IEC SC15E: Report on liaison activities of CIGRÉ-SC15

DEFF Research Database (Denmark)

Henriksen, Mogens

2000-01-01

WG’s activities under CIGRÉ SC15:WG 15.01 - Fluid impregnated systems.WG 15.02 - Dielectric Liquids.WG 15.03 - Gas Insulation.WG 15.04 - Outdoor Insulation.WG 15.05 - Capacitors.WG 15.07 - Solid Insulating Materials for Rotating Machines.WG 15/33.08 - Insulation Monitoring and Life Estimation. WG...

GaN-based FETs using Cat-CVD SiN passivation for millimeter-wave applications

International Nuclear Information System (INIS)

Higashiwaki, Masataka; Mimura, Takashi; Matsui, Toshiaki

2008-01-01

We have found that SiN passivation by catalytic chemical vapor deposition (Cat-CVD) can significantly increase an electron density of an AlGaN/GaN heterostructure field-effect transistor (HFET). This effect enables thin-barrier HFET structures to have a high-density two-dimensional electron gas and leads to suppression of short-channel effects. We fabricated 30-nm-gate Al 0.4 Ga 0.6 N(8 nm)/GaN HFETs using Cat-CVD SiN. The maximum drain current density and extrinsic transconductance were 1.49 A/mm and 402 mS/mm, respectively. Current-gain cutoff frequency and maximum oscillation frequency of the HFETs were 181 and 186 GHz, respectively. These high-frequency device characteristics are sufficiently high enough for millimeter-wave applications

Predicting the performance of a power amplifier using large-signal circuit simulations of an AlGaN/GaN HFET model

Science.gov (United States)

Bilbro, Griff L.; Hou, Danqiong; Yin, Hong; Trew, Robert J.

2009-02-01

We have quantitatively modeled the conduction current and charge storage of an HFET in terms its physical dimensions and material properties. For DC or small-signal RF operation, no adjustable parameters are necessary to predict the terminal characteristics of the device. Linear performance measures such as small-signal gain and input admittance can be predicted directly from the geometric structure and material properties assumed for the device design. We have validated our model at low-frequency against experimental I-V measurements and against two-dimensional device simulations. We discuss our recent extension of our model to include a larger class of electron velocity-field curves. We also discuss the recent reformulation of our model to facilitate its implementation in commercial large-signal high-frequency circuit simulators. Large signal RF operation is more complex. First, the highest CW microwave power is fundamentally bounded by a brief, reversible channel breakdown in each RF cycle. Second, the highest experimental measurements of efficiency, power, or linearity always require harmonic load pull and possibly also harmonic source pull. Presently, our model accounts for these facts with an adjustable breakdown voltage and with adjustable load impedances and source impedances for the fundamental frequency and its harmonics. This has allowed us to validate our model for large signal RF conditions by simultaneously fitting experimental measurements of output power, gain, and power added efficiency of real devices. We show that the resulting model can be used to compare alternative device designs in terms of their large signal performance, such as their output power at 1dB gain compression or their third order intercept points. In addition, the model provides insight into new device physics features enabled by the unprecedented current and voltage levels of AlGaN/GaN HFETs, including non-ohmic resistance in the source access regions and partial depletion of

Phobos - Spectrophotometry between 0.3 and 0.6 micron and IR-radiometry

Science.gov (United States)

Ksanfomality, L.; Murchie, S.; Britt, D.; Fisher, P.; Duxbury, T.

1991-01-01

A 0.3 - 0.6 micron UV-visible spectrophotometer and a 5 - 50 micron radiometer in the KRFM experiment on Phobos 2 measured two groundtracks in the equatorial region of Phobos. Preliminary results indicate that three surface units can be recognized on the basis of differing UV-visible spectral reflectance properties. One of the units is most comparable spectrally to optically darkened mafic material, and a second is comparable either to anhydrous carbonaceous chondrite or to blackened mafic material. Spectral properties of the third unit do not resemble those of known meteorite types. Brightness temperatures measured by the radiometer are consistent with a typical surface thermal inertia of 1 - 3 x 10 to the -3 cal/(sq cm deg s exp 1/2), as suggested by previous investigations, implying a lunar-like regolith texture. At least one area of possibly higher thermal inertia has been tentatively identified, where a large degraded crater is crossed by several grooves. These results indicate significant lateral heterogeneity in the optical and textural properties of Phobos' surface.

Paracyclophane functionalized with Sc and Li for hydrogen storage

Science.gov (United States)

Sathe, Rohit Y.; Dhilip Kumar, T. J.

2018-01-01

Li and Sc metals functionalized on the delocalized π -electrons of benzene rings in [2,2]paracyclophane structure are studied for hydrogen storage efficiency by using the M06 DFT functional with 6-311G(d,p) basis set. It is found that Sc and Li functionalized [2,2]paracyclophane complexes can hold up to 10 H2 molecules and 8 H2 molecules by Kubas-Niu-Jena interaction and charge polarization mechanism with hydrogen weight percentage of 11.4 and 13.5, respectively. Molecular dynamics simulation at various temperatures showed appreciable thermal stability while the chemical potential calculation at room temperature reveals that Sc functionalized [2,2]paracyclophane system will be a promising hydrogen storage material.

Symmetry breaking and electrical conductivity of La0.7Sr0.3Cr0.4Mn0.6O3-δ perovskite as SOFC anode material

International Nuclear Information System (INIS)

Reyes-Rojas, A.; Alvarado-Flores, J.; Esparza-Ponce, H.; Esneider-Alcala, M.; Espitia-Cabrera, I.; Torres-Moye, E.

2011-01-01

Research highlights: → Perovskite-type La 0.7 Sr 0.3 Cr 0.4 Mn 0.6 O 3-δ -NiO nucleation kinetics. Symmetry-breaking by introducing Ni 2+ cations at 1050 deg. C. Phase transition from high temperature aristotype R3-bar c to hettotype I4/mmm. At low Ni concentration ρ resistivity decreases when increasing the temperature. For Ni concentration higher than 25% ρ resistivity increases. - Abstract: This work is focused on nanocrystalline solid oxide fuel cell synthesis and characterization (SOFC) anodes of La 0.7 Sr 0.3 Cr 0.4 Mn 0.6 O 3-δ (perovskite-type) with Nickel. Perovskite-type oxide chemical reactivity, nucleation kinetics and phase composition related with La 0.7 Sr 0.3 Cr 0.4 Mn 0.6 O 3-δ -NiO to La 0.7 Sr 0.3 Cr 0.4 Mn 0.6 O 3-δ -Ni transformation have been analyzed. SOFC anode powders were obtained by sol-gel synthesis, using polyvinyl alcohol as an organic precursor to get a porous cermet electrode after sintering at 1365 deg. C and oxide reduction by hydrogen at 800 deg. C/1050 deg. C for 8 h in a horizontal tubular reactor furnace under 10% H 2 /N 2 atmosphere. Composite powders were compressed into 10-mm diameter discs with 25-75 wt% Ni. Electrical and structural characterization by four-point probe method for conductivity, scanning electron microscopy (SEM), X-ray energy dispersive spectroscopy (EDS), X-ray diffraction (XRD), and Rietveld method were carried out. Symmetry-breaking by phase transition from high temperature aristotype R3-bar c to hettotype I4/mmm has been identified and confirmed by XRD and Rietveld method which can be produced by introducing Ni 2+ cations in the perovskite solid solution. Rietveld analysis suggests that Ni contents are directly proportional to La 0.7 Sr 0.3 Cr 0.4 Mn 0.6 NiO 3.95 tetragonal structure cell volume and inversely proportional to Ni cubic structure cell volume after reduction at 1050 deg. C. Kinetic analysis indicated that the Johnson-Mehl-Avrami equation is able to provide a good fit to phase

Fabrication of Very High Efficiency 5.8 GHz Power Amplifiers using AlGaN HFETs on SiC Substrates for Wireless Power Transmission

Science.gov (United States)

Sullivan, Gerry

2001-01-01

For wireless power transmission using microwave energy, very efficient conversion of the DC power into microwave power is extremely important. Class E amplifiers have the attractive feature that they can, in theory, be 100% efficient at converting, DC power to RF power. Aluminum gallium nitride (AlGaN) semiconductor material has many advantageous properties, relative to silicon (Si), gallium arsenide (GaAs), and silicon carbide (SiC), such as a much larger bandgap, and the ability to form AlGaN/GaN heterojunctions. The large bandgap of AlGaN also allows for device operation at higher temperatures than could be tolerated by a smaller bandgap transistor. This could reduce the cooling requirements. While it is unlikely that the AlGaN transistors in a 5.8 GHz class E amplifier can operate efficiently at temperatures in excess of 300 or 400 C, AlGaN based amplifiers could operate at temperatures that are higher than a GaAs or Si based amplifier could tolerate. Under this program, AlGaN microwave power HFETs have been fabricated and characterized. Hybrid class E amplifiers were designed and modeled. Unfortunately, within the time frame of this program, good quality HFETs were not available from either the RSC laboratories or commercially, and so the class E amplifiers were not constructed.

CMS ECAL Endcap (EE) Dee Assembly - SC mounting on Dee 1

CERN Multimedia

Cockerill, D

2007-01-01

Protection panels on back of Dee 1, Completion of SC mounting, 03/10/2007: Completion of SC mounting (aart from the inner 3-2-1)on the first quadrant of Dee 1 and subsequent survey. 22-28/08/2007: The first supercrystals on Dee1, Dee1 in 867 with the first column of SCs ready for mounting, Dee1 with its protection panels over the laser monitoring fibre system

40 CFR 86.159-08 - Exhaust emission test procedures for US06 emissions.

Science.gov (United States)

2010-07-01

..., CH4, and NOX. (b) Dynamometer activities. (1) All official US06 tests shall be run on a large single... be supplied on request of the Administrator. (6) The drive wheel tires may be inflated up to a gauge... prevent tire damage. The drive wheel tire pressure shall be reported with the test results. (7) The...

Assembly of a supercrystal (SC) of the CMS endcap electromagnetic calorimeter

CERN Multimedia

J. Williams et al., RAL

2004-01-01

The first three pictures show the insertion of the first three rows of crystals into the supercrystal SC03 on Jan. 2004 and the completion of the SC endstops. Fig. 4 shows a complete supercrystal and Fig. 5 its components (alveolar, interface plate, housing, optical fibre, insert, crystal and VPT, endstop). A set of 25 inserts is shown in Fig. 6, while Fig. 7 shows housing, interface plates and inserts. Finally, a SC rear view showing the Vacum Phototriode (VPT) wires through the inserts can be seen in Fig. 8. Fig. 9 and 10 show two supercrystals under test on Dee F and R, respectively.

Design, fabrication and irradiation test report on HANARO instrumented capsule (03M-06U) for researches of universities in 2003

International Nuclear Information System (INIS)

Choo, K. N.; Kim, B. G.; Kang, Y. H.; Choi, M. H.; Cho, M. S.; Son, J. M.; Shin, Y. T.; Park, S. J.

2005-03-01

As a part of 2003 project for active utilization of HANARO, an instrumented capsule (03M-06U) was designed, fabricated and irradiated for the irradiation test of various nuclear materials under irradiation conditions requested by external researchers from universities. The basic structure of 03M-06U capsule was based on the 00M-01U, 01M-05U and 02M-05U capsules successfully irradiated in HANARO as 2000, 2001 and 2002 projects. However, because of the limited number of specimens and budget of 4 universities, the remained space of the capsule was charged with KAERI specimens for the development of the precise temperature control technology under irradiation. The material of the specimens is mainly Fe-based alloys partially mixed with Zr, Al and Cu-Ag alloys. The capsule is composed of 5 stages having many kinds of specimens and independent electric heater in each stage. During the irradiation test, the temperature of the specimens and the thermal/fast neutron fluences were measured by 14 thermocouples and 5 sets of Ni-Ti-Fe neutron fluence monitors installed in the capsule. Various types of specimens such as tensile, Charpy, TEM, toughness, electrical resistance specimens were inserted in the capsule. The capsule was firstly irradiated in the CT test hole of HANARO of 30MW thermal output at 275∼500±10 .deg. C up to a fast neutron fluence of 5.4 x 10 20 (n/cm 2 ) (E>1.0MeV). The obtained results will be very valuable for the related researches of the users

Improving SC-FDMA performance by Turbo Equalization in UTRA LTE Uplink

DEFF Research Database (Denmark)

Berardinelli, Gilberto; Priyanto, Basuki Endah; Sørensen, Troels Bundgaard

2008-01-01

of UTRA Long Term Evolution (LTE) Uplink. The performance is evaluated for 1x2 Single Input Multiple Output (SIMO) antenna configuration in a 6 paths Typical Urban (TU-06) channel profile. For assessment purpose, the results are compared with SC-FDMA MMSE and OFDMA schemes. Simulation results show...

Radiation protection Group (SC/RP) desperately seeking...

CERN Document Server

A. Hervé, Y. Donjoux / SC

2006-01-01

We are trying to trace two transit permits (passavants), which constitute the customs clearance documentation for two 'AD6'portable radiation detectors. The two permits (No. 1308 and No. 1309) were sent in the same internal mail envelope towards the middle of March 2006 but never reached their final destination. After weeks of searching in vain, we are now appealing for your help. If you have these two permits in your possession, please get in touch with us. Many thanks in advance. A.HERVE - SC/RP- ( 163168 / 70927) Y.DONJOUX - SC/RP - (160105 / 73171)

Injury Incidence and Injury Risk Factors Among U.S. Army Basic Trainees at Ft. Jackson SC, 1998 (Including Fitness Training Unit Personnel, Discharges, and Newstarts)

National Research Council Canada - National Science Library

Knapik, J

1999-01-01

An epidemiological consultation (EPICON) was requested by the Commander, U.S. Army Training Center, Ft Jackson, SC, to assist in the development of an Army Center for the Study of Training-Related Injuries. This EPICON (1...

SC*994C>T causes the Sc(null) phenotype in Pacific Islanders and successful transfusion of Sc3+ blood to a patient with anti-Sc3.

Science.gov (United States)

Reid, Marion E; Hue-Roye, Kim; Velliquette, Randall W; Larimore, Kathleen; Moscarelli, Sue; Ohswaldt, Nicolas; Lomas-Francis, Christine

2013-01-01

Antigens in the SC blood group system are expressed by the human erythrocyte membrane-associated protein (ERMAP).Two molecular bases have been reported for the Sc,un phenotype:SC*307del2 and SC*994C>T. We report our investigation of the molecular background of five Sc,n1 individuals from the Pacific Islands and describe the successful transfusion of Sc3+ blood to a patient with anti-Sc3 in her plasma. SC (ERMAP) exons 2,3, and 12 and their flanking intronic regions were analyzed. TheSC*994C>T change introduces a restriction enzyme cleavage site for Tsp45I, and polymerase chain reaction (PCR) products from exon 12 were subjected to this PCR-restriction fragment length polymorphism (RFLP) assay. The five samples had the variant SC*994T/T. One sample, from a first cousin of one Marshallese proband, was heterozygous for SC*1514C/T (in the 3' untranslated region); the other four samples were SC*1514C/C(consensus sequence). Samples from white donors (n = 100) and African American donors (n = 99) were tested using the Tsp45IPCR-RFLP assay; all gave a banding pattern that was consistent with the SC*994C/C consensus sequence. In all five samples,our analyses showed homozygosity for the nonsense nucleotide change SC*994C>Tin an allele carrying the nucleotide associated with SLd. Further investigation determined that one of the probands reported previously with the SC*994C>T change was from the Marshall Islands (which form part of the Micronesian Pacific Islands) and the other was from an unspecified location within the large collection of Pacific Islands. Taken together, the five known probands with the SC*994C>T silencing nucleotide change were from the Pacific Islands.

Gallium-containing Heusler phases ScRh{sub 2}Ga, ScPd{sub 2}Ga, TmRh{sub 2}Ga and LuRh{sub 2}Ga. Magnetic and solid state NMR-spectroscopic characterization

Energy Technology Data Exchange (ETDEWEB)

Heletta, Lukas; Seidel, Stefan; Poettgen, Rainer [Muenster Univ. (Germany). Inst. fuer Anorganische und Analytische Chemie; Benndorf, Christopher [Leipzig Univ. (Germany). Inst. fuer Mineralogie, Kristallographie und Materialwissenschaften; Eckert, Hellmut [Muenster Univ. (Germany). Inst. fuer Physikalische Chemie; Sao Paulo Univ., Sao Carlos (Brazil). Inst. of Physics

2017-10-01

The gallium-containing Heusler phases ScRh{sub 2}Ga, ScPd{sub 2}Ga, TmRh{sub 2}Ga and LuRh{sub 2}Ga have been synthesized by arc-melting of the elements followed by different annealing sequences to improve phase purity. The samples have been studied by powder X-ray diffraction. The structures of Lu{sub 0.97}Rh{sub 2}Ga{sub 1.03} (Fm3m, a=632.94(5) pm, wR2=0.0590, 46 F{sup 2} values, seven variables) and Sc{sub 0.88}Rh{sub 2}Ga{sub 1.12} (a=618.91(4) pm, wR2=0.0284, 44 F{sup 2} values, six variables) have been refined from single crystal X-ray diffractometer data. Both gallides show structural disorder through Lu/Ga and Sc/Ga mixing. Temperature dependent magnetic susceptibility measurements showed Pauli paramagnetism for ScRh{sub 2}Ga, ScPd{sub 2}Ga, and LuRh{sub 2}Ga and Curie-Weiss paramagnetism for TmRh{sub 2}Ga. {sup 45}Sc and {sup 71}Ga solid state MAS NMR spectroscopic investigations of the Sc containing compounds confirmed the site mixing effects typically observed for Heusler phases. The data indicate that the effect of mixed Sc/Ga occupancy is significantly stronger in ScRh{sub 2}Ga than in ScPd{sub 2}Ga.

Dissolved inorganic carbon, pH, alkalinity, temperature, salinity and other variables collected from discrete sample and profile observations using CTD, Coulometer for DIC measurement and other instruments from the OSHORO MARU in the North Pacific Ocean from 2003-06-03 to 2003-06-16 (NODC Accession 0112275)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0112275 includes chemical, discrete sample, physical and profile data collected from OSHORO MARU in the North Pacific Ocean from 2003-06-03 to...

Sc-W-Si and Sc-W-Ge ternary systems

International Nuclear Information System (INIS)

Kotur, B.Ya.; Voznyak, O.M.; Bodak, O.I.

1989-01-01

Phase equilibria in Sc-W-Si and Sc-W-Ge ternary systems are investigated at 1070 K. Sc 2+x W 3-x Si 4 ternary compound (0≤x≤1) is determined, its crystal structure (Ce 2 Sc 3 Si 4 structural type), as well as, change of elementary cell parameters and microhardness within homogeneity range are determined. Regularities of component interaction within Sc-M-Si(Ge) (M-Cr, Mo, W) ternary system are determined. Ternary systems with Mo and W are more closer to each other according to the phase equilibria character, than to ternary systems with Cr

Analytical charge control model for AlGaN/GaN MIS-HFETs including an undepleted barrier layer

Energy Technology Data Exchange (ETDEWEB)

Shenghui, Lu; Jiangfeng, Du; Qian, Luo; Qi, Yu; Wei, Zhou; Jianxin, Xia; Mohua, Yang, E-mail: lushenghui@sohu.co [State key Laboratory of Electronic Thin Films and Integrated Devices, University of Electronic Science and Technology of China, Chengdu 610054 (China)

2010-09-15

An analytical charge control model considering the insulator/AlGaN interface charge and undepleted Al-GaN barrier layer is presented for AlGaN/GaN metal-insulator-semiconductor heterostructure field effect transistors (MIS-HFETs) over the entire operation range of gate voltage. The whole process of charge control is analyzed in detail and partitioned into four regions: I-full depletion, II-partial depletion, III-neutral region and IV-electron accumulation at the insulator/AlGaN interface. The results show that two-dimensional electron gas (2DEG) saturates at the boundary of region II/III and the gate voltage should not exceed the 2DEG saturation voltage in order to keep the channel in control. In addition, the span of region II accounts for about 50% of the range of gate voltage before 2DEG saturates. The good agreement of the calculated transfer characteristic with the measured data confirms the validity of the proposed model. (semiconductor devices)

New indides Sc{sub 6}Co{sub 2.18}In{sub 0.82}, Sc{sub 10}Ni{sub 9}In{sub 19.44} and ScCu{sub 4}In-synthesis, structure, and crystal chemistry

Energy Technology Data Exchange (ETDEWEB)

Zaremba, R.I.; Rodewald, U. Ch.; Poettgen, R. [Inst. fuer Anorganische und Analytische Chemie, Westfaelische Wilhelms-Univ. Muenster (Germany); Kalychak, Y.M.; Zaremba, V.I. [Inorganic Chemistry Dept., Ivan Franko National Univ. of Lviv, Lviv (Ukraine)

2006-08-15

New indides Sc{sub 6}Co{sub 2.18}In{sub 0.82}, Sc{sub 10}Ni{sub 9}In{sub 19.44} and ScCu{sub 4}In have been synthesized from the elements by arc-melting. Single crystals were grown by special annealing modes. The thee indides were investigated via X-ray powder and single crystal diffraction: Ho{sub 6}Co{sub 2}Ga type, Immm, a = 886.7(3), b = 878.0(2), c = 932.1(3) pm, wR2 = 0.0517, 711 F{sup 2} values, 35 variables for Sc{sub 6}Co{sub 2.18}In{sub 0.82}, Ho{sub 10}Ni{sub 9}In{sub 20} type, P4/nmm, a = 1287.5(2), c = 884.7(1) pm, wR2 = 0.0642, 1221 F{sup 2} values, 63 variables for Sc{sub 10}Ni{sub 9}In{sub 19.44}, and MgCu{sub 4}Sn type, anti F 43m, a = 704.03(7) pm, wR2 = 0.0267, 101 F{sup 2} values, and 7 variables for ScCu{sub 4}In. The scandium rich indide Sc{sub 6}Co{sub 2.18}In{sub 0.82} contains two Co{sub 2} dumb-bells at Co-Co distances of 221 and 230 pm. Each cobalt atom within these dumb-bells has a tricapped trigonal prismatic coordination. The In1 site has a distorted cube-like coordination by scandium and shows a mixed occupancy (36%) with cobalt. The In2 atoms have distorted icosahedral scandium coordination. As a consequence of the small size of the scandium atoms, the In4 site in Sc{sub 10}Ni{sub 9}In{sub 19.44} shows defects and was furthermore refined with a split model leading to a new distorted variant within the family of Ho{sub 10}Ni{sub 9}In{sub 20} compounds. ScCu{sub 4}In is an ordered version of the cubic Laves phase with scandium and indium atoms in the CN16 voids of the copper substructure. The Cu-Cu distances within the three-dimensional network of corner-sharing tetrahedra are 248.6 and 249.2 pm. The crystal chemical peculiarities of these three indide structures are briefly discussed. (orig.)

Relaxor-ferroelectric BaLnZT (Ln = La, Nd, Sm, Eu, and Sc) ceramics for actuator and energy storage application

Science.gov (United States)

Ghosh, Sarit K.; Mallick, Kaushik; Tiwari, B.; Sinha, E.; Rout, S. K.

2018-01-01

Lead free ceramics Ba1-x Ln2x/3Zr0.3Ti0.7O3 (Ln = La, Nd, Sm, Eu and Sc), x = 0.02-0.10 are investigated for electrostrictive effect and energy storage properties in the proximity of relaxor-paraelectric phase boundary. Relaxor phase evidence from slim hysteresis loop and low remnant polarization are the key parameters responsible for improve the electrostrictive effect and energy storage properties simultaneously. With increase in rare earth content negative strain disappeared and almost hysteresis free strain is achieved. Strain-hysteresis profile in term of S-E, S-E 2 and S-P 2 is used to analyze the electrostrictive behavior of these ceramics. An average strain (S%) ˜ 0.03%, is accomplished at initial concentrations of x = 0.02-0.04 and electrostrictive coefficients (Q 11, and M 11) as well as the energy storage density is improved by a factor of 1.2 and 2.6 respectively when compare with pure (x = 0.0) ceramic. Above x ≥ 0.06, all compositions show a stable behavior which suggested the possibilities of these relaxor ceramics towards high precision actuators and energy storage application.

New separation method of no-carrier-added {sup 47}Sc from titanium targets

Energy Technology Data Exchange (ETDEWEB)

Bartos, B.; Majkowska, A.; Kasperek, A.; Krajewski, S.; Bilewicz, A. [Institute of Nuclear Chemistry and Technology, Warszawa (Poland). Nuclear Chemistry and Radiochemistry Center

2012-07-01

Radionuclides with medium energy beta emission and a several day half-life are attractive candidates for radioimmunotherapy. Among the most promising in this category is {sup 47}Sc produced by fast neutron irradiation (E{sub n} > 1 MeV) of titanium target with high energy neutrons in {sup 47}Ti(n,p){sup 47}Sc nuclear reaction. In the previously reported production scheme the dissolution of the TiO{sub 2} target in hot concentrated H{sub 2}SO{sub 4} and evaporation of the resulting solution were the most time-consuming steps. The present paper describes new, simple and efficient production method of {sup 47}Sc, where the slow dissolution of the target is avoided. After irradiation in fast neutron flux {sup 47}TiO{sub 2} and Li{sub 2}{sup 47}TiF{sub 6} targets were dissolved in HF solutions. Next {sup 47}Sc was separated from the target using anion exchange resin Dowex 1 with 0.4 M HF + 0.06 M HNO{sub 3} solution as eluent. The eluted {sup 47}Sc was adsorbed on cation exchange resin and eluted with 0.5 M of ammonium acetate. The 47Sc separation yield in the proposed procedure is about 90% with the separation time less than 2 h. The obtained no-carrier-added {sup 47}Sc was used to label DOTATATE conjugate with 96% labeling yield. (orig.)

Reactive diffusion in Sc/Si multilayer X-ray mirrors with CrB2 barrier layers

International Nuclear Information System (INIS)

Pershyn, Y.P.; Zubarev, E.N.; Kondratenko, V.V.; Sevryukova, V.A.; Kurbatova, S.V.

2011-01-01

Processes undergoing in Sc/Si multilayer X-ray mirrors (MXMs) with periods of ∝27 nm and barrier layers of CrB 2 0.3- and 0.7-nm thick within the temperature range of 420-780 K were studied by methods of small-angle X-ray reflectivity (λ=0.154 nm) and cross-sectional transmission electron microscopy. All layers with the exception of Sc ones are amorphous. Barrier layers are stable at least up to a temperature of 625 K and double the activation energy of diffusional intermixing at moderate temperatures. Introduction of barriers improves the thermal stability of Sc/Si MXMs at least by 80 degrees. Diffusion of Si atoms through barrier layers into Sc layers with formation of silicides was shown to be the main degradation mechanism of MXMs. A comparison of the stability for Sc/Si MXMs with different barriers published in the literature is conducted. The ways of further improvement of barrier properties are discussed. (orig.)

[Sickle-cell anemia in the 1st 5 years of life].

Science.gov (United States)

Svarch, E; Nordet, I; Machín, S; Fernández, L; Muñiz, A; Wade, M

1996-02-01

A programme for antenatal diagnosis of sickle-cell anaemia (SA) and SC haemoglobinopathy (SC) was started in Cuba in 1983. The purpose of this paper is to report the clinical and haematological data of a group of children diagnosed before birth or in the first few months of life. Between June 1986 and December 1992, 78 children under 5 years of age were studied at the Haemoglobinpathies Clinic of the Instituto de Hematología e Inmunologia in La Habana; of them, 53 had SA and 25 had SC, there were 41 girls and 37 boys. A comprehensive questionnaire was carried out during the first visit to the clinic, about the onset of the clinical manifestations, as well as a careful physical examination plus peripheral blood study and Hb A2 and Hb F assay. Parents were informed, and folate and prophylactic penicillin were given orally to the children. The yearly average admissions to hospital were 1.6 +/- 3.8 for SA and 0.1 +/- 0.6 for SC. The average number of veno-occlusive crises was 0.2 +/- 0.6 in SA and 0.1 +/- 0.6 in SC (p < 0.04); the average hand-foot crises were 0.3 +/- 1.1. for SA and nil for SC. The average number of infections per year was 0.3 +/- 0.6 in SA and 0.1 +/-0.3 in SC, without any significant difference. Significant differences were found in the haemoglobin rates and reticulocyte counts between both haemoglobinopathies. Hb F rate was 7.80 +/- 4.78% in SA and 2.83 +/- 3.45% in SC. Admission to hospital, hand-foot crises, infections and splenic sequestration are the commonest clinical events during the first 5 years of life. The number of infections episodes decreases with prophylactic oral penicillin, and overacute pneumococcal infection is suppressed. Parent education allows one to early treat sequestration crises, and partial splenectomy avoids repetition of this complication, while preserving the splenic function.

Structure and bonding of ScCN and ScNC: Ground and low-lying states

International Nuclear Information System (INIS)

Kalemos, Apostolos; Metropoulos, Aristophanes; Mavridis, Aristides

2012-01-01

Graphical abstract: The experimentally unknown systems ScCN and ScNC have been studied through single reference CISD and CCSD(T) methods. A total of 20 = 10 (ScCN) + 10 (ScNC) states were examined. All states are quite ionic whereas ScNC(X ∼3 Δ) is stabler than ScCN(X ∼3 Δ) by ∼5 kcal/mol. Display Omitted Highlights: ► We have studied through ab initio methods the polytopic system Sc[CN]. ► A series of low lying states for both isomeric forms have been examined. ► Around equilibrium the system displays a pronounced Sc + [CN] − ionic character. - Abstract: We have studied the experimentally unknown Sc[CN] molecular system in both its isomeric forms, scandium cyanide (ScCN) and isocyanide (ScNC), through ab initio computations. We report energetics, geometries, harmonic frequencies, and dipole moments for the first 20 Sc[CN] states correlating diabatically to Sc + ( 3 D, 1 D, 3 F) + CN − (X 1 Σ + ). Both isomers have a pronounced ionic character around equilibrium due to the high electron affinity of the CN group and the low ionization energy of the Sc atom. According to our calculations the ScNC isomer (X ∼3 Δ) is stabler than the ScCN(X ∼3 Δ) by ∼5 kcal/mol.

Structural, electrical and magnetic properties of Sc{sup 3+} doped Mn-Zn ferrite nanoparticles

Energy Technology Data Exchange (ETDEWEB)

Angadi, V. Jagdeesha [Department of Physics, Bangalore University, Bangalore 560056 (India); Choudhury, Leema [Department of Physics, K.G. Reddy College of Engineering & Technology, Moinabad, 501504 Ranga Reddy, Telangana (India); Sadhana, K. [Department of Physics, University College of Science, Osmania University, Saifabad, Hyderabad 500004 (India); Liu, Hsiang-Lin [Department of Physics, National Taiwan Normal University, Taipei 11677, Taiwan (China); Sandhya, R. [Department of Physics, University College of Science, Osmania University, Hyderabad 500007 (India); Matteppanavar, Shidaling; Rudraswamy, B.; Pattar, Vinayak; Anavekar, R.V. [Department of Physics, Bangalore University, Bangalore 560056 (India); Praveena, K., E-mail: praveenaou@gmail.com [Department of Physics, National Taiwan Normal University, Taipei 11677, Taiwan (China)

2017-02-15

Sc{sup 3+} doped Mn{sub 0.5}Zn{sub 0.5}Sc{sub y}Fe{sub 2−y}O{sub 4} (y=0.00, 0.01, 0.03 and 0.05) nanoparticles were synthesized by solution combustion method using mixture of fuels were reported for the first time. The mixture of fuels plays an important role in obtaining nano crystalline, single phase present without any heat treatment. X-ray diffraction (XRD) results confirm the formation of the single-phase ferrites which crystallize in cubic spinel structure. The Fourier transform infrared spectra (FTIR) exhibit two prominent bands around 360 cm{sup −1} and 540 cm{sup −1} which are characteristic feature of spinel ferrite. The transmission electron microscope (TEM) micrographs revealed the nanoparticles to be nearly spherical in shape and of fairly uniform size. The room temperature impedance spectra (IS) and vibrating sample magnetometry (VSM) measurements were carried out in order to study the effect of doping (Sc{sup 3+}) on the characteristic properties of Mn-Zn ferrites. Further, the frequency dependent dielectric constant and dielectric loss were found to decrease with increasing multiple Sc{sup 3+} concentration. Nyquist plot in the complex impedance spectra suggest the existence of multiple electrical responses. Magnetic measurements reveals that saturation magnetization (M{sub s}), remnant magnetization (M{sub r}), magnetic moment (η{sub B}) and magnetic particle size (D{sub m}) increase with Sc{sup 3+} ion concentration up to x=0.03 and then decrease. The values of spin canting angle (α{sub Y-K}) and the magnetic particle size (D{sub m}) are found to be in the range of 68–75° and 10–19 nm respectively with Sc{sup 3+} concentration. The room temperature Mössbauer spectra were fitted with two sextets corresponding to ions at tetrahedral (A-) and octahedral (B-) sites confirms the spinel lattice. The ferromagnetic resonance (FMR) spectra's has shown that high concentration of scandium doping leads to an increase in dipolar interaction

Crystal structure and phase stability of AlSc in the near-equiatomic Al–Sc alloy

Energy Technology Data Exchange (ETDEWEB)

Li, Juan; Huang, Li; Liang, Yongfeng [State Key Laboratory for Advanced Metals and Materials, University of Science and Technology Beijing, 30 Xueyuan Road, Beijing 100083 (China); Ye, Feng, E-mail: yefeng@skl.ustb.edu.cn [State Key Laboratory for Advanced Metals and Materials, University of Science and Technology Beijing, 30 Xueyuan Road, Beijing 100083 (China); Lin, Junpin [State Key Laboratory for Advanced Metals and Materials, University of Science and Technology Beijing, 30 Xueyuan Road, Beijing 100083 (China); Shang, Shunli; Liu, Zikui [Department of Materials Science and Engineering, The Pennsylvania State University, University Park, PA 16802 (United States)

2015-01-05

Highlights: • Two lattice structures of equiatomic Al–Sc compounds are confirmed. • Al–Sc phase at Sc 50 at.% has a space group of Pbam. • Al–Sc phase at Sc 55 at.% has a space group of B2. • B2 AlSc is a metastable phase with Sc 50 at.%. • Lattice transition between two compounds is proposed under local thermal stress. - Abstract: Intermetallic compound AlSc is found in the equiatomic Al–Sc binary alloy. The present work indicates that the orthorhombic AlSc with the Au{sub 2}CuZn-type structure can be formed at 50 at.% Sc, while the CsCl-type (B2) AlSc will be formed at 55 at.% Sc. After annealing at 1100 °C, some orthorhombic AlSc grains transit to the B2 structure, and the annealing at lower temperatures leads to the disappearance of B2 phase, indicating that the B2 AlSc is also a metastable phase in the alloy at lower Sc content (<50 at.%). First-principle calculations at 0 K reveal that the orthorhombic AlSc is more stable than the B2 AlSc with the energy difference between them being 5.4 meV/atom. The fast transition between these two phases, which cannot be interpreted by the mechanism of atomic diffusion, was tentatively analyzed by the volume change based on the calculated atomic positions of these two phases.

Theoretical study of stability and superconductivity of ScHn (n =4 -8 ) at high pressure

Science.gov (United States)

Qian, Shifeng; Sheng, Xiaowei; Yan, Xiaozhen; Chen, Yangmei; Song, Bo

2017-09-01

The synthesis of hydrogen sulfides, with the potential of high-temperature superconductivity, was recently proposed at high Tc = 203 K. It motivated us to employ an ab initio approach for the predictions of crystal structures to find the stable scandium hydrides. In addition to the earlier predicted three stoichiometries of ScH, ScH2, and ScH3, we identify three other metallic stoichiometries of ScH4, ScH6, and ScH8, which show superconductivity at significantly higher temperatures. The phases of ScH4 and ScH6, whose stability does not require extremely high pressures (ZPE), are primarily ionic compounds containing exotic quasimolecular H2 arrangements. The present electron-phonon calculations revealed the superconductive potential of ScH4 and ScH6 with estimated Tc of 98 K and 129 K at 200 GPa and 130 GPa, respectively. The superconductivity of ScHn stems from the large electron-phonon coupling associated with the wagging, bending, and intermediate-frequency modes attributed mainly to the hydrogen atoms.

46 CFR 7.70 - Folly Island, SC to Hilton Head Island, SC.

Science.gov (United States)

2010-10-01

... 46 Shipping 1 2010-10-01 2010-10-01 false Folly Island, SC to Hilton Head Island, SC. 7.70 Section... BOUNDARY LINES Atlantic Coast § 7.70 Folly Island, SC to Hilton Head Island, SC. (a) A line drawn from the...′ W. (Port Royal Sound Lighted Whistle Buoy “2PR”); thence to the easternmost extremity of Hilton Head...

44gSc production using a water target on a 13 MeV cyclotron

International Nuclear Information System (INIS)

Hoehr, Cornelia; Oehlke, Elisabeth; Benard, Francois; Lee, Chris Jaeil; Hou, Xinchi; Badesso, Brian; Ferguson, Simon; Miao, Qing; Yang, Hua; Buckley, Ken; Hanemaayer, Victoire; Zeisler, Stefan; Ruth, Thomas; Celler, Anna; Schaffer, Paul

2014-01-01

Introduction: Access to promising radiometals as isotopes for novel molecular imaging agents requires that they are routinely available and inexpensive to obtain. Proximity to a cyclotron center outfitted with solid target hardware, or to an isotope generator for the metal of interest is necessary, both of which can introduce significant hurdles in development of less common isotopes. Herein, we describe the production of 44 Sc (t 1/2 = 3.97 h, E avg,β + = 1.47 MeV, branching ratio = 94.27%) in a solution target and an automated loading system which allows a quick turn-around between different radiometallic isotopes and therefore greatly improves their availability for tracer development. Experimental yields are compared to theoretical calculations. Methods: Solutions containing a high concentration (1.44–1.55 g/mL) of natural-abundance calcium nitrate tetrahydrate (Ca(NO 3 ) 2 · 4 H 2 O) were irradiated on a 13 MeV proton-beam cyclotron using a standard liquid target. 44g Sc was produced via the 44 Ca(p,n) 44g Sc reaction. Results: 44g Sc was produced for the first time in a solution target with yields sufficient for early radiochemical studies. Saturation yields of up to 4.6 ± 0.3 MBq/μA were achieved using 7.6 ± 0.3 μA proton beams for 60.0 ± 0.2 minutes (number of runs n = 3). Experimental data and calculation results are in fair agreement. Scandium was isolated from the target mixture via solid-phase extraction with 88 ± 6% (n = 5) efficiency and successfully used for radiolabelling experiments. The demonstration of the production of 44 Sc in a liquid target greatly improves its availability for tracer development

High-resolution clean-sc

NARCIS (Netherlands)

Sijtsma, P.; Snellen, M.

2016-01-01

In this paper a high-resolution extension of CLEAN-SC is proposed: HR-CLEAN-SC. Where CLEAN-SC uses peak sources in “dirty maps” to define so-called source components, HR-CLEAN-SC takes advantage of the fact that source components can likewise be derived from points at some distance from the peak,

Efficiency Enhancement of Pico-cell Base Station Power Amplifier MMIC in Gallium Nitride HFET Technology Using the Doherty technique

Science.gov (United States)

Seneviratne, Sashieka

With the growth of smart phones, the demand for more broadband, data centric technologies are being driven higher. As mobile operators worldwide plan and deploy 4th generation (4G) networks such as LTE to support the relentless growth in mobile data demand, the need for strategically positioned pico-sized cellular base stations known as 'pico-cells' are gaining traction. In addition to having to design a transceiver in a much compact footprint, pico-cells must still face the technical challenges presented by the new 4G systems, such as reduced power consumptions and linear amplification of the signals. The RF power amplifier (PA) that amplifies the output signals of 4G pico-cell systems face challenges to minimize size, achieve high average efficiencies and broader bandwidths while maintaining linearity and operating at higher frequencies. 4G standards as LTE use non-constant envelope modulation techniques with high peak to average ratios. Power amplifiers implemented in such applications are forced to operate at a backed off region from saturation. Therefore, in order to reduce power consumption, a design of a high efficiency PA that can maintain the efficiency for a wider range of radio frequency signals is required. The primary focus of this thesis is to enhance the efficiency of a compact RF amplifier suitable for a 4G pico-cell base station. For this aim, an integrated two way Doherty amplifier design in a compact 10mm x 11.5mm2 monolithic microwave integrated circuit using GaN device technology is presented. Using non-linear GaN HFETs models, the design achieves high effi-ciencies of over 50% at both back-off and peak power regions without compromising on the stringent linearity requirements of 4G LTE standards. This demonstrates a 17% increase in power added efficiency at 6 dB back off from peak power compared to conventional Class AB amplifier performance. Performance optimization techniques to select between high efficiency and high linearity operation are

EMP Attachment 3 DOE-SC PNNL Site Dose Assessment Guidance

Energy Technology Data Exchange (ETDEWEB)

Snyder, Sandra F.

