between privately insured and public patients.

Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

Energy Technology Data Exchange (ETDEWEB)

Ljusev, P.; Andersen, Michael A.E.

2005-07-01

This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)

Tapping mode microwave impedance microscopy

KAUST Repository

Lai, K.

2009-01-01

We report tapping mode microwave impedance imaging based on atomic force microscope platforms. The shielded cantilever probe is critical to localize the tip-sample interaction near the tip apex. The modulated tip-sample impedance can be accurately simulated by the finite-element analysis and the result agrees quantitatively to the experimental data on a series of thin-film dielectric samples. The tapping mode microwave imaging is also superior to the contact mode in that the thermal drift in a long time scale is totally eliminated and an absolute measurement on the dielectric properties is possible. We demonstrated tapping images on working nanodevices, and the data are consistent with the transport results. © 2009 American Institute of Physics.

Ac irreversibility line of bismuth-based high temperature superconductors

International Nuclear Information System (INIS)

Mehdaoui, A.; Beille, J.; Berling, D.; Loegel, B.; Noudem, J.G.; Tournier, R.

1997-01-01

We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe ac <100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL close-quote s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.copyright 1997 Materials Research Society

Smart Multi-Frequency Bioelectrical Impedance Spectrometer for BIA and BIVA Applications.

Science.gov (United States)

Harder, Rene; Diedrich, Andre; Whitfield, Jonathan S; Buchowski, Macie S; Pietsch, John B; Baudenbacher, Franz J

2016-08-01

Bioelectrical impedance analysis (BIA) is a noninvasive and commonly used method for the assessment of body composition including body water. We designed a small, portable and wireless multi-frequency impedance spectrometer based on the 12 bit impedance network analyzer AD5933 and a precision wide-band constant current source for tetrapolar whole body impedance measurements. The impedance spectrometer communicates via Bluetooth with mobile devices (smart phone or tablet computer) that provide user interface for patient management and data visualization. The export of patient measurement results into a clinical research database facilitates the aggregation of bioelectrical impedance analysis and biolectrical impedance vector analysis (BIVA) data across multiple subjects and/or studies. The performance of the spectrometer was evaluated using a passive tissue equivalent circuit model as well as a comparison of body composition changes assessed with bioelectrical impedance and dual-energy X-ray absorptiometry (DXA) in healthy volunteers. Our results show an absolute error of 1% for resistance and 5% for reactance measurements in the frequency range of 3 kHz to 150 kHz. A linear regression of BIA and DXA fat mass estimations showed a strong correlation (r(2)=0.985) between measures with a maximum absolute error of 6.5%. The simplicity of BIA measurements, a cost effective design and the simple visual representation of impedance data enables patients to compare and determine body composition during the time course of a specific treatment plan in a clinical or home environment.

Microfluidic Impedance Flow Cytometry Enabling High-Throughput Single-Cell Electrical Property Characterization

Science.gov (United States)

Chen, Jian; Xue, Chengcheng; Zhao, Yang; Chen, Deyong; Wu, Min-Hsien; Wang, Junbo

2015-01-01

This article reviews recent developments in microfluidic impedance flow cytometry for high-throughput electrical property characterization of single cells. Four major perspectives of microfluidic impedance flow cytometry for single-cell characterization are included in this review: (1) early developments of microfluidic impedance flow cytometry for single-cell electrical property characterization; (2) microfluidic impedance flow cytometry with enhanced sensitivity; (3) microfluidic impedance and optical flow cytometry for single-cell analysis and (4) integrated point of care system based on microfluidic impedance flow cytometry. We examine the advantages and limitations of each technique and discuss future research opportunities from the perspectives of both technical innovation and clinical applications. PMID:25938973

Harmonic current prediction by impedance modeling of grid-tied inverters

DEFF Research Database (Denmark)

Pereira, Heverton A.; Freijedo, Francisco D.; Silva, M. M.

2017-01-01

and harmonic voltage profiles. Results reinforce that impedance models can represent with relatively accuracy the harmonic current emitted by the PV plants at the point of common coupling (PCC). Lastly, a stress test is performed to show how a variation in the harmonic voltage phase angle impacts the PV plant...... impedance models when used in harmonic integration studies. It is aimed to estimate the harmonic current contribution as a function of the background harmonic voltages components. Time domain simulations based on detailed and average models are compared with the impedance model developed in frequency domain....... In grids with harmonic voltages, impedance models can predict the current distortion for all active power injection scenarios. Furthermore, measurements in a 1.4 MW PV plant connected in a distributed grid are used to validate the simulation based on impedance models during different power injections...

ACS-Hach Programs: Supporting Excellence in High School Chemistry Teaching

Science.gov (United States)

Taylor, Terri

2009-05-01

In January 2009, the ACS received a gift of approximately $33 million from the Hach Scientific Foundation, the largest gift in the society's 133-year history. The foundation's programs will be continued by the ACS and will complement pre-existing ACS resources that support high school chemistry teaching. Three activities serve as the pillars of the ACS-Hach programs—the High School Chemistry Grant Program, the Second Career Teacher Scholarship Program, and the Land Grant University Scholars Program. Collectively, the ACS-Hach programs support high school chemistry teaching and learning by responding to the needs of both in-service and pre-service secondary teachers. The goals of each of the ACS-Hach programs align well with the ACS Mission—to advance the broader chemistry enterprise and its practitioners for the benefit of Earth and its people.

Two very long chain fatty acid acyl-CoA synthetase genes, acs-20 and acs-22, have roles in the cuticle surface barrier in Caenorhabditis elegans.

Directory of Open Access Journals (Sweden)

Eriko Kage-Nakadai

Full Text Available In multicellular organisms, the surface barrier is essential for maintaining the internal environment. In mammals, the barrier is the stratum corneum. Fatty acid transport protein 4 (FATP4 is a key factor involved in forming the stratum corneum barrier. Mice lacking Fatp4 display early neonatal lethality with features such as tight, thick, and shiny skin, and a defective skin barrier. These symptoms are strikingly similar to those of a human skin disease called restrictive dermopathy. FATP4 is a member of the FATP family that possesses acyl-CoA synthetase activity for very long chain fatty acids. How Fatp4 contributes to skin barrier function, however, remains to be elucidated. In the present study, we characterized two Caenorhabditis elegans genes, acs-20 and acs-22, that are homologous to mammalian FATPs. Animals with mutant acs-20 exhibited defects in the cuticle barrier, which normally prevents the penetration of small molecules. acs-20 mutant animals also exhibited abnormalities in the cuticle structure, but not in epidermal cell fate or cell integrity. The acs-22 mutants rarely showed a barrier defect, whereas acs-20;acs-22 double mutants had severely disrupted barrier function. Moreover, the barrier defects of acs-20 and acs-20;acs-22 mutants were rescued by acs-20, acs-22, or human Fatp4 transgenes. We further demonstrated that the incorporation of exogenous very long chain fatty acids into sphingomyelin was reduced in acs-20 and acs-22 mutants. These findings indicate that C. elegans Fatp4 homologue(s have a crucial role in the surface barrier function and this model might be useful for studying the fundamental molecular mechanisms underlying human skin barrier and relevant diseases.