2011-12-21

This Dose Assessment Guidance (DAG) describes methods to use to determine the Maximally-Exposed Individual (MEI) location and to estimate dose impact to that individual under the U.S. Department of Energy Office of Science (DOE-SC) Pacific Northwest National Laboratory (PNNL) Site Environmental Monitoring Plan (EMP). This guidance applies to public dose from radioactive material releases to the air from PNNL Site operations. This document is an attachment to the Pacific Northwest National Laboratory (PNNL) Environmental Monitoring Plan (EMP) and describes dose assessment guidance for radiological air emissions. The impact of radiological air emissions from the U.S. Department of Energy Office of Science (DOE-SC) PNNL Site is indicated by dose estimates to a maximally exposed member of the public, referred to as the maximally exposed individual (MEI). Reporting requirements associated with dose to members of the public from radiological air emissions are in 40 CFR Part 61.94, WAC 246-247-080, and DOE Order 458.1. The DOE Order and state standards for dose from radioactive air emissions are consistent with U.S. Environmental Protection Agency (EPA) dose standards in 40 CFR 61.92 (i.e., 10 mrem/yr to a MEI). Despite the fact that the current Contract Requirements Document (CRD) for the DOE-SC PNNL Site operations does not include the requirement to meet DOE CRD 458.1, paragraph 2.b, public dose limits, the DOE dose limits would be met when EPA limits are met.

Measurement of small bowel transit time by 99Tcm-SC imaging: preliminary clinical study

International Nuclear Information System (INIS)

Zhang Shaohua; Xu Jingying; Bei Lian; Zhu Chaohui; Ba Jiantao

1999-01-01

Objective: To develop a method of measuring small bowel transit time (SBTT) by 99 Tc m -sulfur collide (SC) imaging and to compare with the method of added lactose in the test meal. Methods: 20 healthy volunteers and 26 patients with gastrointestinal disorders were studied. In fasting state, the subjects were asked to ingest the 99 Tc m -SC labelled solid meal within 5 minutes, then the image acquisition was immediately started with SPECT. The images were acquired every 15 min during the first hour, at 30 min intervals during 2∼4 hours and hourly thereafter until 80% radioactivity had entered the colon. One week later, the same procedure of imaging with 15 g lactulose added in the test meal was performed. The regions of interest (ROIs) were taken at stomach and colon, and the SBTT was calculated by deconvolution or by subtraction of the 50% time of gastric emptying from the 50% time of colon filling. Results: 1) The mean SBTT of 20 healthy volunteers was (4.2 +- 0.5) h, oral-caecum transit time (OCTT) was (4.3 +- 0.6) h; lactulose shortened the SBTT by (1.8 +- 0.6) h; 2) 26 patients showed different results of SBTT due to their different gastrointestinal disorders bases. Conclusions: 99 Tc m -SC imaging was a noninvasive and useful method to measure SBTT. The added lactulose can shorten the examination time and help to identify the time of food to the ileocecal region

Determination of Sc and Th in ScI3-NaI-ThI4 sample

International Nuclear Information System (INIS)

Yuan Hui; Yang Zhihong

1999-01-01

Determination of Sc and Th in ScI 3 -NaI-ThI 4 sample is studied by X-ray fluorescence and complexometry. The effect of working condition of Sc on X-ray fluorescence spectrometer and different sample-making method on the determination of Sc and Th are studied experimentally. The X-ray fluorescence analysis of determination of Sc and Th is developed by polyester film sample-making technique, the measuring precision of Sc and Th is better than 4%. The effect of acidity and temperature on the determining end point of titration is obvious. The results of different complexometric methods are compared. The precision of Sc and Th is less than 2% by comlexometry, it is fit for the routine analysis of ScI 3 -NaI-ThI 4 sample

Development of SC structure modularization in Nuclear Power Plant

International Nuclear Information System (INIS)

Mun, Taeyoup

2008-01-01

New Focus on NPP are Rising Concerns on Global Warming, Potential energy crisis (geo-political), Improved reliability and safety of nuclear power plant, Advent of Generation 3+ NPP technology and Economical Energy Resource. New NPPs are 6 units in Korea and 23 in Asia being built, 32 units being planned in China by 2020 (150 by 2050), 10 units being planned in US by 2020 and IAEA expects $200 billions on NPP construction next 25 years (up to 30% of total world energy). □ SC(Steel Plate Concrete) structure · Steel Plate is used as a Structural Element instead of Reinforcing Bars in RC · SC structure consists of Steel Plate with Headed Studs. Connected by Tie-bars - The Primary Purpose of Tie-bars is to Stiffen and Hold Together the Plates during Construction Process - Headed Studs are Welded to the Inside of Steel Plate for composite action □ Benefits of SC Structure · Shorten Construction Duration for Re bar, Forming and Scaffolding Works · Minimize Site Labors · Improve the Construction Quality · Enable Construction Sites to be kept Clean □ SC Modularization · Fit for Modular Construction for Structural Features · Fit for Modular Construction for Structural Features · Inattentively Effective for Integrated Modules · Pre-fabrication, Pre-assembly and Modularization □ Project Overview · Project Name: Development of SC structure for Modularization in NPP · Project Type: Electric Power Industry R and D (Ministry of Knowledge Economy) · Duration: Sep. 2005 ∼ Aug. 2008 (36 Months) · Research Team and Scopes - Project Management: Korea Hydro and Nuclear Power Company (KHNP) - Development of Code and Standards for SC Structure: Korea Society of Steel Construction (KSSC) Korea Electric Power Research Institute (KEPRI) - Development of SC Structural Analysis and Design: Korea Power Engineering Company (KOPEC) - Development of Construction Techniques for SC Modularization: KHNP, Korea Institute of Nuclear Safety(KINS), KOPEC □ Performance

Oceanographic Station Data and temperature profiles from XBT and bottle casts from the DOLPHIN as part of the Marine Resources Monitoring, Assessment and Prediction (MARMAP) from 1975-12-03 to 1975-12-06 (NODC Accession 7600754)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Oceanographic Station Data and temperature profiles were collected from XBT and bottle casts from the DOLPHIN from 03 December 1975 to 06 December 1975. Data were...

2018-05-06T17:17:01Z https://www.ajol.info/index.php/all/oai oai:ojs ...

African Journals Online (AJOL)

article/11784 2018-05-06T17:17:01Z njnpm:ART ANTIBACTERIAL ACTIVITY OF THE ESSENTIAL OILS FROM FOUR SELECTED VARIETIES OF CAPASIUM ANNUUM Odoemena, SC; Department of Botany and Microbiology, University of Uyo, ...

Magnetic properties of ball-milled Fe0.6Mn0.1Al0.3 alloys

International Nuclear Information System (INIS)

Rebolledo, A.F.; Romero, J.J.; Cuadrado, R.; Gonzalez, J.M.; Pigazo, F.; Palomares, F.J.; Medina, M.H.; Perez Alcazar, G.A.

2007-01-01

The FeMnAl-disordered alloy system exhibits, depending on the composition and the temperature, a rich variety of magnetic phases including the occurrence of ferromagnetism, antiferromagnetism, paramagnetism and spin-glass and reentrant spin glass behaviors. These latter phases result from the presence of atomic disorder and magnetic dilution and from the competing exchange interactions taking place between an Fe atom and its Mn and Fe first neighbors. The use of mechanical alloying in order to prepare these alloys is specially interesting since it allows to introduce in a progressive way large amounts of disorder. In this work, we describe the evolution with the milling time of the temperature dependence of the magnetic properties of mechanically alloyed Fe 0.6 Mn 0.1 Al 0.3 samples. The materials were prepared in a planetary ball mill using a balls-to-powder mass ratio of 15:1 and pure (99.95 at%) Fe, Mn and Al powders for times up to 19 h. The X-rays diffraction (XRD) spectra show the coexistence of three phases at short milling times. For milling times over 6 h, only the FeMnAl ternary alloy BCC phase is observed. Moesbauer spectroscopy reveals the complete formation of the FeMnAl alloy after 9 h milling time. The magnetic characterization showed that all the samples were ferromagnetic at room temperature with coercivities decreasing from 105 Oe (3 h milled sample) down to 5 Oe in the case of the sample milled for 19 h

Pilot-Scale Demonstration of In-Situ Chemical Oxidation Involving Chlorinated Volatile Organic Compounds - Design and Deployment Guidelines (Parris Island, SC, U.S. Marine Corp Recruit Depot, Site 45 Pilot Study)

Science.gov (United States)

A pilot-scale in situ chemical oxidation (ISCO) demonstration, involving subsurface injections of sodium permanganate (NaMnO4), was performed at the US Marine Corp Recruit Depot (MCRD), site 45 (Parris Island (PI), SC). The ground water was originally contaminated with perchloroe...

33 CFR 80.712 - Morris Island, SC to Hilton Head Island, SC.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Morris Island, SC to Hilton Head..., SC to Hilton Head Island, SC. (a) A line drawn from the easternmost tip of Folley Island to the... easternmost extremity of Hilton Head at latitude 32°13.0′ N. longitude 80°40.1′ W. [CGD 77-118a, 42 FR 35784...

Super-solar Metallicity Stars in the Galactic Center Nuclear Star Cluster: Unusual Sc, V, and Y Abundances

Science.gov (United States)

Do, Tuan; Kerzendorf, Wolfgang; Konopacky, Quinn; Marcinik, Joseph M.; Ghez, Andrea; Lu, Jessica R.; Morris, Mark R.

2018-03-01

We present adaptive-optics assisted near-infrared high-spectral-resolution observations of late-type giants in the nuclear star cluster of the Milky Way. The metallicity and elemental abundance measurements of these stars offer us an opportunity to understand the formation and evolution of the nuclear star cluster. In addition, their proximity to the supermassive black hole (∼0.5 pc) offers a unique probe of the star formation and chemical enrichment in this extreme environment. We observed two stars identified by medium spectral-resolution observations as potentially having very high metallicities. We use spectral-template fitting with the PHOENIX grid and Bayesian inference to simultaneously constrain the overall metallicity, [M/H], alpha-element abundance [α/Fe], effective temperature, and surface gravity of these stars. We find that one of the stars has very high metallicity ([M/H] > 0.6) and the other is slightly above solar metallicity. Both Galactic center stars have lines from scandium (Sc), vanadium (V), and yttrium (Y) that are much stronger than allowed by the PHOENIX grid. We find, using the spectral synthesis code Spectroscopy Made Easy, that [Sc/Fe] may be an order of magnitude above solar. For comparison, we also observed an empirical calibrator in NGC 6791, the highest metallicity cluster known ([M/H] ∼ 0.4). Most lines are well matched between the calibrator and the Galactic center stars, except for Sc, V, and Y, which confirms that their abundances must be anomalously high in these stars. These unusual abundances, which may be a unique signature of nuclear star clusters, offer an opportunity to test models of chemical enrichment in this region.

Toxicity, tissue distribution and excretion of 46ScCl3 and 46Sc-EDTA in mice

International Nuclear Information System (INIS)

Lachine, E.E.; Noujaim, A.A.; Ediss, C.; Wiebe, L.I.

1976-01-01

The acute toxicity, differential distribution in tissue, and elimination of ScCl 3 , 46 ScCl 3 , Sc-EDTA and 46 Sc-EDTA, in mice, has been investigated. The LD 50 sup(24hr) doses for ScCl 3 were 440 and 24 mg kg -1 respectively after intraperitioneal and intravenous injection, and 720 and 108 mg kg -1 respectively for Sc-EDTA. 46 ScCl 3 was extensively deposited in the liver and the spleen. 46 Sc-EDTA was rapidly taken up by the kidney with subsequent elimation via the urine. While-body desaturation kinetics for 46 Sc-EDTA were found to fit a three compartmental model. The fast elimination phase (T1/2 = 12.75 min; K = 0.05540 min -1 ) accounted for 74.6% of the dose; the intermediate phase (T1/2 = 40.2 min; K = 0.01722 min -1 ) for 21.8%, and the slow (T1/2 = 5351 min; K = 0.00013 min -1 ) for 3.6% of the dose. (author)

Effect of the annealing temperature on the structural and magnetic behaviors of 0.875La{sub 0.6}Ca{sub 0.4}MnO{sub 3}/0.125La{sub 0.6}Sr{sub 0.4}MnO{sub 3} composition

Energy Technology Data Exchange (ETDEWEB)

Gharsallah, H. [Laboratoire de Physique Appliquée, Faculté des Sciences, Université de Sfax, B.P. 1171, 3000 Sfax (Tunisia); Institut Préparatoire aux Études d’Ingénieur de Sfax, Université de Sfax, BP 1172, 3018 Sfax (Tunisia); Bejar, M., E-mail: bejar_moez@yahoo.fr [Laboratoire de Physique Appliquée, Faculté des Sciences, Université de Sfax, B.P. 1171, 3000 Sfax (Tunisia); Dhahri, E. [Laboratoire de Physique Appliquée, Faculté des Sciences, Université de Sfax, B.P. 1171, 3000 Sfax (Tunisia); Hlil, E.K. [Institut Néel, CNRS Université J. Fourier, BP166, 38042 Grenoble (France); Sajieddine, M. [Laboratoire de Physique et Mécanique des Matériaux, Faculté des Sciences et Techniques, Université Sultan Moulay Slimane, BP 523, 23000 Béni-Mellal (Morocco)

2016-03-01

The polycrystalline compounds of La{sub 0.6}Ca{sub 0.4}MnO{sub 3} (S0C1) and La{sub 0.6}Sr{sub 0.4}MnO{sub 3} (S1C0) were prepared using the citric–gel method. With the resultant nanoparticle powders having crystallite size of 22.51 nm from S0C1 and 27.39 nm from S1C0, the 0.875(S0C1)0.125(S1C0) composition was sintered at different temperatures: SC. 4-1 (at 700 °C), SC. 4-2 (at 900 °C), SC. 4-3 (at 1100 °C) and SC. 4-4 (at 1300 °C). XRD data were analyzed by Rietveld refinement technique. The two S0C1 and S1C0 mother compounds were found to crystallize in the rhombohedral and orthorhombic structure, respectively. The compounds sintered at 700 °C (SC. 4-1) and 900 °C (SC. 4-2) were found to present the two rhombohedral and orthorhombic phases corresponding to the mother compounds, which indicates that no interfacial reaction occurs. However, when augmenting the sintering temperature, the formation of the 0.875(S0C1)0.125(S1C0) new phase was observed. These observations were confirmed from the magnetization study, which revealed that the SC. 4-1 and SC. 4-2 compounds present two magnetic transitions temperature corresponding to the two mother compounds. For higher sintering temperature (1100 and 1300 °C), we have noted the presence of a new magnetic transition corresponding to the composition 0.875(S0C1)0.125(S1C0) compound. The variation of the M(T) curves were discussed in terms of the orthorhombic distortion σ{sup 2}(Mn–O). - Highlights: • Polycrystalline samples of S0C1 and S1C0 were prepared via citric-gel method. • 0.875(S0C1)0.125(S1C0) mixture was sintered at different temperatures. • The magnetic study revealed the presence of two magnetic transitions. • The M(T) curves variation were discussed in term of the orthorhombic distortion.

Magnetic moment of {sup 48}Sc

Energy Technology Data Exchange (ETDEWEB)

Ohtsubo, T., E-mail: tohtsubo@np.gs.niigata-u.ac.jp; Kawamura, Y.; Ohya, S. [Niigata University, Department of Physics (Japan); Izumikawa, T. [Niigata University, Radioisotope Center (Japan); Nishimura, K. [Toyama University, Faculty of Engineering (Japan); Muto, S. [Neutron Science Laboratory, KEK (Japan); Shinozuka, T. [Tohoku University, Cyclotron and Radioisotope Center (Japan)

2007-11-15

Nuclear magnetic resonances were measured for {sup 48}Sc and {sup 44m}Sc oriented at 8 mK in an Fe host metal. The magnetic hyperfine splitting frequencies at an external magnetic field of 0.2 T were determined to be 63.22(11) MHz and 64.81(1) MHz for {sup 48}Sc and {sup 44m}Sc, respectively. With the known magnetic moment of {mu}({sup 44m}Sc)=+3.88 (1) {mu}{sub N}, the magnetic moment of {sup 48}Sc is deduced as {mu}({sup 44}Sc)=+3.785(12) {mu}{sub N}. The measured magnetic moment of {sup 48}Sc is discussed in terms of the shell model using the effective interactions.

Chemical, physical, profile and other oceanographic data collected aboard NOAA Ship THOMAS JEFFERSON in the Gulf of Mexico from 2010-06-03 to 2010-07-18 in response to the Deepwater Horizon Oil Spill event (NODC Accession 0069082)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Chemical, physical, profile, tows and underway oceanographic data were collected aboard NOAA Ship THOMAS JEFFERSON in the Gulf of Mexico from 2010-06-03 to...

Topotactic oxidation pathway of ScTiO3 and high-temperature structure evolution of ScTiO3.5 and Sc4Ti3O12-type phases.

Science.gov (United States)

Shafi, Shahid P; Hernden, Bradley C; Cranswick, Lachlan M D; Hansen, Thomas C; Bieringer, Mario

2012-02-06

The novel oxide defect fluorite phase ScTiO(3.5) is formed during the topotactic oxidation of ScTiO(3) bixbyite. We report the oxidation pathway of ScTiO(3) and structure evolution of ScTiO(3.5), Sc(4)Ti(3)O(12), and related scandium-deficient phases as well as high-temperature phase transitions between room temperature and 1300 °Cusing in-situ X-ray diffraction. We provide the first detailed powder neutron diffraction study for ScTiO(3). ScTiO(3) crystallizes in the cubic bixbyite structure in space group Ia3 (206) with a = 9.7099(4) Å. The topotactic oxidation product ScTiO(3.5) crystallizes in an oxide defect fluorite structure in space group Fm3m (225) with a = 4.89199(5) Å. Thermogravimetric and differential thermal analysis experiments combined with in-situ X-ray powder diffraction studies illustrate a complex sequence of a topotactic oxidation pathway, phase segregation, and ion ordering at high temperatures. The optimized bulk synthesis for phase pure ScTiO(3.5) is presented. In contrast to the vanadium-based defect fluorite phases AVO(3.5+x) (A = Sc, In) the novel titanium analogue ScTiO(3.5) is stable over a wide temperature range. Above 950 °C ScTiO(3.5) undergoes decomposition with the final products being Sc(4)Ti(3)O(12) and TiO(2). Simultaneous Rietveld refinements against powder X-ray and neutron diffraction data showed that Sc(4)Ti(3)O(12) also exists in the defect fluorite structure in space group Fm3m (225) with a = 4.90077(4) Å. Sc(4)Ti(3)O(12) undergoes partial reduction in CO/Ar atmosphere to form Sc(4)Ti(3)O(11.69(2)).

CERN: SC-33

Energy Technology Data Exchange (ETDEWEB)

Anon.

1991-06-15

On 22 April a forward-looking CERN also looked back for a day, when the 'SC-33' event reviewed the achievements of CERN's first machine, the 600 MeV SynchroCyclotron (SC), which closed down on 17 December after 33 years of valiant service.

Magnetic and magneto-optical characteristics of spin coated Co{sub 0.6}Zn{sub 0.4}Fe{sub 1.7}Mn{sub 0.3}O{sub 4} thin films on Pt (1 1 1) coated Si substrate

Energy Technology Data Exchange (ETDEWEB)

Gupta, Arti, E-mail: artigupta80@gmail.com [Department of Physics and Astrophysics, University of Delhi, Delhi110007 (India); Dutta, Shankar [Solid State Physics Laboratory, DRDO, Lucknow Road, Timarpur, Delhi110054 (India); Tandon, Ram Pal [Department of Physics and Astrophysics, University of Delhi, Delhi110007 (India)

2016-05-15

Highlights: • Properties of Co{sub 0.6}Zn{sub 0.4}Mn{sub 0.3}Fe{sub 1.7}O{sub 4} thin films on Pt-Si substrate are reported. • Reduction in thickness ∼27% with increased annealing temperature was found. • Partial (3 3 3) plane textured orientation was noted for these films. - Abstract: This paper reports magnetic and magneto-optical properties of Co{sub 0.6}Zn{sub 0.4}Fe{sub 1.7}Mn{sub 0.3}O{sub 4} nanocrystalline thin films (thickness ∼140–200 nm) deposited on Pt (1 1 1)/Ti/SiO{sub 2}/Si substrates by spin coating technique. Deposited films are then annealed at 600 °C and 700 °C for 60 min (significant reduction in film thickness from 200 nm to 140 nm was noted with the increase in post deposition annealing temperature). The X ray diffraction patterns confirmed the spinel cubic structure of Co{sub 0.6}Zn{sub 0.4}Fe{sub 1.7}Mn{sub 0.3}O{sub 4} films with polycrystalline phase and also indicated a partial <3 3 3> texture orientation. Deposited films showed magnetic anisotropy as evidenced from magnetic and magneto-optical measurements. Higher in plane remnant magnetization and low coercivity values as compared to out of plane ones were observed for both samples, indicating in plane alignment of easy axis of magnetization.

CERN: SC-33

International Nuclear Information System (INIS)

Anon.

1991-01-01

On 22 April a forward-looking CERN also looked back for a day, when the 'SC-33' event reviewed the achievements of CERN's first machine, the 600 MeV SynchroCyclotron (SC), which closed down on 17 December after 33 years of valiant service

S-C Mylonites

NARCIS (Netherlands)

Lister, G.S.; Snoke, A.W.

1984-01-01

Two types of foliations are commonly developed in mylonites and mylonitic rocks: (a) S-surfaces related to the accumulation of finite strain and (b) C-surfaces related to displacement discontinuities or zones of relatively high shear strain. There are two types of S-C mylonites. Type I S-C

Determination of 46Sc in water

International Nuclear Information System (INIS)

Huo Bijun; Ji Zhaogang; Wang Juying

1985-01-01

Analytical procedures for the determination of 46 Sc in water is presented. 46 Sc in water is concentrated with Fe(OH) 3 ; Then 46 Sc is extracted with TBP and purified by precipitating it with Amygdalic Acid. Finally the precipitate is ignited into Sc 2 O 3 under 800 deg C and β-activity is counted. In this method chemical reeovery for Sc was (90.8 +- 2.8)% and radiochemical recovery for 46 Sc was (89.8 +- 3.8)%. Purification factors for some of the relevant Radionuclides ranged from 10 3 to 10 5

The effect of Sc additions on the microstructure and age hardening behaviour of as cast Al–Sc alloys

International Nuclear Information System (INIS)

Costa, S.; Puga, H.; Barbosa, J.; Pinto, A.M.P.

2012-01-01

Highlights: ► The Sc effect on the microstructure and ageing behaviour of Al–Sc alloys is studied. ► Cast into copper mould allows the elimination of solution heat treatment. ► Directly aged as cast alloys exhibits higher hardness and precipitation kinetics. ► Sc addition and optimised ageing result in an increase in Al–Sc mechanical properties. -- Abstract: The grain refinement effect and the ageing behaviour of Al–0.5 wt.% Sc, Al–0.7 wt.% Sc, and Al–1 wt.% Sc alloys are studied on the basis of optic microscopy (OM), scanning electron microscopy (SEM), X-ray diffraction (XRD) observations and hardness measurements. In Al–Sc alloys the higher grain refinement is observed for Sc contents greater than 0.5 wt.% accompanied by a notorious morphology modification, from coarse columnar grains to a fine perfect equiaxed structure. The as cast structures are characterised by a rich supersaturated solid solution in Sc, that promotes a great age hardening response at 250 °C and 300 °C. The age hardening curves also demonstrate a low overageing kinetics for all the alloys. Although the higher Sc content in solid solution for the alloys with 0.7 and 1 wt.% Sc, the age hardening response of all the Al–Sc alloys remains similar. The direct age hardening response of the as cast Al–0.5 wt.% Sc is shown to be greater than the solutionised and age hardened alloy.

Development of SC structure modularization in Nuclear Power Plant

Energy Technology Data Exchange (ETDEWEB)

Mun, Taeyoup [Korea Hydro and Nuclear Power Co., Ltd., Seoul (Korea, Republic of)

2008-04-15

New Focus on NPP are Rising Concerns on Global Warming, Potential energy crisis (geo-political), Improved reliability and safety of nuclear power plant, Advent of Generation 3+ NPP technology and Economical Energy Resource. New NPPs are 6 units in Korea and 23 in Asia being built, 32 units being planned in China by 2020 (150 by 2050), 10 units being planned in US by 2020 and IAEA expects $200 billions on NPP construction next 25 years (up to 30% of total world energy). {open_square} SC(Steel Plate Concrete) structure {center_dot} Steel Plate is used as a Structural Element instead of Reinforcing Bars in RC {center_dot} SC structure consists of Steel Plate with Headed Studs. Connected by Tie-bars - The Primary Purpose of Tie-bars is to Stiffen and Hold Together the Plates during Construction Process - Headed Studs are Welded to the Inside of Steel Plate for composite action {open_square} Benefits of SC Structure {center_dot} Shorten Construction Duration for Re bar, Forming and Scaffolding Works {center_dot} Minimize Site Labors {center_dot} Improve the Construction Quality {center_dot} Enable Construction Sites to be kept Clean {open_square} SC Modularization {center_dot} Fit for Modular Construction for Structural Features {center_dot} Fit for Modular Construction for Structural Features {center_dot} Inattentively Effective for Integrated Modules {center_dot} Pre-fabrication, Pre-assembly and Modularization {open_square} Project Overview {center_dot} Project Name: Development of SC structure for Modularization in NPP {center_dot} Project Type: Electric Power Industry R and D (Ministry of Knowledge Economy) {center_dot} Duration: Sep. 2005 {approx} Aug. 2008 (36 Months) {center_dot} Research Team and Scopes - Project Management: Korea Hydro and Nuclear Power Company (KHNP) - Development of Code and Standards for SC Structure: Korea Society of Steel Construction (KSSC) Korea Electric Power Research Institute (KEPRI) - Development of SC Structural Analysis and Design

2004/06 Beginning Postsecondary Students Longitudinal Study (BPS:04/06) Field Test Methodology Report. Working Paper Series. NCES 2006-01

Science.gov (United States)

Wine, Jennifer; Cominole, Melissa; Wheeless, Sarah; Bryant, Alyssa; Gilligan, Theresa; Dudley, Kristin; Franklin, Jeff

2006-01-01

The 2004/06 Beginning Postsecondary Students Longitudinal Study (BPS:04/06), conducted for the U.S. Department of Education's National Center for Education Statistics (NCES), collected information about the education and employment experiences of students in the two years following their first enrollment in postsecondary education. The primary…

Solid-State NMR Spectroscopy Proves the Presence of Penta-coordinated Sc Sites in MIL-100(Sc).

Science.gov (United States)

Giovine, Raynald; Volkringer, Christophe; Ashbrook, Sharon E; Trébosc, Julien; McKay, David; Loiseau, Thierry; Amoureux, Jean-Paul; Lafon, Olivier; Pourpoint, Frédérique

2017-07-18

Advanced solid-state NMR methods and first-principles calculations demonstrate for the first time the formation of penta-coordinated scandium sites. These coordinatively unsaturated sites were shown during the thermal activation of scandium-based metal-organic frameworks (MOFs). A 45 Sc NMR experiment allows their specific observation in activated Sc 3 BTB 2 (H 3 BTB=1,3,5-tris(4-carboxyphenyl)benzene) and MIL-100(Sc) MOFs. The assignment of the ScO 5 groups is supported by the DFT calculations of NMR parameters. The presence of ScO 5 Lewis acid sites in MIL-100(Sc) explains furthermore its catalytic activity. The first NMR experiment to probe 13 C- 45 Sc distances is also introduced. This advanced solid-state NMR pulse sequence allows the demonstration of the shrinkage of the MIL-100(Sc) network when the activation temperature is raised. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

Local structure of perovskites ReO3 and ScF3 with negative thermal expansion: interpretation beyond the quasiharmonic approximation

International Nuclear Information System (INIS)

Purans, Juris; Piskunov, Sergei; Bocharov, Dmitry; Kalinko, Aleksandr; Kuzmin, Alexei; Ali, Shehab E.; Rocca, Francesco

2016-01-01

We propose an approach beyond the quasiharmonic approximation for interpretation of EXAFS and XRD data and for ab initio calculations of electronic and vibration properties of materials with negative thermal expansion. Ab initio electronic structure and lattice dynamics calculations for cubic and distorted ScF 3 were performed using the linear combination of atomic orbitals (LCAO) method. The band gap obtained in calculations for ScF 3 is equal to 10.54 eV and agree well with the expected value. The calculated infrared spectra of F displaced (FD) cubic ScF 3 allow us to predict that its mean Sc-F-Sc angle within NTE deviates from 180 degree. (paper)

44Sc-DOTA-BN[2-14]NH2 in comparison to 68Ga-DOTA-BN[2-14]NH2 in pre-clinical investigation. Is 44Sc a potential radionuclide for PET?

Science.gov (United States)

Koumarianou, E; Loktionova, N S; Fellner, M; Roesch, F; Thews, O; Pawlak, D; Archimandritis, S C; Mikolajczak, R

2012-12-01

In the present study we demonstrate the in vitro and in vivo comparison of the (44)Sc and (68)Ga labeled DOTA-BN[2-14]NH(2). (44)Sc is a positron emitter with a half life of 3.92 h. Hence it could be used for PET imaging with ligands requiring longer observation time than in the case of (68)Ga. The binding affinity of (nat)Sc-DOTA-BN[2-14]NH(2) and (nat)Ga-DOTA-BN[2-14]NH(2) to GRP receptors was studied in competition to [(125)I-Tyr(4)]-Bombesin in the human prostate cancer cell line PC-3. A preliminary biodistribution in normal rats was performed, while first microPET images were assessed in male Copenhagen rats bearing the androgen-independent Dunning R-3327-AT-1 prostate cancer tumor. The affinity to GRP receptors in the PC-3 cell line was higher for (nat)Ga-DOTA-BN[2-14]NH(2) (IC(50)(nM)=0.85 ± 0.06) than that of (nat)Sc-DOTA-BN[2-14]NH(2) (IC(50) (nM)=6.49 ± 0.13). The internalization rate of (68)Ga labeled DOTA-BN[2-14]NH(2) was slower than that of (44)Sc, but their final internalization percents were comparable. (68)Ga-DOTA-BN[2-14]NH(2) was externalized faster than (44)Sc-DOTA-BN[2-14]NH(2). The biodistribution of (44)Sc-DOTA-BN[2-14]NH(2) and (68)Ga-DOTA-BN[2-14]NH(2) in normal rats revealed a higher uptake in target organs and tissues of the first one while both excreted mainly through urinary tract. In microPET images both tracers were accumulated in the tumor with similar uptake patterns. Despite the differences in the receptor affinity both the (68)Ga- and the (44)Sc-labeled DOTA-BN[2-14]NH(2) tracers showed comparable distribution and similar time constants of uptake and elimination. Moreover no differences in tumor accumulation (neither in the overall uptake nor in the dynamics) were observed from the microPet imaging. From that perspective the use of either (44)Sc or (68)Ga for detecting tumors with GRP receptors is equivalent. Copyright © 2012 Elsevier Ltd. All rights reserved.

Infectivity-associated PrP(Sc) and disease duration-associated PrP(Sc) of mouse BSE prions.

Science.gov (United States)

Miyazawa, Kohtaro; Okada, Hiroyuki; Masujin, Kentaro; Iwamaru, Yoshifumi; Yokoyama, Takashi

2015-01-01

Disease-related prion protein (PrP(Sc)), which is a structural isoform of the host-encoded cellular prion protein, is thought to be a causative agent of transmissible spongiform encephalopathies. However, the specific role of PrP(Sc) in prion pathogenesis and its relationship to infectivity remain controversial. A time-course study of prion-affected mice was conducted, which showed that the prion infectivity was not simply proportional to the amount of PrP(Sc) in the brain. Centrifugation (20,000 ×g) of the brain homogenate showed that most of the PrP(Sc) was precipitated into the pellet, and the supernatant contained only a slight amount of PrP(Sc). Interestingly, mice inoculated with the obtained supernatant showed incubation periods that were approximately 15 d longer than those of mice inoculated with the crude homogenate even though both inocula contained almost the same infectivity. Our results suggest that a small population of fine PrP(Sc) may be responsible for prion infectivity and that large, aggregated PrP(Sc) may contribute to determining prion disease duration.

SC tuning fork

CERN Document Server

The tuning fork used to modulate the radiofrequency system of the synchro cyclotron (SC) from 1957 to 1973. This piece is an unused spare part. The SC was the 1st accelerator built at CERN. It operated from August 1957 until it was closed down at the end of 1990. In the SC the magnetic field did not change with time, and the particles were accelerated in successive pulses by a radiofrequency voltage of some 20kV which varied in frequency as they spiraled outwards towards the extraction radius. The frequency varied from 30MHz to about 17Mz in each pulse. The tuning fork vibrated at 55MHz in vacuum in an enclosure which formed a variable capacitor in the tuning circuit of the RF system, allowing the RF to vary over the appropriate range to accelerate protons from the centre of the macine up to 600Mev at extraction radius. In operation the tips of the tuning fork blade had an amplitude of movement of over 1 cm. The SC accelerator underwent extensive improvements from 1973 to 1975, including the installation of a...

Measurement for commercial exposives with SC-DSC test. Sangyoyo bakuhayaku no SC-DSC sokutei

Energy Technology Data Exchange (ETDEWEB)

Yabashi, H.; Wada, Y.; Hwang, D.; Akutsu, Y.; Tamura, M.; Yoshida, T. (The University of Tokyo, Tokyo (Japan). Faculty of Engineering); Matsuzawa, T. (Nippon Kayaku Co. Ltd., Tokyo (Japan))

1991-08-30

The sealed cell differential scanning calorimetry (SC-DSC) was sintroduced of commercial blasting explosives. As a series of testing the commercial blasting explosives in performance, an SC-DSC test was made to compare the critical detonability line with that resulting therefrom. From the result of SC-DSC measurement, the critical dilution rate was estimated of commercial blasting explosives to become without detonating propagation. As a result, all the explosives with exception of ANFO one were assumed to have a possibility of detonating propagation so that the ANFO explosive was known to be material, unable to exactly evaluate the detonability by the SC-DSC test. The explosion heat, then calculated by the REITP2 in order to assume how the reaction proceeded in the DSC cell, was compared with the reaction heat measured by the SC-DSC test. As a result, the calculated value was known to be almost equal to or slightly larger than the measured one. 15 refs., 4 figs., 2 tabs.

Dissolved inorganic carbon, temperature, salinity and other variables collected from discrete sample and profile observations using CTD, bottle and other instruments from the OCEANUS in the North Atlantic Ocean from 1995-05-29 to 1995-06-03 (NODC Accession 0113588)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0113588 includes chemical, discrete sample, physical and profile data collected from OCEANUS in the North Atlantic Ocean from 1995-05-29 to 1995-06-03...

Detection of a coronary artery vessel wall: performance of 0.3 mm fine-cell detector computed tomography-a phantom study

International Nuclear Information System (INIS)

Yamada, Minoru; Jinzaki, Masahiro; Tanami, Yutaka; Matsumoto, Kazuhiro; Ueno, Akihisa; Kuribayashi, Sachio; Nukui, Masatake; Imai, Yasuhiro; Ishihara, Yotaro; Nishide, Akihiko; Sasaki, Kosuke

2011-01-01

The purpose of this study was to evaluate whether experimental fine-cell detector computed tomography with a 0.3125 mm cell (0.3 mm cell CT) can improve the detection of coronary vessel walls compared with conventional 64-slice computed tomography with a 0.625 mm cell (0.6 mm cell CT). A coronary vessel wall phantom was scanned using 0.6 mm cell CT and 0.3 mm cell CT. The data for 0.3 mm cell CT were obtained using four protocols: a radiation dose equal, double, triple or quadruple that were used in the 0.6 mm cell CT protocol. The detectable size of the vessel wall was assessed based on the first and second derivative functions, and the minimum measurable values were compared using a paired t-test. As a result, the minimum detectable wall thickness of 0.6 mm cell CT (1.5 mm) was significantly larger than that of 0.3 mm cell CT performed using the triple- and quadruple-dose protocols (0.9 mm) and the double-dose protocol (1.1 mm). The difference in the minimum detectable vessel wall thickness measured using 0.6 mm cell CT (1.5 ± 0.1 mm) and 0.3 mm cell CT (0.9 ± 0.1 mm, 1.1 ± 0.2 mm) was significant (p < 0.01). We concluded that 0.3 mm cell CT improved the detection of coronary vessel walls when a more than double-dose protocol was used compared with 0.6 mm cell CT.

Investigations of AlGaN/GaN HFETs utilizing post-metallization etching by nitric acid treatment

International Nuclear Information System (INIS)

Chou, Bo-Yi; Hsu, Wei-Chou; Liu, Han-Yin; Tsai, Chih-Ming; Ho, Chiu-Sheng; Lee, Ching-Sung

2013-01-01

This work investigates AlGaN/GaN heterostructure field-effect transistors (HFETs) processed by using a simple post-metallization etching (PME) treatment. Decreased gate length (L G ) can be achieved by using nitric acid (HNO 3 ) PME treatment owing to the high etching selectivity of HNO 3 of Ni against the Au and GaN layer. Influences on L G , etched gate profiles and device characteristics with respect to different PME processing parameters by HNO 3 treatment are systematically investigated. Optimum device performance is obtained as L G was reduced to 0.5 µm by using a 1 µm long gate mask by immersing the device into a 45% diluted HNO 3 solution for 35 s. Improved device performances, including maximum drain–source current density (I DS,max : 657.6 mA mm −1 → 898.5 mA mm −1 ), drain–source saturation current density at zero gate bias (I DSS0 : 448.3 mA mm −1 → 653.4 mA mm −1 ), maximum extrinsic transconductance (g m,max : 158.3 mS mm −1 → 219.2 mS mm −1 ), unity-gain cut-off frequency (f T : 12.35 GHz → 22.05 GHz), maximum oscillation frequency (f max : 17.55 GHz → 29.4 GHz) and power-added efficiency (P.A.E.: 26.3% → 34.5%) compared to the untreated reference device, have been successfully achieved. (invited paper)

44Sc-DOTA-BN[2-14]NH2 in comparison to 68Ga-DOTA-BN[2-14]NH2 in pre-clinical investigation. Is 44Sc a potential radionuclide for PET?

International Nuclear Information System (INIS)

Koumarianou, E.; Loktionova, N.S.; Fellner, M.; Roesch, F.; Thews, O.; Pawlak, D.; Archimandritis, S.C.; Mikolajczak, R.

2012-01-01

Aim: In the present study we demonstrate the in vitro and in vivo comparison of the 44 Sc and 68 Ga labeled DOTA-BN[2-14]NH 2 . 44 Sc is a positron emitter with a half life of 3.92 h. Hence it could be used for PET imaging with ligands requiring longer observation time than in the case of 68 Ga. Methods: The binding affinity of nat Sc-DOTA-BN[2-14]NH 2 and nat Ga-DOTA-BN[2-14]NH 2 to GRP receptors was studied in competition to [ 125 I-Tyr 4 ]-Bombesin in the human prostate cancer cell line PC-3. A preliminary biodistribution in normal rats was performed, while first microPET images were assessed in male Copenhagen rats bearing the androgen-independent Dunning R-3327-AT-1 prostate cancer tumor. Results: The affinity to GRP receptors in the PC-3 cell line was higher for nat Ga-DOTA-BN[2-14]NH 2 (IC 50 (nM)=0.85±0.06) than that of nat Sc-DOTA-BN[2-14]NH 2 (IC 50 (nM)=6.49±0.13). The internalization rate of 68 Ga labeled DOTA-BN[2-14]NH 2 was slower than that of 44 Sc, but their final internalization percents were comparable. 68 Ga-DOTA-BN[2-14]NH 2 was externalized faster than 44 Sc-DOTA-BN[2-14]NH 2 . The biodistribution of 44 Sc-DOTA-BN[2-14]NH 2 and 68 Ga-DOTA-BN[2-14]NH 2 in normal rats revealed a higher uptake in target organs and tissues of the first one while both excreted mainly through urinary tract. In microPET images both tracers were accumulated in the tumor with similar uptake patterns. Conclusions: Despite the differences in the receptor affinity both the 68 Ga- and the 44 Sc-labeled DOTA-BN[2-14]NH 2 tracers showed comparable distribution and similar time constants of uptake and elimination. Moreover no differences in tumor accumulation (neither in the overall uptake nor in the dynamics) were observed from the microPet imaging. From that perspective the use of either 44 Sc or 68 Ga for detecting tumors with GRP receptors is equivalent. - Highlights: ► In vitro and in vivo evaluation of 44 Sc- and 68 Ga-DOTA-BN[2-14]NH 2 in reference to published

Dissolved inorganic carbon, alkalinity, temperature, salinity and other variables collected from discrete sample and profile observations using Alkalinity titrator, CTD and other instruments from HEALY in the Bering Sea from 2008-03-29 to 2008-05-06 (NCEI Accession 0144549)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0144549 includes discrete sample and profile data collected from HEALY in the Bering Sea from 2008-03-29 to 2008-05-06. These data include AMMONIUM...

α-ScVSe2O8, β-ScVSe2O8, and ScVTe2O8: new quaternary mixed metal oxides composed of only second-order Jahn-Teller distortive cations.

Science.gov (United States)

Kim, Yeong Hun; Lee, Dong Woo; Ok, Kang Min

2013-10-07

Three new quaternary scandium vanadium selenium/tellurium oxides, α-ScVSe2O8, β-ScVSe2O8, and ScVTe2O8 have been synthesized through hydrothermal and standard solid-state reactions. Although all three reported materials are stoichiometrically similar, they exhibit different crystal structures: α-ScVSe2O8 has a three-dimensional framework structure consisting of ScO6, VO6, and SeO3 groups. β-ScVSe2O8 reveals another three-dimensional framework composed of ScO7, VO5, and SeO3 polyhedra. ScVTe2O8 shows a layered structure with ScO6, VO4, and TeO4 polyhedra. Interestingly, the constituent cations, that is, Sc(3+), V(5+), Se(4+), and Te(4+) are all in a distorted coordination environment attributable to second-order Jahn-Teller (SOJT) effects. Complete characterizations including infrared spectroscopy, elemental analyses, thermal analyses, dipole moment calculation, and the magnitudes of out-of-center distortions for the compounds are reported. Transformation reactions suggest that α-ScVSe2O8 may change to β-ScVSe2O8, and then to Sc2(SeO3)3·H2O under hydrothermal conditions.

A DFT study of the effects of Sc doping on electronic and optical properties of CdS nanoparticles

Directory of Open Access Journals (Sweden)

Ur Rehman Shafiq

2015-12-01

Full Text Available In the present work a systematic study was carried out to understand the influence of Sc doping on electronic and optical properties of CdS nanoparticles. The geometry optimization and symmetry computation for CdS and Sc doped CdS nanoparticles using Density Functional Theory (DFT on B3LYP level with the QZ4P for Cd and DZ2P for sulphur and Sc were performed by Amsterdam Density Functional (ADF. The results show that HOMO-LUMO gap as well as electronic and optical properties of CdS clusters vary with Sc doping. The HOMO-LUMO gap is affected by the dopant and its value decreases to 0.6 eV. Through considering the numerical integration scheme in the ADF package, we investigated different vibrational modes and our calculated Raman and IR spectra are consistent with the reported result. The calculated IR and Raman peaks of CdS and Sc doped CdS clusters were in the range of 100 to 289 cm−1, 60 cm−1 to 350 cm−1 and 99 cm−1 to 282 cm−1, 60 cm−1 to 350 cm−1, respectively, which was also confirmed by experiment as well as a blue shift occurrence. Subsequently, for deeper research of pure and doped CdS clusters, their absorption spectra were calculated using time-dependent DFT method.

Two anionically derivatized scandium oxoselenates(IV): ScF[SeO3] and Sc2O2[SeO3

Science.gov (United States)

Greiner, Stefan; Chou, Sheng-Chun; Schleid, Thomas

2017-02-01

Scandium fluoride oxoselenate(IV) ScF[SeO3] and scandium oxide oxoselenate(IV) Sc2O2[SeO3] could be synthesized through solid-state reactions. ScF[SeO3] was obtained phase-pure, by reacting mixtures of Sc2O3, ScF3 and SeO2 (molar ratio: 1:1:3) together with CsBr as fluxing agent in corundum crucibles embedded into evacuated glassy silica ampoules after firing at 700 °C for seven days. Sc2O2[SeO3] first emerged as by-product during the attempts to synthesize ScCl[SeO3] following aforementioned synthesis route and could later be reproduced from appropriate Sc2O3/SeO3 mixtures. ScF[SeO3] crystallizes monoclinically in space group P21/m with a=406.43(2), b =661.09(4), c=632.35(4) pm, β=93.298(3)° and Z=2. Sc2O2[SeO3] also crystallizes in the monoclinic system, but in space group P21/n with a=786.02(6), b=527.98(4), c=1086.11(8) pm, β=108.672(3)° for Z=4. The crystal structures of both compounds are strongly influenced by the stereochemically active lone pairs of the ψ1-tetrahedral [SeO3]2- anions. They also show partial structures, where the derivatizing F- or O2- anions play an important role. For ScF[SeO3] chains of the composition 2+∞ 1[FS c 2 / 2 ] form from connected [FSc2]5+ dumbbells, while [OSc3]7+ pyramids and [OSc4]10+ tetrahedra units are condensed to layers according to 2+ ∞ 2[O2Sc2 ] in Sc2O2[SeO3].

Compensation of native donor doping in ScN: Carrier concentration control and p-type ScN

Science.gov (United States)

Saha, Bivas; Garbrecht, Magnus; Perez-Taborda, Jaime A.; Fawey, Mohammed H.; Koh, Yee Rui; Shakouri, Ali; Martin-Gonzalez, Marisol; Hultman, Lars; Sands, Timothy D.

2017-06-01

Scandium nitride (ScN) is an emerging indirect bandgap rocksalt semiconductor that has attracted significant attention in recent years for its potential applications in thermoelectric energy conversion devices, as a semiconducting component in epitaxial metal/semiconductor superlattices and as a substrate material for high quality GaN growth. Due to the presence of oxygen impurities and native defects such as nitrogen vacancies, sputter-deposited ScN thin-films are highly degenerate n-type semiconductors with carrier concentrations in the (1-6) × 1020 cm-3 range. In this letter, we show that magnesium nitride (MgxNy) acts as an efficient hole dopant in ScN and reduces the n-type carrier concentration, turning ScN into a p-type semiconductor at high doping levels. Employing a combination of high-resolution X-ray diffraction, transmission electron microscopy, and room temperature optical and temperature dependent electrical measurements, we demonstrate that p-type Sc1-xMgxN thin-film alloys (a) are substitutional solid solutions without MgxNy precipitation, phase segregation, or secondary phase formation within the studied compositional region, (b) exhibit a maximum hole-concentration of 2.2 × 1020 cm-3 and a hole mobility of 21 cm2/Vs, (c) do not show any defect states inside the direct gap of ScN, thus retaining their basic electronic structure, and (d) exhibit alloy scattering dominating hole conduction at high temperatures. These results demonstrate MgxNy doped p-type ScN and compare well with our previous reports on p-type ScN with manganese nitride (MnxNy) doping.

Investigation of Sc(3) state in nonaqueous solutions by the 45Sc NMR method of high permission

International Nuclear Information System (INIS)

Buslaev, Yu.A.; Kirakosyan, G.A.; Tarasov, V.P.

1980-01-01

The ScCl 3 + CH 3 CN and ScCl 3 + KNCS + CH 3 CN solutions have been studied by a high-resolution NMR 45 Sc method. It has been estimated that in acetonitrile solutions, with competing ligands of Cl - and NCS - being available, hexacoordination Sc(3) complexes of various compositions are formed, and solvent molecules also take part in formation of the coordination sphere of scandium. Chemical shifts in NMR 45 Sc signals depend linearly on the number of chlor- or NCS - ions bound to scandium(3). This made it possible to determine the value of chemical shifts in signals of all 28 potential complexes formed in a system with three competing ligands

NCBI nr-aa BLAST: CBRC-DDIS-03-0190 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DDIS-03-0190 ref|XP_646956.1| ARID/BRIGHT DNA binding domain-containing protei...n [Dictyostelium discoideum AX4] gb|EAL72978.1| ARID/BRIGHT DNA binding domain-containing protein [Dictyostelium discoideum AX4] XP_646956.1 1e-06 23% ...

Development of standardized radioactive 46Sc solution

International Nuclear Information System (INIS)

Du Hongshan; Jia Zhang; Yu Yiguang; Sun Naiyao

1988-01-01

A method of preparation of standardized radioactive 46 Sc solution is developed. The separation of 46 Sc, the composition of 46 Sc solution and its stability, and radioactivity measurement of 46 Sc are systematically studied. The results obtained in the study and in the applications in many laboratories have shown that our method is effective and reliable

Knowledge insufficient: the management of haemoglobin SC disease.

Science.gov (United States)

Pecker, Lydia H; Schaefer, Beverly A; Luchtman-Jones, Lori

2017-02-01

Although haemoglobin SC (HbSC) accounts for 30% of sickle cell disease (SCD) in the United States and United Kingdom, evidence-based guidelines for genotype specific management are lacking. The unique pathology of HbSC disease is complex, characterized by erythrocyte dehydration, intracellular sickling and increased blood viscosity. The evaluation and treatment of patients with HbSC is largely inferred from studies of SCD consisting mostly of haemoglobin SS (HbSS) patients. These studies are underpowered to allow definitive conclusions about HbSC. We review the pathophysiology of HbSC disease, including known and potential differences between HbSS and HbSC, and highlight knowledge gaps in HbSC disease management. Clinical and translational research is needed to develop targeted treatments and to validate management recommendations for efficacy, safety and impact on quality of life for people with HbSC. © 2016 John Wiley & Sons Ltd.

Effect of solution treatment on precipitation behaviors and age hardening response of Al–Cu alloys with Sc addition

International Nuclear Information System (INIS)

Chen, B.A.; Pan, L.; Wang, R.H.; Liu, G.; Cheng, P.M.; Xiao, L.; Sun, J.

2011-01-01

Highlights: ► Effects of Sc addition on the precipitation and age hardening of Al–Cu alloy were investigated. ► The critical influence of solution treatment on the Sc effect was revealed. ► A significant enhancement in age hardening response was experimentally found and quantitatively assessed. - Abstract: Influences of solution treatment on precipitation behaviors and age hardening response of Al–2.5 wt% Cu–0.3 wt% Sc alloys were investigated, in comparison with Sc-free one. The Al 3 Sc dispersoids, formed during homogenization, were either survived or dissolved to become Sc solute atoms in solution treatment, depending on the solution temperature. When the temperature for solution treatment is 873 K, most of the Al 3 Sc dispersoids were dissolved and a significant enhancement in the uniform precipitation of finer θ′-Al 2 Cu particles was achieved in following aging treatment, causing a noticeable increase in peak-aging hardness by about 90% compared to Sc-free alloys. The enhanced age hardening effect was quantitatively related to the remarkable reduction in effective inter-particle spacing of the plate-shaped θ′-Al 2 Cu precipitates. When the temperature for solution treatment is 793 K, however, most of the Al 3 Sc dispersoids were survived after solution treatment and facilitated the heterogeneous precipitation of θ′-Al 2 Cu plates directly on the {1 0 0} facets of dispersoids in following aging treatment. Concomitantly, the uniform precipitation of θ′-Al 2 Cu plates was greatly suppressed, resulting in a reduced age hardening response. The age hardening responses were quantitatively assessed by using a modified strengthening model that is applicable to the plate-shaped precipitates. The calculations were in good agreement with experimental results. The present results show the importance of controlling solution treatments to achieve significant promotion effect of Sc addition on the precipitation hardening in heat-treatable aluminum

SC-FDMA for mobile communications

CERN Document Server

Abd El-Samie, Fathi E

2013-01-01

SC-FDMA for Mobile Communications examines Single-Carrier Frequency Division Multiple Access (SC-FDMA). Explaining this rapidly evolving system for mobile communications, it describes its advantages and limitations and outlines possible solutions for addressing its current limitations. The book explores the emerging trend of cooperative communication with SC-FDMA and how it can improve the physical layer security. It considers the design of distributed coding schemes and protocols for wireless relay networks where users cooperate to send their data to the destination. Supplying you with the re

Religious characteristics of US women physicians.

Science.gov (United States)

Frank, E; Dell, M L; Chopp, R

1999-12-01

Physicians' religious attributes are unknown, and may affect patient care. The Women Physicians' Health Study (WPHS) is a random sample (n = 4501 respondents, 59% response rate) of US women physicians aged 30-70; the first large, national study of US women physicians. In this study US women physicians were less likely to be Christian than were other Americans (61.2% of women physicians versus 85.1% of the general population), but were more likely to be Jewish (13.2% vs 2.0%), Buddhist (1.4% vs 0.3%), Hindu (3.9% vs 0.4%), or atheist/agnostic (5.9% vs 0.6%). Protestantism (29.3% of the population) and Catholicism (24.9%) were the most commonly reported religious identities. The strongest religious identity was claimed by Mormons and Seventh Day Adventists. Thus, women physicians' religious beliefs differ from those of the general population in the US. This may be particularly important for physicians practicing with patient populations with different religious affiliations, and in addressing clinical questions with ethical or religious dimensions.

Precipitation in cold-rolled Al-Sc-Zr and Al-Mn-Sc-Zr alloys prepared by powder metallurgy

KAUST Repository

Vlach, Martin

2013-12-01

The effects of cold-rolling on thermal, mechanical and electrical properties, microstructure and recrystallization behaviour of the AlScZr and AlMnScZr alloys prepared by powder metallurgy were studied. The powder was produced by atomising in argon with 1% oxygen and then consolidated by hot extrusion at 350 C. The electrical resistometry and microhardness together with differential scanning calorimetry measurements were compared with microstructure development observed by transmission and scanning electron microscopy, X-ray diffraction and electron backscatter diffraction. Fine (sub)grain structure developed and fine coherent Al3Sc and/or Al3(Sc,Zr) particles precipitated during extrusion at 350 C in the alloys studied. Additional precipitation of the Al3Sc and/or Al3(Sc,Zr) particles and/or their coarsening was slightly facilitated by the previous cold rolling. The presence of Sc,Zr-containing particles has a significant antirecrystallization effect that prevents recrystallization at temperatures minimally up to 420 C. The precipitation of the Al6Mn- and/or Al 6(Mn,Fe) particles of a size ~ 1.0 μm at subgrain boundaries has also an essential antirecrystallization effect and totally suppresses recrystallization during 32 h long annealing at 550 C. The texture development of the alloys seems to be affected by high solid solution strengthening by Mn. The precipitation of the Mn-containing alloy is highly enhanced by a cold rolling. The apparent activation energy of the Al3Sc particles formation and/or coarsening and that of the Al6Mn and/or Al 6(Mn,Fe) particle precipitation in the powder and in the compacted alloys were determined. The cold deformation has no effect on the apparent activation energy values of the Al3Sc-phase and the Al 6Mn-phase precipitation. © 2013 Elsevier Inc.

Precipitation in cold-rolled Al-Sc-Zr and Al-Mn-Sc-Zr alloys prepared by powder metallurgy

KAUST Repository

Vlach, Martin; Stulí ková , Ivana; Smola, Bohumil; Kekule, Tomá š; Kudrnová , Hana; Daniš, Stanislav; Gemma, Ryota; Očená šek, Vladivoj; Má lek, Jaroslav; Tanprayoon, Dhritti; Neubert, Volkmar

2013-01-01

The effects of cold-rolling on thermal, mechanical and electrical properties, microstructure and recrystallization behaviour of the AlScZr and AlMnScZr alloys prepared by powder metallurgy were studied. The powder was produced by atomising in argon with 1% oxygen and then consolidated by hot extrusion at 350 C. The electrical resistometry and microhardness together with differential scanning calorimetry measurements were compared with microstructure development observed by transmission and scanning electron microscopy, X-ray diffraction and electron backscatter diffraction. Fine (sub)grain structure developed and fine coherent Al3Sc and/or Al3(Sc,Zr) particles precipitated during extrusion at 350 C in the alloys studied. Additional precipitation of the Al3Sc and/or Al3(Sc,Zr) particles and/or their coarsening was slightly facilitated by the previous cold rolling. The presence of Sc,Zr-containing particles has a significant antirecrystallization effect that prevents recrystallization at temperatures minimally up to 420 C. The precipitation of the Al6Mn- and/or Al 6(Mn,Fe) particles of a size ~ 1.0 μm at subgrain boundaries has also an essential antirecrystallization effect and totally suppresses recrystallization during 32 h long annealing at 550 C. The texture development of the alloys seems to be affected by high solid solution strengthening by Mn. The precipitation of the Mn-containing alloy is highly enhanced by a cold rolling. The apparent activation energy of the Al3Sc particles formation and/or coarsening and that of the Al6Mn and/or Al 6(Mn,Fe) particle precipitation in the powder and in the compacted alloys were determined. The cold deformation has no effect on the apparent activation energy values of the Al3Sc-phase and the Al 6Mn-phase precipitation. © 2013 Elsevier Inc.

Band structure of the quaternary Heusler alloys ScMnFeSn and ScFeCoAl

Science.gov (United States)

Shanthi, N.; Teja, Y. N.; Shaji, Shephine M.; Hosamani, Shashikala; Divya, H. S.

2018-04-01

In our quest for materials with specific applications, a theoretical study plays an important role in predicting the properties of compounds. Heusler alloys or compounds are the most studied in this context. More recently, a lot of quaternary Heusler compounds are investigated for potential applications in fields like Spintronics. We report here our preliminary study of the alloys ScMnFeSn and ScFeCoAl, using the ab-initio linear muffin-tin orbital method within the atomic sphere approximation (LMTO-ASA). The alloy ScMnFeSn shows perfect half-metallicity, namely, one of the spins shows a metallic behaviour and the other spin shows semi-conducting behaviour. Such materials find application in devices such as the spin-transfer torque random access memory (STT-MRAM). In addition, the alloy ScMnFeSn is found to have an integral magnetic moment of 4 µB, as predicted by the Slater-Pauling rule. The alloy ScFeCoAl does not show half-metallicity.

06 Barnard 03.pmd

African Journals Online (AJOL)

Owner

24 Jul 2008 ... Gertie as Little Red Riding Hood is metaphorically swallowed by the fox of Christian values about women and sex. Key words: Afrikaans literature, child identity, Jeanne Goosen, Mark Behr, race, sexuality. However, Goldhagen's explanation (the tradition of eliminationist anti-Semitism which was already ...

06 Mtumane 03.pmd

African Journals Online (AJOL)

Owner

2010-07-29

Jul 29, 2010 ... Key words: Dialogue, isiXhosa novel, S.A. Dazela, Izono zakho ziya kukujikela, ... The common dictionary definition of personality denotes one's “character, ..... South African Journal of African Languages, 28(2): 115–25.

06 Roos 03.pmd

African Journals Online (AJOL)

Owner

2009-03-02

Mar 2, 2009 ... a complete breakdown of interest in his successful career, he leaves his old life and ... things British, he has never been regarded by them as “one of us” (Le .... woman who has “a baby every year by a different man,” the .... the scheming of the Belgian companies and Hammad, trying to obtain a face of re-.

06 Keraan 03.pmd

African Journals Online (AJOL)

Owner

of his B. A. Honours degree in the Department of Arabic Studies at the ..... we have attained great benefits, the blessings of which cannot be enumerated ..... The question of tafakkur (meditation) and the notion that the attributes of Allah.

High figure of merit and thermoelectric properties of Bi-doped Mg2Si0.4Sn0.6 solid solutions

International Nuclear Information System (INIS)

Liu, Wei; Zhang, Qiang; Yin, Kang; Chi, Hang; Zhou, Xiaoyuan; Tang, Xinfeng; Uher, Ctirad

2013-01-01

The study of Mg 2 Si 1−x Sn x -based thermoelectric materials has received widespread attention due to a potentially high thermoelectric performance, abundant raw materials, relatively low cost of modules, and non-toxic character of compounds. In this research, Mg 2.16 (Si 0.4 Sn 0.6 ) 1−y Bi y solid solutions with the nominal Bi content of 0≤y≤0.03 are prepared using a two-step solid state reaction followed by spark plasma sintering consolidation. Within this range of Bi concentrations, no evidence of second phase segregation was found. Bi is confirmed to occupy the Si/Sn sites in the crystal lattice and behaves as an efficient n-type dopant in Mg 2 Si 0.4 Sn 0.6 . Similar to the effect of Sb, Bi doping greatly increases the electron density and the power factor, and reduces the lattice thermal conductivity of Mg 2.16 Si 0.4 Sn 0.6 solid solutions. Overall, the thermoelectric figure of merit of Bi-doped Mg 2.16 Si 0.4 Sn 0.6 solid solutions is improved by about 10% in comparison to values obtained with Sb-doped materials of comparable dopant content. This improvement comes chiefly from a marginally higher Seebeck coefficient of Bi-doped solid solutions. The highest ZT∼1.4 is achieved for the y=0.03 composition at 800 K. - Graphical abstract: (a)The relationship between electrical conductivity and power factor for Sb/Bi-doped Mg 2.16 (Si 0.4 Sn 0.6 ) 1−y (Sb/Bi) y (0 2.16 (Si 0.4 Sn 0.6 ) 1−y Bi y (0≤y≤0.03) solid solutions. (c)Temperature dependent dimensionless figure of merit ZT of Mg 2.16 (Si 0.4 Sn 0.6 ) 1−y Bi y (0≤y≤0.03) solid solutions. - Highlights: • Bi doped Mg 2.16 Si 0.4 Sn 0.6 showed 15% enhancement in the power factor as compared to Sb doped samples. • Bi doping reduced κ ph of Mg 2.16 Si 0.4 Sn 0.6 due to stronger point defect scattering. • The highest ZT=1.4 at 800 K was achieved for Mg 2.16 (Si 0.4 Sn 0.6 ) 0.97 Bi 0.03

The SC State NSF PAARE Program

Science.gov (United States)

Walter, Donald; Ajello, Marco; Brittain, Sean; Cash, Jennifer; Fogle, Bryan; Hartmann, Dieter; Ho, Shirley; Howell, Steve; King, Jeremy; Leising, Mark; Smith, Daniel

2018-01-01

We report on the activities of our NSF PAARE program during Year 3 of the project. Our partnership under this award includes South Carolina State University (a Historically Black College/University), Clemson University (a Ph.D. granting institution) and individual investigators at NASA Ames and elsewhere. Our partnership with the Citizen CATE Experiment and involvement in the total solar eclipse which passed through our campus on August 21, 2017, will be discussed. The PAARE project continues to strengthen our partnership with Clemson. We are close to completing a memorandum of agreement between the two institutions that will allow for the seamless transfer of an undergraduate from SC State to Clemson’s graduate program in physics and astronomy. Additionally, we have worked together under the Citizen CATE project and through other research activities. SC State is a member of the National Astronomy Consortium (NAC) and participates through its faculty and undergraduates, one of whom (Wesley Red) is reporting on his summer internship at this conference. We also served as the state coordinator for South Carolina for the Citizen CATE Experiment. The August 21st path of totality crossed through our campus and the campus of our partner Clemson University. Additional colleges, universities and citizen scientist groups partnered with us to provide 7 sites of coverage across South Carolina from the foothills of the Appalachian mountains to the Atlantic Ocean near the site of departure of the shadow from the continental U.S. Support for this work includes our NSF PAARE award AST-1358913 as well as resources and support provided by Clemson University and the National Optical Astronomy Observatory. CATE work has been supported by NASA SMD award NNX16AB92A to the National Solar Observatory. Additional details can be found at: http://physics.scsu.edu

Modification mechanism of eutectic silicon in Al–6Si–0.3Mg alloy with scandium

Energy Technology Data Exchange (ETDEWEB)

Patakham, Ussadawut [Manufacturing and Systems Engineering Program, Department of Production Engineering, Faculty of Engineering, King Mongkut’s University of Technology Thonburi, 126 Pracha-Utid Rd., Bangmod, Tungkhru, Bangkok 10140 (Thailand); Kajornchaiyakul, Julathep [National Metal and Material Technology Center, National Science and Technology Development Agency, 114 Thailand Science Park, Klong Nueng, Klong Luang, Pathumthani 12120 (Thailand); Limmaneevichitr, Chaowalit, E-mail: chaowalit.lim@kmutt.ac.th [Manufacturing and Systems Engineering Program, Department of Production Engineering, Faculty of Engineering, King Mongkut’s University of Technology Thonburi, 126 Pracha-Utid Rd., Bangmod, Tungkhru, Bangkok 10140 (Thailand)

2013-10-25

Highlights: •Morphologies and growth of Sc and Sr-modified eutectic silicon resemble those of dendrites. •Crystal orientation of eutectic aluminum depends on growth characteristics of eutectic silicon. •We report strong evidence of the occurrence of an impurity-induced twinning mechanism. -- Abstract: The modification mechanism of eutectic silicon in Al–6Si–0.3Mg alloy with scandium was studied. The crystallographic orientation relationships between primary dendrites and the eutectic phase of unmodified and modified Al–6Si–0.3 Mg alloys were determined using electron backscatter diffraction (EBSD). The orientation of aluminum modified with scandium in the eutectic phase was different from that of the neighboring primary dendrites. This result implies that eutectic aluminum grows epitaxially from the surrounding primary aluminum dendrites in the unmodified alloy and that eutectic aluminum grows competitively from the surrounding primary aluminum dendrites in the modified alloy. The pole figure maps of eutectic Si in the [1 0 0], [1 1 0] and [1 1 1] axes of the unmodified and Sc-modified alloys were different, suggesting that the eutectic Al and Si crystals in modified alloy growth are more isotropic and cover a larger set of directions. The lattice fringes of Si of the alloys with and without Sc modification were different in the TEM results. The lattice fringes of Si in modified alloy were found to be multiple twins. However, this was not observed in the unmodified alloy. The growth characteristic of eutectic Si crystal in modified alloy suggests the occurrence of multiple twinning reactions and the formation of a high density of twins. This modification mechanism by Sc is explained by the results of scanning electron microscopy (SEM), electron backscatter diffraction (EBSD) and transmission electron microscopy (TEM) analysis, which provide strong evidence of the occurrence of the impurity-induced twinning (IIT) mechanism.

Structural characterization of PbTi03, Sm0.6Nd0.4NiO3 and NdMnO3 multifunctional Perovskite thin films

Directory of Open Access Journals (Sweden)

Rapenne L.

2012-06-01

Full Text Available Different multifunctional (PbTiO3, Sm0.6Nd0.4NiO3, NdMnO3 thin films were grown by metalorganic chemical vapor deposition (MOCVD technique on SrTiO3 and LaAlO3 substrates. TEM and X-ray diffraction measurements reveal that almost single crystalline thin films can be epitaxially grown on the top of substrates. The relationship between the crystallographic orientation of the films and those of the substrates were determined by reciprocal space mapping and TEM analyses. PbTi03 thin films appear to be under tensile or compressive strain according to the different mismatch of their cell parameter with those of the substrate. Relaxation mechanism as a function of the film thickness arises from coexistence of different type of domains and size and strain effect are analyzed. SmNiO3 thin films present diffuse scattering strikes and are less well organized when compared to PbTi03 thin films. Different domains are observed as well as an additional parasitic phase close to NiO. Its regular distribution can be associated to reduced transport properties. Preliminary observations on NdMnO3 thin films show that an amorphous phase is obtained during MOCVD that can be transformed in a single crystalline film by annealing. The films are under tensile or compressive strain according to the different mismatch of their cell parameter with those of the substrate. Magnetic properties are investigated.

The colours of Hubble Sc galaxy nuclei

International Nuclear Information System (INIS)

Iskudaryan, S.G.

1975-01-01

The colorimetric data on the nuclei of the Sc galaxies are given. Comparison of the following parameters: color of a nucleus, integral color of a galaxy, Byurakan class, and spectral type of normal spirals gives the possibility to conclude: (1) The colors of the nuclei of the Sc galaxies have a high dispersion in its values. In all Byurakan classes the galaxies with intensely red and blue nuclei occur; (2) Some Sc galaxies exhibit a discrepancy between the spectral and morphological types. The results of colorimetry of nuclei indicate that almost all such Sc galaxies have intensely red nuclei which, naturally, provide for these late spectral types. It can be assumed that the intensely red color of the nuclei of such Sc galaxies is a result of a new type of activity of these nuclei; and (3) some Sc galaxies show the characteristics of the Markarian objects

Single and double-layer composite microwave absorbers with hexaferrite BaZn{sub 0.6}Zr{sub 0.3}X{sub 0.3}Fe{sub 10.8}O{sub 19} (X = Ti, Ce, Sn) powders

Energy Technology Data Exchange (ETDEWEB)

Afghahi, Seyyed Salman Seyyed [Department of Materials Science and Engineering, Imam Hossein University, Tehran (Iran, Islamic Republic of); Jafarian, Mojtaba, E-mail: m.jafarian@srbiau.ac.ir [Young Researchers and Elites Club, Science and Research Branch, Islamic Azad University, Tehran (Iran, Islamic Republic of); Atassi, Yomen [Department of Applied Physics, Higher Institute for Applied Sciences and Technology, Damascus (Syrian Arab Republic); Stergiou, Charalampos A. [Lab. of Inorganic Materials, Centre for Research and Technology Hellas, 57001, Thermi (Greece)

2017-01-15

In the present study, substituted barium hexaferrites with the composition BaZn{sub 0.6}Zr{sub 0.3} × {sub 0.3}Fe{sub 10.8}O{sub 19} (where X = Ti, Ce, Sn) are prepared with the solid-state reaction method. X-ray diffraction (XRD), scanning electron microscopy (SEM), vibrating sample magnetometry (VSM) and network analysis techniques are used to analyze the crystal phases, morphology, static magnetic and microwave absorption properties, respectively. Based on the recorded results, barium hexaferrite is the major phase obtained after milling of the powders for 20 h, followed by calcination at 1000 °C for 5 h. The morphology of the particles of the substituted ferrite samples is plate-like with hexagonal shape. The microwave absorption in the X-band of epoxy composites loaded with the ferrite fillers, either separately, in pairs or all together, has been extensively investigated. Multicomponent composites filled with the new hexaferrites under study are promising candidates for electromagnetic absorbers in the 8–12 GHz range. It is found that single-layer absorbers of 5 mm thickness with 45 wt% of a binary (Sn and Ti-doped hexaferrite) or ternary filler mixture exhibit the maximum bandwidth of 2.7 GHz at the level of −10 dB or maximum losses of 26.4 dB at 10.8 GHz, respectively. - Highlights: • Preparation of substituted hexaferrites via mechanical activation. • We designed a broad band microwave absorber with mixing powders. • We designed single layer absorber with RL{sub min} = −26.4 dB and 1.6 GHz bandwidth. • We designed double layer absorbers, as monoband absorbers at a matching frequency.

EPIDEMIOLOGY OF KNEE INJURIES AMONG US HIGH SCHOOL ATHLETES, 2005/06–2010/11

Science.gov (United States)

Swenson, David M.; Collins, Christy L.; Best, Thomas M.; Flanigan, David C.; Fields, Sarah K.; Comstock, R. Dawn

2012-01-01

Purpose US high school athletes sustain millions of injuries annually. Detailed patterns of knee injuries, among the most costly sports injuries, remain largely unknown. We hypothesize that patterns of knee injuries in US high school sports differ by sport and gender. Methods US High school sports-related injury data were collected for 20 sports using the National High School Sports-Related Injury Surveillance System, High School RIO™. Knee injury rates, rate ratios, and injury proportion ratios were calculated. Results From 2005/06–2010/11, 5,116 knee injuries occurred during 17,172,376 athlete exposures (AEs) for an overall rate of 2.98 knee injuries per 10,000 AEs. Knee injuries were more common in competition than practice (RR 3.53, 95% CI 3.34–3.73). Football had the highest knee injury rate (6.29 per 10,000 AEs) followed by girls’ soccer (4.53) and girls’ gymnastics (4.23). Girls had significantly higher knee injury rates than boys in gender-comparable sports (soccer, volleyball, basketball, baseball/softball, lacrosse, swimming and diving, and track and field) (RR 1.52, 95% CI 1.39–1.65). The most commonly involved structure was the MCL (reported in 36.1% of knee injuries), followed by the patella/patellar tendon (29.5%), ACL (25.4%), meniscus (23.0%), LCL (7.9%), and PCL (2.4%). Girls were significantly more likely to sustain ACL injuries in gender-comparable sports (RR 2.38, 95% CI 1.91–2.95). Overall, 21.2% of knee injuries were treated with surgery; girls were more often treated with surgery than boys in gender-comparable sports (IPR 1.30, 95% CI 1.11–1.53). Conclusions Knee injury patterns differ by sport and gender. Continuing efforts to develop preventive interventions could reduce the burden of these injuries. PMID:23059869

Hydroxyurea decreases hospitalizations in pediatric patients with Hb SC and Hb SB+ thalassemia

Directory of Open Access Journals (Sweden)

Lebensburger JD

2015-12-01

Full Text Available Jeffrey D Lebensburger, Rakeshkumar J Patel, Prasannalaxmi Palabindela, Christina J Bemrich-Stolz, Thomas H Howard, Lee M HilliardDivision of Pediatric Hematology Oncology, University of Alabama at Birmingham, Birmingham, AL, USAPurpose: Patients with hemoglobin SC (Hb SC and hemoglobin SB+ (Hb SB+ thalassemia suffer from frequent hospitalizations yet strong evidence of a clinical benefit of hydroxyurea (HU in this population is lacking. Patients with recurrent hospitalizations for pain crisis are offered HU at our institution based on small cohort data and anecdotal benefit. This study identifies outcomes from a large cohort of patients with Hb SC and SB+ thalassemia who were treated with HU for 2 years.Materials and methods: A retrospective review was conducted of 32 patients with Hb SC and SB+ thalassemia who were treated with HU. We reviewed the number, and reasons for hospitalization in the 2 years prior to, and 2 years post-HU treatment as well as laboratory changes from baseline, over 1 year.Results: Patients with Hb SC and SB+ thalassemia started on HU for frequent pain, had a significant reduction in hospitalizations over 2 years as compared to the 2 years prior to HU initiation (mean total hospitalizations/year: pre-HU: 1.6 vs post-HU 0.4 hospitalizations, P<0.001; mean pain hospitalizations/year: pre-HU 1.5 vs post-HU 0.3 hospitalizations, P<0.001. Patients demonstrated hematologic changes including an increase in percent fetal hemoglobin (%HbF pre–post HU (4.5% to 7.7%, P=0.002, mean corpuscular volume (74 to 86 fL, P<0,0001, and decrease in absolute neutrophil count (5.0 to 3.2×109/L, P=0.007. Patients with higher doses of HU demonstrated the greatest reduction in hospitalizations but this was unrelated to absolute neutrophil count.Conclusion: This cohort of patients with Hb SC and SB+ thalassemia provides additional support for using HU in patients with recurrent hospitalizations for pain. A large randomized multicenter trial of

Plane-wave impulse approximation extraction of the neutron magnetic form factor from Quasi-Elastic 3(rvec H)e((rvec e),e(prime)) at Q2 = 0.3 to 0.6 (GeV/c)2

International Nuclear Information System (INIS)

Xu, W.; Anderson, B.; Auberbach, L.; Averett, T.; Bertozzi, W.; Black, T.; Calarco, J.; Cardman, L.; Cates, G.D.; Chai, Z.W.; Chen, J.P.; Choi, S.; Chudakov, E.; Churchwell, S.; Corrado, G.S.; Crawford, C.; Dale, D.; Deur, A.; Djawotho, P.; Donnelly, T.W.; Dutta, D.; Finn, J.M.; Gao, H.; Gilman, R.; Glamazdin, A.V.; Glashausser, C.; Gloeckle, Walter; Golak, J.; Gomez, J.; Gorbenko, V.G.; Hansen, J.O.; Hersman, F.W.; Higinbotham, D.W.; Holmes, R.; Howell, C.R.; Hughes, E.; Humensky, B.; Incerti, S.; Jager, C.W. de; Jensen, J.S.; Jiang, X.; Jones, C.E.; Jones, M.; Kahl, R.; Kamada, H.; Kievsky, A.; Kominis, I.; Korsch, W.; Kramer, K.; Kumbartzki, G.; Kuss, M.; Lakuriqi, E.; Liang, M.; Liyanage, N.; LeRose, J.; Malov, S.; Margaziotis, D.J.; Martin, J.W.; McCormick, K.; McKeown, R. D.; McIlhany, K.; Meziani, Z.E.; Michaels, R.; Miller, G.W.; Mitchell, J.; Nanda, S.; Pace, E.; Pavlin, T.; Petratos, G.G.; Pomatsalyuk, R.I.; Pripstein, D.; Prout, D.; Ransome, R.D.; Roblin, Y.; Rvachev, M.; Saha, A.; Salme, G.; Schnee, M.; Shin, T.; Slifer, K.; Souder, P.A.; Strauch, S.; Suleiman, R.; Sutter, M.; Tipton, B.; Todor, L.; Viviani, M.; Vlahovic, B.; Watson, J.; Williamson, C.F.; Witala, H.; Wojtsekhowski, B.; Xiong, F.; Yeh, J.; Zolnierczuk, P.

2003-01-01

A high precision measurement of the transverse spin-dependent asymmetry A T in 3 (rvec H)e((rvec e),e(prime)) quasielastic scattering was performed in Hall A at Jefferson Lab at values of the squared four-momentum transfer, Q 2 , between 0.1 and 0.6 (GeV/c) 2 . A T is sensitive to the neutron magnetic form factor, G M n . Values of G M n at Q 2 = 0.1 and 0.2 (GeV/c) 2 , extracted using Faddeev calculations, were reported previously. Here, we report the extraction of G M n for the remaining Q 2 -values in the range from 0.3 to 0.6 (GeV/c) 2 using a Plane-Wave Impulse Approximation calculation. The results are in good agreement with recent precision data from experiments using a deuterium target

Saccharomyces cerevisiae Differential Functionalization of Presumed ScALT1 and ScALT2 Alanine Transaminases Has Been Driven by Diversification of Pyridoxal Phosphate Interactions

Directory of Open Access Journals (Sweden)

Erendira Rojas-Ortega

2018-05-01

Full Text Available Saccharomyces cerevisiae arose from an interspecies hybridization (allopolyploidiza-tion, followed by Whole Genome Duplication. Diversification analysis of ScAlt1/ScAlt2 indicated that while ScAlt1 is an alanine transaminase, ScAlt2 lost this activity, constituting an example in which one of the members of the gene pair lacks the apparent ancestral physiological role. This paper analyzes structural organization and pyridoxal phosphate (PLP binding properties of ScAlt1 and ScAlt2 indicating functional diversification could have determined loss of ScAlt2 alanine transaminase activity and thus its role in alanine metabolism. It was found that ScAlt1 and ScAlt2 are dimeric enzymes harboring 67% identity and intact conservation of the catalytic residues, with very similar structures. However, tertiary structure analysis indicated that ScAlt2 has a more open conformation than that of ScAlt1 so that under physiological conditions, while PLP interaction with ScAlt1 allows the formation of two tautomeric PLP isomers (enolimine and ketoenamine ScAlt2 preferentially forms the ketoenamine PLP tautomer, indicating a modified polarity of the active sites which affect the interaction of PLP with these proteins, that could result in lack of alanine transaminase activity in ScAlt2. The fact that ScAlt2 forms a catalytically active Schiff base with PLP and its position in an independent clade in “sensu strictu” yeasts suggests this protein has a yet undiscovered physiological function.