Low-frequency quadrupole impedance of undulators and wigglers

Directory of Open Access Journals (Sweden)

A. Blednykh

2016-10-01

Full Text Available An analytical expression of the low-frequency quadrupole impedance for undulators and wigglers is derived and benchmarked against beam-based impedance measurements done at the 3 GeV NSLS-II storage ring. The adopted theoretical model, valid for an arbitrary number of electromagnetic layers with parallel geometry, allows to calculate the quadrupole impedance for arbitrary values of the magnetic permeability μ_{r}. In the comparison of the analytical results with the measurements for variable magnet gaps, two limit cases of the permeability have been studied: the case of perfect magnets (μ_{r}→∞, and the case in which the magnets are fully saturated (μ_{r}=1.

Characterizing aging effects of lithium ion batteries by impedance spectroscopy

International Nuclear Information System (INIS)

Troeltzsch, Uwe; Kanoun, Olfa; Traenkler, Hans-Rolf

2006-01-01

Impedance spectroscopy is one of the most promising methods for characterizing aging effects of portable secondary batteries online because it provides information about different aging mechanisms. However, application of impedance spectroscopy 'in the field' has some higher requirements than for laboratory experiments. It requires a fast impedance measurement process, an accurate model applicable with several batteries and a robust method for model parameter estimation. In this paper, we present a method measuring impedance at different frequencies simultaneously. We propose to use a composite electrode model, capable to describe porous composite electrode materials. A hybrid method for parameter estimation based on a combination of evolution strategy and Levenberg-Marquardt method allowed a robust and fast parameter calculation. Based on this approach, an experimental investigation of aging effects of a lithium ion battery was carried out. After 230 discharge/charge cycles, the battery showed a 14% decreased capacity. Modeling results show that series resistance, charge transfer resistance and Warburg coefficient changed thereby their values by approximately 60%. A single frequency impedance measurement, usually carried out at 1 kHz, delivers only information about series resistance. Impedance spectroscopy allows additionally the estimation of charge transfer resistance and Warburg coefficient. This fact and the high sensitivity of model parameters to capacity change prove that impedance spectroscopy together with an accurate modeling deliver information that significantly improve characterization of aging effects

Characterizing aging effects of lithium ion batteries by impedance spectroscopy

Energy Technology Data Exchange (ETDEWEB)

Troeltzsch, Uwe [University of the Bundeswehr Munich Institute for Measurement and Automation, 85579 Neubiberg (Germany)]. E-mail: uwe.troeltzsch@unibw-muenchen.de; Kanoun, Olfa [University of the Bundeswehr Munich Institute for Measurement and Automation, 85579 Neubiberg (Germany); Traenkler, Hans-Rolf [University of the Bundeswehr Munich Institute for Measurement and Automation, 85579 Neubiberg (Germany)

2006-01-20

Impedance spectroscopy is one of the most promising methods for characterizing aging effects of portable secondary batteries online because it provides information about different aging mechanisms. However, application of impedance spectroscopy 'in the field' has some higher requirements than for laboratory experiments. It requires a fast impedance measurement process, an accurate model applicable with several batteries and a robust method for model parameter estimation. In this paper, we present a method measuring impedance at different frequencies simultaneously. We propose to use a composite electrode model, capable to describe porous composite electrode materials. A hybrid method for parameter estimation based on a combination of evolution strategy and Levenberg-Marquardt method allowed a robust and fast parameter calculation. Based on this approach, an experimental investigation of aging effects of a lithium ion battery was carried out. After 230 discharge/charge cycles, the battery showed a 14% decreased capacity. Modeling results show that series resistance, charge transfer resistance and Warburg coefficient changed thereby their values by approximately 60%. A single frequency impedance measurement, usually carried out at 1 kHz, delivers only information about series resistance. Impedance spectroscopy allows additionally the estimation of charge transfer resistance and Warburg coefficient. This fact and the high sensitivity of model parameters to capacity change prove that impedance spectroscopy together with an accurate modeling deliver information that significantly improve characterization of aging effects.

Magnetic irreversibility in granular superconductors: ac susceptibility study

International Nuclear Information System (INIS)

Perez, F.; Obradors, X.; Fontcuberta, J.; Vallet, M.; Gonzalez-Calbet, J.

1991-01-01

Ac susceptibility measurements of a ceramic weak-coupled superconductor in very low ac fields (2mG, 111Hz) are reported. We present evidence for the observation of the magnetic irreversibility following a ZFC-FC thermal cycling by means of ac susceptibilty measurements. It is shown that this technique also reflect local magnetic field effects in granular superconductors, as previously suggested in microwave surface resistance and I-V characteristics. (orig.)

Impedance Conjugate Matching of Plasmonic Nanoantenna in Optical Nanocircuits

DEFF Research Database (Denmark)

Sachkou, Yauhen; Andryieuski, Andrei; Lavrinenko, Andrei

2011-01-01

-shaped optical nanoantenna on its geometrical parameters. We show that several parameters – an arm length of the T-shaped nanoantenna, nanoantenna width and a width of the front facet of the connector – can influence on the impedance conjugate matching which gives flexibility in impedance tuning for coupling......Optical antennas are a state-of-the-art concept in modern plasmonics. Nanoantennas can be advantageously used to localize, enhance and detect radiation in nanoscale volumes. These abilities unlock an enormous potential applications ranging from optoelectronics engineering and integrated optical...... nanocircuitry to nanoscale optical microscopy and ultra-sensing. The coupling efficiency between nanoantenna and other elements in integrated optical nanocircuit strongly depends on its properties where the impedance matching plays a crucial role. We investigate the dependence of impedance of the T...

Control of hybrid AC/DC microgrid under islanding operational conditions

DEFF Research Database (Denmark)

Ding, G.; Gao, F.; Zhang, S.

2014-01-01

This paper presents control methods for hybrid AC/DC microgrid under islanding operation condition. The control schemes for AC sub-microgrid and DC sub-microgrid are investigated according to the power sharing requirement and operational reliability. In addition, the key control schemes...... of interlinking converter with DC-link capacitor or energy storage, which will devote to the proper power sharing between AC and DC sub-microgrids to maintain AC and DC side voltage stable, is reviewed. Combining the specific control methods developed for AC and DC sub-microgrids with interlinking converter......, the whole hybrid AC/DC microgrid can manage the power flow transferred between sub-microgrids for improving on the operational quality and efficiency....

New Perspectives on Droop Control in AC MicroGrid

DEFF Research Database (Denmark)

Sun, Yao; Hou, Xiaochao; Yang, Jian

2017-01-01

Virtual impedance, angle droop and frequency droop control play important roles in maintaining system stability, and load sharing among distributed generators (DGs) in microgrid. These approaches have been developed into three totally independent concepts, but present strong relevance....... In this letter, their similarities and differences are significantly revealed. Some new findings are established as follows: 1) angle droop control is intrinsically a virtual impedance method; 2) virtual impedance method can also be regarded as a special frequency droop control with a power derivative feedback......; 3) the combination of virtual impedance method and frequency droop control is equivalent to the proportional–derivative (PD) type frequency droop, which is introduced to enhance the power oscillation damping. As a whole, these analogous relationships provide the new insight into the design...

Ac irreversibility line of bismuth-based high temperature superconductors

Energy Technology Data Exchange (ETDEWEB)

Mehdaoui, A. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Beille, J. [Laboratoire Louis Neel, CNRS, BP 166, 38042 Grenoble Cedex 9 (France); Berling, D.; Loegel, B. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Noudem, J.G.; Tournier, R. [EPM-MATFORMAG, Laboratoire dElaboration par Procede Magnetique, CNRS, BP 166, 38042 Grenoble Cedex 9 (France)

1997-09-01

We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe{lt}h{sub ac}{lt}100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL{close_quote}s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.{copyright} {ital 1997 Materials Research Society.}

Finger impedance evaluation by means of hand exoskeleton.

Science.gov (United States)

Fiorilla, Angelo Emanuele; Nori, Francesco; Masia, Lorenzo; Sandini, Giulio

2011-12-01

Modulation of arm mechanical impedance is a fundamental aspect for interaction with the external environment and its regulation is essential for stability preservation during manipulation. Even though past research on human arm movements has suggested that models of human finger impedance would benefit the study of neural control mechanisms and the design of novel hand prostheses, relatively few studies have focused on finger and hand impedance. This article touches on the two main aspects of this research topic: first it introduces a mechanical refinement of a device that can be used to effectively measure finger impedance during manipulation tasks; then, it describes a pilot study aimed at identifying the inertia of the finger and the viscous and elastic properties of finger muscles. The proposed wearable exoskeleton, which has been designed to measure finger posture and impedance modulation while leaving the palm free, is capable of applying fast displacements while monitoring the interaction forces between the human finger and the robotic links. Moreover, due to the relatively small inertia of the fingers, it allows us to meet some stringent specifications, performing relatively large displacements (~45°) before the stretch reflex intervenes (~25 ms). The results of measurements on five subjects show that inertia, damping, and stiffness can be effectively identified and that the parameters obtained are comparable with values from previous studies.

Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation

Science.gov (United States)

Reitan, D. K.

1973-01-01

Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.

Longitudinal coupling impedance of a hole in the accelerator beam pipe

International Nuclear Information System (INIS)

Chae, Yong-Chul.

1993-12-01

In the design of modern accelerators, an accurate estimate of coupling impedance is very important. The sources which give rise to coupling impedance are the geometric discontinuities in the accelerator beam pipe. In various discontinuities such as RF cavities, bellows, and collimators, the coupling impedance of the holes has not been well understood. Although coupling impedance can be obtained in general from the Fourier transform of the corresponding wake potential which may be obtained numerically, this is time consuming and requires a large amount of computer storage when applied to a small dimension of a discontinuity in a typical beam pipe, often imposing a fundamental limitation of the numerical approach. More fundamentally, however, numerical calculation does not have the predictive power because of limited understanding of how the coupling impedance of a hole should behave over a wide frequency range. This question was studied by developing a theoretical analysis based on a variational method. An analytical formula for the coupling impedance of a hole is developed in this work using a variational method. The result gives good qualitative agreements with the coupling impedances evaluated numerically from the Fourier transform of the wake potential which is obtained from the computer code MAFIA-T3. The author shows that the coupling impedance of a hole behaves quite similar to the impedance of an RLC-resonator circuit. Important parameters used to describe such a resonator circuit are the resonant frequency and bandwidth. The author provides a theoretical insight on how to parameterize properly the numerical impedance of a hole when data exhibit complicated dependence on frequency. This is possible because one can show that the parameters are a function of the dimensionless quantity kd alone, with k the free-space wave number and d the radius of hole

Stable, high-order computation of impedance-impedance operators for three-dimensional layered medium simulations

Science.gov (United States)

Nicholls, David P.

2018-04-01

The faithful modelling of the propagation of linear waves in a layered, periodic structure is of paramount importance in many branches of the applied sciences. In this paper, we present a novel numerical algorithm for the simulation of such problems which is free of the artificial singularities present in related approaches. We advocate for a surface integral formulation which is phrased in terms of impedance-impedance operators that are immune to the Dirichlet eigenvalues which plague the Dirichlet-Neumann operators that appear in classical formulations. We demonstrate a high-order spectral algorithm to simulate these latter operators based upon a high-order perturbation of surfaces methodology which is rapid, robust and highly accurate. We demonstrate the validity and utility of our approach with a sequence of numerical simulations.

Stable, high-order computation of impedance-impedance operators for three-dimensional layered medium simulations.

Science.gov (United States)

Nicholls, David P

2018-04-01

The faithful modelling of the propagation of linear waves in a layered, periodic structure is of paramount importance in many branches of the applied sciences. In this paper, we present a novel numerical algorithm for the simulation of such problems which is free of the artificial singularities present in related approaches. We advocate for a surface integral formulation which is phrased in terms of impedance-impedance operators that are immune to the Dirichlet eigenvalues which plague the Dirichlet-Neumann operators that appear in classical formulations. We demonstrate a high-order spectral algorithm to simulate these latter operators based upon a high-order perturbation of surfaces methodology which is rapid, robust and highly accurate. We demonstrate the validity and utility of our approach with a sequence of numerical simulations.

Beam impedance of ferrite kicker magnets

International Nuclear Information System (INIS)

Voelker, F.; Lambertson, G.

1989-03-01

We have measured the longitudinal beam impedance of a typical pulsed magnet that will be used in the Advanced Light Source. The magnets are of a ferrite window-frame design with a single plate conductor on each side. Two separate power supplies are used to drive current in opposite directions in the two conductors. The continuity of the ferrite yoke is interrupted by two copper plates 1 mm thick in the center of the top and bottom of the window frame. This increases the reluctance of the magnetic path, and thus decreases the flux which couples the beam. The measurements were made by exciting a 1/8'' rod along the beam path through the magnet. This makes a 185 ohm transmission line, and it was terminated in a resistive divider at the exit end. A 3 GHz network analyzer was used to measure S 21 through the magnet, and longitudinal beam impedance was calculated from this data. The impedance is dominated by two low frequency resonances in the magnet winding and drive current. 8 figs

A Case Study of Wind-PV-Thermal-Bundled AC/DC Power Transmission from a Weak AC Network

Science.gov (United States)

Xiao, H. W.; Du, W. J.; Wang, H. F.; Song, Y. T.; Wang, Q.; Ding, J.; Chen, D. Z.; Wei, W.

2017-05-01

Wind power generation and photovoltaic (PV) power generation bundled with the support by conventional thermal generation enables the generation controllable and more suitable for being sent over to remote load centre which are beneficial for the stability of weak sending end systems. Meanwhile, HVDC for long-distance power transmission is of many significant technique advantages. Hence the effects of wind-PV-thermal-bundled power transmission by AC/DC on power system have become an actively pursued research subject recently. Firstly, this paper introduces the technical merits and difficulties of wind-photovoltaic-thermal bundled power transmission by AC/DC systems in terms of meeting the requirement of large-scale renewable power transmission. Secondly, a system model which contains a weak wind-PV-thermal-bundled sending end system and a receiving end system in together with a parallel AC/DC interconnection transmission system is established. Finally, the significant impacts of several factors which includes the power transmission ratio between the DC and AC line, the distance between the sending end system and receiving end system, the penetration rate of wind power and the sending end system structure on system stability are studied.