Saccharomyces cerevisiae Differential Functionalization of Presumed ScALT1 and ScALT2 Alanine Transaminases Has Been Driven by Diversification of Pyridoxal Phosphate Interactions

Science.gov (United States)

Rojas-Ortega, Erendira; Aguirre-López, Beatriz; Reyes-Vivas, Horacio; González-Andrade, Martín; Campero-Basaldúa, Jose C.; Pardo, Juan P.; González, Alicia

2018-01-01

Saccharomyces cerevisiae arose from an interspecies hybridization (allopolyploidiza-tion), followed by Whole Genome Duplication. Diversification analysis of ScAlt1/ScAlt2 indicated that while ScAlt1 is an alanine transaminase, ScAlt2 lost this activity, constituting an example in which one of the members of the gene pair lacks the apparent ancestral physiological role. This paper analyzes structural organization and pyridoxal phosphate (PLP) binding properties of ScAlt1 and ScAlt2 indicating functional diversification could have determined loss of ScAlt2 alanine transaminase activity and thus its role in alanine metabolism. It was found that ScAlt1 and ScAlt2 are dimeric enzymes harboring 67% identity and intact conservation of the catalytic residues, with very similar structures. However, tertiary structure analysis indicated that ScAlt2 has a more open conformation than that of ScAlt1 so that under physiological conditions, while PLP interaction with ScAlt1 allows the formation of two tautomeric PLP isomers (enolimine and ketoenamine) ScAlt2 preferentially forms the ketoenamine PLP tautomer, indicating a modified polarity of the active sites which affect the interaction of PLP with these proteins, that could result in lack of alanine transaminase activity in ScAlt2. The fact that ScAlt2 forms a catalytically active Schiff base with PLP and its position in an independent clade in “sensu strictu” yeasts suggests this protein has a yet undiscovered physiological function. PMID:29867852

The ternary systems Sc-Sm(Dy)-Si at 870 K

International Nuclear Information System (INIS)

Kotur, B.Ya.; Mokra, I.Ya.; Toporinskij, A.Ya.

1991-01-01

Isothermal cross sections of the ternary systems Sc-Sm-Si and Sc-Dy-Si at 870 K have been plotted. Investigation of scandium and disprosium in ternary systems have been examined by X-ray diffraction and microstructure analysis. Besides literary data on binary systems Sc-Si, Sm-Si, Dy-Si have been used. Formation of limited (Sc-Sm-Si, Sc-Dy-Si) and continuous (Sc-Dy-Si) solid solutions based on bisilicides of Sc and Sm(Dy) is discovered. Two and five ternary compounds in Sc-Sm-Si and Sc-Dy-Si systems have been determined and their crystal structure has been established. When investigating of Sc-(rare earth element)-Si ternary systems and should take into account the specific interaction of scandium and samarium with REE

Possible occultation by Pluto from US East Coast

Science.gov (United States)

Waagen, Elizabeth O.

2012-06-01

We have been asked to help disseminate the news of a possible occultation by Pluto visible to observers on the US East coast. Although the AAVSO does not ordinarily issue announcements of upcoming occultations, in this case the object is Pluto and the NASA New Horizons mission (http://www.nasa.gov/mission_pages/newhorizons/main/index.html) will be visiting Pluto in 2015. The information below has been supplied by Dr. Leslie Young (Southwest Research Institute), who is coordinating this observing campaign on Pluto. Dr. Young is also Deputy Project Scientist for the New Horizons mission. ALERT: Possible Pluto occultation Wednesday night (2012/06/14 03:28 UT) from US East coast. CONTACT: Leslie Young (layoung@boulder.swri.edu; work: 303-546-6057; skype: drpluto). Also see our planning pages in progress at http://wiki.boulder.swri.edu/mediawiki/index.php/2012-06-14_Pluto_occultation. Pluto's thin, nitrogen atmosphere is in vapor-pressure equilibrium with the surface ice, and changes seasonally. We've seen it double since 1988, and now we measure its pressure once or twice a year. The technique we use is stellar occultation, when a star passes behind Pluto's atmosphere. The atmosphere defocuses the starlight. By the timing of the fading of the star, we measure the pressure and temperature in Pluto's atmosphere at ~10 km resolution. MORE INFORMATION: See http://wiki.boulder.swri.edu/mediawiki/index.php/2012-06-14_Pluto_occultation.

Thermoelectric properties of epitaxial ScN films deposited by reactive magnetron sputtering onto MgO(001) substrates

Science.gov (United States)

Burmistrova, Polina V.; Maassen, Jesse; Favaloro, Tela; Saha, Bivas; Salamat, Shuaib; Rui Koh, Yee; Lundstrom, Mark S.; Shakouri, Ali; Sands, Timothy D.

2013-04-01

Epitaxial ScN(001) thin films were grown on MgO(001) substrates by dc reactive magnetron sputtering. The deposition was performed in an Ar/N2 atmosphere at 2 × 10-3 Torr at a substrate temperature of 850 °C in a high vacuum chamber with a base pressure of 10-8 Torr. In spite of oxygen contamination of 1.6 ± 1 at. %, the electrical resistivity, electron mobility, and carrier concentration obtained from a typical film grown under these conditions by room temperature Hall measurements are 0.22 mΩ cm, 106 cm2 V-1 s-1, and 2.5 × 1020 cm-3, respectively. These films exhibit remarkable thermoelectric power factors of 3.3-3.5 × 10-3 W/mK2 in the temperature range of 600 K to 840 K. The cross-plane thermal conductivity is 8.3 W/mK at 800 K yielding an estimated ZT of 0.3. Theoretical modeling of the thermoelectric properties of ScN calculated using a mean-free-path of 23 nm at 300 K is in very good agreement with the experiment. These results also demonstrate that further optimization of the power factor of ScN is possible. First-principles density functional theory combined with the site occupancy disorder technique was used to investigate the effect of oxygen contamination on the electronic structure and thermoelectric properties of ScN. The computational results suggest that oxygen atoms in ScN mix uniformly on the N site forming a homogeneous solid solution alloy. Behaving as an n-type donor, oxygen causes a shift of the Fermi level in ScN into the conduction band without altering the band structure and the density of states.

A drought severity climatology for the Carpathian Region using Sc-PDSI

Science.gov (United States)

Antofie, Tiberiu; Naumann, Gustavo; Spinoni, Jonathan; Weynants, Melanie; Szalai, Sandor; Szentimrey, Tamas; Bihari, Zita; Vogt, Jürgen

2013-04-01

Monthly grids of the self-calibrating Palmer Drought Severity Index (Sc-PDSI) have been calculated for the period 1961-2010 for the Carpathian Region (17˚-27˚E, 44˚-50˚N) with a spatial resolution of 0.1˚x 0.1˚. Using the Sc-PDSI and the assumptions of the Palmer Drought Model (PDM), the approximated precipitation required for drought termination (achieved when the Sc-PDSI turns back above -0.5) and amelioration (achieved when the Sc-PDSI value turns back above -2.0) are computed for periods of 1, 3, 6, and 9 months. The Sc-PDSI is based on a modified version of the Palmer Drought Severity Index (PDSI), first introduced by Palmer (1965) with the intent to measure the cumulative departure (related to local normal conditions) of moisture supply and demand. Due to its empirically derived climatic characteristic (K) and duration factors - limited to U.S. climatic conditions - Wells et al. (2004) improved it and transformed the PDSI into the Sc-PDSI, which is more appropriate for spatial comparisons in different climatic regions. The Sc-PDSI is based on the supply-and-demand concept of a complex water budget system based on precipitation and temperature records and also on the soil characteristics at any location. The inputs used in this study are the Available Water Capacity of the soil (AWC) derived from the soil texture (European Soil Database of JRC) with a spatial resolution of 0.1˚x0.1˚, Potential Evapo-Transpiration (PET), and 6 hydrological parameters of the soil water balance: recharge, runoff, loss, and their potential values (used in the calculation of Palmer's constants to define the normal climate for the specific location, i.e. the so called CAFEC). PET has been computed using the 0.1˚x 0.1˚ gridded monthly precipitation and mean temperature for 1961-2010 provided by the CARPATCLIM project in the framework of the construction of a Climate Atlas for the Carpathian Region. The Sc-PDSI focuses on the monthly anomalies of the soil moisture, thus it

Hydride vapor phase epitaxy growth of GaN, InGaN, ScN, and ScAIN

NARCIS (Netherlands)

Bohnen, T.

2010-01-01

Chemical vapor deposition (CVD); hydride vapor phase epitaxy (HVPE); gallium nitride (GaN); indium gallium nitride (InGaN); scandium nitride (ScN); scandium aluminum nitride (ScAlN); semiconductors; thin films; nanowires; III nitrides; crystal growth - We studied the HVPE growth of different III

Ultimate internal pressure capacity assessment of SC structure

International Nuclear Information System (INIS)

Park, Hyungkui; Choi, Inkil

2013-01-01

An SC structure applied to a containment building can be quite effective. However, an SC structure cannot be applied to a containment building, because its internal pressure resistance performance has not been verified. The containment building, which undergoes ultimate internal pressure, resists the internal pressure through a pre-stress tendon. It is hard to apply a tendon to an SC structure because of its structural characteristics. Therefore, the internal pressure resistance performance of the SC structure itself should be ensured to apply it to a structure with internal pressure resistance. In this study, the suitability of an SC structure as a substitution for the tendon of a pressure resistant structure was evaluated. A containment structure model was used in this study, because it was representative structures that resistance of ultimate internal pressure be required. In this study, a nonlinear analysis was performed to evaluate and compare the behaviors of tendon model and SC structure model. By comparing the internal pressure-displacement according to the structure type, the stability of SC structure model was assessed

Ab-initio studies of the Sc adsorption and the ScN thin film formation on the GaN(000-1)-(2 × 2) surface

International Nuclear Information System (INIS)

Guerrero-Sánchez, J.; Sánchez-Ochoa, F.; Cocoletzi, Gregorio H.; Rivas-Silva, J.F.; Takeuchi, Noboru

2013-01-01

First principles total energy calculations have been performed to investigate the initial stages of the Sc adsorption and ScN thin film formation on the GaN(000-1)-(2 × 2) surface. Studies are done within the periodic density functional theory as implemented in the PWscf code of the Quantum ESPRESSO package. The Sc adsorption at high symmetry sites results in the bridge site as the most stable structure. When a Sc monolayer is deposited above the surface the T4 site results as the most stable geometry. The Sc migration into the first Ga monolayer induces the Ga displaced ad-atom to be adsorbed at the T4-2 site. A ScN bilayer may be obtained under the Ga monolayer. Finally a ScN bilayer may be formed in the wurtzite phase above the surface. The formation energy plots show that in the moderate Ga-rich conditions we obtain the formation of a ScN bilayer under the gallium monolayer. However at N-rich conditions the formation of ScN bilayer above the surface is the most favorable structure. We report the density of states to explain the electronic structure of the most favorable geometries. - Highlights: • Studies of the initial stages in the formation of Sc and ScN structures on GaN • In the adsorption of Sc on the GaN the Br site is the most favorable geometry. • When a Sc replaces a Ga of the first monolayer the displaced Ga occupies a T4-2 site. • For Ga-rich conditions there is formation of ScN under the Ga monolayer. • In N-rich conditions there is formation of ScN in the wurtzite phase

Effect of doping of trivalent cations Ga{sup 3+}, Sc{sup 3+}, Y{sup 3+} in Li{sub 1.3}Al{sub 0.3}Ti{sub 1.7} (PO{sub 4}){sub 3} (LATP) system on Li{sup +} ion conductivity

Energy Technology Data Exchange (ETDEWEB)

Kothari, Dharmesh H.; Kanchan, D.K., E-mail: dkkanchan.ssi@gmail.com

2016-11-15

We report the effect of trivalent cations dopants in the Li{sub 1.3}Al{sub 0.3−x}R{sub x}Ti{sub 1.7}(PO{sub 4}){sub 3} (R=Ga{sup 3+}, Sc{sup 3+}, Y{sup 3+}) NASICON ceramic system in the concentration range x=0.01,0.03,0.05,0.07, on the Li{sup +} ion conducting properties using impedance spectroscopy. The samples were prepared by solid state reaction method and characterized by X-Ray Diffraction and density measurements. The electrical properties were studied using impedance spectroscopy in frequency range 10 Hz to 20 MHz and temperature range 303 K to 423 K. Although the porosity of the material decreased with doping, the overall Li{sup +} ion conductivity of the system did not improve with doping. Ionic radii of the dopant cations was found to be an important factor in formation of impurity phases and low Li{sup +} ion conductivity. Gallium doped samples exhibited a higher Li{sup +} ion conductivity compared to its scandium and yttrium doped counterparts.

Length-scale dependent microalloying effects on precipitation behaviors and mechanical properties of Al–Cu alloys with minor Sc addition

International Nuclear Information System (INIS)

Jiang, L.; Li, J.K.; Liu, G.; Wang, R.H.; Chen, B.A.; Zhang, J.Y.; Sun, J.; Yang, M.X.; Yang, G.; Yang, J.; Cao, X.Z.

2015-01-01

Heat-treatable Al alloys containing Al–2.5 wt% Cu (Al–Cu) and Al–2.5 wt% Cu–0.3 wt% Sc (Al–Cu–Sc) with different grain length scales, i.e., average grain size >10 μm ( defined coarse grained, CG), 1–2 μm (fine grained, FG), and <1 μm (ultrafine grained, UFG), were prepared by equal-channel angular pressing (ECAP). The length scale and Sc microalloying effects and their interplay on the precipitation behavior and mechanical properties of the Al–Cu alloys were systematically investigated. In the Al–Cu alloys, intergranular θ-Al 2 Cu precipitation gradually dominated by sacrificing the intragranular θ′-Al 2 Cu precipitation with reducing the length scale. Especially in the UFG regime, only intergranular θ-Al 2 Cu particles were precipitated and intragranular θ′-Al 2 Cu precipitation was completely disappeared. This led to a remarkable reduction in yield strength and ductility due to insufficient dislocation storage capacity. The minor Sc addition resulted in a microalloying effect in the Al–Cu alloy, which, however, is strongly dependent on the length scale. The smaller is the grain size, the more active is the microalloying effect that promotes the intragranular precipitation while reduces the intergranular precipitation. Correspondingly, compared with their Sc-free counterparts, the yield strength of post-aged CG, FG, and UFG Al–Cu alloys with Sc addition increased by ~36 MPa, ~56 MPa, and ~150 MPa, simultaneously in tensile elongation by ~20%, ~30%, and 280%, respectively. The grain size-induced evolutions in vacancy concentration/distribution and number density of vacancy-solute/solute–solute clusters and their influences on precipitation nucleation and kinetics have been comprehensively considered to rationalize the length scale-dependent Sc microalloying mechanisms using positron annihilation lifetime spectrum and three dimension atom probe. The increase in ductility was analyzed in the light of Sc microalloying effect and the

Length-scale dependent microalloying effects on precipitation behaviors and mechanical properties of Al–Cu alloys with minor Sc addition

Energy Technology Data Exchange (ETDEWEB)

Jiang, L.; Li, J.K. [State Key Laboratory for Mechanical Behavior of Materials, Xi' an Jiaotong University, Xi' an 710049 (China); Liu, G., E-mail: lgsammer@mail.xjtu.edu.cn [State Key Laboratory for Mechanical Behavior of Materials, Xi' an Jiaotong University, Xi' an 710049 (China); Wang, R.H. [School of Materials Science and Engineering, Xi' an University of Technology, Xi' an 710048 (China); Chen, B.A.; Zhang, J.Y. [State Key Laboratory for Mechanical Behavior of Materials, Xi' an Jiaotong University, Xi' an 710049 (China); Sun, J., E-mail: junsun@mail.xjtu.edu.cn [State Key Laboratory for Mechanical Behavior of Materials, Xi' an Jiaotong University, Xi' an 710049 (China); Yang, M.X.; Yang, G. [Central Iron and Steel Research Institute, Beijing 100081 (China); Yang, J.; Cao, X.Z. [Key Laboratory of Nuclear Radiation and Nuclear Energy Technology, Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China)

2015-06-18

Heat-treatable Al alloys containing Al–2.5 wt% Cu (Al–Cu) and Al–2.5 wt% Cu–0.3 wt% Sc (Al–Cu–Sc) with different grain length scales, i.e., average grain size >10 μm ( defined coarse grained, CG), 1–2 μm (fine grained, FG), and <1 μm (ultrafine grained, UFG), were prepared by equal-channel angular pressing (ECAP). The length scale and Sc microalloying effects and their interplay on the precipitation behavior and mechanical properties of the Al–Cu alloys were systematically investigated. In the Al–Cu alloys, intergranular θ-Al{sub 2}Cu precipitation gradually dominated by sacrificing the intragranular θ′-Al{sub 2}Cu precipitation with reducing the length scale. Especially in the UFG regime, only intergranular θ-Al{sub 2}Cu particles were precipitated and intragranular θ′-Al{sub 2}Cu precipitation was completely disappeared. This led to a remarkable reduction in yield strength and ductility due to insufficient dislocation storage capacity. The minor Sc addition resulted in a microalloying effect in the Al–Cu alloy, which, however, is strongly dependent on the length scale. The smaller is the grain size, the more active is the microalloying effect that promotes the intragranular precipitation while reduces the intergranular precipitation. Correspondingly, compared with their Sc-free counterparts, the yield strength of post-aged CG, FG, and UFG Al–Cu alloys with Sc addition increased by ~36 MPa, ~56 MPa, and ~150 MPa, simultaneously in tensile elongation by ~20%, ~30%, and 280%, respectively. The grain size-induced evolutions in vacancy concentration/distribution and number density of vacancy-solute/solute–solute clusters and their influences on precipitation nucleation and kinetics have been comprehensively considered to rationalize the length scale-dependent Sc microalloying mechanisms using positron annihilation lifetime spectrum and three dimension atom probe. The increase in ductility was analyzed in the light of Sc microalloying

Energy Levels and Radiative Rates for Transitions in F-like Sc XIII and Ne-like Sc XII and Y XXX

Science.gov (United States)

Aggarwal, Kanti

2018-05-01

Energy levels, radiative rates and lifetimes are reported for F-like Sc~XIII and Ne-like Sc~XII and Y~XXX for which the general-purpose relativistic atomic structure package ({\\sc grasp}) has been adopted. For all three ions limited data exist in the literature but comparisons have been made wherever possible to assess the accuracy of the calculations. In the present work the lowest 102, 125 and 139 levels have been considered for the respective ions. Additionally, calculations have also been performed with the flexible atomic code ({\\sc fac}) to (particularly) confirm the accuracy of energy levels.

Cyclotron production of {sup 44}Sc for clinical application

Energy Technology Data Exchange (ETDEWEB)

Krajewski, S.; Bilewicz, A. [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Cydzik, I. [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); European Commission Joint Research Center, Ispra (Italy). Inst. for Health and Consumer Protection; Warsaw Univ. (Poland). Heavy Ion Lab.; Abbas, K. [European Commission Joint Research Center, Ispra (Italy). Institute for Transuranium Elements; Bulgheroni, A.; Simonelli, F.; Holzwarth, U. [European Commission Joint Research Center, Ispra (Italy). Inst. for Health and Consumer Protection

2013-08-01

{sup 44} is a promising {beta}{sup +}-emitter for molecular imaging with intermediate half-life of 4 h. Due to the chemical similarity of Sc{sup 3+} to the Lu{sup 3+} and Y{sup 3+} cations, {sup 44}Sc-DOTA bioconjugates are expected to demonstrate similar properties in vivo as the {sup 177}Lu- and {sup 90}Y-bioconjugates, what is important in planning the radionuclide therapy. {sup 44}Sc can be obtained from the {sup 44}Ti/{sup 44}Sc generator. An alternative method for {sup 44}Sc production can be the irradiation of {sup 44}Ca target at small cyclotrons. The aim of our work was to optimize the parameters of {sup 44}CaCO{sub 3} irradiation and to develop a simple procedure for {sup 44}Sc separation from the calcium target. For optimization study, {sup 44}CaCO{sub 3} targets were irradiated by protons in the energy range of 5.6-17.5 MeV with 9 MeV being found to be the best energy for {sup 44}Ca irradiations. A simple and fast separation procedure of {sup 44}Sc from calcium target was developed using chelating resin Chelex 100. DOTATATE conjugate was successfully radiolabelled with high yield at elevated temperature using the produced {sup 44}Sc. While {sup 44}CaCO{sub 3} is relatively expensive, the cost of {sup 44}Sc-DOTATATE production can be reduced by target recovery. Due to low proton energy required to produce GBq activity level of {sup 44}Sc, the availability of {sup 44}Sc radioisotope could be enhanced to open new opportunities for applications in medical imaging. (orig.)

Radiation Protection Section (SC/SL/RP)

CERN Document Server

2006-01-01

We should like to inform you that the Radiation Protection Section (SC/SL/RP) located on the Prévessin site has moved from Building 865 (ground floor) to new premises in Wing A of Building 892 (second floor). Telephone numbers remain the same. SC/SL/RP section

Charge-ordering, magnetic and electric-transport properties of Bi0.6-xEuxCa0.4MnO3 (0.0≤x≤0.6)

International Nuclear Information System (INIS)

Yadava, Kamlesh; Varma, G.D.; Singh, M.P.; Razavi, F.S.

2012-01-01

We have studied structure, magnetic and transport properties of polycrystalline Bi 0.6-x Eu x Ca 0.4 MnO 3 (x=0.0, 0.1, 0.2, 0.3, 0.4, 0.5 and 0.6) perovskite manganites. Magnetic measurements show that the charge-ordering temperature (T CO ) decreases with increasing x up to x=0.4 and then slightly increases with further increasing x up to x=0.6. Further, the antiferromagnetic (AFM) ordering temperature (T N ) decreases with increasing x. At T N a transition to metamagnetic glass like state is also seen. Eu doping also leads to enhancement in the magnetic moment and a concomitant decrease in resistivity up to x=0.2 and then an increase in resistivity up to x=0.5. We propose that the local lattice distortion induced by the size mismatch between the A-site cations and 6s 2 character of Bi 3+ lone pair electron are responsible for the observed variation in physical properties. (author)

Cyclotron production of {sup 43}Sc for PET imaging

Energy Technology Data Exchange (ETDEWEB)

Walczak, Rafał [Institute of Nuclear Chemistry and Technology, Dorodna 16, 03-195 Warsaw (Poland); Krajewski, Seweryn [Synektik S.A., Research and Development Center, Warsaw (Poland); Szkliniarz, Katarzyna [Department of Nuclear Physics, University of Silesia, Katowice (Poland); Sitarz, Mateusz [Heavy Ion Laboratory, University of Warsaw, Warsaw (Poland); Abbas, Kamel [Nuclear Security Unit, Joint Research Centre, Institute for Transuranium Elements, European Commission, Ispra (Italy); Choiński, Jarosław; Jakubowski, Andrzej; Jastrzębski, Jerzy [Heavy Ion Laboratory, University of Warsaw, Warsaw (Poland); Majkowska, Agnieszka [Institute of Nuclear Chemistry and Technology, Dorodna 16, 03-195 Warsaw (Poland); Simonelli, Federica [Nuclear Decommissioning Unit, Joint Research Centre, Ispra Site Management Directorate, European Commission, Ispra (Italy); Stolarz, Anna; Trzcińska, Agnieszka [Heavy Ion Laboratory, University of Warsaw, Warsaw (Poland); Zipper, Wiktor [Department of Nuclear Physics, University of Silesia, Katowice (Poland); Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Dorodna 16, 03-195 Warsaw (Poland)

2015-12-04

Recently, significant interest in {sup 44}Sc as a tracer for positron emission tomography (PET) imaging has been observed. Unfortunately, the co-emission by {sup 44}Sc of high-energy γ rays (E{sub γ} = 1157, 1499 keV) causes a dangerous increase of the radiation dose to the patients and clinical staff. However, it is possible to produce another radionuclide of scandium—{sup 43}Sc—having properties similar to {sup 44}Sc but is characterized by much lower energy of the concurrent gamma emissions. This work presents the production route of {sup 43}Sc by α irradiation of natural calcium, its separation and purification processes, and the labeling of [DOTA,Tyr3] octreotate (DOTATATE) bioconjugate. Natural CaCO{sub 3} and enriched [{sup 40}Ca]CaCO{sub 3} were irradiated with alpha particles for 1 h in an energy range of 14.8–30 MeV at a beam current of 0.5 or 0.25 μA. In order to find the optimum method for the separation of {sup 43}Sc from irradiated calcium targets, three processes previously developed for {sup 44}Sc were tested. Radiolabeling experiments were performed with DOTATATE radiobioconjugate, and the stability of the obtained {sup 43}Sc-DOTATATE was tested in human serum. Studies of {sup nat}CaCO{sub 3} target irradiation by alpha particles show that the optimum alpha particle energies are in the range of 24–27 MeV, giving 102 MBq/μA/h of {sup 43}Sc radioactivity which creates the opportunity to produce several GBq of {sup 43}Sc. The separation experiments performed indicate that, as with {sup 44}Sc, due to the simplicity of the operations and because of the chemical purity of the {sup 43}Sc obtained, the best separation process is when UTEVA resin is used. The DOTATATE conjugate was labeled by the obtained {sup 43}Sc with a yield >98 % at elevated temperature. Tens of GBq activities of {sup 43}Sc of high radionuclidic purity can be obtainable for clinical applications by irradiation of natural calcium with an alpha beam.

Performance of AlGaN/GaN Heterostructure Field-Effect Transistors for High-Frequency and High-Power Electronics

Directory of Open Access Journals (Sweden)

Peter Kordos

2005-01-01

Full Text Available Preparation and properties of GaN-based heterostructure field-effect transistors (HFETs for high-frequency and high-power applications are studied in this work. Performance of unpassivated and SiO2 passivated AlGaN/GaN HFETs, as well as passivated SiO2/AlGaN/GaN MOSHFETs (metal-oxide-semicondutor HFETs is compared. It is found that MOSHFETs exhibit better DC and RF properties than simple HFET counterparts. Deposited SiO2 yielded an increase of the sheet carrier density from 7.6x10^12 cm^-2 to 9.2x10^12 cm^-2 and subsequent increase of the static drain saturation current from 0.75 A/mm to 1.09 A/mm. Small-signal RF characterisation of MOSHFETs showed an extrinsic current gain cut-off frequency fT of 24 GHz and a maximum frequency of oscillation fmax of 40 GHz. These are fully comparable values with state-of-the-art AlGaN/GaN HFETs. Finnaůůy, microwave power measurements confirmed excellent performance of MOSHFETs:the output power measured at 7 GHz is about two-times larger than that of simple unpassived HFET. Thus, a great potential in application of GaN-based MOSHFETs is documented. 

A Semitransparent Inorganic Perovskite Film for Overcoming Ultraviolet Light Instability of Organic Solar Cells and Achieving 14.03% Efficiency.

Science.gov (United States)

Chen, Weijie; Zhang, Jingwen; Xu, Guiying; Xue, Rongming; Li, Yaowen; Zhou, Yinhua; Hou, Jianhui; Li, Yongfang

2018-05-01

Organic solar cells (OSCs) can be unstable under ultraviolet (UV) irradiation. To address this issue and enhance the power conversion efficiency (PCE), an inorganic-perovskite/organic four-terminal tandem solar cell (TSC) based on a semitransparent inorganic CsPbBr 3 perovskite solar cell (pero-SC) as the top cell and an OSC as bottom cell is constructed. The high-quality CsPbBr 3 photoactive layer of the planar pero-SC is prepared with a dual-source vacuum coevaporation method, using stoichiometric precursors of CsBr and PbBr 2 with a low evaporation rate. The resultant opaque planar pero-SC exhibits an ultrahigh open-circuit voltage of 1.44 V and the highest reported PCE of 7.78% for a CsPbBr 3 -based planar pero-SC. Importantly, the devices show no degradation after 120 h UV light illumination. The related semitransparent pero-SC can almost completely filter UV light and well maintain photovoltaic performance; it additionally shows an extremely high average visible transmittance. When it is used to construct a TSC, the top pero-SC acting as a UV filter can utilize UV light for photoelectric conversion, avoiding the instability problem of UV light on the bottom OSC that can meet the industrial standards of UV-light stability for solar cells, and leading to the highest reported PCE of 14.03% for the inorganic-perovskite/organic TSC. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Spinning cylinder experiments SC-I and SC-II: A review of results and analyses provided to the FALSIRE project

International Nuclear Information System (INIS)

Morland, E.; Sherry, A.H.

1993-01-01

A series of six large-scale experiments have been carried out at AEA Technology using the Spinning Cylinder test facility. Results from two of those experiments (SC-I and SC-II) have been provided to Project FALSIRE and are reviewed in this paper. The Spinning Cylinder tests were carried out using hollow cylinders of 1.4m outer diameter, 0.2m wall thickness and 1.3m length, containing full-length axial defects and fabricated from a modified A508 Class 3 steel. The first Spinning Cylinder test (SC-I) was an investigation of stable ductile growth induced via mechanical (primary) loading and under conditions of contained yielding. Mechanical loading was provided in the hoop direction by rotating the cylinder about its major axis within an enclosed oven. The second test (SC-II) investigated stable ductile growth under severe thermal shock (secondary) loading again under conditions of contained yielding. In this case thermal shock was produced by spraying cold water on the inside surface of the heated cylinder whilst it was rotating. For each experiment, results are presented in terms of a number of variables, eg. crack growth, temperature, stress, strain and applied K and J. In addition, an overview of the analyses of the FALSIRE Phase-1 report is also presented with respect to test SC-I and SC-II. 4 refs., 14 figs., 13 tabs

Effects of magnesium substitution on the magnetic properties of Nd0.7Sr0.3MnO3

International Nuclear Information System (INIS)

Tseggai, M.; Mathieu, R.; Nordblad, P.; Tellgren, R.; Bau, L.V.; Nam, D.N.H.; Phuc, N.X.; Khiem, N.V.; Andre, G.; Bouree, F.

2005-01-01

Effects of magnesium substitution on the magnetic properties of Nd 0.7 Sr 0.3 MnO 3 have been investigated by neutron powder diffraction and magnetization measurements on polycrystalline samples of composition Nd 0.7 Sr 0.3 MnO 3 , Nd 0.6 Mg 0.1 Sr 0.3 MnO 3 , Nd 0.6 Mg 0.1 Sr 0.3 Mn 0.9 Mg 0.1 O 3 , and Nd 0.6 Mg 0.1 Sr 0.3 Mn 0.8 Mg 0.2 O 3 . The pristine compound Nd 0.7 Sr 0.3 MnO 3 is ferromagnetic with a transition temperature occurring at about 210K. Increasing the Mg-substitution causes weakened ferromagnetic interaction and a great reduction in the magnetic moment of Mn. The Rietveld analyses of the neutron powder diffraction (NPD) data at 1.5K for the samples with Mg concentration, y=0.0 and 0.1, show ferromagnetic Mn moments of 3.44(4) and 3.14(4)μ B , respectively, which order along the [001] direction. Below 20K the Mn moments of these samples become canted giving an antiferromagnetic component along the [010] direction of about 0.4μ B at 1.5K. The analyses also show ferromagnetic polarization along [001] of the Nd moments below 50K, with a magnitude of almost 1μ B at 1.5K for both samples. In the samples with Mg substitution of 0.2 and 0.3 only short range magnetic order occurs and the magnitude of the ferromagnetic Mn moments is about 1.6μ B at 1.5K for both samples. Furthermore, the low-temperature NPD patterns show an additional very broad and diffuse feature resulting from short range antiferromagnetic ordering of the Nd moments

Effective single chain antibody (scFv) concentrations in vivo via adenoviral vector mediated expression of secretory scFv

NARCIS (Netherlands)

Arafat, WO; Gomez-Navarro, J; Buchsbaum, DJ; Xiang, J; Casado, E; Barker, SD; Mahasreshti, PJ; Haisma, HJ; Barnes, MN; Siegal, GP; Alvarez, RD; Hemminki, A; Nettelbeck, DM; Curiel, DT

Single chain antibodies (scFv) represent powerful interventional agents for the achievement of targeted therapeutics. The practical utility of these agents have been limited, however, by difficulties related to production of recombinant scFv and the achievement of effective and sustained levels of

Hemoglobin C, S-C, and E Diseases

Science.gov (United States)

... quickly than others, resulting in chronic anemia. Hemoglobin C disease Hemoglobin C disease occurs mostly in blacks. ... a common complication of hemoglobin C disease. Hemoglobin S-C disease Hemoglobin S-C disease occurs in people who ...

RPL-SC dosimetric system for measuring gamma and neutron irradiation in case of emergency

International Nuclear Information System (INIS)

Khristova, M. G.

1993-01-01

A RPL-SC dosimetric system is designed based on radiophotoluminescence (RPL) and on the effect of fast neutron bombardment of silicon semiconductor (SC) diodes. The experimental prototype consists of a computerized automatic measurement system and an individual dosimetric cassette accommodating RPL and SC detectors. The equipment includes: a device for measurement of the direct voltage of Si diodes and the RPL light emitted by RPL detectors; a compartment with dosimetric cassettes to be measured; a manipulator with three positions executing automatic measurement of cassettes; a computer and a printer. The system operates in both manual and automatic modes. In the manual mode each step of the manipulator is set up by the operator who changes the ranges after they have been filled to capacity and registers the results. In the automatic mode the whole process of maintaining the supply and control voltage, of manipulator's operation, measuring, data recording and data processing are controlled by a specially designed computer programme. Main technical parameters: 1) Measurement range of absorbed dose: gamma rays - 10 -3 to 10 2 Gy; thermal neutrons - 10 -3 to 10 2 Gy; fast neutrons - 10 to 30 Gy. 2) Energy range: gamma rays - 0.04 to 1.25 MeV; thermal neutrons - 0.024 eV; fast neutrons - 0.3 to 14 MeV. 3) Relative measurement error - ±15% 4) Recurrent measurement of one and the same dose. 5) Measurement time of 1 detector - 15 sec. (author)

Antioxidant Activity of Essential Oil Extracted by SC-CO₂ from Seeds of Trachyspermum ammi.

Science.gov (United States)

Singh, Aarti; Ahmad, Anees

2017-07-11

Bcakground: Extracts obtained from natural sources such as plants are of immense importance for humans. Methods: Therefore this study was conducted to obtain essential oil from the seeds of T. ammi by conventional and non-conventional methods. Hydrodistillation (HD), Solvent Extraction (SE), Ultrasonication (US), and Supercritical Carbon-dioxide (SC-CO₂) extraction techniques were used to extract essential oil from the powdered seeds of T. ammi . A quality control method for each extracted oil was developed using HPTLC, FTIR, and GC-MS. The optimization process was carried out using fractional factorial design (FFD) under which three parameters were considered: pressure (150, 175, and 300 bar), temperature (25, 30, and 40 °C), and CO₂ flow rate (5, 10, 15 g/min). Results: The yield of essential oil obtained from the HD, SE, US, and SC-CO₂ methods were 1.20%, 1.82%, 2.30%, and 2.64% v/w , respectively. Antioxidant activity was determined by the DPPH and superoxide scavenging methods and the IC 50 (Inhibition Concentration) values of the T. ammi oil sample were found to be 36.41 and 20.55 µg mL -1 , respectively. Conclusion: The present paper reported that different extraction methods lead to different yields of essential oils and the choice of a suitable method is extremely important to obtain more preferred compounds. The yield was higher in the SC-CO₂ method and it is a sustainable and green extraction technique. Many important constituents were detected in analytical techniques. Antioxidant activities carried out showed that essential oil extracted from T. ammi seeds possess significant antioxidant activity.

NOS ESRI Grid, St. Croix (Buck Island), 2006: 3M Multibeam Bathymetry of, US Virgin Islands, Project NF-06-03, UTM 20 NAD83

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — This dataset contains an ESRI Grid with 3 meter cell size representing the bathymetry of the north shore of St. Croix, U.S. Virgin Islands. NOAA's NOS/NCCOS/CCMA...

NOAA ESRI Geotiff - 3m Multibeam Bathymetry of St. Croix (Buck Island), US Virgin Islands, Project NF-06-03, 2006, UTM 20 NAD83

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — This dataset contains an ESRI Geotiff with 3 meter cell size representing the bathymetry of the north shore of St. Croix, U.S. Virgin Islands. NOAA's NOS/NCCOS/CCMA...

NCBI nr-aa BLAST: CBRC-DDIS-06-0058 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DDIS-06-0058 ref|XP_001216414.1| conserved hypothetical protein [Aspergillus terre...us NIH2624] gb|EAU32055.1| conserved hypothetical protein [Aspergillus terreus NIH2624] XP_001216414.1 4e-75 44% ...

06 Asante WEB 03.pmd

African Journals Online (AJOL)

Owner

and in the lives of the ordinary people, the writers must represent the vanguard of the ... (1978), Until the Morning After: Collected Poems, 1963–1985 (1987), Latin American and ... In Contemporary Literature in Ghana 1911–1978: A.

INCREASING OF THE EXPRESSION OF RECOMBINANT scFv-ANTIBODIES EFFICIENCY

Directory of Open Access Journals (Sweden)

O.V. Galkin

2017-10-01

Full Text Available Obtaining single-chain variable fragments (scFv of recombinant antibodies in E. coli cells is often associated with numerous problems causing low yields or inactive conformation of the product. The aim of this work was to study the influence of staphylococcal protein A fragment fused with scFv antibodies (SpA-tag on the efficiency of expression of final product. Examination of scFv antibodies of different origin and specificity has shown that in similar expression systems fused scFv is synthesized in much higher quantities than free scFv. Furthermore, the scFv antibodies in fused form retained their antigen-binding properties and the SpA fragment the ability to bind other immunoglobulins. Thus, the proposed strategy can be considered effective in improving the efficiency of scFv-antibodies production in E. coli cells.

PET imaging of 64Cu-DOTA-scFv-anti-PSMA lipid nanoparticles (LNPs): Enhanced tumor targeting over anti-PSMA scFv or untargeted LNPs

International Nuclear Information System (INIS)

Wong, Patty; Li, Lin; Chea, Junie; Delgado, Melissa K.; Crow, Desiree; Poku, Erasmus; Szpikowska, Barbara; Bowles, Nicole; Channappa, Divya; Colcher, David; Wong, Jeffrey Y.C.; Shively, John E.; Yazaki, Paul J.

2017-01-01

Introduction: Single chain (scFv) antibodies are ideal targeting ligands due to their modular structure, high antigen specificity and affinity. These monovalent ligands display rapid tumor targeting but have limitations due to their fast urinary clearance. Methods: An anti-prostate membrane antigen (PSMA) scFv with a site-specific cysteine was expressed and evaluated in a prostate cancer xenograft model by Cu-64 PET imaging. To enhance tumor accumulation, the scFv-cys was conjugated to the co-polymer DSPE-PEG-maleimide that spontaneously assembled into a homogeneous multivalent lipid nanoparticle (LNP). Results: The targeted LNP exhibited a 2-fold increase in tumor uptake compared to the scFv alone using two different thiol ester chemistries. The anti-PSMA scFv-LNP exhibited a 1.6 fold increase in tumor targeting over the untargeted LNP. Conclusions: The targeted anti-PSMA scFv-LNP showed enhanced tumor accumulation over the scFv alone or the untargeted DOTA-micelle providing evidence for the development of this system for drug delivery. Advances in knowledge and implications for patient care: Anti-tumor scFv antibody fragments have not achieved their therapeutic potential due to their fast blood clearance. Conjugation to an LNP enables multivalency to the tumor antigen as well as increased molecular size for chemotherapy drug delivery.

A Further Study of the Products of Sc and Dioxygen Reactions

Science.gov (United States)

Bauschlicher, Charles W., Jr.; Zhou, Mingfei; Andrews, Lester; Johnson, J. R. Tobias; Panas, Itai; Snis, Anders; Roos, Bjoern O.; Arnold, James O. (Technical Monitor)

1999-01-01

The products of the reaction of Sc and dioxygen have been reinvestigated. By adding the electron-trapping molecule CC14, additional information about the IR spectra has been obtained, as well as the observation of new bands. New ab initio calculations are also performed on possible products of the Sc plus O2 reaction. The previously observed band at 722.5 per cm is assigned as the b2 mode of ScO2(-). Bands arising from ScO(+), Sc(O2)(+), and(O2)ScO are also assigned. We are still unable to assign any bands to OScO. The problems associated with the computational study of ScO2 are discussed.

Synthesis and Isolation of the Titanium-Scandium Endohedral Fullerenes-Sc2 TiC@Ih -C80 , Sc2 TiC@D5h -C80 and Sc2 TiC2 @Ih -C80 : Metal Size Tuning of the Ti(IV) /Ti(III) Redox Potentials.

Science.gov (United States)

Junghans, Katrin; Ghiassi, Kamran B; Samoylova, Nataliya A; Deng, Qingming; Rosenkranz, Marco; Olmstead, Marilyn M; Balch, Alan L; Popov, Alexey A

2016-09-05

The formation of endohedral metallofullerenes (EMFs) in an electric arc is reported for the mixed-metal Sc-Ti system utilizing methane as a reactive gas. Comparison of these results with those from the Sc/CH4 and Ti/CH4 systems as well as syntheses without methane revealed a strong mutual influence of all key components on the product distribution. Whereas a methane atmosphere alone suppresses the formation of empty cage fullerenes, the Ti/CH4 system forms mainly empty cage fullerenes. In contrast, the main fullerene products in the Sc/CH4 system are Sc4 C2 @C80 (the most abundant EMF from this synthesis), Sc3 C2 @C80 , isomers of Sc2 C2 @C82 , and the family Sc2 C2 n (2 n=74, 76, 82, 86, 90, etc.), as well as Sc3 CH@C80 . The Sc-Ti/CH4 system produces the mixed-metal Sc2 TiC@C2 n (2 n=68, 78, 80) and Sc2 TiC2 @C2 n (2 n=80) clusterfullerene families. The molecular structures of the new, transition-metal-containing endohedral fullerenes, Sc2 TiC@Ih -C80 , Sc2 TiC@D5h -C80 , and Sc2 TiC2 @Ih -C80 , were characterized by NMR spectroscopy. The structure of Sc2 TiC@Ih -C80 was also determined by single-crystal X-ray diffraction, which demonstrated the presence of a short Ti=C double bond. Both Sc2 TiC- and Sc2 TiC2 -containing clusterfullerenes have Ti-localized LUMOs. Encapsulation of the redox-active Ti ion inside the fullerene cage enables analysis of the cluster-cage strain in the endohedral fullerenes through electrochemical measurements. © 2016 The Authors. Published by Wiley-VCH Verlag GmbH & Co. KGaA.

Energy Levels, wavelengths and hyperfine structure measurements of Sc II

Science.gov (United States)

Hala, Fnu; Nave, Gillian

2018-01-01

Lines of singly ionized Scandium (Sc II) along with other Iron group elements have been observed [1] in the region surrounding the massive star Eta Carinae [2,3] called the strontium filament (SrF). The last extensive analysis of Sc II was the four-decade old work of Johansson & Litzen [4], using low-resolution grating spectroscopy. To update and extend the Sc II spectra, we have made observation of Sc/Ar, Sc/Ne and Sc/Ge/Ar hollow cathode emission spectrum on the NIST high resolution FT700 UV/Vis and 2 m UV/Vis/IR Fourier transform spectrometers (FTS). More than 850 Sc II lines have been measured in the wavelength range of 187 nm to 3.2 μm. connecting a total of 152 energy levels. The present work also focuses to resolve hyperfine structure (HFS) in Sc II lines. We aim to obtain accurate transition wavelengths, improved energy levels and HFS constants of Sc II. The latest results from work in progress will be presented.Reference[1] Hartman H, Gull T, Johansson S and Smith N 2004 Astron. Astrophys. 419 215[2] Smith N, Morse J A and Gull T R 2004 Astrophys. J. 605 405[3] Davidson K and Humphreys R M 1997 Annu. Rev. Astron. Astrophys. 35[4] Johansson S and Litzén U 1980 Phys. Scr. 22 49

Sc-Decorated WS_2 Nanoribbons as Hydrogen Storage Media

International Nuclear Information System (INIS)

Xu Bin; Wang Yu-Sheng; Zhang Jing; Song Na-Hong; Li Meng; Yi Lin

2016-01-01

The hydrogen storage behavior of Sc-decorated WS_2 monolayer and WS_2 nanoribbons is systematically studied by using first principles calculations based on the density functional theory. The present results indicate that an Sc-decorated WS_2 monolayer is not suitable for storing hydrogen due to the weak interaction between the monolayer WS_2 sheet and the Sc atoms. It is found that both the hybridization mechanism and the Coulomb attraction make the Sc atoms stably adsorb on the edges of WS_2 nanoribbons without clustering. The 2Sc/WS_2 NRs system can adsorb at most eight H_2 molecules with average adsorption energy of 0.20 eV/H_2. The results show that the desorption of H_2 is possible by lowering the pressure or by increasing the temperature. (paper)

CORRELATION BETWEEN SEED TESTS AND FIELD EMERGENCE OF TWO MAIZE HYBRIDS (SC704 AND SC500)

OpenAIRE

A.A. ALILOO; B. SHOKATI

2011-01-01

Early emergence and stand establishment of maize (Zea mays L.) are considered to be the most important yield-contributing factors. The influence of seed vigor on these factors is vital. Therefore, five laboratory tests and field experiment were conducted on basis of a randomized complete block design (RCBD) with five replications in 2011, to evaluate the correlation among the seed vigor tests and field emergence of two maize hybrids (SC704 and SC500). In laboratory tests, differences between ...

NCBI nr-aa BLAST: CBRC-DDIS-06-0058 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DDIS-06-0058 ref|XP_747491.1| K+ homeostasis protein Kha1, putative [Aspergill...us fumigatus Af293] gb|EAL85453.1| K+ homeostasis protein Kha1, putative [Aspergillus fumigatus Af293] XP_747491.1 3e-75 43% ...

Depletion of Arabidopsis SC35 and SC35-like serine/arginine-rich proteins affects the transcription and splicing of a subset of genes.

Science.gov (United States)

Yan, Qingqing; Xia, Xi; Sun, Zhenfei; Fang, Yuda

2017-03-01

Serine/arginine-rich (SR) proteins are important splicing factors which play significant roles in spliceosome assembly and splicing regulation. However, little is known regarding their biological functions in plants. Here, we analyzed the phenotypes of mutants upon depleting different subfamilies of Arabidopsis SR proteins. We found that loss of the functions of SC35 and SC35-like (SCL) proteins cause pleiotropic changes in plant morphology and development, including serrated leaves, late flowering, shorter roots and abnormal silique phyllotaxy. Using RNA-seq, we found that SC35 and SCL proteins play roles in the pre-mRNA splicing. Motif analysis revealed that SC35 and SCL proteins preferentially bind to a specific RNA sequence containing the AGAAGA motif. In addition, the transcriptions of a subset of genes are affected by the deletion of SC35 and SCL proteins which interact with NRPB4, a specific subunit of RNA polymerase II. The splicing of FLOWERING LOCUS C (FLC) intron1 and transcription of FLC were significantly regulated by SC35 and SCL proteins to control Arabidopsis flowering. Therefore, our findings provide mechanistic insight into the functions of plant SC35 and SCL proteins in the regulation of splicing and transcription in a direct or indirect manner to maintain the proper expression of genes and development.

The Resilient Schools Consortium (RiSC): Linking Climate Literacy, Resilience Thinking and Service Learning

Science.gov (United States)

Branco, B. F.; Fano, E.; Adams, J.; Shon, L.; Zimmermann, A.; Sioux, H.; Gillis, A.

2017-12-01

Public schools and youth voices are largely absent from climate resilience planning and projects in New York City. Additionally, research shows that U.S. science teachers' understanding of climate science is lacking, hence there is not only an urgent need to train and support teachers on both the science and pedagogy of climate change, but to link climate literacy, resilience thinking and service learning in K-12 education. However, research on participation of students and teachers in authentic, civic-oriented experiences points to increased engagement and learning outcomes in science. The Resilient Schools Consortium (RiSC) Project will address all these needs through an afterschool program in six coastal Brooklyn schools that engages teachers and urban youth (grades 6-12), in school and community climate resilience assessment and project design. The RiSC climate curriculum, co-designed by New York City school teachers with Brooklyn College, the National Wildlife Federation, New York Sea Grant and the Science and Resilience Institute at Jamaica Bay, will begin by helping students to understand the difference between climate and weather. The curriculum makes extensive use of existing resources such as NOAA's Digital Coast and the Coastal Resilience Mapping Portal. Through a series of four modules over two school years, the six RiSC teams will; 1. explore and understand the human-induced drivers of climate change and, particularly, the significant climate and extreme weather related risks to their schools and surrounding communities; 2. complete a climate vulnerability assessment within the school and the community that is aligned to OneNYC - the city's resilience planning document; 3. design and execute a school-based resilience project; and 4. propose resilience guidelines for NYC Department of Education schools. At the end of each school year, the six RiSC teams will convene a RiSC summit with city officials and resilience practitioners to share ideas and

Magnetic and charge ordering properties of Bi0.6−xEuxCa0.4MnO3 (0.0≤x≤0.6)

International Nuclear Information System (INIS)

Yadav, Kamlesh; Singh, M.P.; Razavi, F.S.; Varma, G.D.

2012-01-01

We have studied structure, magnetic and transport properties of polycrystalline Bi 0.6−x Eu x Ca 0.4 MnO 3 (x=0.0, 0.1, 0.2, 0.3, 0.4, 0.5 and 0.6) perovskite manganites. Magnetic measurements show that the charge-ordering temperature (T CO ) decreases with increasing x up to x=0.4 and then slightly increases with further increasing x up to x=0.6. Further, the antiferromagnetic (AFM) ordering temperature (T N ) decreases with increasing x. At T N a transition to metamagnetic glass like state is also seen. Eu doping also leads to enhancement in the magnetic moment and a concomitant decrease in resistivity up to x=0.2 and then an increase in resistivity up to x=0.5. We propose that the local lattice distortion induced by the size mismatch between the A-site cations and 6s 2 character of Bi 3+ lone pair electron are responsible for the observed variation in physical properties. - Highlights: ► We have studied structure, magnetic and transport properties of Bi 0.6−x Eu x Ca 0.4 MnO 3 (0.0≤x≤0.6). ► Substitution of Eu at Bi-site induces a strong interplay between the magnetic and charge-ordering properties. ► T CO decreases with increasing x up to x=0.4 and then slightly increases with further increasing x up to x=0.6. ► The antiferromagnetic ordering temperature (T N ) decreases with increasing x. ► The A-site cations size mismatch and 6s 2 character of Bi 3+ lone pair electron explain variation in physical properties.

DiSC-OPAL

DEFF Research Database (Denmark)

Kemal, Mohammed Seifu; Pedersen, Rasmus; Iov, Florin

2017-01-01

of such systems. The simulation tool should be able to model Electrical Grid and flexible assets with different time scales and resolution levels fulfilling specific functionalities. In this paper DiSC-OPAL, an OPAL-RT compatible toolbox library for modelling of assets is presented. The library is suitable...

PET Imaging of 64Cu-DOTA-scFv-Anti-PSMA Lipid Nanoparticles (LNPs): Enhanced Tumor Targeting over Anti-PSMA scFv or Untargeted LNPs

Science.gov (United States)

Wong, Patty; Li, Lin; Chea, Junie; Delgado, Melissa K.; Crow, Desiree; Poku, Erasmus; Szpikowska, Barbara; Bowles, Nicole; Channappa, Divya; Colcher, David; Wong, Jeffrey Y.C.; Shively, John E.; Yazaki, Paul J.

2017-01-01

Introduction Single chain (scFv) antibodies are ideal targeting ligands due to their modular structure, high antigen specificity and affinity. These monovalent ligands display rapid tumor targeting but have limitations due to their fast urinary clearance. Methods An anti-prostate membrane antigen (PSMA) scFv with a site-specific cysteine was expressed and evaluated in a prostate cancer xenograft model by Cu-64 PET imaging. To enhance tumor accumulation, the scFv-cys was conjugated to the co-polymer DSPE-PEG-maleimide that spontaneously assembled into a homogeneous multivalent lipid nanoparticle (LNP). Results The targeted LNP exhibited a 2-fold increase in tumor uptake compared to the scFv alone using two different thiol ester chemistries. The anti-PSMA scFv-LNP exhibited a 1.6 fold increase in tumor targeting over the untargeted LNP. Conclusions The targeted anti-PSMA scFv-LNP showed enhanced tumor accumulation over the scFv alone or the untargeted DOTA-micelle providing evidence for the development of this system for drug delivery. Advances in Knowledge and implications for patient care Anti-tumor scFv antibody fragments have not achieved their therapeutic potential due to their fast blood clearance. Conjugation to a LNP enables multivalency to the tumor antigen as well as increased molecular size for chemotherapy drug delivery. PMID:28126683

WOCSDICE 94 - European Workshop on Compound Semiconductor Devices and Integrated Circuits (18th) Held in Kinsale, Ireland on 29 May-1 June 1994

Science.gov (United States)

1994-06-01

Taskert, M. Demmiler, J. Braunsteint, B. Hughes* and E. SAnchez Dpto. Tecnologfas de las Comunicaciones , Universidad de Vigo, E-36200 Vigo, Spain. Phone...Typical Hall mobilities of MOVPE and MBE grown lattice matched HFET layers 20 InGaAs 10 nm- Vg- 0.4V 60015estimated bulk InA LAs 20 nm 15 sl’,e-rai...P measured 0.3 R measured 1-ti) Rs ~~~0.4 .. .....7. ....... -. C simulated 0.2 C measured 0.1 La ~ ~0.2

Efficacy of Selected Insecticide Sprays and Aerosols against the Common Bed Bug, Cimex lectularius (Hemiptera: Cimicidae

Directory of Open Access Journals (Sweden)

Changlu Wang

2016-01-01

Full Text Available We evaluated the residual efficacy of four liquid sprays and four ready-to-use aerosols that are commonly used in the U.S. against a field-collected bed bug, Cimex lectularius L., strain with moderate resistance level to pyrethroids. The four liquid sprays were: Tandem (0.1% thiamethoxam, 0.03% lambda-cyhalothrin, Temprid SC (0.05% imidacloprid, 0.025% cyfluthrin, Transport GHP (0.05% acetamiprid, 0.06% bifenthrin, and Demand CS (0.03% lambda-cyhalothrin. The four aerosols were: Alpine (0.5% dinotefuran, Bedlam (0.4% sumithrin, 1.6% MGK 264, Bedlam Plus (0.4% sumithrin, 1% MGK 264, 0.05% imidacloprid, and Phantom (0.5% chlorfenapyr. Bed bugs were confined for 4 h to treated substrates (aged 24 h. Four substrates were tested: fabric, unpainted wood, painted wood, and vinyl. Bedlam, Demand CS, and Temprid SC resulted in ≤70% mortality on all tested substrates. Among the other five products, substrate type significantly affected their residual efficacy, except for Transport GHP, which caused ≥89.7% mortality regardless of the substrate. The effect of exposure time (5 min, 4 h, and 24 h on the efficacy of Transport GHP and Phantom aerosol also was evaluated. A 4 h continuous exposure to Phantom aerosol or Transport GHP residue caused similar mortality to 24 h exposure and higher mortality than 5 min exposure.

Molecular and functional characterization of peptidoglycan-recognition protein SC2 (PGRP-SC2) from Nile tilapia (Oreochromis niloticus) involved in the immune response to Streptococcus agalactiae.

Science.gov (United States)

Gan, Zhen; Chen, Shannan; Hou, Jing; Huo, Huijun; Zhang, Xiaolin; Ruan, Baiye; Laghari, Zubair Ahmed; Li, Li; Lu, Yishan; Nie, Pin

2016-07-01

PGRP-SC2, the member of PGRP family, plays an important role in regulation of innate immune response. In this paper, a PGRP-SC2 gene of Nile tilapia, Oreochromis niloticus (designated as On-PGRP-SC2) was cloned and its expression pattern under the infection of Streptococcus agalactiae was investigated. Sequence analysis showed main structural features required for amidase activity were detected in the deduced amino acid sequence of On-PGRP-SC2. In healthy tilapia, the On-PGRP-SC2 transcripts could be detected in all the examined tissues, with the most abundant expression in the muscle. When infected with S. agalactiae, there was a clear time-dependent expression pattern of On-PGRP-SC2 in the spleen, head kidney and brain. The assays for the amidase activity suggested that recombinant On-PGRP-SC2 protein had a Zn(2+)-dependent PGN-degrading activity. Moreover, our works showed that recombinant On-PGRP-SC2 protein could significantly reduce bacterial load in target organs attacked by S. agalactiae. These findings indicated that On-PGRP-SC2 may play important roles in the immune response to S. agalactiae in Nile tilapia. Copyright © 2016 Elsevier Ltd. All rights reserved.

Organometallic Pt precursor on graphite substrate: deposition from SC CO2, reduction and morphology transformation as revealed by SFM

International Nuclear Information System (INIS)

Elmanovich, Igor V.; Naumkin, Alexander V.; Gallyamov, Marat O.; Khokhlov, Alexei R.

2012-01-01

Organometallic Pt precursor was deposited on model highly oriented pyrolytic graphite substrate from solutions in supercritical carbon dioxide. Morphology transformations during reduction process including real-time observations were studied by scanning force microscopy (SFM). We confirmed that SC CO 2 is a promising mediator in deposition process even for rather hydrophobic supports. SFM data show that thermal decomposition of the PtMe 2 (COD) precursor with subsequent hydrogen post-treatment allows one to obtain rather pure and well-defined Pt nanoparticles with average height above a substrate level of 4.5 ± 0.6 nm.

Pascal-SC a computer language for scientific computation

CERN Document Server

Bohlender, Gerd; von Gudenberg, Jürgen Wolff; Rheinboldt, Werner; Siewiorek, Daniel

1987-01-01

Perspectives in Computing, Vol. 17: Pascal-SC: A Computer Language for Scientific Computation focuses on the application of Pascal-SC, a programming language developed as an extension of standard Pascal, in scientific computation. The publication first elaborates on the introduction to Pascal-SC, a review of standard Pascal, and real floating-point arithmetic. Discussions focus on optimal scalar product, standard functions, real expressions, program structure, simple extensions, real floating-point arithmetic, vector and matrix arithmetic, and dynamic arrays. The text then examines functions a

Synthesis, crystal structure and photoluminescence of a new Eu-doped Sr containing sialon (Sr{sub 0.94}Eu{sub 0.06})(Al{sub 0.3}Si{sub 0.7}){sub 4}(N{sub 0.8}O{sub 0.2}){sub 6}

Energy Technology Data Exchange (ETDEWEB)

Yamane, Hisanori, E-mail: yamane@tagen.tohoku.ac.jp [Institute of Multidisciplinary Research for Advanced Materials, Tohoku University 2-1-1 Katahira, Aoba-ku, Sendai 980-8577 (Japan); Shimooka, Satoshi; Uheda, Kyota [Mitsubishi Chemical Group, Science and Technology Research Center, Inc. 1000 Kamoshida-cho, Aoba-ku, Yokohama 227-8502 (Japan)

2012-06-15

Colorless transparent platelet single crystals of a novel Eu{sup 2+}-doped strontium silicon aluminum oxynitride, (Sr{sub 0.94}Eu{sub 0.06})(Al{sub 0.3}Si{sub 0.7}){sub 4}(N{sub 0.8}O{sub 0.2}){sub 6}, were prepared at 1800 Degree-Sign C and 0.92 MPa of N{sub 2}. Fundamental reflections of electron and X-ray diffraction of the crystals were indexed with a face-centered orthorhombic unit cell (a=5.8061(5) A, b=37.762(3) A, c=9.5936(9) A). Diffuse streaks elongated in the b-axis direction were observed around the fundamental reflections hkl with h=2n+1 of the electron and X-ray diffraction, indicating stacking faults of (0 1 0)[1 0 0]/2. A crystal structure model without the stacking faults was obtained using the X-ray diffraction data of the fundamental reflections with the space group Fdd2. A SiN{sub 4}-tetrahedron double layer of [SiN{sub 2}]{sub 2} and a Sr/Eu double layer of [(Sr{sub 0.94}Eu{sub 0.06})Al{sub 1.2}Si{sub 0.8}N{sub 0.8} O{sub 1.2}]{sub 2} are stacked alternately along the b-axis direction. The title compound showed an emission with a peak wavelength of 490 nm under 334 nm excitation at room temperature. - Graphical abstract: Single crystals of a novel Eu{sup 2+}-doped strontium silicon aluminum oxynitride, (Sr{sub 0.94}Eu{sub 0.06})(Al{sub 0.3}Si{sub 0.7}){sub 4}(N{sub 0.8}O{sub 0.2}){sub 6}, having stacking faults on the (0 1 0) plane of an orthorhombic cell, were prepared at 1800 Degree-Sign C and 0.92 MPa of N{sub 2}. The compound showed emission with a peak wavelength of 490 nm under 334 nm excitation at room temperature. Highlights: Black-Right-Pointing-Pointer A new compound Eu{sup 2+}-doped (Sr{sub 0.94}Eu{sub 0.06})(Al{sub 0.3}Si{sub 0.7}){sub 4}(N{sub 0.8}O{sub 0.2}){sub 6} was prepared. Black-Right-Pointing-Pointer Stacking faults in the compound were clarified by electron and X-ray diffraction. Black-Right-Pointing-Pointer A basic crystal structure model was obtained based on the X-ray diffraction data. Black-Right-Pointing-Pointer An

Thermodynamic modeling of the Sc-Zn system coupled with first-principles calculation

Directory of Open Access Journals (Sweden)

Tang C.

2012-01-01

Full Text Available The Sc-Zn system has been critically reviewed and assessed by means of CALPHAD (CALculation of PHAse Diagram approach. By means of first-principles calculation, the enthalpies of formation at 0 K for the ScZn, ScZn2, Sc17Zn58, Sc3Zn17 and ScZn12 have been computed with the desire to assist thermodynamic modeling. A set of self-consistent thermodynamic parameters for the Sc-Zn system is then obtained. The calculated phase diagram and thermodynamic properties agree well with the experimental data and first-principles calculations, respectively.

Comparison of Spectral and Scintillation Properties of LuAP:Ce and LuAP:Ce,Sc Single Crystals

Science.gov (United States)

Petrosyan, Ashot G.; Derdzyan, Marina; Ovanesyan, Karine; Shirinyan, Grigori; Lecoq, Paul; Auffray, Etiennette; Kronberger, Matthias; Frisch, Benjamin; Pedrini, Christian; Dujardin, Christophe

2009-10-01

Scintillation properties of LuAP:Ce and LuAP:Ce,Sc crystal series were studied under excitation by gamma-rays from a 137Cs source. Both series demonstrated comparable optical quality in terms of underlying absorption at 260 nm, slope of the optical edge and transmission in the range of emission. The light yield of LuAP:Ce crystals measured in 0.2 cm times 0.2 cm times 0.8 cm pixels increases linearly with the Ce concentration reaching at 0.58 at. % 6448 plusmn 322 ph/MeV and 9911 plusmn 496 ph/MeV in the long and in the short directions respectively (the light yield ratio is 65%) and shows no sign of light saturation. The energy resolution is found to depend, among other factors, on the uniformity of Ce concentration within the pixels and is improved to 7.1 plusmn 0.4% (I = 0.2 cm), 9.5 plusmn 0.5% (I = 0.8 cm). Intentional co-doping with Sc + ions was tested and resulted in increase of the Ce distribution coefficient to about 0.3. This enabled to increase the concentration of Ce in LuAP:Ce,Sc crystals up to 0.7 at. %, while conserving high optical quality. In contrast to LuAP:Ce, the light yield in LuAP:Ce,Sc crystals does not increase with Ce concentration, the photo peak being gradually suppressed. The involved mechanisms are discussed basing on measurements of the unit cell volumes, Ce concentration uniformity, x-ray rocking spectra, absorption spectra of pure and variously doped LuAP crystals, and emission spectra under different excitations.

Lifetime and g-factor measurements in 44Sc

International Nuclear Information System (INIS)

Chevallier, A.; Chavallier, J.; Gross, J.L.; Haas, B.; Schulz, N.; Styczen, J.; Toulemonde, M.

1975-01-01

The lifetimes of the 235 keV, 2 - state and 350 keV, 4 + state in 44 Sc have been measured via the 44 Ca(p, n) 44 Sc reaction with a pulsed proton beam. The time integral perturbed angular distribution technique with an external field was used to measure the precession angles of the 2 - and 4 + states populated by the 30 Si( 16 O, pnγ) 44 Sc reaction. The following values for the mean-lives and g-factors were obtained: π(2 - ) = 8.83(33) ns, g(2 - ) = 0.30(13) and π(4 + ) = 4.52(27)ns, g(4 + ) = 0.90(12). The results for the 2 - state support a rotational description of the negative parity states in 44 Sc. The magnetic moment of the 4 + state is compared to shell model predictions. (orig.) [de

Charleston Harbor, SC, Regional Sediment Management Study: Beneficial Use of Dredged Material through Nearshore Placement

Science.gov (United States)

2017-05-01

Modeling System (CMS) that were developed and applied previously for the Charleston Harbor numerical modeling study (Kashlan 2013) were used in...Particle Tracking Model; Report 1: Model theory, implementation, and example applications. ERDC/CHL TR-6-20. Vicksburg, MS: U.S. Army Engineer Research ...ER D C/ CH L TR -1 7- 7 Regional Sediment Management (RSM) Program Charleston Harbor, SC, Regional Sediment Management Study

Charleston Harbor, SC, Regional Sediment Management Study; Beneficial Use of Dredged Material through Nearshore Placement

Science.gov (United States)

2017-05-01

Modeling System (CMS) that were developed and applied previously for the Charleston Harbor numerical modeling study (Kashlan 2013) were used in...Particle Tracking Model; Report 1: Model theory, implementation, and example applications. ERDC/CHL TR-6-20. Vicksburg, MS: U.S. Army Engineer Research ...ER D C/ CH L TR -1 7- 7 Regional Sediment Management (RSM) Program Charleston Harbor, SC, Regional Sediment Management Study

Electronic structure and local distortions in epitaxial ScGaN films

International Nuclear Information System (INIS)

Knoll, S M; Zhang, S; Rovezzi, M; Joyce, T B; Moram, M A

2014-01-01

High energy resolution fluorescence-detected x-ray absorption spectroscopy and density functional theory calculations were used to investigate the local bonding and electronic structure of Sc in epitaxial wurtzite-structure Sc x Ga 1−x N films with x ≤ 0.059. Sc atoms are found to substitute for Ga atoms, accompanied by a local distortion involving an increase in the internal lattice parameter u around the Sc atoms. The local bonding and electronic structure at Sc are not affected strongly by the strain state or the defect microstructure of the films. These data are consistent with theoretical predictions regarding the electronic structure of dilute Sc x Ga 1−x N alloys. (paper)

PlanktonSet 1.0: Plankton imagery data collected from F.G. Walton Smith in Straits of Florida from 2014-06-03 to 2014-06-06 and used in the 2015 National Data Science Bowl (NCEI Accession 0127422)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Data presented here are subset of a larger plankton imagery data set collected in the subtropical Straits of Florida from 2014-05-28 to 2014-06-14. Imagery data were...

03 Wessels 03.pmd

African Journals Online (AJOL)

Tienie01

12 Jun 2006 ... benadering definieer. Maria Edgeworth (1767-1849) het byvoorbeeld na 'n realistiese uitbeelding van haar samelewing gestreef en word as 'n belangrike invloed op beide Sir Walter Scott se historiese werke en Jane Austen se sosiale romans beskou. (Albei skrywers het haar bewonder en. 03 Wessels 03.

Antioxidant Activity of Essential Oil Extracted by SC-CO2 from Seeds of Trachyspermum ammi

Directory of Open Access Journals (Sweden)

Aarti Singh

2017-07-01

Full Text Available Bcakground: Extracts obtained from natural sources such as plants are of immense importance for humans. Methods: Therefore this study was conducted to obtain essential oil from the seeds of T. ammi by conventional and non-conventional methods. Hydrodistillation (HD, Solvent Extraction (SE, Ultrasonication (US, and Supercritical Carbon-dioxide (SC-CO2 extraction techniques were used to extract essential oil from the powdered seeds of T. ammi. A quality control method for each extracted oil was developed using HPTLC, FTIR, and GC-MS. The optimization process was carried out using fractional factorial design (FFD under which three parameters were considered: pressure (150, 175, and 300 bar, temperature (25, 30, and 40 °C, and CO2 flow rate (5, 10, 15 g/min. Results: The yield of essential oil obtained from the HD, SE, US, and SC-CO2 methods were 1.20%, 1.82%, 2.30%, and 2.64% v/w, respectively. Antioxidant activity was determined by the DPPH and superoxide scavenging methods and the IC50 (Inhibition Concentration values of the T. ammi oil sample were found to be 36.41 and 20.55 µg mL−1, respectively. Conclusion: The present paper reported that different extraction methods lead to different yields of essential oils and the choice of a suitable method is extremely important to obtain more preferred compounds. The yield was higher in the SC-CO2 method and it is a sustainable and green extraction technique. Many important constituents were detected in analytical techniques. Antioxidant activities carried out showed that essential oil extracted from T. ammi seeds possess significant antioxidant activity.

Antioxidant Activity of Essential Oil Extracted by SC-CO2 from Seeds of Trachyspermum ammi

Science.gov (United States)

Singh, Aarti; Ahmad, Anees

2017-01-01

Bcakground: Extracts obtained from natural sources such as plants are of immense importance for humans. Methods: Therefore this study was conducted to obtain essential oil from the seeds of T. ammi by conventional and non-conventional methods. Hydrodistillation (HD), Solvent Extraction (SE), Ultrasonication (US), and Supercritical Carbon-dioxide (SC-CO2) extraction techniques were used to extract essential oil from the powdered seeds of T. ammi. A quality control method for each extracted oil was developed using HPTLC, FTIR, and GC-MS. The optimization process was carried out using fractional factorial design (FFD) under which three parameters were considered: pressure (150, 175, and 300 bar), temperature (25, 30, and 40 °C), and CO2 flow rate (5, 10, 15 g/min). Results: The yield of essential oil obtained from the HD, SE, US, and SC-CO2 methods were 1.20%, 1.82%, 2.30%, and 2.64% v/w, respectively. Antioxidant activity was determined by the DPPH and superoxide scavenging methods and the IC50 (Inhibition Concentration) values of the T. ammi oil sample were found to be 36.41 and 20.55 µg mL−1, respectively. Conclusion: The present paper reported that different extraction methods lead to different yields of essential oils and the choice of a suitable method is extremely important to obtain more preferred compounds. The yield was higher in the SC-CO2 method and it is a sustainable and green extraction technique. Many important constituents were detected in analytical techniques. Antioxidant activities carried out showed that essential oil extracted from T. ammi seeds possess significant antioxidant activity. PMID:28930268

Effects of hydroxyurea treatment for patients with hemoglobin SC disease.

Science.gov (United States)

Luchtman-Jones, Lori; Pressel, Sara; Hilliard, Lee; Brown, R Clark; Smith, Mary G; Thompson, Alexis A; Lee, Margaret T; Rothman, Jennifer; Rogers, Zora R; Owen, William; Imran, Hamayun; Thornburg, Courtney; Kwiatkowski, Janet L; Aygun, Banu; Nelson, Stephen; Roberts, Carla; Gauger, Cynthia; Piccone, Connie; Kalfa, Theodosia; Alvarez, Ofelia; Hassell, Kathryn; Davis, Barry R; Ware, Russell E

2016-02-01

Although hemoglobin SC (HbSC) disease is usually considered less severe than sickle cell anemia (SCA), which includes HbSS and HbS/β(0) -thalassemia genotypes, many patients with HbSC experience severe disease complications, including vaso-occlusive pain, acute chest syndrome, avascular necrosis, retinopathy, and poor quality of life. Fully 20 years after the clinical and laboratory efficacy of hydroxyurea was proven in adult SCA patients, the safety and utility of hydroxyurea treatment for HbSC patients remain unclear. Recent NHLBI evidence-based guidelines highlight this as a critical knowledge gap, noting HbSC accounts for ∼30% of sickle cell patients within the United States. To date, only 5 publications have reported short-term, incomplete, or conflicting laboratory and clinical outcomes of hydroxyurea treatment in a total of 71 adults and children with HbSC. We now report on a cohort of 133 adult and pediatric HbSC patients who received hydroxyurea, typically for recurrent vaso-occlusive pain. Hydroxyurea treatment was associated with a stable hemoglobin concentration; increased fetal hemoglobin (HbF) and mean corpuscular volume (MCV); and reduced white blood cell count (WBC), absolute neutrophil count (ANC), and absolute reticulocyte count (ARC). Reversible cytopenias occurred in 22% of patients, primarily neutropenia and thrombocytopenia. Painful events were reduced with hydroxyurea, more in patients >15 years old. These multicenter data support the safety and potentially salutary effects of hydroxyurea treatment for HbSC disease; however, a multicenter, placebo-controlled, Phase 3 clinical trial is needed to determine if hydroxyurea therapy has efficacy for patients with HbSC disease. © 2015 Wiley Periodicals, Inc.

Design of SC walls and slabs for impulsive loading

Energy Technology Data Exchange (ETDEWEB)

Varma, Amit H. [Purdue Univ., West Lafayette, IN (United States)

2015-11-11

Reinforced concrete (RC) structures have historically been the preferred choice for blast resistant structures because of their mass and the ductility provided by steel reinforcement. Steel-plate composite (SC) walls are a viable alternative to RC for protecting the infrastructure against explosive threats. SC structures consist of two steel faceplates with a plain concrete core between them. The steel faceplates are anchored to the concrete using stud anchors and connected to each other using tie bars. SC structures provide mass from the concrete infill and ductility from the continuous external steel faceplates. This dissertation presents findings and recommendations from experimental and analytical investigations of the performance of SC walls subjected to far-field blast loads.

LOCAL COLLISION SIMULATION OF AN SC WALL USING ENERGY ABSORBING STEEL

Directory of Open Access Journals (Sweden)

CHUL-HUN CHUNG

2013-08-01

Full Text Available This study evaluates the local damage of a turbine in an auxiliary building of a nuclear power plant due to an external impact by using the LS-DYNA finite element program. The wall of the auxiliary building is SC structure and the material of the SC wall plate is high manganese steel, which has superior ductility and energy absorbance compared to the ordinary steel used for other SC wall plates. The effects of the material of the wall, collision speed, and angle on the magnitude of the local damage were evaluated by local collision analysis. The analysis revealed that the SC wall made of manganese steel had significantly less damage than the SC wall made of ordinary steel. In conclusion, an SC wall made of manganese steel can have higher effective resistance than an SC wall made of ordinary steel against the local collision of an airplane engine or against a turbine impact.

Local Collision Simulation of an SC Wall Using Energy Absorbing Steel

Energy Technology Data Exchange (ETDEWEB)

Chung, Chulhun; Choi, Hyun; Park, Jaegyun [Dankook Univ., Yongin (Korea, Republic of)

2013-08-15

This study evaluates the local damage of a turbine in an auxiliary building of a nuclear power plant due to an external impact by using the LS-DYNA finite element program. The wall of the auxiliary building is SC structure and the material of the SC wall plate is high manganese steel, which has superior ductility and energy absorbance compared to the ordinary steel used for other SC wall plates. The effects of the material of the wall, collision speed, and angle on the magnitude of the local damage were evaluated by local collision analysis. The analysis revealed that the SC wall made of manganese steel had significantly less damage than the SC wall made of ordinary steel. In conclusion, an SC wall made of manganese steel can have higher effective resistance than an SC wall made of ordinary steel against the local collision of an airplane engine or against a turbine impact.

Kampelite, Ba3Mg1.5Sc4(PO4)6(OH)3·4H2O, a new very complex Ba-Sc phosphate mineral from the Kovdor phoscorite-carbonatite complex (Kola Peninsula, Russia)

Science.gov (United States)

Yakovenchuk, Victor N.; Ivanyuk, Gregory Yu.; Pakhomovsky, Yakov A.; Panikorovskii, Taras L.; Britvin, Sergei N.; Krivovichev, Sergey V.; Shilovskikh, Vladimir V.; Bocharov, Vladimir N.

2018-02-01

Kampelite, Ba3Mg1.5Sc4(PO4)6(OH)3·4H2O, is a new Ba-Sc phosphate from the Kovdor phoscorite-carbonatite complex (Kola Peninsula, Russia). It is orthorhombic, Pnma, a = 11.256(1), b = 8.512(1), c = 27.707(4) Å, V = 2654.6(3) Å3 and Z = 4 (from powder diffraction data) or a = 11.2261(9), b = 8.5039(6), c = 27.699(2) Å, V = 2644.3(3) Å3 (from single-crystal diffraction data). The mineral was found in a void within the calcite-magnetite phoscorite (enriched in hydroxylapatite and Sc-rich baddeleyite) inside the axial zone of the Kovdor phoscorite-carbonatite pipe. Kampelite forms radiated aggregates (up to 1.5 mm in diameter) of platy crystals grown on the surfaces of crystals of quintinite-2 H in close association with pyrite, bobierrite and quintinite-3 R. Kampelite is colourless, with a pearly lustre and a white streak. The cleavage is perfect on {001}, the fracture is smooth. Mohs hardness is about 1. In transmitted light, the mineral is colourless without pleochroism or dispersion. Kampelite is biaxial + (pseudouniaxial), α ≈ β = 1.607(2), γ = 1.612(2) (589 nm), and 2 V calc = 0°. The calculated and measured densities are 3.28 and 3.07(3) g·cm-3, respectively. The mean chemical composition determined by electron microprobe is: MgO 4.79, Al2O3 0.45, P2O5 31.66, K2O 0.34, Sc2O3 16.17, Mn2O3 1.62, Fe2O3 1.38, SrO 3.44, and BaO 29.81 wt%. The H2O content estimated from the crystal-structure refinement is 7.12 wt%, giving a total of 96.51 wt%. The empirical formula calculated on the basis of P = 6 apfu (atoms per formula unit) is (Ba2.62Sr0.45K0.10Ca0.06)Σ3.23Mg1.60Mn0.28(Sc3.15Fe3+ 0.23Al0.12)Σ3.50(PO4)6(OH)2.61·4.01H2O. The simplified formula is Ba3Mg1.5Sc4(PO4)6(OH)3·4H2O. The mineral easily dissolves in 10% cold HCl. The strongest X-ray powder-diffraction lines [listed as d in Å ( I) ( hkl)] are as follows: 15.80(100)(001), 13.86(45)(002), 3.184(18)(223), 3.129(19)(026), 2.756(16)(402), 2.688(24)(10 10). The crystal structure of kampelite was

Atomic bonding and mechanical properties of Al-Mg-Zr-Sc alloy

Institute of Scientific and Technical Information of China (English)

高英俊; 班冬梅; 韩永剑; 钟夏平; 刘慧

2004-01-01

The valence electron structures of Al-Mg alloy with minor Sc and Zr were calculated according to the empirical electron theory(EET) in solid. The results show that because of the strong interaction of Al atom with Zr and Sc atom in melting during solidification, the Al3 Sc and Al3 (Sc1-xZrx) particles which act as heterogeneous nuclear are firstly crystallized in alloy to make grains refine. In progress of solidification, the Al-Sc, Al-Zr-Sc segregation regions are formed in solid solution matrix of Al-Mg alloy owing to the strong interaction of Al atom with Zr, Scatoms in bulk of alloy, so in the following homogenization treatment, the finer dispersed Al3 Sc and Al3 (Sc1-x Zrx) second-particles which are coherence with the matrix are precipitated in the segregation region. These finer second particles with the strong Al-Zr, Al-Sc covalent bonds can strengthen the covalent bonds in matrix of the alloy, and also enhance the hardness and strength of Al-Mg alloy. Those finer second-particles precipitated in interface of sub-grains can also strengthen the covalence bonds there, and effectively hinder the interface of sub-grains from migrating and restrain the sub-grains from growing, and cause better thermal stability of Al-Mg alloy.

Turbidity, SOLAR RADIATION - ATMOSPHERIC and other data from SAMUDERA in the Molucca Sea, Indian Ocean and other waters from 1973-03-06 to 1993-03-27 (NODC Accession 9700146)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Zooplankton, phytoplankton, nutrients, and other data were collected from bottle and net casts in the Pacific Ocean (Indonesia) from the Samudera from 06 March 1973...