Acousto-electrical speckle pattern in Lorentz force electrical impedance tomography

International Nuclear Information System (INIS)

Grasland-Mongrain, Pol; Destrempes, François; Cloutier, Guy; Mari, Jean-Martial; Souchon, Rémi; Catheline, Stefan; Chapelon, Jean-Yves; Lafon, Cyril

2015-01-01

Ultrasound speckle is a granular texture pattern appearing in ultrasound imaging. It can be used to distinguish tissues and identify pathologies. Lorentz force electrical impedance tomography is an ultrasound-based medical imaging technique of the tissue electrical conductivity. It is based on the application of an ultrasound wave in a medium placed in a magnetic field and on the measurement of the induced electric current due to Lorentz force. Similarly to ultrasound imaging, we hypothesized that a speckle could be observed with Lorentz force electrical impedance tomography imaging. In this study, we first assessed the theoretical similarity between the measured signals in Lorentz force electrical impedance tomography and in ultrasound imaging modalities. We then compared experimentally the signal measured in both methods using an acoustic and electrical impedance interface. Finally, a bovine muscle sample was imaged using the two methods. Similar speckle patterns were observed. This indicates the existence of an ‘acousto-electrical speckle’ in the Lorentz force electrical impedance tomography with spatial characteristics driven by the acoustic parameters but due to electrical impedance inhomogeneities instead of acoustic ones as is the case of ultrasound imaging. (paper)

Acousto-electrical speckle pattern in Lorentz force electrical impedance tomography

Science.gov (United States)

Grasland-Mongrain, Pol; Destrempes, François; Mari, Jean-Martial; Souchon, Rémi; Catheline, Stefan; Chapelon, Jean-Yves; Lafon, Cyril; Cloutier, Guy

2015-05-01

Ultrasound speckle is a granular texture pattern appearing in ultrasound imaging. It can be used to distinguish tissues and identify pathologies. Lorentz force electrical impedance tomography is an ultrasound-based medical imaging technique of the tissue electrical conductivity. It is based on the application of an ultrasound wave in a medium placed in a magnetic field and on the measurement of the induced electric current due to Lorentz force. Similarly to ultrasound imaging, we hypothesized that a speckle could be observed with Lorentz force electrical impedance tomography imaging. In this study, we first assessed the theoretical similarity between the measured signals in Lorentz force electrical impedance tomography and in ultrasound imaging modalities. We then compared experimentally the signal measured in both methods using an acoustic and electrical impedance interface. Finally, a bovine muscle sample was imaged using the two methods. Similar speckle patterns were observed. This indicates the existence of an ‘acousto-electrical speckle’ in the Lorentz force electrical impedance tomography with spatial characteristics driven by the acoustic parameters but due to electrical impedance inhomogeneities instead of acoustic ones as is the case of ultrasound imaging.

Hybrid-source impedance network and its generalized cascading concepts

DEFF Research Database (Denmark)

Li, Ding; Gao, Feng; Loh, Poh Chiang

2009-01-01

Hybrid-source impedance networks have attracted attention among researchers because of their flexibility in performing buck-boost energy conversion. To date, three distinct types of impedance networks can be summarized for implementing voltage-type inverters, with another three types summarized...... for current-type inverters. These impedance networks can in principle be combined into a single generic network entity, before generalized cascading concepts are proposed for connecting multiple of them together to form energy converters with a higher output voltage gain and other unique advantages...

Small-Signal Analysis of Single-Phase and Three-phase DC/AC and AC/DC PWM Converters with the Frequency-Shift Technique

DEFF Research Database (Denmark)

Blaabjerg, Frede; Aquila, A. Dell’; Liserre, Marco

2004-01-01

of dc/dc converters via a 50 Hz frequency-shift. The input admittance is calculated and measured for two study examples (a three-phase active rectifier and a single-phase photovoltaic inverter). These examples show that the purpose of a well designed controller for grid-connected converters......A systematic approach to study dc/ac and ac/dc converters without the use of synchronous transformation is proposed. The use of a frequency-shift technique allows a straightforward analysis of single-phase and three-phase systems. The study of dc/ac and of ac/dc converters is reported to the study...... is to minimize the input admittance in order to make the grid converter more robust to grid disturbance....

21 CFR 880.5100 - AC-powered adjustable hospital bed.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered adjustable hospital bed. 880.5100 Section 880.5100 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Therapeutic Devices § 880.5100 AC-powered adjustable hospital bed. (a) Identification. An AC-powered...

Nonlinear AC susceptibility, surface and bulk shielding

Science.gov (United States)

van der Beek, C. J.; Indenbom, M. V.; D'Anna, G.; Benoit, W.

1996-02-01

We calculate the nonlinear AC response of a thin superconducting strip in perpendicular field, shielded by an edge current due to the geometrical barrier. A comparison with the results for infinite samples in parallel field, screened by a surface barrier, and with those for screening by a bulk current in the critical state, shows that the AC response due to a barrier has general features that are independent of geometry, and that are significantly different from those for screening by a bulk current in the critical state. By consequence, the nonlinear (global) AC susceptibility can be used to determine the origin of magnetic irreversibility. A comparison with experiments on a Bi 2Sr 2CaCu 2O 8+δ crystal shows that in this material, the low-frequency AC screening at high temperature is mainly due to the screening by an edge current, and that this is the unique source of the nonlinear magnetic response at temperatures above 40 K.

AC BREAKDOWN IN GASES

Science.gov (United States)

electron- emission (multipactor) region, and (3) the low-frequency region. The breakdown mechanism in each of these regions is explained. An extensive bibliography on AC breakdown in gases is included.