Microstructure evolution of the 1469 Al–Cu–Li–Sc alloy during homogenization

Energy Technology Data Exchange (ETDEWEB)

Jia, Min, E-mail: jm_lushan@163.com; Zheng, Ziqiao, E-mail: csu1469@163.com; Gong, Zhu, E-mail: start123gz@163.com

2014-11-25

Highlights: • The formation of the W phase (AlCuSc) was found in the 1469 Al-Cu–Li–Sc alloy. • The W phase formed during the homogenization process. • We model the formation process of the W phase. • The formation of the W phase consumes lots of Cu and Sc atoms. - Abstract: The present work aims to clarify the formation of the W phase (AlCuSc) and its formation time in the high Cu content alloy with Sc addition. The microstructure evolution during the two-step homogenization annealing process was investigated in the 1469 Al–Cu–Li–Sc alloy. No evidences of the Al{sub 3}Sc phase and the W phase were found in the solidification structure. The arrays of the W phases were found to form after homogenization. The AlCu phases with traces of Sc that formed during solidification suppose to be the precursor of the W phases, and then transform into the W phases by consuming the Sc atoms that fixed in the supersaturate solid solution. The formation of the W phase inhibits the precipitation of the Al{sub 3}Sc phase. A corresponding model of the W phase formation mechanism is proposed.

Lightweight hydrogen-storage material Mg0.65Sc0.35D2 studied with 2H and 2H–{45Sc} MAS NMR exchange spectroscopy

NARCIS (Netherlands)

Srinivasan, S.; Magusin, P.C.M.M.

2011-01-01

Using double-quantum 2H MAS NMR with 45Sc recoupling and Bloch–Siegert compensated 2H–{45Sc} TRAPDOR we have identified the overlapping NMR signals of deuterium with and without scandium neighbors in Mg0.65Sc0.35D2, a candidate lightweight material for hydrogen storage. At room temperature we also

Role of cell death in the propagation of PrP(Sc) in immune cells.

Science.gov (United States)

Takahashi, Kenichi; Inoshima, Yasuo; Ishiguro, Naotaka

2015-03-01

A number of studies have suggested that macrophages, dendritic cells, and follicular dendritic cells play an important role in the propagation of PrP(Sc). Both accumulation and proteolysis of PrP(Sc) have been demonstrated in peripheral macrophages. Macrophages may act as reservoirs for PrP(Sc) particles if the cells die during transient PrP(Sc) propagation. However, whether cell death plays a role in PrP(Sc) propagation in macrophages remains unclear. In this study, we investigated the possibility of propagation and transmission of PrP(Sc) between dead immune cells and living neural cells. We found that under specific conditions, transient PrP(Sc) propagation occurs in dead cells, indicating that interaction between PrP(C) and PrP(Sc) on plasma membrane lipid rafts might be important for PrP(Sc) propagation. Co-culturing of killed donor PrP(Sc)-infected macrophages with recipient N2a-3 neuroblastoma cells accelerated PrP(Sc) transmission. Our results suggest that cell death may play an important role in PrP(Sc) propagation, whereas transient PrP(Sc) propagation in macrophages has little effect on PrP(Sc) transmission.

CERN Technical Training 2004: New Short Courses (SC) on Microsoft Outlook

CERN Multimedia

Monique Duval

2004-01-01

The CERN Technical Training programme is now proposing a new format for courses on Microsoft Outlook. Three two-hours Short Courses (SC) will cover basic and advanced functionalities of the recommended mail client for email at CERN. Each module can be followed independently. The next scheduled sessions will take place as follows: Outlook (SC I): E-mail. Next session: 22.10.2004 (9h00-11h00) Outlook (SC II): Calendar, Tasks and Notes. Next session: 22.10.2004 (14h00-16h00) Outlook (SC III): Meetings and Delegation. Next session: 9.11.2004 (14h00-16h00) In particular, SC I will cover how to open, create and send email, work with attachments, use stationery, organise mail, and work with the address book, SC II will show how to work with the calendar, tasks and notes, and SC III will cover how to organise and manage meetings, work with meeting requests, share tasks, and use email and calendar delegation. The number of participants to each session is limited to 8. The instructor is English-French bilingual, and...

Electrochemical Characterization of Ni/(Sc)YSZ Electrodes

DEFF Research Database (Denmark)

Ramos, Tania; Thydén, Karl Tor Sune; Mogensen, Mogens Bjerg

2010-01-01

Investigations of Ni/(Sc)YSZ cermets for solid oxide cells (SOCs) were performed by electrochemical impedance spectroscopy (EIS), under varying experimental conditions and upon redox cycling, using three different designs of symmetric cells. The deconvolution and fitting of the obtained impedance...... parameters. Initial degradation results for both Ni/ScYSZ and Ni/YSZ based anodes under very high steam content are also reported. ©2010 COPYRIGHT ECS - The Electrochemical Society...

One-Step Partially Purified Lipases (ScLipA and ScLipB from Schizophyllum commune UTARA1 Obtained via Solid State Fermentation and Their Applications

Directory of Open Access Journals (Sweden)

Yew Chee Kam

2017-12-01

Full Text Available Lipases with unique characteristics are of value in industrial applications, especially those targeting cost-effectiveness and less downstream processes. The aims of this research were to: (i optimize the fermentation parameters via solid state fermentation (SSF; and (ii study the performance in hydrolysis and esterification processes of the one-step partially purified Schizophyllum commune UTARA1 lipases. Lipase was produced by cultivating S. commune UTARA1 on sugarcane bagasse (SB with used cooking oil (UCO via SSF and its production was optimized using Design-Expert® 7.0.0. Fractions 30% (ScLipA and 70% (ScLipB which contained high lipase activity were obtained by stepwise (NH42SO4 precipitation. Crude fish oil, coconut oil and butter were used to investigate the lipase hydrolysis capabilities by a free glycerol assay. Results showed that ScLipA has affinities for long, medium and short chain triglycerides, as all the oils investigated were degraded, whereas ScLipB has affinities for long chain triglycerides as it only degrades crude fish oil. During esterification, ScLipA was able to synthesize trilaurin and triacetin. Conversely, ScLipB was specific towards the formation of 2-mono-olein and triacetin. From the results obtained, it was determined that ScLipA and ScLipB are sn-2 regioselective lipases. Hence, the one-step partial purification strategy proved to be feasible for partial purification of S. commune UTARA1 lipases that has potential use in industrial applications.

Baculovirus display of single chain antibody (scFv using a novel signal peptide

Directory of Open Access Journals (Sweden)

Gonzalez Gaëlle

2010-11-01

Full Text Available Abstract Background Cells permissive to virus can become refractory to viral replication upon intracellular expression of single chain fragment variable (scFv antibodies directed towards viral structural or regulatory proteins, or virus-coded enzymes. For example, an intrabody derived from MH-SVM33, a monoclonal antibody against a conserved C-terminal epitope of the HIV-1 matrix protein (MAp17, was found to exert an inhibitory effect on HIV-1 replication. Results Two versions of MH-SVM33-derived scFv were constructed in recombinant baculoviruses (BVs and expressed in BV-infected Sf9 cells, N-myristoylation-competent scFvG2/p17 and N-myristoylation-incompetent scFvE2/p17 protein, both carrying a C-terminal HA tag. ScFvG2/p17 expression resulted in an insoluble, membrane-associated protein, whereas scFvE2/p17 was recovered in both soluble and membrane-incorporated forms. When coexpressed with the HIV-1 Pr55Gag precursor, scFvG2/p17 and scFvE2/p17 did not show any detectable negative effect on virus-like particle (VLP assembly and egress, and both failed to be encapsidated in VLP. However, soluble scFvE2/p17 isolated from Sf9 cell lysates was capable of binding to its specific antigen, in the form of a synthetic p17 peptide or as Gag polyprotein-embedded epitope. Significant amounts of scFvE2/p17 were released in the extracellular medium of BV-infected cells in high-molecular weight, pelletable form. This particulate form corresponded to BV particles displaying scFvE2/p17 molecules, inserted into the BV envelope via the scFv N-terminal region. The BV-displayed scFvE2/p17 molecules were found to be immunologically functional, as they reacted with the C-terminal epitope of MAp17. Fusion of the N-terminal 18 amino acid residues from the scFvE2/p17 sequence (N18E2 to another scFv recognizing CD147 (scFv-M6-1B9 conferred the property of BV-display to the resulting chimeric scFv-N18E2/M6. Conclusion Expression of scFvE2/p17 in insect cells using a BV

Laser photoelectron spectrometry of Sc- and Y-

International Nuclear Information System (INIS)

Feigerle, C.S.; Herman, Z.; Lineberger, W.C.

1981-01-01

The photoelectron spectra of Sc - and Y - have been obtained in a crossed ion- and laser-beam experiment. Analysis of the Sc - spectrum yields two bound terms of 3d4s 2 4p configuration ( 1 D 0 and 3 D 0 ), with EA(Sc) = 0.189 +- 0.020 eV and an excited-state binding energy of 0.042 +- 0.020 eV. Similarly, the (4d5s 2 5p) 1 D 0 ground state of Y - is bound by 0.308 +- 0.012 eV and a (4d5s 2 5p) 3 D 0 excited term is bound by 0.165 +- 0.025 eV. With the determination of the bound electronic configuration of Sc - as 3d4s 2 4p, the order of filling of electron shells of the first transition series negative ions is found to be 4s 2 ep, 3d4s 2 4p, the order of filling of electron shells of the first transition series negative ions is found to be 4s 2 4p, 3d4s 2 4p, followed by 3dsup(k) 4s 2 (k = 3, 4, ..., 10). (orig.)

The SC gets ready for visitors

CERN Multimedia

Antonella Del Rosso

2012-01-01

Hall 300, which houses the Synchrocyclotron (SC), CERN’s first accelerator, is getting ready to host a brand-new exhibition. The site will be one of the stops on the new visit itineraries that will be inaugurated for the 2013 CERN Open Day.   The Synchrocyclotron through the years. Just as it did in the late 1950s, when the accelerator was first installed, the gigantic red structure of the Synchrocyclotron's magnet occupies a large part of the 300-square-metre hall. “We have completed the first phase of the project that will give the SC a new lease of life,” says Marco Silari, the project leader and a member of CERN’s Radiation Protection Group. “We have removed all the equipment that was not an integral part of the accelerator. The hall is now ready for the civil-engineering work that will precede the installation of the exhibition.” The SC was witness to a big part of the history of CERN. The accelerator produced ...

CERN Technical Training 2004: New Short Courses (SC) on Microsoft Outlook

CERN Multimedia

Monique Duval

2004-01-01

The CERN Technical Training programme is now proposing a new format for courses on Microsoft Outlook. Three two-hours Short Courses (SC) will cover basic and advanced functionalities of the recommended mail client for email at CERN. Each module can be followed independently. The next scheduled sessions will take place as follows: Outlook (SC I): E-mail. Next session: 31.8.2004 (9h00-11h00) Outlook (SC II): Calendar, Tasks and Notes. Next session: 31.8.2004 (14h00-16h00) Outlook (SC III): Meetings and Delegation. Next session: 7.9.2004 (14h00-16h00) In particular, SC I will cover how to open, create and send email, work with attachments, use stationery, organise mail, and work with the address book, SC II will show how to work with the calendar, tasks and notes, and SC III will cover how to organise and manage meetings, work with meeting requests, share tasks, and use email and calendar delegation. The number of participants to each session is limited to 8. The instructor is English-French bilingual, and she...

Aldehyde dehydrogenase 1 is a marker for normal and malignant human colonic stem cells (SC) and tracks SC overpopulation during colon tumorigenesis.

Science.gov (United States)

Huang, Emina H; Hynes, Mark J; Zhang, Tao; Ginestier, Christophe; Dontu, Gabriela; Appelman, Henry; Fields, Jeremy Z; Wicha, Max S; Boman, Bruce M

2009-04-15

Although the concept that cancers originate from stem cells (SC) is becoming scientifically accepted, mechanisms by which SC contribute to tumor initiation and progression are largely unknown. For colorectal cancer (CRC), investigation of this problem has been hindered by a paucity of specific markers for identification and isolation of SC from normal and malignant colon. Accordingly, aldehyde dehydrogenase 1 (ALDH1) was investigated as a possible marker for identifying colonic SC and for tracking them during cancer progression. Immunostaining showed that ALDH1(+) cells are sparse and limited to the normal crypt bottom, where SCs reside. During progression from normal epithelium to mutant (APC) epithelium to adenoma, ALDH1(+) cells increased in number and became distributed farther up the crypt. CD133(+) and CD44(+) cells, which are more numerous and broadly distributed in normal crypts, showed similar changes during tumorigenesis. Flow cytometric isolation of cancer cells based on enzymatic activity of ALDH (Aldefluor assay) and implantation of these cells in nonobese diabetic-severe combined immunodeficient mice (a) generated xenograft tumors (Aldefluor(-) cells did not), (b) generated them after implanting as few as 25 cells, and (c) generated them dose dependently. Further isolation of cancer cells using a second marker (CD44(+) or CD133(+) serially) only modestly increased enrichment based on tumor-initiating ability. Thus, ALDH1 seems to be a specific marker for identifying, isolating, and tracking human colonic SC during CRC development. These findings also support our original hypothesis, derived previously from mathematical modeling of crypt dynamics, that progressive colonic SC overpopulation occurs during colon tumorigenesis and drives CRC development.

Polymorphous GdScO3 as high permittivity dielectric

International Nuclear Information System (INIS)

Schäfer, A.; Rahmanizadeh, K.; Bihlmayer, G.; Luysberg, M.; Wendt, F.; Besmehn, A.; Fox, A.

2015-01-01

Four different polymorphs of GdScO 3 are assessed theoretically and experimentally with respect to their suitability as a dielectric. The calculations carried out by density functional theory reveal lattice constants, band gaps and the energies of formation of three crystal phases. Experimentally all three crystal phases and the amorphous phase can be realized as thin films by pulsed laser deposition using various growth templates. Their respective crystal structures are confirmed by X-ray diffraction and transmission electron microscopy reflecting the calculated lattice constants. X-ray photoelectron spectroscopy unveils the band gaps of the different polymorphs of GdScO 3 which are above 5 eV for all films demonstrating good insulating properties. From capacitance voltage measurements, high permittivities of up to 27 for hexagonal GdScO 3 are deduced. - Highlights: • Different epitaxial polymorph phases of GdScO 3 were grown by pulsed laser deposition. • The cubic phase of GdScO 3 is reported for the first time. • All phases are proven to be useful for the use in silicon based and III–V based microelectronic devices.

Piezoelectric coefficients and spontaneous polarization of ScAlN

International Nuclear Information System (INIS)

Caro, Miguel A; Laurila, Tomi; Zhang, Siyuan; Moram, Michelle A; Riekkinen, Tommi; Ylilammi, Markku; Molarius, Jyrki; Lopez-Acevedo, Olga

2015-01-01

We present a computational study of spontaneous polarization and piezoelectricity in Sc x Al 1−x N alloys in the compositional range from x = 0 to x = 0.5, obtained in the context of density functional theory and the Berry-phase theory of electric polarization using large periodic supercells. We report composition-dependent values of piezoelectric coefficients e ij , piezoelectric moduli d ij and elastic constants C ij . The theoretical findings are complemented with experimental measurement of e 33 for a series of sputtered ScAlN films carried out with a piezoelectric resonator. The rapid increase with Sc content of the piezoelectric response reported in previous studies is confirmed for the available data. A detailed description of the full methodology required to calculate the piezoelectric properties of ScAlN, with application to other complex alloys, is presented. In particular, we find that the large amount of internal strain present in ScAlN and its intricate relation with electric polarization make configurational sampling and the use of large supercells at different compositions necessary in order to accurately derive the piezoelectric response of the material. (paper)

The SC15 protein of Schizophyllum commune mediates formation of aerial hyphae and attachment in the absence of the SC3 hydrophobin

NARCIS (Netherlands)

Lugones, L G; de Jong, J F; de Vries, O M H; Jalving, R; Dijksterhuis, J; Wösten, H A B

Disruption of the SC3 gene in the basidiomycete Schizophyllum commune affected not only formation of aerial hyphae but also attachment to hydrophobic surfaces. However, these processes were not completely abolished, indicating involvement of other molecules. We here show that the SC15 protein

FRACTIONAL RECRYSTALLIZATION KINETICS IN DIRECTLY COLD ROLLED Al-Mg, Al-Mg-Sc AND Al-Mg-Sc-Zr ALLOY

Directory of Open Access Journals (Sweden)

M. S. Kaiser

2014-12-01

Full Text Available The evaluation of texture as a function of recrystallization has been characterized for directly cold rolled Al-6Mg, Al-6Mg-0.4Sc and Al-6Mg-0.4Sc-0.2Zr alloys. Samples were annealed isothermally at 400 °C for 1 to 240 minutes to allow recrystallization. Recrystallization kinetics of the alloys is analyzed from the micro-hardness variation. Isothermally annealed samples of aluminum alloys were also studied using JMAK type analysis to see if there exists any correlation between the methods. Recrystallization fraction behavior between two methods the scandium added alloys show the higher variation due to precipitation hardening and higher recrystallization behavior. The scandium and zirconium as a combined shows the more variation due to formation of Al3(Sc, Zr precipitate. From the microstructure it is also observed that the base Al-Mg alloy attained almost fully re-crystallized state after annealing at 400 °C for 60 minutes

Phase separation in Al-Zr-Sc alloys: from atomic jumps to ordered precipitates growth; Separation de phase dans les alliages Al-Zr-Sc: du saut des atomes a la croissance de precipites ordonnes

Energy Technology Data Exchange (ETDEWEB)

Clouet, E

2004-07-01

Zirconium and scandium addition to aluminium alloys leads to the formation of ordered precipitates. This study aims to a better understanding of precipitation kinetics thanks to an approach combining atomic and mesoscopic models. An experimental work has been undertaken too so as to characterize by transmission electron microscopy Al{sub 3}Zr kinetics of precipitation. We mainly focus on the nucleation stage and, in this purpose, an atomic model lying on a rigid lattice has been built for Al-Zr-Sc system allowing us to study precipitation with kinetic Monte Carlo simulations. While keeping the vacancy exchange mechanism for diffusion, we introduce multi-site interactions going thus beyond a simple pair interaction model, and test the influence of these interactions on kinetics of precipitation. The comparison between Monte Carlo simulations and classical nucleation theory shows that mesoscopic models can lead to a good description of the nucleation stage of Al{sub 3}Zr and Al{sub 3}Sc as long as the order tendency of the system has been taken into account to calculate input parameters of these models. For the ternary Al-Zr-Sc system, atomic simulations allow a better understanding of the precipitation kinetic path. It is then possible to extend the field of classical nucleation theory so as to model nucleation in a ternary alloy where the stoichiometry of the precipitates is unknown. (author)

Creep properties and precipitate evolution in Al-Li alloys microalloyed with Sc and Yb

Energy Technology Data Exchange (ETDEWEB)

Krug, Matthew E. [Department of Materials Science and Engineering, Northwestern University, 2220 Campus Drive, Evanston, IL 60208 (United States); Seidman, David N. [Department of Materials Science and Engineering, Northwestern University, 2220 Campus Drive, Evanston, IL 60208 (United States); Northwestern Center for Atom Probe Tomography, Northwestern University, 2220 Campus Drive, Evanston, IL 60208 (United States); Dunand, David C., E-mail: dunand@northwestern.edu [Department of Materials Science and Engineering, Northwestern University, 2220 Campus Drive, Evanston, IL 60208 (United States)

2012-07-30

Highlights: Black-Right-Pointing-Pointer We examine the creep behavior of Al-alloys with Li and rare earth element additions. Black-Right-Pointing-Pointer These alloys exhibit threshold stresses below which no measurable creep occurs. Black-Right-Pointing-Pointer Larger precipitate size and lattice parameter mismatch increase creep resistance. Black-Right-Pointing-Pointer A simple parameter describes the threshold stress behavior in ternary Al-Sc-X alloys. Black-Right-Pointing-Pointer The findings are explained by a recent model of dislocation-precipitate interactions. - Abstract: A dilute Al-Sc alloy (Al-0.12 Sc, at.%, Al-Sc), its counterpart with a Li addition (Al-2.9 Li-0.11 Sc, at.%, Al-Li-Sc), as well as a quaternary alloy (Al-5.53 Li-0.048 Sc-0.009 Yb, at.%, Al-Li-Sc-Yb) were isothermally aged at 325 Degree-Sign C, and in some cases isochronally aged to 450 Degree-Sign C. As the {alpha} Prime -Al{sub 3}(Li,Sc) and Al{sub 3}(Li,Sc,Yb) precipitates, with L1{sub 2} structure, coarsen in the two Li-containing alloys, their Li and Yb concentrations decrease and their Sc concentration increases. A significant interfacial excess of Li also segregates at the {alpha}-Al matrix/{alpha} Prime -Al{sub 3}Sc(Li,Sc,Yb) precipitate interface: 5.99 {+-} 0.05 atoms nm{sup -2} in Al-Li-Sc and 13.2 {+-} 0.4 atoms nm{sup -2} in Al-Li-Sc-Yb after aging isochronally to 450 Degree-Sign C. During compression creep at 300 Degree-Sign C, the aged alloys exhibit threshold stresses between 8 and 22 MPa. A recent threshold stress model based on elastic interactions between dislocations and precipitates predicts correctly that Li additions in the Al-Li-Sc alloy reduce the threshold stress, while Yb in the Al-Li-Sc-Yb alloy increases it. The model is also in agreement with the threshold stresses of all Al-Sc-X alloys published to date.

NCBI nr-aa BLAST: CBRC-GACU-03-0029 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GACU-03-0029 ref|XP_001216777.1| conserved hypothetical protein [Aspergillus terre...us NIH2624] gb|EAU31329.1| conserved hypothetical protein [Aspergillus terreus NIH2624] XP_001216777.1 3.1 39% ...

Local Impact Simulation of SC Wall Structures using Aircraft Engine Projectile

International Nuclear Information System (INIS)

Chung, Chulhun; Lee, Jungwhee; Lee, Hanjoo; Jung, Raeyoung; Hyun, Changhun

2013-01-01

SC wall structure developed for nuclear power plant buildings consists of plain concrete and two steel plates on both surface of the concrete, while RC structure consists of re bar and concrete. SC structure has higher scabbing resistance than RC structure due to the action of steel plate on the rear side of impact. Therefore SC structure is known as more effective structure from the viewpoint of aircraft crash than RC structure. However, most of the recent researches and experiments about local impact damage deal with RC structures, and the effect of re bar and steel plate is not considered reasonably. Although Walter et al. and Make-work et al. suggested a formula for evaluating perforation depth of steel plate covered RC walls, most of the previous researches about SC structure are focused on perforation and scabbing due to the impact of hard projectile, rather than soft projectile such as an aircraft. In this research a soft projectile, i. e. aircraft engine, is utilized for impact simulation of RC and SC walls. To evaluate local damage of SC wall structures, parametric study with the variables of wall thickness and steel ratio of the cover plate is performed, and the results are compared with those of RC structures. Since scabbing was prevented by the steel plates, penetration mode of damage was observed in SC walls while scabbing damage was occurred in RC walls. It is confirmed that the rear steel plate not only contains concrete debris, but also reduces the internal damage of the concrete walls. Penetration depth of SC walls did not largely vary due to the increasing steel ratio, and similar results to RC walls were observed when the wall thickness is larger than a certain value since the impact resistance of SC wall is mainly governed by the thickness of concrete part. Therefore, it is expected that similar level of impact resistance to RC structure can be produced with the minimum thickness of steel plates of SC structure. According to these results, SC

Radiolabeling of DOTATOC with the long-lived positron emitter {sup 44}Sc

Energy Technology Data Exchange (ETDEWEB)

Pruszynski, Marek; Majkowska-Pilip, Agnieszka [Centre of Radiochemistry and Nuclear Chemistry, Institute of Nuclear Chemistry and Technology, Dorodna 16, 03-195 Warszawa (Poland); Loktionova, Natalia S.; Eppard, Elisabeth [Institute of Nuclear Chemistry, Johannes Gutenberg-University of Mainz, Fritz-Strassmann-Weg 2, D-55128 Mainz (Germany); Roesch, Frank, E-mail: frank.roesch@uni-mainz.de [Institute of Nuclear Chemistry, Johannes Gutenberg-University of Mainz, Fritz-Strassmann-Weg 2, D-55128 Mainz (Germany)

2012-06-15

The positron-emitting radionuclide {sup 44}Sc with a half-life of 3.97 h and a {beta}{sup +} branching of 94.3% is of potential interest for clinical PET. As so far it is available from a {sup 44}Ti/{sup 44}Sc generator in Mainz, where long-lived {sup 44}Ti decays to no-carrier-added (nca) {sup 44}Sc. The {sup 44}Sc is a trivalent metal cation and should be suitable for complexation with many well established bifunctional chelators conjugated to peptides or other molecular targeting vectors. Thus, the aim of this work was to investigate the potential of {sup 44}Sc for labeling of DOTA-conjugated peptides. DOTA-D-Phe{sup 1}-Tyr{sup 3}-octreotide (DOTATOC) was used as a model molecule to study and optimize labeling procedure. Reaction parameters such as buffer conditions, concentration of peptide, pH range, reaction temperature and time were optimized. Addition of 21 nmol of DOTATOC to {sup 44}Sc in ammonium acetate buffer pH 4.0 provided labeling yields >98% within 25 min of heating in an oil-bath at 95 Degree-Sign C. This time can be reduced to 3 min only by applying microwave supported heating. {sup 44}Sc-DOTATOC was found to be stable in 0.9% NaCl, PBS pH 7.4, fetal calf and human serums, and also in the presence of competing metal cations (Fe{sup 3+}, Ca{sup 2+}, Cu{sup 2+}, Mg{sup 2+}), as well as other ligand competitors, like EDTA and DTPA, even after almost 25 h incubation at 37 Degree-Sign C. Present study shows that nca {sup 44}Sc forms stable complexes with the macrocyclic ligand DOTA and that {sup 44}Sc-DOTATOC and analog targeting vectors may be synthesized for further preclinical and clinical investigations. - Highlights: Black-Right-Pointing-Pointer Labeling of somatostatin analouges with positron emitter {sup 44}Sc was tested. Black-Right-Pointing-Pointer DOTATOC was labeled with {sup 44}Sc isotope. Black-Right-Pointing-Pointer Optimal conditions for {sup 44}Sc-DOTATOC synthesis were found. Black-Right-Pointing-Pointer Stability of {sup 44}Sc

Efficacy of Subcutaneous Morphine Patient Controlled Analgesia Compared to Intravenous Morphine Patient Controlled Analgesia on Cesarean Section

Directory of Open Access Journals (Sweden)

Made Wiryana

2017-09-01

Result: Morphine consumption in IV-PCA group showed lower needs than SC-PCA (9.41 mg vs 4,9mg p <0.001 24 at 24 hours postoperatively. The VAS at resting at 4th hours statistically significantly lower in IV-PCA group (1.06 ± 0.71 vs 0.81 ± 1.40, p=0.029 and at 8th hours (1.03 ± 0.59 vs 0.94 ± 0,9, p=0.048. The moving VAS at 4th hours statistically significant lower in IV-PCA group (2.31 ± 0.47 vs 1.45 ± 2.06, p=0.019 but the static or VAS at moving are not different clinically. Side effects of nausea and vomiting are more common in IV-PCA group. We conclude that SC-PCA provide analgesia more effective and decreases side effects in patients undergo sectio cesarea with spinal anesthesia.

NCBI nr-aa BLAST: CBRC-DDIS-03-0039 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DDIS-03-0039 ref|XP_001209647.1| conserved hypothetical protein [Aspergillus terre...us NIH2624] gb|EAU32345.1| conserved hypothetical protein [Aspergillus terreus NIH2624] XP_001209647.1 2e-30 37% ...

NCBI nr-aa BLAST: CBRC-DDIS-03-0055 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DDIS-03-0055 ref|XP_001211162.1| conserved hypothetical protein [Aspergillus terre...us NIH2624] gb|EAU36946.1| conserved hypothetical protein [Aspergillus terreus NIH2624] XP_001211162.1 1e-10 22% ...

Gadolinium scandium germanide, Gd2Sc3Ge4

Directory of Open Access Journals (Sweden)

Sumohan Misra

2009-04-01

Full Text Available Gd2Sc3Ge4 adopts the orthorhombic Pu5Rh4-type structure. The crystal structure contains six sites in the asymmetric unit: two sites are statistically occupied by rare-earth atoms with Gd:Sc ratios of 0.967 (4:0.033 (4 and 0.031 (3:0.969 (3, one site (.m. symmetry is occupied by Sc atoms, and three distinct sites (two of which with .m. symmetry are occupied by Ge atoms. The rare-earth atoms form two-dimensional slabs with Ge atoms occupying the trigonal-prismatic voids.

Effect of AlN growth temperature on trap densities of in-situ metal-organic chemical vapor deposition grown AlN/AlGaN/GaN metal-insulator-semiconductor heterostructure field-effect transistors

Directory of Open Access Journals (Sweden)

Joseph J. Freedsman

2012-06-01

Full Text Available The trapping properties of in-situ metal-organic chemical vapor deposition (MOCVD grown AlN/AlGaN/GaN metal-insulator-semiconductor heterostructure field-effect transistors (MIS-HFETs with AlN layers grown at 600 and 700 °C has been quantitatively analyzed by frequency dependent parallel conductance technique. Both the devices exhibited two kinds of traps densities, due to AlN (DT-AlN and AlGaN layers (DT-AlGaN respectively. The MIS-HFET grown at 600 °C showed a minimum DT-AlN and DT-AlGaN of 1.1 x 1011 and 1.2 x 1010 cm-2eV-1 at energy levels (ET -0.47 and -0.36 eV. Further, the gate-lag measurements on these devices revealed less degradation ∼ ≤ 5% in drain current density (Ids-max. Meanwhile, MIS-HFET grown at 700 °C had more degradation in Ids-max ∼26 %, due to high DT-AlN and DT-AlGaN of 3.4 x 1012 and 5 x 1011 cm-2eV-1 positioned around similar ET. The results shows MIS-HFET grown at 600 °C had better device characteristics with trap densities one order of magnitude lower than MIS-HFET grown at 700 °C.

Monitor of SC beam profiles

CERN Document Server

CERN PhotoLab

1977-01-01

A high-resolution secondary emission grid for the measurement of SC beam profiles. Modern techniques of metal-ceramic bonding, developed for micro-electronics, have been used in its construction. (See Annual Report 1977 p. 105 Fig. 12.)

Performance Analysis of OFDM 60GHz System and SC-FDE 60GHz System

Directory of Open Access Journals (Sweden)

Han Xueyan

2016-01-01

Full Text Available In this paper, the performance of 60GHz wireless communication system with SC and OFDM is studied, the models of OFDM 60GHz system and SC 60GHz frequency domain equalization (SC-FDE system are established, and the bit error rate (BER performance of OFDM 60GHz system and SC-FDE 60GHz system in 802.15.3c channels is compared. The simulation results show that SC-FDE 60GHz system has a slight advantage over OFDM system in line-of-sight (LOS channels, while OFDM 60GHz system has a slight advantage over SC-FDE system in non-line-of-sight (NLOS channels. For 60GHz system, OFDM 60GHz system has a slight advantage over SC-FDE system in overcoming multipath fading, but the performance of both is close whether in the LOS or NLOS case.

PEMODELAN KONDUKTIVITAS ION DALAM STRUKTUR Li2Sc3(PO43 (Modeling Ionic Conductivity in Li2Sc3(PO43 Structure

Directory of Open Access Journals (Sweden)

Akram La Kilo

2011-11-01

Full Text Available ABSTRAK Fasa Li2Sc3(PO43 merupakan material konduktor superionik yang dapat diaplikasikan sebagai baterai yang dapat diisi ulang (rechargeable. Ion Li+ dalam struktur Li2Sc3(PO4 dapat mengalami migrasi dari posisi terisi ke posisi kosong. Penelitian ini telah memodelkan migrasi ion Li+ dalam struktur Li2Sc3(PO4 dengan menggunakan metode bond valence sum (BVS. Metode ini dapat memprediksi bilangan oksidasi suatu atom berdasarkan jarak dengan atom-atom tetangga. Source code berbasis BVS yang digunakan adalah JUMPITER yang mensimulasi efek gaya listrik eksternal yang bertindak pada ion litium sehingga nilai BVS litium dapat dipetakan terhadap jarak. Hasil simulasi menunjukkan bahwa konduksi ion Li+ dapat terjadi pada arah [010], [101], dan [120]. Namun, lintasan konduksi ion Li+ lebih mudah terjadi pada arah [120] atau bidang ab dengan nilai maksimum BVS adalah 0,982. ABSTRACT g-phase of Li2Sc3(PO43 is a lithium super ionic conductor which can be applied as a rechargeable lithium battery. Lithium ions of g-Li2Sc3(PO43 can migrate from occupied site to vacant site. In this research, simulation of Li+ ions migration in the structure of g-Li2Sc3(PO43 carried out using bond valence sum (BVS to predict the oxidation state of Li+ion based on the distance of the ion to neighboring atoms. BVS-based code used JUMPITER to simulate the effect of external electrical force acting on the lithium ions to produce the lithium BVS value which can be mapped to the distance. The simulation results shows that Li+ ion conduction can be occurred on [010], [101], and [120] directions. However, the Li ion conduction pathway occur more easily in the direction of [120] or ab plane with the BVS maximum value is 0.982.

File list: Unc.PSC.50.AllAg.EpiSC [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available Unc.PSC.50.AllAg.EpiSC mm9 Unclassified Pluripotent stem cell EpiSC SRX1074917,SRX1...074905,SRX1074908 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.PSC.50.AllAg.EpiSC.bed ...

File list: Unc.PSC.05.AllAg.EpiSC [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available Unc.PSC.05.AllAg.EpiSC mm9 Unclassified Pluripotent stem cell EpiSC SRX1074917,SRX1...074908,SRX1074905 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.PSC.05.AllAg.EpiSC.bed ...

File list: Unc.PSC.20.AllAg.EpiSC [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available Unc.PSC.20.AllAg.EpiSC mm9 Unclassified Pluripotent stem cell EpiSC SRX1074917,SRX1...074908,SRX1074905 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.PSC.20.AllAg.EpiSC.bed ...

NOAA TIFF Image - 3 m Backscatter Mosaic of the north shore of St. Croix, U.S. Virgin Islands, Project NF-06-03, 2006, UTM 20 WGS84

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 3 meter resolution backscatter mosaic of the north shore of St. Croix, US Virgin Islands. NOAA's NOS/NCCOS/CCMA Biogeography Team, in...

Phase relationship in AL-Cu-Sc alloys at 450-500 deg C

International Nuclear Information System (INIS)

Kharakterova, M.L.

1991-01-01

Al-Cu-Sc alloys containing up to 40% Cu and up to 6% Sc at 450 deg C and 500 deg C are studied using light microscopy, X-ray-spectral microanalysis, X-ray diffraction analysis, scanning electron microscopy, measurement of microhardness and electric resistance. It is determined, that in equilibrium with aluminium solid solution under the given temperature ther are Al 3 Sc, CuAl 2 phases of the respective binary systems and W (ScCu 6.6-4 Al 5.4-8 ) ternary phase. Isothermal cross sections of Al-Cu-Sc system at 450 and 500 deg C are plotted. Microhardness of equilibrium phases is measured. Combined solubility of copper and scandium in aluminium is determined

Effect of Sc addition on microstructure and mechanical properties of 1460 alloy

Directory of Open Access Journals (Sweden)

Juan Ma

2014-02-01

Full Text Available The effect of minor addition of Sc on microstructure, age hardening behavior, tensile properties and fracture morphology of 1460 alloy have been studied. It is found that Sc content increase from 0.11 wt% to 0.22 wt% is favorable for grain refinement in as-cast alloy but results in a coarsening of Cu-rich particles. The alloy with 0.11 wt% Sc exhibits enhanced mechanical properties and age hardening effect. Transmission electron microscopy (TEM investigations on the alloy with 0.11 wt% Sc have suggested that a large amount of Al3(Sc, Zr particles precipitated at the earlier aging may inhibit recrystallization effectively.

NOS TIFF Unified 3M Backscatter Mosaic, La Parguera, Puerto Rico and St. Croix 2006: of US Virgin Islands, Project NF-06-03, UTM 20 WGS84

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 3 meter resolution backscatter mosaic of the north shore of St. Croix, US Virgin Islands and southwest shore (La Parguera) of Puerto Rico....

[Roberts-SC phocomelia syndrome].

Science.gov (United States)

Musfeld, D A; Bühler, E M; Heinzl, S

2001-01-01

The Roberts-SC phocomelia syndrome is a rare autosomal recessive inherited disorder clinically manifested by tetraphocomelia, pre- and postnatal growth retardation, and craniofacial abnormalities (skull, eyes, lip, and palate), accompanied at times by centromer puffing and splitting, renal abnormalities, heart defect, clitoral or penile enlargement, and bilateral corneal opacities. Mental retardation is common in surviving patients.

Model of Dees and Rotco for the 600 MeV SC

CERN Multimedia

CERN PhotoLab

1978-01-01

The accelerating frequency of the 600 MeV Synchro-Cyclotron (SC) was modulated by the varying capacity of a rotating condenser ("Rotco", the most delicate component of the SC). A 1/5-scale model, dating from the design-period of the SC, was used to study improvements to the SC RF-system, and also the acceleration of ions, first Helium and, at the time of this picture, Carbon. In the middle of the picture is the case containing the Dees. To the left, at the wide end of the cone, a rotco. Reinhold Hohbach is busy with measurements. See also 7805235 (Annual Report 1978, p.110).

First coil for the SC

CERN Multimedia

CERN PhotoLab

1955-01-01

The coils for the SC magnet were stored in the large hangar of the Cointrin Airport (to make sure that they would be available before snow and ice would block the roads and canals from Belgium, where they were built).

Some peculiarities of ScFe2 and ScNi2 interaction with ammonia in the presence of NH4Cl

International Nuclear Information System (INIS)

Shilkin, S.P.; Fokin, V.N.; Fokina, Eh.Eh.; Tarasov, B.P.; Korobkov, I.I.

2000-01-01

Interaction of ScFe 2 and ScNi 2 intermetallic compounds with ammonia in the presence of NH 4 Cl (10 mass % from intermetallide introduced in reaction) as an activator of the process in initial ammonia pressure 0.6-0.8 MPa is investigated. Possibility of preparation of crystalline intermetallide hydrides and amorphous products in highly dispersed state at different temperature are shown. It is established that intermetallides decompose in ammonia medium at ≥ 450 Deg C [ru

Methods for production of UNK SC-dipoles magnetic measurements

International Nuclear Information System (INIS)

Smirnov, N.L.

1991-01-01

Many SC-dipoles for UNK will require from the chosen magnetic measurement methods high accuracy and efficiency. The brief of using methods, their possibilities and analysis of their errors are given. The measurements results for a full-scale model of SC-dipole SPDM1 are presented. 5 refs.; 4 figs.; 4 tabs

Study of the hyperfine magnetic field at Ta181 site in the Heusler Co2 Sc Sn, Co2 Sc Ga and Co2 Hf Sn alloys

International Nuclear Information System (INIS)

Attili, R.N.

1992-01-01

The hyperfine magnetic fields acting on 181 Ta nuclei at the Sc and Hf sites have been measured in Heusler alloys Co 2 Sc Sn and Co 2 Sc Ga and Co 2 Hf Sn using the Time Differential Perturbed γ-γ Angular Correlation (TDPAC) technique. The measurements were carried out using an automatic spectrometer consisting of two Ba F 2 detectors and the conventional electronics. The magnitude of hyperfine magnetic field at 181 Ta was measured for all the alloys. The signs of the were determined in the cases of Co 2 Sc Sn and Co 2 Hf Sn alloys by performing the Perturbed Angular Correlation measurements with an external polarizing magnetic field of ≅ 5 k Gauss. The hyperfine magnetic fields obtained are -187,6± 3,3 and 90,0 ± 2,1 kOe measured at 77 K for Co 2 Sc Sn and Co 2 Sc Ga alloys respectively, and -342,4 ± 10,1 kOe measured at the room temperature for Co 2 Hf Sn alloy. These results are discussed and compared with the hyperfine magnetic field systematics in Co-based Heusler alloy. (author)

Level densities and γ strength functions in light Sc and Ti isotopes

International Nuclear Information System (INIS)

Burger, A.; Larsen, A.C.; Syed, N.U.H.; Guttormsen, M.; Nyhus, H.; Siem, S.; Harissopulos, S.; Konstantinopoulos, T.; Lagoyannis, A.; Perdidakis, G.; Spyrou, A.; Kmiecik, M.; Mazurek, K.; Krticka, M.; Loennroth, T.; Norby, M.; Voinov, A.

2010-01-01

We present preliminary results from a measurement of nuclear level densities and the γ-ray strength of light Sc (Sc 43 , Sc 45 ) and Ti (Ti 44 , Ti 45 and Ti 46 ) isotopes using the Oslo Method. The article begins with a presentation of the experimental setup. (authors)

On the control parameters of the quasi-one dimensional superconductivity in Sc{sub 3}CoC{sub 4}

Energy Technology Data Exchange (ETDEWEB)

Eickerling, Georg; Hauf, Christoph; Scheidt, Ernst-Wilhelm; Reichardt, Lena; Schneider, Christian; Scherer, Wolfgang [Institut fuer Physik, Universitaet Augsburg, Universitaetstrasse 1, 86179 Augsburg (Germany); Munoz, Alfonso [Departamento de Fisica Fundamental II, Instituto de Materiales y Nanotecnologia, Universidad de La Laguna, Tenerife (Spain); Lopez-Moreno, Sinhue [Escuela Superior Cd. Sahagun, Universidad Autonoma del Estado de Hidalgo, Carretera Cd. Sahagun-Otumba s/n. 43990, Hidalgo (Mexico); Humberto Romero, Aldo [Physics Department, West Virginia University, Morgantown, West Virginia 26506-6315 (United States); Max Planck Institut fuer Mikrostruktur Physik, Weinberg 2, 06120 Halle (Germany); Porcher, Florence; Andre, Gilles [Laboratoire Leon Brillouin, UMR12 CEA-CNRS, Bat 563 CEA Saclay, 91191 Gif sur Yvette Cedex (France); Poettgen, Rainer [Institut fuer Anorganische und Analytische Chemie, Universitaet Muenster, Corrensstrasse 30, 48149 Muenster (Germany)

2013-09-15

Within the series of ternary rare-earth transition metal carbides Sc{sub 3}TC{sub 4} (T = Fe, Co, Ni) only the Co congener displays a structural phase transition at 72 K and an onset of bulk superconductivity at 4.5 K. In this paper we present the results of a detailed analysis of the structural, electronic, and vibrational properties of the low-temperature phase of Sc{sub 3}CoC{sub 4} that represents one of the few well-documented examples of a quasi one-dimensional (1D) superconductor. Variable temperature neutron powder diffraction and low temperature X-ray diffraction experiments were performed in order to confirm the subtle structural distortions during the phase transition. The results of periodic electronic structure calculations indicate, that the structural transition can clearly be identified as a Peierls-type distortion and by a comparison with the isostructural carbide Sc{sub 3}FeC{sub 4} we are able to identify the chemical, electronic, and the vibrational control parameters of the transition. Topological analyses of the electron density distribution and of the valence shell charge concentrations at the cobalt atom finally allow us to directly correlate the changes in the electronic structure due to the Peierls transition in reciprocal space with the according subtle changes in the real space properties of Sc{sub 3}CoC{sub 4}. (Copyright copyright 2013 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

The data acquisition system (DAS) for the improved CERN SC

CERN Document Server

Beger, H; Fiebig, A; Schroot, H

1975-01-01

A digital data acquisition system (DAS) based on a minicomputer is described which registers the failure sequences in various equipment areas of the CERN synchrocyclotron (henceforward referred to as the SC). The avalanches of failure signals which occur from time to time are tapped from the alarm/security systems, time-resolved to 10 msec and recorded on a printer in order to aid SC failure diagnosis. The mechanisms of the DAS and its relation to the SC equipment are explained in some detail. All programs were constructed at assembler language level for speed and for ease of on-line program maintenance. The alarm sequences recorded have been of considerable help during the running in of the new radiofrequency system. Now that the new SC is operational, the DAS furnishes useful data from several equipment areas to the operators and engineers.

An alternative method for determination of oscillator strengths: The example of Sc II

International Nuclear Information System (INIS)

Ruczkowski, J.; Elantkowska, M.; Dembczyński, J.

2014-01-01

We describe our method for determining oscillator strengths and hyperfine structure splittings that is an alternative to the commonly used, purely theoretical calculations, or to the semi-empirical approach combined with theoretically calculated transition integrals. We have developed our own computer programs that allow us to determine all attributes of the structure of complex atoms starting from the measured frequencies emitted by the atoms. As an example, we present the results of the calculation of the structure, electric dipole transitions, and hyperfine splittings of Sc II. The angular coefficients of the transition matrix in pure SL coupling were found from straightforward Racah algebra. The transition matrix was transformed into the actual intermediate coupling by the fine structure eigenvectors obtained from the semi-empirical approach. The transition integrals were treated as free parameters in the least squares fit to experimental gf values. For most transitions, the experimental and the calculated gf-values are consistent with the accuracy claimed in the NIST compilation. - Highlights: • The method of simultaneous determination of all the attributes of atomic structure. • The semi-empirical method of parameterization of oscillator strengths. • Illustration of the method application for the example of Sc II data

Toward low-cost affinity reagents: lyophilized yeast-scFv probes specific for pathogen antigens.

Directory of Open Access Journals (Sweden)

Sean A Gray

Full Text Available The generation of affinity reagents, usually monoclonal antibodies, remains a critical bottleneck in biomedical research and diagnostic test development. Recombinant antibody-like proteins such as scFv have yet to replace traditional monoclonal antibodies in antigen detection applications, in large part because of poor performance of scFv in solution. To address this limitation, we have developed assays that use whole yeast cells expressing scFv on their surfaces (yeast-scFv in place of soluble purified scFv or traditional monoclonal antibodies. In this study, a nonimmune library of human scFv displayed on the surfaces of yeast cells was screened for clones that bind to recombinant cyst proteins of Entamoeba histolytica, an enteric pathogen of humans. Selected yeast-scFv clones were stabilized by lyophilization and used in detection assay formats in which the yeast-scFv served as solid support-bound monoclonal antibodies. Specific binding of antigen to the yeast-scFv was detected by staining with rabbit polyclonal antibodies. In flow cytometry-based assays, lyophilized yeast-scFv reagents retained full binding activity and specificity for their cognate antigens after 4 weeks of storage at room temperature in the absence of desiccants or stabilizers. Because flow cytometry is not available to all potential assay users, an immunofluorescence assay was also developed that detects antigen with similar sensitivity and specificity. Antigen-specific whole-cell yeast-scFv reagents can be selected from nonimmune libraries in 2-3 weeks, produced in vast quantities, and packaged in lyophilized form for extended shelf life. Lyophilized yeast-scFv show promise as low cost, renewable alternatives to monoclonal antibodies for diagnosis and research.

Loading 076 assemblies in two IV-04 transport casks for transport to the U.S. Savannah River Site (SC); Trasferimento di 72 elementi irraggiati MTR dalla piscina dell`impianto EUREX a due contenitori IU-04 per il trasporto al Savannah River Site-Department of Energy (USA)

Energy Technology Data Exchange (ETDEWEB)

Gili, Michele [ENEA, Centro Ricerche Saluggia, Vercelli (Italy). Dipt. Energia

1997-09-01

The National Agency for New Technologies and the Environments has signed with the US Department of Energy a contract for the transfer of 150 irradiated MTR fuel assemblies stored in the EUREX plant pool at The National Agency for New Technologies and the Environments Research Centre of Saluggia. The first scheduled transport has been made in february 1997 and has involved the successful loading of 76 assemblies in two IU-04 (Pegase) transport casks. The loaded casks have been shipped to the U.S. Savannah River Site (SC).

Morphologies and growth mechanisms of the eutectic particles in as-cast Al-Mg-Sc alloy; Morphologien und Wachstumsmechanismen eutektischer Partikel in Al-Mg-Sc-Legierung im Gusszustand

Energy Technology Data Exchange (ETDEWEB)

Pan, Dejiang; Zhou, Shi' ang; Li, Heng [Hefei Univ. of Technology (China); Zhang, Zhen; Wu, Yucheng [Laboratories of Nonferrous Metal Material and Processing Engineering of Anhui Province, Hefei (China); Li, Ming [Anhui Jianghuai Automobile Co., Ltd, Hefei (China)

2017-04-15

Primary particles with faceted cubic morphology were produced in as-cast Al-Mg alloy due to the addition of Sc. The cross-section of the particles revealed some eutectic structure composed of multilayer of 'Al{sub 3}Sc + α-Al + Al{sub 3}Sc..'. At the cooling rate of 200 - 300 K/s, Al{sub 3}Sc primary phase nucleated initially on oxides within the melt and developed to a cubic structure with a 'cellular-dendritic' mode of growth. The formation of α-Al structural shells was attributed as a reason for the segregation of Mg-rich lamellar dendrites at later stages. A growth mechanism for multilayer structure was proposed using the results presented.

Bayesian narrowband interference mitigation in SC-FDMA

KAUST Repository

Ali, Anum; Masood, Mudassir; Al-Ghadhban, Samir; Al-Naffouri, Tareq Y.

2015-01-01

This paper presents a novel narrowband interference (NBI) mitigation scheme for SC-FDMA systems. The proposed scheme exploits the frequency domain sparsity of the unknown NBI signal and adopts a low complexity Bayesian sparse recovery procedure. In practice, however, the sparsity of the NBI is destroyed by a grid mismatch between NBI sources and SC-FDMA system. Towards this end, an accurate grid mismatch model is presented and a sparsifying transform is utilized to restore the sparsity of the unknown signal. Numerical results are presented that depict the suitability of the proposed scheme for NBI mitigation.

Bayesian narrowband interference mitigation in SC-FDMA

KAUST Repository

Ali, Anum

2015-08-12

This paper presents a novel narrowband interference (NBI) mitigation scheme for SC-FDMA systems. The proposed scheme exploits the frequency domain sparsity of the unknown NBI signal and adopts a low complexity Bayesian sparse recovery procedure. In practice, however, the sparsity of the NBI is destroyed by a grid mismatch between NBI sources and SC-FDMA system. Towards this end, an accurate grid mismatch model is presented and a sparsifying transform is utilized to restore the sparsity of the unknown signal. Numerical results are presented that depict the suitability of the proposed scheme for NBI mitigation.

Ternary scandium-rich indides Sc{sub 50}T{sub 13}In{sub 3} and Sc{sub 50}Rh{sub 13}In{sub 3}O{sub y} (T = Rh, Ir; y {approx} 8) - synthesis and crystal structure

Energy Technology Data Exchange (ETDEWEB)

Zaremba, R.; Poettgen, R. [Inst. fuer Anorganische und Analytische Chemie, Univ. Muenster (Germany)

2007-12-15

New intermetallic compounds Sc{sub 50}Rh{sub 13.3}In{sub 2.7} and Sc{sub 50}Ir{sub 13.6}In{sub 2.4} and the suboxides Sc{sub 49.2}Rh{sub 13}In{sub 3.8}O{sub 8.8} and Sc{sub 49.2}Rh{sub 13.7}In{sub 2.8}O{sub 8.0} were synthesized from the elements or with Sc{sub 2}O{sub 3} as an oxygen source, respectively, in sealed tantalum tubes in a water-cooled sample chamber of an induction furnace. They crystallize with a new cubic structure type, space group F m anti 3, a = 1772.5(6) pm, wR2 = 0.032, 1111 F{sup 2} values, 34 variables for Sc{sub 50}Rh{sub 13.3}In{sub 2.7}, a = 1766.5(6) pm, wR2 = 0.041, 745 F{sup 2} values, 34 variables for Sc{sub 50}Ir{sub 13.6}In{sub 2.4}, a = 1764.4(2) pm, wR2 = 0.044, 640 F{sup 2} values, 41 variables for Sc{sub 49.2}Rh{sub 13}In{sub 3.8}O{sub 8.8}, and a = 1761.5(6) pm, wR2 = 0.054, 740 F{sup 2} values, 42 variables for Sc{sub 49.2}Rh{sub 13.7}In{sub 2.8}O{sub 8.0}. The main structural motifs are rhodium-centered indium cubes in an fcc like arrangement in which the octahedral and tetrahedral voids are filled by In2Sc{sub 12} and In1Sc{sub 12} icosahedra, respectively, resembling a Li{sub 3}Bi-like structure. The Rh1 (Ir1) and Sc4 atoms lie between these polyhedral units. The oxygen atoms partially fill Sc{sub 6} octahedra in Sc{sub 49.2}Rh{sub 13}In{sub 3.8}O{sub 8.8} and Sc{sub 49.2}Rh{sub 13.7}In{sub 2.8}O{sub 8.0} with Sc-O distances of 214 - 230 pm. These octahedra are condensed via common edges and faces, encapsulating the In2Sc{sub 12} icosahedra. Due to the high scandium content one observes strong Sc-Sc bonding with Sc-Sc distances ranging from 303 to 362 pm in Sc{sub 49.2}Rh{sub 13}In{sub 3.8}O{sub 8.8}. The shortest distances occur for Sc-Rh (267 - 295 pm). The crystal chemical relationship with the Li{sub 3}Bi-related suboxide Ti{sub 12}Sn{sub 3}O{sub 10} is discussed. (orig.)

Static resistance function for steel-plate composite (SC) walls subject to impactive loading

International Nuclear Information System (INIS)

Bruhl, Jakob C.; Varma, Amit H.; Kim, Joo Min

2015-01-01

Highlights: • An idealized static resistance function for SC walls is proposed. • The influence of design parameters on static resistance is explained. • SDOF models can accurately estimate global response of SC walls to missile impact. - Abstract: Steel-plate composite (SC) walls consist of a plain concrete core reinforced with two steel faceplates on the surfaces. Modules (consisting of steel faceplates, shear connectors and tie-bars) can be shop-fabricated and shipped to the site for erection and concrete casting, which expedites construction schedule and thus economy. SC structures have recently been used in nuclear power plant designs and are being considered for the next generation of small modular reactors. Design for impactive and impulsive loading is an important consideration for SC walls in safety-related nuclear facilities. The authors have previously developed design methods to prevent local failure (perforation) of SC walls due to missile impact. This paper presents the development of static resistance functions for use in single-degree-of-freedom (SDOF) analyses to predict the maximum displacement response of SC walls subjected to missile impact and designed to resist local failure (perforation). The static resistance function for SC walls is developed using results of numerical analyses and parametric studies conducted using benchmarked 3D finite element (FE) models. The influence of various design parameters are discussed and used to develop idealized bilinear resistance functions for SC walls with fixed edges and simply supported edges. Results from dynamic non-linear FE analysis of SC panels subjected to rigid missile impact are compared with the maximum displacements predicted by SDOF analyses using the bilinear resistance function.

Static resistance function for steel-plate composite (SC) walls subject to impactive loading

Energy Technology Data Exchange (ETDEWEB)

Bruhl, Jakob C., E-mail: jbruhl@purdue.edu; Varma, Amit H., E-mail: ahvarma@purdue.edu; Kim, Joo Min, E-mail: kim1493@purdue.edu

2015-12-15

Highlights: • An idealized static resistance function for SC walls is proposed. • The influence of design parameters on static resistance is explained. • SDOF models can accurately estimate global response of SC walls to missile impact. - Abstract: Steel-plate composite (SC) walls consist of a plain concrete core reinforced with two steel faceplates on the surfaces. Modules (consisting of steel faceplates, shear connectors and tie-bars) can be shop-fabricated and shipped to the site for erection and concrete casting, which expedites construction schedule and thus economy. SC structures have recently been used in nuclear power plant designs and are being considered for the next generation of small modular reactors. Design for impactive and impulsive loading is an important consideration for SC walls in safety-related nuclear facilities. The authors have previously developed design methods to prevent local failure (perforation) of SC walls due to missile impact. This paper presents the development of static resistance functions for use in single-degree-of-freedom (SDOF) analyses to predict the maximum displacement response of SC walls subjected to missile impact and designed to resist local failure (perforation). The static resistance function for SC walls is developed using results of numerical analyses and parametric studies conducted using benchmarked 3D finite element (FE) models. The influence of various design parameters are discussed and used to develop idealized bilinear resistance functions for SC walls with fixed edges and simply supported edges. Results from dynamic non-linear FE analysis of SC panels subjected to rigid missile impact are compared with the maximum displacements predicted by SDOF analyses using the bilinear resistance function.

Sc-Decorated Porous Graphene for High-Capacity Hydrogen Storage: First-Principles Calculations.

Science.gov (United States)

Chen, Yuhong; Wang, Jing; Yuan, Lihua; Zhang, Meiling; Zhang, Cairong

2017-08-02

The generalized gradient approximation (GGA) function based on density functional theory is adopted to investigate the optimized geometrical structure, electron structure and hydrogen storage performance of Sc modified porous graphene (PG). It is found that the carbon ring center is the most stable adsorbed position for a single Sc atom on PG, and the maximum number of adsorbed H₂ molecules is four with the average adsorption energy of -0.429 eV/H₂. By adding a second Sc atom on the other side of the system, the hydrogen storage capacity of the system can be improved effectively. Two Sc atoms located on opposite sides of the PG carbon ring center hole is the most suitable hydrogen storage structure, and the hydrogen storage capacity reach a maximum 9.09 wt % at the average adsorption energy of -0.296 eV/H₂. The adsorption of H₂ molecules in the PG system is mainly attributed to orbital hybridization among H, Sc, and C atoms, and Coulomb attraction between negatively charged H₂ molecules and positively charged Sc atoms.

Establishment and characterization of Roberts syndrome and SC phocomelia model medaka (Oryzias latipes).

Science.gov (United States)

Morita, Akihiro; Nakahira, Kumiko; Hasegawa, Taeko; Uchida, Kaoru; Taniguchi, Yoshihito; Takeda, Shunichi; Toyoda, Atsushi; Sakaki, Yoshiyuki; Shimada, Atsuko; Takeda, Hiroyuki; Yanagihara, Itaru

2012-06-01

Roberts syndrome and SC phocomelia (RBS/SC) are genetic autosomal recessive syndromes caused by establishment of cohesion 1 homolog 2 ( ESCO 2) mutation. RBS/SC appear to have a variety of clinical features, even with the same mutation of the ESCO2 gene. Here, we established and genetically characterized a medaka model of RBS/SC by reverse genetics. The RBS/SC model was screened from a mutant medaka library produced by the Targeting Induced Local Lesions in Genomes method. The medaka mutant carrying the homozygous mutation at R80S in the conserved region of ESCO2 exhibited clinical variety (i.e. developmental arrest with craniofacial and chromosomal abnormalities and embryonic lethality) as characterized in RBS/SC. Moreover, widespread apoptosis and downregulation of some gene expression, including notch1a, were detected in the R80S mutant. The R80S mutant is the animal model for RBS/SC and a valuable resource that provides the opportunity to extend knowledge of ESCO2. Downregulation of some gene expression in the R80S mutant is an important clue explaining non-correlation between genotype and phenotype in RBS/SC. © 2012 The Authors Development, Growth & Differentiation © 2012 Japanese Society of Developmental Biologists.

MuSC is involved in regulating axonal fasciculation of mouse primary vestibular afferents.

Science.gov (United States)

Kawauchi, Daisuke; Kobayashi, Hiroaki; Sekine-Aizawa, Yoko; Fujita, Shinobu C; Murakami, Fujio

2003-10-01

Regulation of axonal fasciculation plays an important role in the precise patterning of neural circuits. Selective fasciculation contributes to the sorting of different types of axons and prevents the misrouting of axons. However, axons must defasciculate once they reach the target area. To study the regulation of fasciculation, we focused on the primary vestibulo-cerebellar afferents (PVAs), which show a dramatic change from fasciculated axon bundles to defasciculated individual axons at their target region, the cerebellar primordium. To understand how fasciculation and defasciculation are regulated in this system, we investigated the roles of murine SC1-related protein (MuSC), a molecule belonging to the immunoglobulin superfamily. We show: (i) by comparing 1,1'-dioctadecyl-3,3,3',3'-tetramethylindocarbocyanine perchlorate (Dil) labelling and anti-MuSC immunohistochemistry, that downregulation of MuSC in PVAs during development is concomitant with the defasciculation of PVA axons; (ii) in a binding assay with cells expressing MuSC, that MuSC has cell-adhesive activity via a homophilic binding mechanism, and this activity is increased by multimerization; and (iii) that MuSC also displays neurite outgrowth-promoting activity in vestibular ganglion cultures. These findings suggest that MuSC is involved in axonal fasciculation and its downregulation may help to initiate the defasciculation of PVAs.

Improved Soluble ScFv ELISA Screening Approach for Antibody Discovery Using Phage Display Technology.

Science.gov (United States)

Tohidkia, Mohammad R; Sepehri, Maryam; Khajeh, Shirin; Barar, Jaleh; Omidi, Yadollah

2017-09-01

Phage display technology (PDT) is a powerful tool for the isolation of recombinant antibody (Ab) fragments. Using PDT, target molecule-specific phage-Ab clones are enriched through the "biopanning" process. The individual specific binders are screened by the monoclonal scFv enzyme-linked immunosorbent assay (ELISA) that may associate with inevitable false-negative results. Thus, in this study, three strategies were investigated for optimization of the scFvs screening using Tomlinson I and J libraries, including (1) optimizing the expression of functional scFvs, (2) improving the sensitivity of ELISA, and (3) preparing different samples containing scFvs. The expression of all scFv Abs was significantly enhanced when scFv clones were cultivated in the terrific broth (TB) medium at the optimum temperature of 30 °C. The protein A-conjugated with horseradish peroxidase (HRP) was found to be a well-suited reagent for the detection of Ag-bound scFvs in comparison with either anti-c-myc Ab or the mixing procedure. Based on our findings, it seems there is no universal media supplement for an improved expression of all scFvs derived from both Tomlinson I and J libraries. We thus propose that expression of scFv fragments in a microplate scale is largely dependent on a variety of parameters, in particular the scFv clones and relevant sequences.

TU-G-213-03: IEC Subcommittee 62C (Equipment for Radiotherapy, Nuclear Medicine and Radiation Dosimetry): Recent and Active Projects

Energy Technology Data Exchange (ETDEWEB)

Culberson, W. [University of Wisconsin - Madison (United States)

2015-06-15

The International Electrotechnical Commission (IEC) writes standards that manufacturers of electrical equipment must comply with. Medical electrical equipment, such as medical imaging, radiation therapy, and radiation dosimetry devices, fall under Technical Committee 62. Of particular interest to medical physicists are the standards developed within Subcommittees (SC) 62B, which addresses diagnostic radiological imaging equipment, and 62C, which addresses equipment for radiation therapy, nuclear medicine and dosimetry. For example, a Working Group of SC 62B is responsible for safety and quality assurance standards for CT scanners and a Working Group of SC 62C is responsible for standards that set requirements for dosimetric safety and accuracy of linacs and proton accelerators. IEC standards thus have an impact on every aspect of a medical physicist’s job, including equipment testing, shielding design, room layout, and workflow. Consequently, it is imperative that US medical physicists know about existing standards, as well as have input on those under development or undergoing revision. The structure of the IEC and current standards development work will be described in detail. The presentation will explain how US medical physicists can learn about IEC standards and contribute to their development. Learning Objectives: Learn about the structure of the IEC and the influence that IEC standards have on the design of equipment for radiology and radiation therapy. Learn about the mechanisms by which the US participates in the development and revision of standards. Understand the specific requirements of several standards having direct relevance to diagnostic and radiation therapy physicists.

Rotary condenser for SC2

CERN Multimedia

1975-01-01

During 1975 the SC2 performance was improved among other things by redesigning some of the elements of the ROTCO (Annual Report 1975, p. 55). The photo shows an interior wiew of the housing of the rotary condenser and of the sixteen sets of shaped stator blades.

Possible involvement of dopamine D-1 and D-2 receptors in diazepam-induced hyperphagia in rats.

Science.gov (United States)

Naruse, T; Amano, H; Koizumi, Y

1991-01-01

Possible involvement of dopamine receptors in diazepam-induced (1 mg/kg, subcutaneous (sc] hyperphagia was studied in nondeprived rats. Pretreatment with the selective D-1 antagonist, SCH23390 (0.03 mg/kg, sc) inhibited diazepam-induced hyperphagia. In addition, pretreatment with the preferential D-2 antagonists, haloperidol (0.1 to 0.3 mg/kg, sc) and clebopride (0.1 to 0.3 mg/kg, sc) inhibited diazepam-induced hyperphagia in a dose-dependent manner. Pretreatment with co-administration of SCH23390 (0.1 mg/kg, sc) and clebopride (0.03 mg/kg, sc) completely inhibited this hyperphagia. The selective D-2 antagonist, sulpiride (40 mg/kg, sc) and the peripheral D-2 antagonist, domperidone (10 mg/kg, sc) did not affect diazepam-induced hyperphagia. However, sulpiride (10 micrograms, icv) or domperidone (2 micrograms, icv) administered centrally inhibited this hyperphagia. The highest dose of haloperidol (0.3 mg/kg, sc) or clebopride (0.3 mg/kg, sc) and higher doses of SCH23390 (0.01 and 0.03 mg/kg, sc) or SCH23390/clebopride (0.01/0.03 and 0.01/0.1 mg/kg, sc) tended to decrease spontaneous feeding in non-deprived rats. In addition, the highest dose of haloperidol, clebopride or SCH23390/clebopride inhibited spontaneous feeding in deprived rats. Interestingly, diazepam-induced hyperphagia was inhibited significantly by doses of haloperidol (0.1 mg/kg, sc), clebopride (0.1 mg/kg, sc) and SCH23390/clebopride (0.003/0.03 and 0.003/0.1 mg/kg, sc) which did not affect spontaneous feeding in non-deprived or deprived rats. Pretreatment with alpha-methyl-p-tyrosine (40 mg/kg, IP x 2, 6 and 2 h prior to diazepam administration) failed to inhibit this hyperphagia. Furthermore, pretreatment with a large dose of haloperidol (5 mg/kg, sc, 4 days before diazepam administration) augmented the sub-hyperphagic effect to diazepam (0.5 mg/kg, sc). Thus, these findings suggest that hyperphagia to diazepam is mediated in part by both dopamine D-1 and D-2 receptors in non-deprived rats.

HTGR structural-materials efforts in the US

International Nuclear Information System (INIS)

Rittenhouse, P.L.; Roberts, D.I.

1982-07-01

The status of ongoing structural materials programs being conducted in the US to support development and deployment of the high-temperature gas-cooled reactor (HTGR) is described. While the total US program includes work in support of all variants of this reactor system, the emphasis of this paper is on the work aimed at support of the steam cycle/cogeneration (SC/C) version of the HTGR. Work described includes activities to develop design and performance prediction data on metals, ceramics, and graphite

Low-β SC linacs: past, present, and future

International Nuclear Information System (INIS)

Bollinger, L. M.

1998-01-01

This paper is a general review of superconducting low-β technology and applications from its beginning in 1969 into the near-term future. The emphasis is on studies of accelerating resonators and on SC linacs that boost the energy of heavy-ion beams from tandem electrostatic accelerators used for nuclear-physics research. Other topics are positive-ion SC injectors to replace tandems and the need for accelerating structures with β outside of the present proven range, 0.008 < β < 0.2

PLUG-IN HYBRID ELECTRIC VEHICLE AND HYBRID ELECTRIC VEHICLE EMISSIONS UNDER FTP AND US06 CYCLES AT HIGH, AMBIENT, AND LOW TEMPERATURES

Energy Technology Data Exchange (ETDEWEB)

Seidman, M.R.; Markel, T.

2008-01-01

The concept of a Plug-in Hybrid Electric Vehicle (PHEV) is to displace consumption of gasoline by using electricity from the vehicle’s large battery pack to power the vehicle as much as possible with minimal engine operation. This paper assesses the PHEV emissions and operation. Currently, testing of vehicle emissions is done using the federal standard FTP4 cycle on a dynamometer at ambient (75°F) temperatures. Research was also completed using the US06 cycle. Furthermore, research was completed at high (95°F) and low (20°F) temperatures. Initial dynamometer testing was performed on a stock Toyota Prius under the standard FTP4 cycle, and the more demanding US06 cycle. Each cycle was run at 95°F, 75°F, and 20°F. The testing was repeated with the same Prius retrofi tted with an EnergyCS Plug-in Hybrid Electric system. The results of the testing confi rm that the stock Prius meets Super-Ultra Low Emission Vehicle requirements under current testing procedures, while the PHEV Prius under current testing procedures were greater than Super-Ultra Low Emission Vehicle requirements, but still met Ultra Low Emission Vehicle requirements. Research points to the catalyst temperature being a critical factor in meeting emission requirements. Initial engine emissions pass through with minimal conversion until the catalyst is heated to typical operating temperatures of 300–400°C. PHEVs also have trouble maintaining the minimum catalyst temperature throughout the entire test because the engine is turned off when the battery can support the load. It has been observed in both HEVs and PHEVs that the catalyst is intermittently unable to reduce nitrogen oxide emissions, which causes further emission releases. Research needs to be done to combat the initial emission spikes caused by a cold catalyst. Research also needs to be done to improve the reduction of nitrogen oxides by the catalyst system.

SC-HTGR Performance Impact for Arid Sites

International Nuclear Information System (INIS)

Lommers, L.; Geschwindt, J.; Southworth, F.; Shahrokhi, F.

2014-01-01

The SC-HTGR provides high temperature steam which can support industrial process heat applications as well as high efficiency electricity generation. The increased generating efficiency resulting from using high steam temperature provides greater plant output than lower temperature concepts, and it also reduces the fraction of waste heat which must be rejected. This capability is particularly attractive for sites with little or no water for heat rejection. This high temperature capability provides greater flexibility for these sites, and it results in a smaller performance penalty than for lower temperature systems when dry cooling must be used. The performance of the SC-HTGR for a conventional site with wet cooling is discussed first. Then the performance for arid sites is evaluated. Dry cooling performance is evaluated for both moderately arid sites and very hot sites. Offdesign performance of the dry cooling system under extreme conditions is also considered. Finally, operating strategies are explored for sites where some cooling water may be available but only in very limited quantities. Results of these assessments confirm that the higher operating temperatures of the SC-HTGR are very beneficial for arid sites, providing significant advantages for both gross and net power generation. (author)

Technical Training: CERN Technical Training 2004 - New Short Courses (SC) on Microsoft Outlook

CERN Multimedia

Monique Duval

2004-01-01

The CERN Technical Training programme is now proposing a new format for courses on Microsoft Outlook. Three two-hours Short Courses (SC) will cover basic and advanced functionalities of the recommended mail client for email at CERN. Each module can be followed independently. The next scheduled sessions will take place as follows: Outlook (SC I): E-mail. Next session: 31.8.2004 (9h00-11h00) Outlook (SC II): Calendar, Tasks and Notes. Next session: 31.8.2004 (14h00-16h00) Outlook (SC III): Meetings and Delegation. Next session: 7.9.2004 (14h00-16h00) In particular, SC I will cover how to open, create and send email, work with attachments, use stationery, organise mail, and work with the address book, SC II will show how to work with the calendar, tasks and notes, and SC III will cover how to organise and manage meetings, work with meeting requests, share tasks, and use email and calendar delegation. The number of participants to each session is limited to 8. The instructor is English-French bilingual, and s...

Sc-Decorated Porous Graphene for High-Capacity Hydrogen Storage: First-Principles Calculations

Directory of Open Access Journals (Sweden)

Yuhong Chen

2017-08-01

Full Text Available The generalized gradient approximation (GGA function based on density functional theory is adopted to investigate the optimized geometrical structure, electron structure and hydrogen storage performance of Sc modified porous graphene (PG. It is found that the carbon ring center is the most stable adsorbed position for a single Sc atom on PG, and the maximum number of adsorbed H2 molecules is four with the average adsorption energy of −0.429 eV/H2. By adding a second Sc atom on the other side of the system, the hydrogen storage capacity of the system can be improved effectively. Two Sc atoms located on opposite sides of the PG carbon ring center hole is the most suitable hydrogen storage structure, and the hydrogen storage capacity reach a maximum 9.09 wt % at the average adsorption energy of −0.296 eV/H2. The adsorption of H2 molecules in the PG system is mainly attributed to orbital hybridization among H, Sc, and C atoms, and Coulomb attraction between negatively charged H2 molecules and positively charged Sc atoms.

Emission ability of La-Sc-Mo cathode

International Nuclear Information System (INIS)

Yang Jiancan; Nie Zuoren; Xi Xiaoli; Wang Yiman

2004-01-01

In this paper La-Sc-Mo cathode has been prepared and its electron emission ability was measured. This type of cathode shows good electron emission performance that the saturated current density is 6.74 A cm -1 and the work function is about 2.59 eV at 1300 deg. C, which is much lower than thoriated tungsten cathode (Th-W). So it is a potential cathode to replace the Th-W cathode with radioactive pollution. Surface analysis shows that good emission ability due to the 20 nm surplus La layer and the element Sc may do good to the La diffusion to the surface

Influence of the gate position on source-to-drain resistance in AlGaN/AlN/GaN heterostructure field-effect transistors

Directory of Open Access Journals (Sweden)

Yan Liu

2017-08-01

Full Text Available Using a suitable dual-gate structure, the source-to-drain resistance (RSD of AlGaN/AlN/GaN heterostructure field-effect transistor (HFET with varying gate position has been studied at room temperature. The theoretical and experimental results have revealed a dependence of RSD on the gate position. The variation of RSD with the gate position is found to stem from the polarization Coulomb field (PCF scattering. This finding is of great benefit to the optimization of the performance of AlGaN/AlN/GaN HFET. Especially, when the AlGaN/AlN/GaN HFET works as a microwave device, it is beneficial to achieve the impedance matching by designing the appropriate gate position based on PCF scattering.

Superconducting accelerating structures for very low velocity ion beams

Directory of Open Access Journals (Sweden)

J. Xu

2008-03-01

Full Text Available This paper presents designs for four types of very-low-velocity superconducting (SC accelerating cavity capable of providing several MV of accelerating potential per cavity, and suitable for particle velocities in the range 0.00606. Superconducting TEM-class cavities have been widely applied to cw acceleration of ion beams. SC linacs can be formed as an array of independently phased cavities, enabling a variable velocity profile to maximize the output energy for each of a number of different ion species. Several laboratories in the U.S. and Europe are planning exotic beam facilities based on SC linacs. The cavity designs presented here are intended for the front end of such linacs, particularly for the postacceleration of rare isotopes of low charge state. Several types of SC cavities have been developed recently to cover particle velocities above 0.06c. Superconducting four-gap quarter-wave resonators for velocities 0.008<β=v/c<0.05 were developed about two decades ago and have been successfully operated at the ATLAS SC linac at Argonne National Laboratory. Since that time, progress in simulation tools, cavity fabrication, and processing have increased SC cavity gradients by a factor of 3–4. This paper applies these tools to optimize the design of a four-gap quarter-wave resonator for exotic beam facilities and other low-velocity applications.

DIMM-SC: a Dirichlet mixture model for clustering droplet-based single cell transcriptomic data.

Science.gov (United States)

Sun, Zhe; Wang, Ting; Deng, Ke; Wang, Xiao-Feng; Lafyatis, Robert; Ding, Ying; Hu, Ming; Chen, Wei

2018-01-01

Single cell transcriptome sequencing (scRNA-Seq) has become a revolutionary tool to study cellular and molecular processes at single cell resolution. Among existing technologies, the recently developed droplet-based platform enables efficient parallel processing of thousands of single cells with direct counting of transcript copies using Unique Molecular Identifier (UMI). Despite the technology advances, statistical methods and computational tools are still lacking for analyzing droplet-based scRNA-Seq data. Particularly, model-based approaches for clustering large-scale single cell transcriptomic data are still under-explored. We developed DIMM-SC, a Dirichlet Mixture Model for clustering droplet-based Single Cell transcriptomic data. This approach explicitly models UMI count data from scRNA-Seq experiments and characterizes variations across different cell clusters via a Dirichlet mixture prior. We performed comprehensive simulations to evaluate DIMM-SC and compared it with existing clustering methods such as K-means, CellTree and Seurat. In addition, we analyzed public scRNA-Seq datasets with known cluster labels and in-house scRNA-Seq datasets from a study of systemic sclerosis with prior biological knowledge to benchmark and validate DIMM-SC. Both simulation studies and real data applications demonstrated that overall, DIMM-SC achieves substantially improved clustering accuracy and much lower clustering variability compared to other existing clustering methods. More importantly, as a model-based approach, DIMM-SC is able to quantify the clustering uncertainty for each single cell, facilitating rigorous statistical inference and biological interpretations, which are typically unavailable from existing clustering methods. DIMM-SC has been implemented in a user-friendly R package with a detailed tutorial available on www.pitt.edu/∼wec47/singlecell.html. wei.chen@chp.edu or hum@ccf.org. Supplementary data are available at Bioinformatics online. © The Author

4SC-202 activates ASK1-dependent mitochondrial apoptosis pathway to inhibit hepatocellular carcinoma cells

International Nuclear Information System (INIS)

Fu, Meili; Wan, Fuqiang; Li, Zhengling; Zhang, Fenghua

2016-01-01

The aim of the present study is to investigate the potential anti-hepatocellular carcinoma (HCC) cell activity by 4SC-202, a novel class I HDAC inhibitor (HDACi). The associated signaling mechanisms were also analyzed. We showed that 4SC-202 treatment induced potent cytotoxic and proliferation–inhibitory activities against established HCC cell lines (HepG2, HepB3, SMMC-7721) and patient-derived primary HCC cells. Further, adding 4SC-202 in HCC cells activated mitochondrial apoptosis pathway, which was evidenced by mitochondrial permeability transition pore (mPTP) opening, cytochrome C cytosol release and caspase-3/-9 activation. Inhibition of this apoptosis pathway, by caspase-3/-9 inhibitors, mPTP blockers, or by shRNA-mediated knockdown of cyclophilin-D (Cyp-D, a key component of mPTP), significantly attenuated 4SC-202-induced HCC cell death and apoptosis. Reversely, over-expression of Cyp-D enhanced 4SC-202's sensitivity in HCC cells. Further studies showed that 4SC-202 induced apoptosis signal-regulating kinase 1 (ASK1) activation, causing it translocation to mitochondria and physical association with Cyp-D. This mitochondrial ASK1-Cyp-D complexation appeared required for mediating 4SC-202-induced apoptosis activation. ASK1 stable knockdown by targeted-shRNAs largely inhibited 4SC-202-induced mPTP opening, cytochrome C release, and following HCC cell apoptotic death. Together, we suggest that 4SC-202 activates ASK1-dependent mitochondrial apoptosis pathway to potently inhibit human HCC cells. - Highlights: • 4SC-202 exerts potent anti-proliferative and cytotoxic activity against established/primary HCC cells. • SC-202-induced anti-HCC cell activity relies on caspase-dependent apoptosis activation. • 4SC-202 activates Cyp-D-dependent mitochondrial apoptosis pathway in HCC cells. • 4SC-202 activates ASK1 in HCC cells, causing it translocation to mitochondria. • Mitochondrial ASK1-Cyp-D complexation mediates 4SC-202's activity in HCC cells.