Assessing the allelotypic effect of two aminocyclopropane carboxylic acid synthase-encoding genes MdACS1 and MdACS3a on fruit ethylene production and softening in Malus

Science.gov (United States)

Dougherty, Laura; Zhu, Yuandi; Xu, Kenong

2016-01-01

Phytohormone ethylene largely determines apple fruit shelf life and storability. Previous studies demonstrated that MdACS1 and MdACS3a, which encode 1-aminocyclopropane-1-carboxylic acid synthases (ACS), are crucial in apple fruit ethylene production. MdACS1 is well-known to be intimately involved in the climacteric ethylene burst in fruit ripening, while MdACS3a has been regarded a main regulator for ethylene production transition from system 1 (during fruit development) to system 2 (during fruit ripening). However, MdACS3a was also shown to have limited roles in initiating the ripening process lately. To better assess their roles, fruit ethylene production and softening were evaluated at five time points during a 20-day post-harvest period in 97 Malus accessions and in 34 progeny from 2 controlled crosses. Allelotyping was accomplished using an existing marker (ACS1) for MdACS1 and two markers (CAPS866 and CAPS870) developed here to specifically detect the two null alleles (ACS3a-G289V and Mdacs3a) of MdACS3a. In total, 952 Malus accessions were allelotyped with the three markers. The major findings included: The effect of MdACS1 was significant on fruit ethylene production and softening while that of MdACS3a was less detectable; allele MdACS1–2 was significantly associated with low ethylene and slow softening; under the same background of the MdACS1 allelotypes, null allele Mdacs3a (not ACS3a-G289V) could confer a significant delay of ethylene peak; alleles MdACS1–2 and Mdacs3a (excluding ACS3a-G289V) were highly enriched in M. domestica and M. hybrid when compared with those in M. sieversii. These findings are of practical implications in developing apples of low and delayed ethylene profiles by utilizing the beneficial alleles MdACS1-2 and Mdacs3a. PMID:27231553

AC electric motors control advanced design techniques and applications

CERN Document Server

Giri, Fouad

2013-01-01

The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

Wideband impedance measurements and modeling of DC motors for EMI predictions

NARCIS (Netherlands)

Diouf, F.; Leferink, Frank Bernardus Johannes; Duval, Fabrice; Bensetti, Mohamed

2015-01-01

In electromagnetic interference prediction, dc motors are usually modeled as a source and a series impedance. Previous researches only include the impedance of the armature, while neglecting the effect of the motor's rotation. This paper aims at measuring and modeling the wideband impedance of a dc

VLF surface-impedance modelling techniques for coal exploration

Energy Technology Data Exchange (ETDEWEB)

Wilson, G.; Thiel, D.; O' Keefe, S. [Central Queensland University, Rockhampton, Qld. (Australia). Faculty of Engineering and Physical Systems

2000-10-01

New and efficient computational techniques are required for geophysical investigations of coal. This will allow automated inverse analysis procedures to be used for interpretation of field data. In this paper, a number of methods of modelling electromagnetic surface impedance measurements are reviewed, particularly as applied to typical coal seam geology found in the Bowen Basin. At present, the Impedance method and the finite-difference time-domain (FDTD) method appear to offer viable solutions although both have problems. The Impedance method is currently slightly inaccurate, and the FDTD method has large computational demands. In this paper both methods are described and results are presented for a number of geological targets. 17 refs., 14 figs.

Shunt impedance of spiral loaded resonant rf cavities

International Nuclear Information System (INIS)

Peebles, P.Z. Jr.; Parvarandeh, M.

1975-01-01

Based upon a treatment of the spiral loaded resonant radio frequency cavity as a shorted quarter-wave transmission line, a model for shunt impedance is developed. The model is applicable to loosely wound spirals in large diameter containers. Theoretical shunt impedance is given for spirals wound from tubing of circular or rectangular cross section. The former produces higher shunt impedance. Measurements made at Oak Ridge National Laboratory on 17 copper cavities are described which support the theoretical results. Theoretical results are also compared to data from twenty-three additional cavities measured at Los Alamos Scientific Laboratory. It is shown that the theoretical function forms a useful means of interpreting the quality of constructed cavities. (author)

Pengembangan Sistem Otomatisasi AC dan Lampu Menggunakan Fuzzy dan Raspberry Pi

Directory of Open Access Journals (Sweden)

Rudy Ariyanto

2017-11-01

Full Text Available Otomatisasi AC dan lampu dilakukan untuk menghemat energi yang digunakan pada kehidupan sehari-hari. Dalam pengembangan otomatisasi AC dan lampu perlu menerapkan sebuah perangkat yang memiliki fungsi maksimal dengan harga yang minimal. Raspberry Pi merupakan perangkat atau modul dengan harga rendah yang mampu melakukan komunikasi wireless tanpa bantuan modul lain. Dalam pengembangan otomatisasi AC dan lampu juga diperlukan sebuah metode yang mampu melakukan kontrol terhadap nyala AC dan lampu. Penerapan metode fuzzy dapat dilakukan untuk menghimpun informasi keadaan ruang yang didapat dari sensor untuk menentukan nyala AC dan lampu secara otomatis. Oleh sebab itu pada penelitian ini mengusulkan pengembangan otomatisasi AC dan lampu menggunakan Raspberry Pi dan Fuzzy. Otomatisasi AC dan lampu menggunakan Raspberry Pi yang menerapkan metode Fuzzy dapat menghemat energi hingga 59,87% dalam hal lama waktu nyala AC dan 57,47% untuk lumenasi lampu

Electrochemical Impedance Spectroscopy Of Metal Alloys

Science.gov (United States)

Macdowell, L. G.; Calle, L. M.

1993-01-01

Report describes use of electrochemical impedance spectroscopy (EIS) to investigate resistances of 19 alloys to corrosion under conditions similar to those of corrosive, chloride-laden seaside environment of Space Transportation System launch site. Alloys investigated: Hastelloy C-4, C-22, C-276, and B-2; Inconel(R) 600, 625, and 825; Inco(R) G-3; Monel 400; Zirconium 702; Stainless Steel 304L, 304LN, 316L, 317L, and 904L; 20Cb-3; 7Mo+N; ES2205; and Ferralium 255. Results suggest electrochemical impedance spectroscopy used to predict corrosion performances of metal alloys.

Impedance-Source Networks for Electric Power Conversion Part I

DEFF Research Database (Denmark)

Siwakoti, Yam P.; Peng, Fang Zheng; Blaabjerg, Frede

2015-01-01

power chain, which may improve the reliability and performance of the power system. The first part of this paper provides a comprehensive review of the various impedance-source-networks-based power converters and discusses the main topologies from an application point of view. This review paper...... is the first of its kind with the aim of providing a “one-stop” information source and a selection guide on impedance-source networks for power conversion for researchers, designers, and application engineers. A comprehensive review of various modeling, control, and modulation techniques for the impedance...

Coupling Impedance of the CERN SPS beam position monitors

CERN Document Server

Salvant, B; Boccard, C; Caspers, Friedhelm; Grudiev, A; Jones, R; Métral, E; Rumolo, G; Zannini, C; Spataro, B; Alesini, D; Migliorati, M; Roncarolo, F; Calaga, R

2010-01-01

A detailed knowledge of the beam coupling impedance of the CERN Super Proton Synchrotron (SPS) is required in order to operate this machine with a higher intensity for the foreseen Large Hadron Collider (LHC) luminosity upgrade. A large number of Beam Position Monitors (BPMs) is currently installed in the SPS, and this is why their contribution to the SPS impedance has to be assessed. This paper focuses on electromagnetic (EM) simulations and bench measurements of the longitudinal and transverse impedance generated by the horizontal and vertical BPMs installed in the SPS machine.

Electrochemical Impedance Spectroscopy in Solid State Ionics: Recent Advances

NARCIS (Netherlands)

Boukamp, Bernard A.

2004-01-01

Electrochemical Impedance Spectroscopy (EIS) has become an important research tool in Solid State Ionics. Some new developments are highlighted: new methods of automatic parameter extraction from impedance measurements are briefly discussed. The Kramers–Kronig data validation test presents another

Performance Comparison for Virtual Impedance Techniques Used in Droop Controlled Islanded Microgrids

DEFF Research Database (Denmark)

Micallef, Alexander; Apap, Maurice; Spiteri-Staines, Cyril

2016-01-01

). Virtual impedance loops were proposed in literature to improve the current sharing between the inverters by normalizing the output impedance of the inverters. However, virtual impedance loops have constraints in this respect since the improvement in the current sharing occurs through redistribution...... for a single phase microgrid setup to achieve a fair performance comparison of the different virtual impedance techniques....

Dielectric relaxation and ac conductivity behaviour of polyvinyl alcohol–HgSe quantum dot hybrid films

International Nuclear Information System (INIS)

Sinha, Subhojyoti; Chatterjee, Sanat Kumar; Meikap, Ajit Kumar; Ghosh, Jiten

2014-01-01

Here we report a comparative study on the dielectric relaxation and ac conductivity behaviour of pure polyvinyl alcohol (PVA) and PVA–mercury selenide (HgSe) quantum dot hybrid films in the temperature range 298 K ⩽ T ⩽ 420 K and in the frequency range 100 Hz ⩽ f ⩽ 1 MHz. The prepared nanocomposite exhibits a larger dielectric constant as compared to the pure PVA. The real and imaginary parts of the dielectric constants were found to fit appreciably with the modified Cole–Cole equation, from which temperature-dependent values of the relaxation times, free charge carrier conductivity and space charge carrier conductivity were calculated. The relaxation time decreases with the quantum dot's inclusion in the PVA matrix and with an increase in temperature, whereas free charge carrier conductivity and space charge carrier conductivity increases with an increase in temperature. An increase in ac conductivity for the nanocomposites has also been observed, while the charge transport mechanism was found to follow the correlated barrier hopping model in both cases. An easy-path model with a suitable electrical equivalent circuit has been employed to analyse the temperature-dependent impedance spectra. The imaginary part of the complex electric modulus spectra exhibit an asymmetric nature and a non-Debye type of behaviour, which has been elucidated considering a generalized susceptibility function. The electric modulus spectra of the nanocomposite demonstrate a smaller amplitude and broader width, as compared to the pure PVA sample. (paper)

Successful enrichment of the ubiquitous freshwater acI Actinobacteria.

Science.gov (United States)

Garcia, Sarahi L; McMahon, Katherine D; Grossart, Hans-Peter; Warnecke, Falk

2014-02-01

Actinobacteria of the acI lineage are often the numerically dominant bacterial phylum in surface freshwaters, where they can account for > 50% of total bacteria. Despite their abundance, there are no described isolates. In an effort to obtain enrichment of these ubiquitous freshwater Actinobacteria, diluted freshwater samples from Lake Grosse Fuchskuhle, Germany, were incubated in 96-well culture plates. With this method, a successful enrichment containing high abundances of a member of the lineage acI was established. Phylogenetic classification showed that the acI Actinobacteria of the enrichment belonged to the acI-B2 tribe, which seems to prefer acidic lakes. This enrichment grows to low cell densities and thus the oligotrophic nature of acI-B2 was confirmed. © 2013 Society for Applied Microbiology and John Wiley & Sons Ltd.

Impact of ac/dc spark anodizing on the corrosion resistance of Al-Cu alloys

Energy Technology Data Exchange (ETDEWEB)

Alsrayheen, Enam, E-mail: ealsrayh@ucalgary.ca [Department of Chemistry, University of Calgary, 2500 University Drive NW, Calgary AB, T2N 1N4 (Canada); McLeod, Eric, E-mail: hmolero@ucalgary.ca [Department of Chemistry, University of Calgary, 2500 University Drive NW, Calgary AB, T2N 1N4 (Canada); Rateick, Richard, E-mail: richard.rateick@honeywell.com [Department of Chemistry, University of Calgary, 2500 University Drive NW, Calgary AB, T2N 1N4 (Canada); Molero, Hebert, E-mail: Eric.McLeod@stmu.ab.ca [Department of Chemistry, University of Calgary, 2500 University Drive NW, Calgary AB, T2N 1N4 (Canada); Birss, Viola, E-mail: birss@ucalgary.ca [Department of Chemistry, University of Calgary, 2500 University Drive NW, Calgary AB, T2N 1N4 (Canada)

2011-07-01

An ac/dc spark anodization method was used to deposit an oxide film (6 {+-} 3 {mu}m in thickness) on the Al-Cu alloy AA2219. The oxide films were formed at 10 mA/cm{sup 2} for 30 min in an alkaline silicate solution, showing three main stages of growth. Scanning electron microscopy and electron microprobe analysis revealed that the oxide films are not uniform and consist of three main layers, an inner Al-rich barrier layer ({approx}1 {mu}m), an intermediate Al-Si mixed oxide layer ({approx}2 {+-} 1 {mu}m), and an outer porous Si-rich layer ({approx}3 {+-} 3 {mu}m). In addition, microscopic analysis showed that the Al{sub 2}Cu intermetallics present in the alloy have not been excessively oxidized during the anodization process and thus are retained beneath the oxide film, as desired. The coating passivity and corrosion resistance, evaluated using linear sweep voltammetry (LSV) in pH 7 borate buffer solution and electrochemical impedance spectroscopy (EIS) in 0.86 M NaCl solution, respectively, were both significantly improved after spark-anodization.

Wavelet analysis of the impedance cardiogram waveforms

Science.gov (United States)

Podtaev, S.; Stepanov, R.; Dumler, A.; Chugainov, S.; Tziberkin, K.

2012-12-01

Impedance cardiography has been used for diagnosing atrial and ventricular dysfunctions, valve disorders, aortic stenosis, and vascular diseases. Almost all the applications of impedance cardiography require determination of some of the characteristic points of the ICG waveform. The ICG waveform has a set of characteristic points known as A, B, E ((dZ/dt)max) X, Y, O and Z. These points are related to distinct physiological events in the cardiac cycle. Objective of this work is an approbation of a new method of processing and interpretation of the impedance cardiogram waveforms using wavelet analysis. A method of computer thoracic tetrapolar polyrheocardiography is used for hemodynamic registrations. Use of original wavelet differentiation algorithm allows combining filtration and calculation of the derivatives of rheocardiogram. The proposed approach can be used in clinical practice for early diagnostics of cardiovascular system remodelling in the course of different pathologies.

Wavelet analysis of the impedance cardiogram waveforms

International Nuclear Information System (INIS)

Podtaev, S; Stepanov, R; Dumler, A; Chugainov, S; Tziberkin, K

2012-01-01

Impedance cardiography has been used for diagnosing atrial and ventricular dysfunctions, valve disorders, aortic stenosis, and vascular diseases. Almost all the applications of impedance cardiography require determination of some of the characteristic points of the ICG waveform. The ICG waveform has a set of characteristic points known as A, B, E ((dZ/dt) max ) X, Y, O and Z. These points are related to distinct physiological events in the cardiac cycle. Objective of this work is an approbation of a new method of processing and interpretation of the impedance cardiogram waveforms using wavelet analysis. A method of computer thoracic tetrapolar polyrheocardiography is used for hemodynamic registrations. Use of original wavelet differentiation algorithm allows combining filtration and calculation of the derivatives of rheocardiogram. The proposed approach can be used in clinical practice for early diagnostics of cardiovascular system remodelling in the course of different pathologies.

AcEST(EST sequences of Adiantum capillus-veneris and their annotation) - AcEST | LSDB Archive [Life Science Database Archive metadata

Lifescience Database Archive (English)

Full Text Available List Contact us AcEST AcEST(EST sequences of Adiantum capillus-veneris and their annotation) Data detail Dat...a name AcEST(EST sequences of Adiantum capillus-veneris and their annotation) DOI 10.18908/lsdba.nbdc00839-0...01 Description of data contents EST sequence of Adiantum capillus-veneris and its annotation (clone ID, libr...le search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acest#en Data acquisition method Capillary ...ainst UniProtKB/Swiss-Prot and UniProtKB/TrEMBL databases) Number of data entries Adiantum capillus-veneris

High transmission acoustic focusing by impedance-matched acoustic meta-surfaces

KAUST Repository

Al Jahdali, Rasha

2016-01-19

Impedance is an important issue in the design of acoustic lenses because mismatched impedance is detrimental to real focusing applications. Here, we report two designs of acoustic lenses that focus acoustic waves in water and air, respectively. They are tailored by acoustic meta-surfaces, which are rigid thin plates decorated with periodically distributed sub-wavelength slits. Their respective building blocks are constructed from the coiling-up spaces in water and the layered structures in air. Analytic analysis based on coupled-mode theory and transfer matrix reveals that the impedances of the lenses are matched to those of the background media. With these impedance-matched acoustic lenses, we demonstrate the acoustic focusing effect by finite-element simulations.

High transmission acoustic focusing by impedance-matched acoustic meta-surfaces

KAUST Repository

Al Jahdali, Rasha; Wu, Ying

2016-01-01

Impedance is an important issue in the design of acoustic lenses because mismatched impedance is detrimental to real focusing applications. Here, we report two designs of acoustic lenses that focus acoustic waves in water and air, respectively. They are tailored by acoustic meta-surfaces, which are rigid thin plates decorated with periodically distributed sub-wavelength slits. Their respective building blocks are constructed from the coiling-up spaces in water and the layered structures in air. Analytic analysis based on coupled-mode theory and transfer matrix reveals that the impedances of the lenses are matched to those of the background media. With these impedance-matched acoustic lenses, we demonstrate the acoustic focusing effect by finite-element simulations.

Design and synthesis of 225Ac radioimmunopharmaceuticals

International Nuclear Information System (INIS)

McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A.

2002-01-01

The alpha-particle-emitting radionuclides 213 Bi, 211 At, 224 Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. 213 Bi and 211 At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated 224 Ra chloride selectively seeks bone. 225 Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential 225 Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach 225 Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93±8% radiochemically pure (n=26). The second step yielded 225 Ac-DOTA-IgG constructs that were 95±5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted 225 Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans

Nuclear structure of 231Ac

International Nuclear Information System (INIS)

Boutami, R.; Borge, M.J.G.; Mach, H.; Kurcewicz, W.; Fraile, L.M.; Gulda, K.; Aas, A.J.; Garcia-Raffi, L.M.; Lovhoiden, G.; Martinez, T.; Rubio, B.; Tain, J.L.; Tengblad, O.

2008-01-01

The low-energy structure of 231 Ac has been investigated by means of γ ray spectroscopy following the β - decay of 231 Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of 231 Ra → 231 Ac has been constructed for the first time. The Advanced Time Delayed βγγ(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus

Autographa californica multiple nucleopolyhedrovirus ac53 plays a role in nucleocapsid assembly

International Nuclear Information System (INIS)

Liu Chao; Li Zhaofei; Wu Wenbi; Li Lingling; Yuan Meijin; Pan Lijing; Yang Kai; Pang Yi

2008-01-01

Autographa californica multiple nucleopolyhedrovirus (AcMNPV) orf53 (ac53) is a highly conserved gene existing in all sequenced Lepidoptera and Hymenoptera baculoviruses, but its function remains unknown. To investigate its role in the baculovirus life cycle, an ac53 deletion virus (vAc ac53KO-PH-GFP ) was generated through homologous recombination in Escherichia coli. Fluorescence and light microscopy and titration analysis revealed that vAc ac53KO-PH-GFP could not produce infectious budded virus in infected Sf9 cells. Real-time PCR demonstrated that the ac53 deletion did not affect the levels of viral DNA replication. Electron microscopy showed that many lucent tubular shells devoid of the nucleoprotein core are present in the virogenic stroma and ring zone, indicating that the ac53 knockout affected nucleocapsid assembly. With a recombinant virus expressing an Ac53-GFP fusion protein, we observed that Ac53 was distributed within the cytoplasm and nucleus at 24 h post-infection, but afterwards accumulated predominantly near the nucleus-cytoplasm boundary. These data demonstrate that ac53 is involved in nucleocapsid assembly and is an essential gene for virus production

Marketingová komunikace AC Sparta Praha

OpenAIRE

Fanta, Jan

2016-01-01

Title: Marketing communications of AC Sparta Praha Objectives: The main objective of this thesis is to analyze contemporary state of marketing communications with the audience of AC Sparta Praha, identify deficiencies and develop a proposal to improve the marketing communications with fans of this club. Methods: In this thesis have been used methods of case study, analysis of available documents and texts, structured interview with director od marketing, and director of communications and pub...

Investigating the low-temperature impedance increase of lithium-ion cells

International Nuclear Information System (INIS)

Abraham, D. P.; Heaton, J. R.; Kang, S.-H.; Dees, D. W.; Jansen, A. N.; Chemical Engineering

2008-01-01

Low-temperature performance loss is a significant barrier to commercialization of lithium-ion cells in hybrid electric vehicles. Increased impedance, especially at temperatures below 0 C, reduces the cell pulse power performance required for cold engine starts, quick acceleration, or regenerative braking. Here we detail electrochemical impedance spectroscopy data on binder- and carbon-free layered-oxide and spinel-oxide electrodes, obtained over the +30 to ?30 C temperature range, in coin cells containing a lithium-preloaded Li 4/3 Ti 5/3 O 4 composite (LTOc) counter electrode and a LiPF 6 -bearing ethylene carbonate/ethyl methyl carbonate electrolyte. For all electrodes studied, the impedance increased with decreasing cell temperature; the increases observed in the midfrequency arc dwarfed the increases in ohmic resistance and diffusional impedance. Our data suggest that the movement of lithium ions across the electrochemical interface on the active material may have been increasingly hindered at lower temperatures, especially below 0 C. Low-temperature performance may be improved by modifying the electrolyte-active material interface (for example, through electrolyte composition changes). Increasing surface area of active particles (for example, through nanoparticle use) can lower the initial electrode impedance and lead to lower cell impedances at -30 C

Development of a Multifidelity Approach to Acoustic Liner Impedance Eduction

Science.gov (United States)

Nark, Douglas M.; Jones, Michael G.

2017-01-01

The use of acoustic liners has proven to be extremely effective in reducing aircraft engine fan noise transmission/radiation. However, the introduction of advanced fan designs and shorter engine nacelles has highlighted a need for novel acoustic liner designs that provide increased fan noise reduction over a broader frequency range. To achieve aggressive noise reduction goals, advanced broadband liner designs, such as zone liners and variable impedance liners, will likely depart from conventional uniform impedance configurations. Therefore, educing the impedance of these axial- and/or spanwise-variable impedance liners will require models that account for three-dimensional effects, thereby increasing computational expense. Thus, it would seem advantageous to investigate the use of multifidelity modeling approaches to impedance eduction for these advanced designs. This paper describes an extension of the use of the CDUCT-LaRC code to acoustic liner impedance eduction. The proposed approach is applied to a hardwall insert and conventional liner using simulated data. Educed values compare well with those educed using two extensively tested and validated approaches. The results are very promising and provide justification to further pursue the complementary use of CDUCT-LaRC with the currently used finite element codes to increase the efficiency of the eduction process for configurations involving three-dimensional effects.

Validation of an Acoustic Impedance Prediction Model for Skewed Resonators

Science.gov (United States)

Howerton, Brian M.; Parrott, Tony L.

2009-01-01

An impedance prediction model was validated experimentally to determine the composite impedance of a series of high-aspect ratio slot resonators incorporating channel skew and sharp bends. Such structures are useful for packaging acoustic liners into constrained spaces for turbofan noise control applications. A formulation of the Zwikker-Kosten Transmission Line (ZKTL) model, incorporating the Richards correction for rectangular channels, is used to calculate the composite normalized impedance of a series of six multi-slot resonator arrays with constant channel length. Experimentally, acoustic data was acquired in the NASA Langley Normal Incidence Tube over the frequency range of 500 to 3500 Hz at 120 and 140 dB OASPL. Normalized impedance was reduced using the Two-Microphone Method for the various combinations of channel skew and sharp 90o and 180o bends. Results show that the presence of skew and/or sharp bends does not significantly alter the impedance of a slot resonator as compared to a straight resonator of the same total channel length. ZKTL predicts the impedance of such resonators very well over the frequency range of interest. The model can be used to design arrays of slot resonators that can be packaged into complex geometries heretofore unsuitable for effective acoustic treatment.

Electrical Impedance Spectroscopy for Electro-Mechanical Characterization of Conductive Fabrics

Directory of Open Access Journals (Sweden)

Tushar Kanti Bera

2014-06-01

Full Text Available When we use a conductive fabric as a pressure sensor, it is necessary to quantitatively understand its electromechanical property related with the applied pressure. We investigated electromechanical properties of three different conductive fabrics using the electrical impedance spectroscopy (EIS. We found that their electrical impedance spectra depend not only on the electrical properties of the conductive yarns, but also on their weaving structures. When we apply a mechanical tension or compression, there occur structural deformations in the conductive fabrics altering their apparent electrical impedance spectra. For a stretchable conductive fabric, the impedance magnitude increased or decreased under tension or compression, respectively. For an almost non-stretchable conductive fabric, both tension and compression resulted in decreased impedance values since the applied tension failed to elongate the fabric. To measure both tension and compression separately, it is desirable to use a stretchable conductive fabric. For any conductive fabric chosen as a pressure-sensing material, its resistivity under no loading conditions must be carefully chosen since it determines a measurable range of the impedance values subject to different amounts of loadings. We suggest the EIS method to characterize the electromechanical property of a conductive fabric in designing a thin and flexible fabric pressure sensor.

Impedance Characterization and Modeling of Lithium-Ion Batteries Considering the Internal Temperature Gradient

Directory of Open Access Journals (Sweden)

Haifeng Dai

2018-01-01

Full Text Available Battery impedance is essential to the management of lithium-ion batteries for electric vehicles (EVs, and impedance characterization can help to monitor and predict the battery states. Many studies have been undertaken to investigate impedance characterization and the factors that influence impedance. However, few studies regarding the influence of the internal temperature gradient, which is caused by heat generation during operation, have been presented. We have comprehensively studied the influence of the internal temperature gradient on impedance characterization and the modeling of battery impedance, and have proposed a discretization model to capture battery impedance characterization considering the temperature gradient. Several experiments, including experiments with artificial temperature gradients, are designed and implemented to study the influence of the internal temperature gradient on battery impedance. Based on the experimental results, the parameters of the non-linear impedance model are obtained, and the relationship between the parameters and temperature is further established. The experimental results show that the temperature gradient will influence battery impedance and the temperature distribution can be considered to be approximately linear. The verification results indicate that the proposed discretization model has a good performance and can be used to describe the actual characterization of the battery with an internal temperature gradient.

Optimization design of power efficiency of exponential impedance transformer

International Nuclear Information System (INIS)

Wang Meng; Zou Wenkang; Chen Lin; Guan Yongchao; Fu Jiabin; Xie Weiping

2011-01-01

The paper investigates the optimization design of power efficiency of exponential impedance transformer with analytic method and numerical method. In numerical calculation, a sine wave Jantage with hypothesis of rising edge equivalence is regarded as the forward-going Jantage at input of transformer, and its dominant angular frequency is determined by typical rise-time of actual Jantage waveforms. At the same time, dissipative loss in water dielectric is neglected. The numerical results of three typical modes of impedance transformation, viz. linear mode, saturation mode and steep mode,are compared. Pivotal factors which affect the power efficiency of exponential impedance transformer are discussed, and a certain extent quantitative range of intermediate variables and accordance coefficients are obtained. Finally, the paper discusses some important issues in actual design, such as insulation safety factor in structure design, effects of coupling capacitance on impedance calculation, and dissipative loss in water dielectric. (authors)

Low profile conformal antenna arrays on high impedance substrate

CERN Document Server

Singh, Hema; Jha, Rakesh Mohan

2016-01-01

This book presents electromagnetic (EM) design and analysis of dipole antenna array over high impedance substrate (HIS). HIS is a preferred substrate for low-profile antenna design, owing to its unique boundary conditions. Such substrates permit radiating elements to be printed on them without any disturbance in the radiation characteristics. Moreover HIS provides improved impedance matching, enhanced bandwidth, and increased broadside directivity owing to total reflection from the reactive surface and high input impedance. This book considers different configurations of HIS for array design on planar and non-planar high-impedance surfaces. Results are presented for cylindrical dipole, printed dipole, and folded dipole over single- and double-layered square-patch-based HIS and dogbone-based HIS. The performance of antenna arrays is analyzed in terms of performance parameters such as return loss and radiation pattern. The design presented shows acceptable return loss and mainlobe gain of radiation pattern. Thi...

c-axis ac susceptibility in high-Tc superconductors

International Nuclear Information System (INIS)

Waldmann, O.; Lichtschlag, G.; Talalaevskii, A.; Kleiner, R.; Mueller, P.; Steinmeyer, F.; Gerhaeuser, W.