4SC-202 activates ASK1-dependent mitochondrial apoptosis pathway to inhibit hepatocellular carcinoma cells

Energy Technology Data Exchange (ETDEWEB)

Fu, Meili, E-mail: fumeilidrlinyi@tom.com [Department of Infectious Disease, Linyi People' s Hospital, Linyi 276000 (China); Wan, Fuqiang [Department of Head and Neck Surgery, Linyi Tumor Hospital, Linyi 276000 (China); Li, Zhengling [Department of Nursing, Tengzhou Central People' s Hospital, Tengzhou 277500 (China); Zhang, Fenghua [Department of Operating Room, Linyi People' s Hospital, Linyi 276000 (China)

2016-03-04

The aim of the present study is to investigate the potential anti-hepatocellular carcinoma (HCC) cell activity by 4SC-202, a novel class I HDAC inhibitor (HDACi). The associated signaling mechanisms were also analyzed. We showed that 4SC-202 treatment induced potent cytotoxic and proliferation–inhibitory activities against established HCC cell lines (HepG2, HepB3, SMMC-7721) and patient-derived primary HCC cells. Further, adding 4SC-202 in HCC cells activated mitochondrial apoptosis pathway, which was evidenced by mitochondrial permeability transition pore (mPTP) opening, cytochrome C cytosol release and caspase-3/-9 activation. Inhibition of this apoptosis pathway, by caspase-3/-9 inhibitors, mPTP blockers, or by shRNA-mediated knockdown of cyclophilin-D (Cyp-D, a key component of mPTP), significantly attenuated 4SC-202-induced HCC cell death and apoptosis. Reversely, over-expression of Cyp-D enhanced 4SC-202's sensitivity in HCC cells. Further studies showed that 4SC-202 induced apoptosis signal-regulating kinase 1 (ASK1) activation, causing it translocation to mitochondria and physical association with Cyp-D. This mitochondrial ASK1-Cyp-D complexation appeared required for mediating 4SC-202-induced apoptosis activation. ASK1 stable knockdown by targeted-shRNAs largely inhibited 4SC-202-induced mPTP opening, cytochrome C release, and following HCC cell apoptotic death. Together, we suggest that 4SC-202 activates ASK1-dependent mitochondrial apoptosis pathway to potently inhibit human HCC cells. - Highlights: • 4SC-202 exerts potent anti-proliferative and cytotoxic activity against established/primary HCC cells. • SC-202-induced anti-HCC cell activity relies on caspase-dependent apoptosis activation. • 4SC-202 activates Cyp-D-dependent mitochondrial apoptosis pathway in HCC cells. • 4SC-202 activates ASK1 in HCC cells, causing it translocation to mitochondria. • Mitochondrial ASK1-Cyp-D complexation mediates 4SC-202's activity in HCC cells.

Study on examples of safety culture enhancing activities at U.S. Nuclear Power Stations

International Nuclear Information System (INIS)

Ichiki, Kuniyasu

2010-01-01

After the wake of the incident of reactor vessel head degradation at Davis Basse in 2002, the NRC, the regulatory body in the U.S., included extraction of safety culture (SC) related elements from every failure into its inspection scheme of Reactor Oversight Process, since July 2006. The idea of SC itself was established some time ago, though, there are very few similar examples of such evaluation so far. This study is an attempt of making analyses on various activities with regard to SC in the U.S., to gain useful knowledge for considering the way to improve station's SC in Japan. Despite the fact that the numbers of inspection findings at stations are generally seen as unchanged, it is obvious that there are substantial difference in the number of the NRC's findings by each station. This appears to show that the condition of SC may largely different by stations. At several stations which accepted our investigation, those staff have made serious efforts to correct their area for improvements which were pointed out by the NRC. Such examples include improving management of their Corrective Action Program and establishing various measures to enable transmitting employee's concerns. It is thought that such activities aim to achieve efficient transfer of vital information among the station. This kind of activities should help every station solve various deficiencies in equipment, and also remove any obstacles in its communication. Their effort seem to result in not only the decrease in number of trouble but also much enhancement of mutual trust among the station, which would contribute to the great advance in their SC. (author)

Thermoelectric performance of functionalized Sc2C MXenes

KAUST Repository

Kumar, S.; Schwingenschlö gl, Udo

2016-01-01

Functionalization of the MXene Sc2C, which has the rare property to realize semiconducting states for various functionalizations including O, F, and OH, is studied with respect to the electronic and thermal behavior. The lowest lattice thermal conductivity is obtained for OH functionalization and an additional 30% decrease can be achieved by confining the phonon mean free path to 100 nm. Despite a relatively low Seebeck coefficient, Sc2C(OH)2 is a candidate for intermediate-temperature thermoelectric applications due to compensation by a high electrical conductivity and very low lattice thermal conductivity.

Thermoelectric performance of functionalized Sc2C MXenes

KAUST Repository

Kumar, S.

2016-07-05

Functionalization of the MXene Sc2C, which has the rare property to realize semiconducting states for various functionalizations including O, F, and OH, is studied with respect to the electronic and thermal behavior. The lowest lattice thermal conductivity is obtained for OH functionalization and an additional 30% decrease can be achieved by confining the phonon mean free path to 100 nm. Despite a relatively low Seebeck coefficient, Sc2C(OH)2 is a candidate for intermediate-temperature thermoelectric applications due to compensation by a high electrical conductivity and very low lattice thermal conductivity.

Energy Levels and Radiative Rates for Transitions in F-like Sc XIII and Ne-like Sc XII and Y XXX

Directory of Open Access Journals (Sweden)

Kanti M. Aggarwal

2018-05-01

Full Text Available Energy levels, radiative rates and lifetimes are reported for F-like Sc XIII and Ne-like Sc XII and Y XXX for which the general-purpose relativistic atomic structure package (GRASP has been adopted. For all three ions, limited data exist in the literature but comparisons have been made wherever possible to assess the accuracy of the calculations. In the present work, the lowest 102, 125 and 139 levels have been considered for the respective ions. Additionally, calculations have also been performed with the flexible atomic code (FAC to (particularly confirm the accuracy of energy levels.

Department of Energy – Office of Science Pacific Northwest Site Office Environmental Monitoring Plan for the DOE-SC PNNL Site

Energy Technology Data Exchange (ETDEWEB)

Snyder, Sandra F.; Meier, Kirsten M.; Barnett, J. Matthew; Bisping, Lynn E.; Poston, Ted M.; Rhoads, Kathleen

2011-12-21

The Pacific Northwest Site Office (PNSO) manages the contract for operations at the U.S. Depart¬ment of Energy Office of Science (DOE-SC) Pacific Northwest National Laboratory (PNNL) Site in Richland, Washington. Radiological operations at the DOE-SC PNNL Site expanded in 2010 with the completion of facilities at the Physical Sciences Facility. As a result of the expanded radiological work at the site, the Washington State Department of Health (WDOH) has required that offsite environmental surveillance be conducted as part of the PNNL Site Radioactive Air Emissions License. The environ¬mental monitoring and surveillance requirements of various orders, regulations, and guidance documents consider emission levels and subsequent risk of negative human and environmental impacts. This Environmental Monitoring Plan (EMP) describes air surveillance activities at the DOE-SC PNNL Site. The determination of offsite environmental surveillance needs evolved out of a Data Quality Objectives process (Barnett et al. 2010) and Implementation Plan (Snyder et al. 2010). The entire EMP is a compilation of several documents, which include the Main Document (this text), Attachment 1: Sampling and Analysis Plan, Attachment 2: Data Management Plan, and Attachment 3: Dose Assessment Guidance.

Awareness of Cardiovascular Risk Factors in U.S. Young Adults Aged 18–39 Years

Science.gov (United States)

Bucholz, Emily M.; Gooding, Holly C.; de Ferranti, Sarah D.

2018-01-01

Introduction Young adults with hyperlipidemia, hypertension, and diabetes are at increased risk of developing heart disease later in life. Despite emphasis on early screening, little is known about awareness of these risk factors in young adulthood. Methods Data from the nationally representative cross-sectional survey National Health and Nutrition Examination Survey 2011–2014 were analyzed in 2017 to estimate the prevalence of self-reported awareness of hypercholesterolemia, hypertension, and diabetes in U.S. young adults aged 18–39 years (n=11,083). Prevalence estimates were weighted to population estimates using survey procedures, and predictors of awareness were identified using weighted logistic regression. Results Among U.S. young adults, the prevalence of hypercholesterolemia, hypertension, and diabetes was 8.8% (SE=0.4%), 7.3% (SE=0.3%), and 2.6% (SE=0.2%), respectively. The prevalence of borderline high cholesterol, blood pressure, and blood glucose were substantially higher (21.6% [SE= 0.6%], 26.9% [SE=0.7%], and 18.9% [SE=0.6%], respectively). Awareness was low for hypercholesterolemia (56.9% [SE=2.4%]) and moderate for hypertension and diabetes (62.7% [SE=2.4%] and 70.0% [SE=2.7%]); young adults with borderline levels of these risk factors were aware of their risk. Correlates of risk factor awareness included older age, insurance status, family income above the poverty line, U.S. origin, having a usual source of health care, and the presence of comorbid conditions. Conclusions Despite the high prevalence of cardiovascular risk factors in U.S. young adults, awareness remains less than ideal. Interventions that target access may increase awareness and facilitate achieving treatment goals in young adults. PMID:29433955

An ideal scintillator – ZnO:Sc for sub-nanosecond pulsed radiation detection

Energy Technology Data Exchange (ETDEWEB)

Zhang, Kan, E-mail: zhangkan8414@163.com [Northwest Institute of Nuclear Technology, Xi’an 710024 (China); Ouyang, Xiaoping [Northwest Institute of Nuclear Technology, Xi’an 710024 (China); Xi’an Jiaotong University, Xi’an 710049 (China); Song, Zhaohui; Han, Hetong [Northwest Institute of Nuclear Technology, Xi’an 710024 (China); Zuo, Yanbin [China Nonferrous Metal Guilin Research Institute of Geology for Mineral Resource, Guilin 541004 (China); Guan, Xingyin [Northwest Institute of Nuclear Technology, Xi’an 710024 (China); Xi’an Jiaotong University, Xi’an 710049 (China); Tan, Xinjian; Zhang, Zichuan; Liu, Junhong [Northwest Institute of Nuclear Technology, Xi’an 710024 (China)

2014-08-21

ZnO-based scintillators are particularly well suited for use as ultrafast pulsed radiation detectors which have shown broad application prospects in various fields such as the inertial confinement fusion (ICF) diagnosis, the nuclear reaction mechanism, etc. Using the hydro-thermal method, a ZnO single-crystal doped with Scandium (ZnO:Sc) sample was prepared. As a new ZnO-based scintillator, the scintillation characteristics of ZnO:Sc have not been reported previously. In this paper, optical and scintillation characteristics of ZnO:Sc single-crystal were studied. Also a scintillation detector based on ZnO:Sc was designed. Excited by the alpha-particle, the rise time of ZnO:Sc detectors was from 162.5 to 170.7 ps, and the fall time was from 300.4 to 328.8 ps.

An ideal scintillator – ZnO:Sc for sub-nanosecond pulsed radiation detection

International Nuclear Information System (INIS)

Zhang, Kan; Ouyang, Xiaoping; Song, Zhaohui; Han, Hetong; Zuo, Yanbin; Guan, Xingyin; Tan, Xinjian; Zhang, Zichuan; Liu, Junhong

2014-01-01

ZnO-based scintillators are particularly well suited for use as ultrafast pulsed radiation detectors which have shown broad application prospects in various fields such as the inertial confinement fusion (ICF) diagnosis, the nuclear reaction mechanism, etc. Using the hydro-thermal method, a ZnO single-crystal doped with Scandium (ZnO:Sc) sample was prepared. As a new ZnO-based scintillator, the scintillation characteristics of ZnO:Sc have not been reported previously. In this paper, optical and scintillation characteristics of ZnO:Sc single-crystal were studied. Also a scintillation detector based on ZnO:Sc was designed. Excited by the alpha-particle, the rise time of ZnO:Sc detectors was from 162.5 to 170.7 ps, and the fall time was from 300.4 to 328.8 ps

Chronic hypoxia suppresses the CO2 response of solitary complex (SC) neurons from rats.

Science.gov (United States)

Nichols, Nicole L; Wilkinson, Katherine A; Powell, Frank L; Dean, Jay B; Putnam, Robert W

2009-09-30

We studied the effect of chronic hypobaric hypoxia (CHx; 10-11% O(2)) on the response to hypercapnia (15% CO(2)) of individual solitary complex (SC) neurons from adult rats. We simultaneously measured the intracellular pH and firing rate responses to hypercapnia of SC neurons in superfused medullary slices from control and CHx-adapted adult rats using the blind whole cell patch clamp technique and fluorescence imaging microscopy. We found that CHx caused the percentage of SC neurons inhibited by hypercapnia to significantly increase from about 10% up to about 30%, but did not significantly alter the percentage of SC neurons activated by hypercapnia (50% in control vs. 35% in CHx). Further, the magnitudes of the responses of SC neurons from control rats (chemosensitivity index for activated neurons of 166+/-11% and for inhibited neurons of 45+/-15%) were the same in SC neurons from CHx-adapted rats. This plasticity induced in chemosensitive SC neurons by CHx appears to involve intrinsic changes in neuronal properties since they were the same in synaptic blockade medium.

Fe-moment instability in Ti{sub 1-x}Sc{sub x}Fe{sub 2} Laves-phase compounds

Energy Technology Data Exchange (ETDEWEB)

Ouladdiaf, B. [Institut Laue-Langevin, BP 156, 38042 GRENOBLE Cedex 09 (France); Deportes, J. [Lab. Louis Neel, CNRS, BP 166, 38042 GRENOBLE Cedex 09 (France); Saoudi, M. [Centre Universitaire de Guelma, GUELMA 24 000 (Algeria)

2002-07-01

The magnetic properties of the pseudo-binary Laves-phase compounds Ti{sub 1-x}Sc{sub x}Fe{sub 2} were investigated by means of magnetisation and high-resolution powder neutron diffraction techniques. For x<0.2 a transition from an antiferromagnetic state to a canted one with a ferromagnetic component in the basal plane is observed, while for 0.20.3, an additional first-order transition is observed at low temperature accompanied by a large magnetovolume anomaly due to the increase of the intrinsic moment of the Fe atoms at the 2a site. (orig.)

1.06 μm reflectivity measurements of metal optics

International Nuclear Information System (INIS)

Saito, T.T.

1975-01-01

The equipment and technique for the measurement of 1.06 μm reflectivity of diamond turned, diamond turned/polished, and polished metal mirrors is presented. From an analysis of repeatability and systematic errors it is concluded the precision of the measurements is 0.003 and the accuracy is 0.005. Diamond turned mirrors compete well with the best 1 μm reflectivity values reported and are superior to polished surfaces studied in this work. (U.S.)

Use of antifungal Saponin SC-2 of Solanum chrysotrichum for the ...

African Journals Online (AJOL)

Fungistatic and fungicidal activity of saponin SC-2 on Candida albicans and other Candida species, fluconazole and ketoconazole resistaent strains was demostrated. SC-2-associated ultrastructural alterations in several Candida species were observed. An exploratory clinical, randomized, double-blind, and controlled ...

Interplay between charge and antiferromagnetic ordering in Bi0.6-xPrxCa0.4MnO3 (0≤x≤0.6) perovskite manganite

International Nuclear Information System (INIS)

Yadav, Kamlesh; Singh, H.K.; Varma, G.D.

2012-01-01

Structure, magnetic and transport properties of polycrystalline Bi 0.6-x Pr x Ca 0.4 MnO 3 (x=0.0, 0.1, 0.2, 0.3, 0.4, 0.5 and 0.6) have been studied. Systematic substitution of Pr at Bi site induces an interesting interplay between the charge ordering and antiferromagnetism. The charge ordering temperature (T CO ) decreases with increasing x. The antiferromagnetic (AFM) ordering temperature (T N ) increases sharply at both the extremes but remains nearly constant from x=0.2 to 0.4. At temperatures lower than T N a transition to the glassy state is observed. The nature of this glass like state appears to be controlled by the Pr content, and at lower values of x this is akin to a spin glass, while at higher x it has a characteristic of cluster glass. The Pr doping also leads to enhancement in the magnetic moment. In the present work it has been proposed that the local lattice distortion induced due to size mismatch between the A-site cations and 6s 2 character of Bi 3+ lone pair electron is responsible for the observed magnetic and electrical properties.

In vivo reproducibility of robotic probe placement for an integrated US-CT image-guided radiation therapy system

Science.gov (United States)

Lediju Bell, Muyinatu A.; Sen, H. Tutkun; Iordachita, Iulian; Kazanzides, Peter; Wong, John

2014-03-01

Radiation therapy is used to treat cancer by delivering high-dose radiation to a pre-defined target volume. Ultrasound (US) has the potential to provide real-time, image-guidance of radiation therapy to identify when a target moves outside of the treatment volume (e.g. due to breathing), but the associated probe-induced tissue deformation causes local anatomical deviations from the treatment plan. If the US probe is placed to achieve similar tissue deformations in the CT images required for treatment planning, its presence causes streak artifacts that will interfere with treatment planning calculations. To overcome these challenges, we propose robot-assisted placement of a real ultrasound probe, followed by probe removal and replacement with a geometrically-identical, CT-compatible model probe. This work is the first to investigate in vivo deformation reproducibility with the proposed approach. A dog's prostate, liver, and pancreas were each implanted with three 2.38-mm spherical metallic markers, and the US probe was placed to visualize the implanted markers in each organ. The real and model probes were automatically removed and returned to the same position (i.e. position control), and CT images were acquired with each probe placement. The model probe was also removed and returned with the same normal force measured with the real US probe (i.e. force control). Marker positions in CT images were analyzed to determine reproducibility, and a corollary reproducibility study was performed on ex vivo tissue. In vivo results indicate that tissue deformations with the real probe were repeatable under position control for the prostate, liver, and pancreas, with median 3D reproducibility of 0.3 mm, 0.3 mm, and 1.6 mm, respectively, compared to 0.6 mm for the ex vivo tissue. For the prostate, the mean 3D tissue displacement errors between the real and model probes were 0.2 mm under position control and 0.6 mm under force control, which are both within acceptable

The role of the bimodal distribution of ultra-fine silicon phase and nano-scale V-phase (AlSi2Sc2) on spark plasma sintered hypereutectic Al–Si–Sc alloys

International Nuclear Information System (INIS)

Raghukiran, Nadimpalli; Kumar, Ravi

2016-01-01

Hypereutectic Al–Si and Al–Si–Sc alloys were spark plasma sintered from corresponding gas-atomized powders. The microstructures of the Al–Si and Al–Si–Sc alloys possessed remarkably refined silicon particles in the size range of 0.38–3.5 µm and 0.35–1.16 µm respectively in contrast to the silicon particles of size greater than 100 µm typically found in conventionally cast alloys. All the sintered alloys exhibited significant ductility of as high as 85% compressive strain without failure even with the presence of relatively higher weight fraction of the brittle silicon phase. Moreover, the Al–Si–Sc alloys have shown appreciable improvement in the compressive strength over their binary counterparts due to the presence of intermetallic compound AlSi 2 Sc 2 of size 10–20 nm distributed uniformly in the matrix of those alloys. The dry sliding pin-on-disc wear tests showed improvement in the wear performance of the sintered alloys with increase in silicon content in the alloys. Further, the Al–Si–Sc ternary alloys with relatively lesser silicon content exhibited appreciable improvement in the wear resistance over their binary counterparts. The Al–Si–Sc alloys with bimodal distribution of the strengthening phases consisting of ultra-fine (sub-micron size) silicon particles and the nano-scale AlSi 2 Sc 2 improved the strength and wear properties of the alloys while retaining significant amount of ductility.

Magnet measuring equipment of SC2

CERN Multimedia

CERN PhotoLab

1974-01-01

Checking the positioning of the magnet measuring equipment installed between the poles of SC2. The steel structure in front of the magnet is designed to house the rotary condenser and to shield it from the stray magnetic field of the accelerator.

Phase equilibria in the system Li2O - MoO3 - Sc2O3

International Nuclear Information System (INIS)

Safonov, V.V.; Chaban, N.G.; Porotnikov, N.V.

1984-01-01

Using the methods of DTA and X-ray phase analysis, interaction of components in the system Li 2 O-MoO 3 -Sc 2 O 3 in concentration range, adjacent to the vertex of MoO 3 , has been studied. Projection of the Li 2 MoO 4 -MoO 3 -Sc 2 (MoO 4 ) 3 system liquidus on concentrational triangle of the compositions Li 2 O-MoO 3 -Sc 2 O 3 , which consists of the fields of primary separation of Li 2 MoO 4 , Li 2 Mo 5 O 17 , Li 2 Mo 4 O 13 , MoO 3 , Sc 2 (MoO 4 ) 3 , Li 3 Sc(MoO 4 ) 3 and LiSc(MoO 4 ) 2 , is built

LHCb Data Replication During SC3

CERN Multimedia

Smith, A

2006-01-01

LHCb's participation in LCG's Service Challenge 3 involves testing the bulk data transfer infrastructure developed to allow high bandwidth distribution of data across the grid in accordance with the computing model. To enable reliable bulk replication of data, LHCb's DIRAC system has been integrated with gLite's File Transfer Service middleware component to make use of dedicated network links between LHCb computing centres. DIRAC's Data Management tools previously allowed the replication, registration and deletion of files on the grid. For SC3 supplementary functionality has been added to allow bulk replication of data (using FTS) and efficient mass registration to the LFC replica catalog.Provisional performance results have shown that the system developed can meet the expected data replication rate required by the computing model in 2007. This paper details the experience and results of integration and utilisation of DIRAC with the SC3 transfer machinery.

Mise en scène ja kertova lavastus

OpenAIRE

Bruun, Ida

2013-01-01

Tämä opinnäytetyö tutkii mise en scèneä ja lavastuksen kerronnallista vaikutusta elokuvassa. Työ on toteutettu toiminnallisena ja koostuu kirjallisesta osasta ja teososasta. Teososa on vuonna 2012 ensi-iltansa saanut fiktiivinen lyhytelokuva Varjelus. Toimin elokuvassa lavastajana ja rekvisitöörinä. Kirjallinen osuus alkaa käsittelemällä mise en scènen, eli ’näyttämöllepanon’ määritelmää ja sen syntyä elokuvalliseksi konseptiksi. Työ etenee esittelemään ja tarkastelemaan käsitteen eri vis...

Phonon and thermodynamical properties of CuSc: A DFT study

Science.gov (United States)

Jain, Ekta; Pagare, Gitanjali; Dubey, Shubha; Sanyal, S. P.

2018-05-01

A detailed systematic theoretical investigation of phonon and thermodynamical behavior of CuSc intermetallic compound has been carried out by uing first-principles density functional theory in B2-type (CsCl) crystal structure. Phonon dispersion curve and phonon density of states (PhDOS) are studied which confirm the stability of CuSc intermetallic compound in B2 phase. It is found that PhDOS at high frequencies mostly composed of Sc states. We have also presented some temperature dependent properties such as entropy, free energy, heat capacity, internal energy and thermal displacement, which are computed under PHONON code. The various features of these quantities are discussed in detail. From these results we demonstrate that the particular intermetallic have better ductility and larger thermal expansion.

Original Research: Use of hydroxyurea and phlebotomy in pediatric patients with hemoglobin SC disease

OpenAIRE

Summarell, Carly C Ginter; Sheehan, Vivien A

2016-01-01

Hydroxyurea is an excellent therapeutic agent for the pharmacological induction of HbF in patients with sickle cell disease (SCD). However, all completed clinical trials of hydroxyurea have excluded patients with hemoglobin SC (HbSC) disease. HbSC differs significantly in pathophysiology from HbSS, as HbC does not sickle, but instead causes cellular dehydration which potentiates sickling of HbS. Many severely affected HbSC patients have been placed on hydroxyurea on a case by case basis, but ...

First-principles study of the nucleation and stability of ordered precipitates in ternary Al-Sc-Li alloys

International Nuclear Information System (INIS)

Mao, Z.; Chen, W.; Seidman, D.N.; Wolverton, C.

2011-01-01

First-principles density functional calculations are used to study the nucleation and stability of L1 2 -ordered precipitates in Al-Sc-Li alloys. For dilute Al alloys, there are three possible ordered L1 2 precipitates: Al 3 Sc, Al 3 Li and an Al 3 Sc/Al 3 Li core/shell structure. To calculate the nucleation behavior, information about bulk thermodynamics (both static total energies and vibrational free energies), interfacial energetics and coherency strain is required. The study finds the following: (1) the coherency strain energies for forming coherent interfaces between Al/Al 3 Sc, Al/Al 3 Li and Al 3 Sc/Al 3 Li are relatively small, owing to the small atomic size mismatches in these systems; (2) the sublattice site preferences of Sc and Li are calculated, and it is demonstrated that Sc and Li share the same sublattice sites in both Al 3 Sc(L1 2 ) and Al 3 Li(L1 2 ), in agreement with recent experimental results; (3) the calculated solubilities of Sc and Li in α-Al alloys are in good agreement with experimental values and, for Sc, agree well with prior first-principles results; (4) the interfacial energies for Al/Al 3 Sc, Al/Al 3 Li and Al 3 Sc/Al 3 Li for (1 0 0), (1 1 0) and (1 1 1) interfaces are calculated: the values of the Al/Al 3 Sc interfacial energies are significantly larger than those of the Al/Al 3 Li and Al 3 Sc/Al 3 Li interfaces; (5) combining the bulk and interfacial energies yields the nucleation barriers and critical radii for Al 3 Sc and Al 3 Li precipitates; and (6) the energetic stability of the Al 3 Sc/Al 3 Li core/shell structure is compared with individual Al 3 Sc and Al 3 Li nuclei, and the range of precipitate sizes for which the core/shell structure is energetically favored is determined quantitatively.

Design of SC solenoid with high homogeneity

International Nuclear Information System (INIS)

Yang Xiaoliang; Liu Zhong; Luo Min; Luo Guangyao; Kang Qiang; Tan Jie; Wu Wei

2014-01-01

A novel kind of SC (superconducting) solenoid coil is designed to satisfy the homogeneity requirement of the magnetic field. In this paper, we first calculate the current density distribution of the solenoid coil section through the linear programming method. Then a traditional solenoid and a nonrectangular section solenoid are designed to produce a central field up to 7 T with a homogeneity to the greatest extent. After comparison of the two solenoid coils designed in magnet field quality, fabrication cost and other aspects, the new design of the nonrectangular section of a solenoid coil can be realized through improving the techniques of framework fabrication and winding. Finally, the outlook and error analysis of this kind of SC magnet coil are also discussed briefly. (authors)

Impregnated cathode coated with tungsten thin film containing Sc2O3

International Nuclear Information System (INIS)

Yamamoto, S.; Taguchi, S.; Watanabe, I.; Kawase, S.

1987-01-01

An impregnated cathode of a novel structure is proposed, fabricated, and evaluated. A thin tungsten film 100--400 nm in thickness containing various amounts of Sc 2 O 3 is coated on a standard impregnated cathode composed of a porous tungsten body in which electron emissive materials are impregnated. The electron emission property measured with a diode configuration is found to be dependent on Sc 2 O 3 content and surface atom distribution. Surface atom distribution is depicted by means of Auger electron spectroscopy. For high electron emission enhancement it is necessary for Sc 2 O 3 content to be 2.5--6.5 wt. % and for a layer of the order of a monolayer in thickness composed of Ba, Sc, and O to develop on the cathode surface

Temperature and salinity profile data from globally distributed Argo profiling floats for the week of 2007-06-03 for the Global Argo Data Repository, date ranged from 2003-12-03 to 2007-06-09 (NODC Accession 0020394)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The U.S. National Oceanographic Data Center (NODC) operates the Global Argo Data Repository(GADR) as the long-term archive for the International Global Argo Project...

Differential dynamics of splicing factor SC35 during the cell cycle

Indian Academy of Sciences (India)

Fluorescence recovery after photobleaching (FRAP) experiments revealed that the mobility of GFP-SC35 was distinct in different mitotic compartments. Interestingly, the mobility of GFP-SC35 was 3-fold higher in the cytoplasm of metaphase cells compared with interphase speckles, the nucleoplasm or MIGs. Treatment of ...

BOOK REVIEW: Assessing Sc1 for GCSE

Science.gov (United States)

Reynolds, H.

2000-01-01

It is well known that investigations that `fit' the National Curriculum or examination board criteria are few in number. The fair testing emphasis means that pupils all over the country are finding out what affects the rate of a chemical reaction, the rate of photosynthesis or, in the case of Physics, the resistance of a wire. This book focuses on nine of the most common Sc1 investigations and how to prepare for them, manage and assess them. The author, a GCSE examiner, has turned his expertise into a handbook for improving Sc1 performance in the classroom. He has produced a book that would be extremely useful to both newly qualified teachers and experienced teachers. The first aim of the book, however, is to explain the requirements of Sc1. This is done comprehensively with examples of what the jargon means in practice. By breaking down the elements of planning, obtaining evidence, analysing evidence and evaluating, it is easy to see the subtleties of the mark descriptors. At first glance there seems to be little difference between the type of scientific knowledge needed for planning at level 6 and level 8. However, the level 8 statement specifies `detailed' scientific knowledge and understanding, which would mean a student should use equations from physics or symbolic chemical equations to support their arguments. One of the most useful sections in the book details the marking problems that can arise with some investigations. For example, in an investigation into electromagnets it is difficult for students to provide sufficient relevant scientific theory to satisfy the requirements of planning at level 6. One of the problems with Sc1 is that certain requirements, such as graph plotting, are difficult for many students. This book provides exercises that can be given to students to improve those skills. Each of the nine investigations is covered in great detail. Each investigation begins with an introduction detailing the rationale for choosing it, whether students

Enhanced hardness in epitaxial TiAlScN alloy thin films and rocksalt TiN/(Al,Sc)N superlattices

Energy Technology Data Exchange (ETDEWEB)

Saha, Bivas [School of Materials Engineering, Purdue University, West Lafayette, Indiana 47907 (United States); Birck Nanotechnology Center, Purdue University, West Lafayette, Indiana 47907 (United States); Lawrence, Samantha K.; Bahr, David F. [School of Materials Engineering, Purdue University, West Lafayette, Indiana 47907 (United States); Schroeder, Jeremy L.; Birch, Jens [Thin Film Physics Division, Department of Physics, Chemistry, and Biology (IFM), Linköping University, SE-581 83 Linköping (Sweden); Sands, Timothy D. [School of Materials Engineering, Purdue University, West Lafayette, Indiana 47907 (United States); Birck Nanotechnology Center, Purdue University, West Lafayette, Indiana 47907 (United States); School of Electrical and Computer Engineering, Purdue University, West Lafayette, Indiana 47907 (United States)

2014-10-13

High hardness TiAlN alloys for wear-resistant coatings exhibit limited lifetimes at elevated temperatures due to a cubic-AlN to hexagonal-AlN phase transformation that leads to decreasing hardness. We enhance the hardness (up to 46 GPa) and maximum operating temperature (up to 1050 °C) of TiAlN-based coatings by alloying with scandium nitride to form both an epitaxial TiAlScN alloy film and epitaxial rocksalt TiN/(Al,Sc)N superlattices on MgO substrates. The superlattice hardness increases with decreasing period thickness, which is understood by the Orowan bowing mechanism of the confined layer slip model. These results make them worthy of additional research for industrial coating applications.

Martensitic Transformation in a β-Type Mg-Sc Alloy

Science.gov (United States)

Ogawa, Yukiko; Ando, Daisuke; Sutou, Yuji; Somekawa, Hidetoshi; Koike, Junichi

2018-03-01

Recently, we found that a Mg-Sc alloy with a bcc (β) phase exhibits superelasticity and a shape memory effect at low temperature. In this work, we examined the stress-induced and thermally induced martensitic transformation of the β-type Mg-Sc alloy and investigated the crystal structure of the thermally induced martensite phase based on in situ X-ray diffraction (XRD) measurements. The lattice constants of the martensite phase were calculated to be a = 0.3285 nm, b = 0.5544 nm, and c = 0.5223 nm when we assumed that the martensite phase has an orthorhombic structure (Cmcm). Based on the lattice correspondence between a bcc and an orthorhombic structures such as that in the case of β-Ti shape memory alloys, we estimated the transformation strain of the β Mg-Sc alloy. As a result, the transformation strains along the 001, 011, and 111 directions in the β phase were calculated to be + 5.7, + 8.8, and + 3.3%, respectively.

Martensitic Transformation in a β-Type Mg-Sc Alloy

Science.gov (United States)

Ogawa, Yukiko; Ando, Daisuke; Sutou, Yuji; Somekawa, Hidetoshi; Koike, Junichi

2017-12-01

Recently, we found that a Mg-Sc alloy with a bcc (β) phase exhibits superelasticity and a shape memory effect at low temperature. In this work, we examined the stress-induced and thermally induced martensitic transformation of the β-type Mg-Sc alloy and investigated the crystal structure of the thermally induced martensite phase based on in situ X-ray diffraction (XRD) measurements. The lattice constants of the martensite phase were calculated to be a = 0.3285 nm, b = 0.5544 nm, and c = 0.5223 nm when we assumed that the martensite phase has an orthorhombic structure (Cmcm). Based on the lattice correspondence between a bcc and an orthorhombic structures such as that in the case of β-Ti shape memory alloys, we estimated the transformation strain of the β Mg-Sc alloy. As a result, the transformation strains along the 001, 011, and 111 directions in the β phase were calculated to be + 5.7, + 8.8, and + 3.3%, respectively.

The development of the code package PERMAK--3D//SC--1

International Nuclear Information System (INIS)

Bolobov, P. A.; Oleksuk, D. A.

2011-01-01

Code package PERMAK-3D//SC-1 was developed for performing pin-by-pin coupled neutronic and thermal hydraulic calculation of the core fragment of seven fuel assemblies and was designed on the basis of 3D multigroup pin-by-pin code PERMAK-3D and 3D (subchannel) thermal hydraulic code SC-1 The code package predicts axial and radial pin-by-pin power distribution and coolant parameters in stimulated region (enthalpies,, velocities,, void fractions,, boiling and DNBR margins).. The report describes some new steps in code package development. Some PERMAK-3D//SC-1 outcomes of WWER calculations are presented in the report. (Authors)

Experimental Study on Temperature Behavior of SC Structures under Pure Bending

International Nuclear Information System (INIS)

Ham, K. W.; Lee, K. J.; Park, D. S.; Jeon, J. H.

2006-01-01

SC(Steel plate Concrete) module method uses steel plate instead of reinforcing bar and mold in existing RC structure. Steel plate modules are fabricated in advance, installed and poured with concrete in construction field, so construction period is remarkably shortened by SC module technique. In case of existence of temperature gap between internal and external structure surface such as spent fuel storage pool, thermal stress is taken place and as a result of it, structural strength is deteriorated. In this study, we designed three test specimens and several tests with or without temperature heating were conducted to evaluate temperature behavior of SC structures under pure bending loading condition

Final Scientific Report: DE-SC0008580

Energy Technology Data Exchange (ETDEWEB)

Seidler, Gerald T. [Univ. of Washington, Seattle, WA (United States)

2017-03-16

We report scientific, technical, and organizational accomplishments under DE-SC0008580. This includes 10 publications, 5 patent or provisional patent applications, beamtime with important results at both LCLS and APS, and new progress in understanding target design for x-ray heating experiments at x-ray heating facilities.

Observed travel times for Multiply-reflected ScS waves from a deep-focus earthquake

Directory of Open Access Journals (Sweden)

A. F. ESPISOSA

1966-06-01

Full Text Available Tlie deep-focus Argentinean earthquake of December 8
1962, generated multiply reflected ScS phases which were recorded very
clearly at stations of the IGY and the TJSC&GS standardized worldwide
networks and at Canadian stations. The data gathered from this earthquake
for the multiply-reflected ScS and sScS were used to construct the
travel times and to extend them to shorter epicentral distances. These
new data brought to light an error in published travel times for the 2(ScS
phase.

Transport of one SC coil through the village of Meyrin

CERN Multimedia

1956-01-01

In 1952, before CERN was officially founded, two accelerator projects were launched: one for an innovative accelerator to operate at an energy level unequalled at the time, the other for a more standard machine, a Synchro-Cyclotron (SC) to operate at 600 MeV. Design work on the SC was started in 1952 and carried out by teams scattered throughout Europe. Once construction began in 1954, CERN had to arrange road transport for the first of what has since been a long series of spectacular component deliveries, such as those of the machine's two magnetic coils each weighing 60 tonnes and measuring 7.2 metres in diameter. Above, one of them is seen passing through the village of Meyrin. The SC was commissioned in 1957 and was operational for 34 years!

L-Arginine ethylester enhances in vitro amplification of PrP(Sc) in macaques with atypical L-type bovine spongiform encephalopathy and enables presymptomatic detection of PrP(Sc) in the bodily fluids.

Science.gov (United States)

Murayama, Y; Ono, F; Shimozaki, N; Shibata, H

2016-02-12

Protease-resistant, misfolded isoforms (PrP(Sc)) of a normal cellular prion protein (PrP(C)) in the bodily fluids, including blood, urine, and saliva, are expected to be useful diagnostic markers of prion diseases, and nonhuman primate models are suited for performing valid diagnostic tests for human Creutzfeldt-Jakob disease (CJD). We developed an effective amplification method for PrP(Sc) derived from macaques infected with the atypical L-type bovine spongiform encephalopathy (L-BSE) prion by using mouse brain homogenate as a substrate in the presence of polyanions and L-arginine ethylester. This method was highly sensitive and detected PrP(Sc) in infected brain homogenate diluted up to 10(10) by sequential amplification. This method in combination with PrP(Sc) precipitation by sodium phosphotungstic acid is capable of amplifying very small amounts of PrP(Sc) contained in the cerebrospinal fluid (CSF), saliva, urine, and plasma of macaques that have been intracerebrally inoculated with the L-BSE prion. Furthermore, PrP(Sc) was detectable in the saliva or urine samples as well as CSF samples obtained at the preclinical phases of the disease. Thus, our novel method may be useful for furthering the understanding of bodily fluid leakage of PrP(Sc) in nonhuman primate models. Copyright © 2016 Elsevier Inc. All rights reserved.

Correlative characterization of primary Al{sub 3}(Sc,Zr) phase in an Al–Zn–Mg based alloy

Energy Technology Data Exchange (ETDEWEB)

Li, J.H., E-mail: jie-hua.li@hotmail.com [Institute of Casting Research, Montanuniversität Leoben, A-8700 Leoben (Austria); Wiessner, M. [Materials Center Leoben Forschung GmbH, A-8700 Leoben (Austria); Albu, M. [Institute for Electron Microscopy and Nanoanalysis, Graz University of Technology, Center for Electron Microscopy (Austria); Wurster, S. [Department of Materials Physics, Montanuniversität Leoben, Erich Schmid Institute of Materials Science of the Austrian Academy of Sciences, A-8700 Leoben (Austria); Sartory, B. [Materials Center Leoben Forschung GmbH, A-8700 Leoben (Austria); Hofer, F. [Institute for Electron Microscopy and Nanoanalysis, Graz University of Technology, Center for Electron Microscopy (Austria); Schumacher, P. [Institute of Casting Research, Montanuniversität Leoben, A-8700 Leoben (Austria); Austrian Foundry Research Institute, A-8700 Leoben (Austria)

2015-04-15

Three-dimensional electron backscatter diffraction, focused ion beam, transmission electron microscopy and energy filtered transmission electron microscopy were employed to investigate the structural information of primary Al{sub 3}(Sc,Zr) phase, i.e. size, shape, element distribution and orientation relationship with the α-Al matrix. It was found that (i) most primary Al{sub 3}(Sc,Zr) phases have a cubic three-dimensional morphology, with a size of about 6–10 μm, (ii) most primary Al{sub 3}(Sc,Zr) phases are located within the α-Al matrix, and exhibit a cube to cube orientation relationship with the α-Al matrix, and (iii) a layer by layer growth was observed within primary Al{sub 3}(Sc,Zr) phases. Al, Cu, Si and Fe are enriched in the α-Al matrix between the layers of cellular eutectic Al{sub 3}(Sc,Zr) phase, while Sc, Ti and Zr are enriched in small Al{sub 3}(Sc,Zr) phases. A peritectic reaction and subsequent eutectic reaction between Al{sub 3}Sc and Al was proposed to interpret the observed layer by layer growth. This paper demonstrates that the presence of impurities (Fe, Si, Cu, Ti) in the diffusion field surrounding the growing Al{sub 3}(Sc,Zr) particle enhances the heterogeneous nucleation of Al{sub 3}(Sc,Zr) phases. - Highlights: • Most fine cubic primary Al{sub 3}(Sc,Zr) phases were observed within the α-Al matrix. • A layer by layer growth within primary Al{sub 3}(Sc,Zr) phase was observed. • A peritectic and subsequent eutectic reaction between Al{sub 3}Sc and Al was proposed. • Impurities in diffusion fields enhance heterogeneous nucleation of Al{sub 3}(Sc,Zr)

Accumulation of Pb, Hg, Cd, Se, Sc, Cr, Rb, Fe, Zn, Co in the plants and sludges of the Lake Balaton

International Nuclear Information System (INIS)

Teherani, D.K.; Altmann, H.; Wallisch, G.

1981-01-01

Various plants (Ceratophyllum demersum, Potamogeton pectinatus, Myriophyllum spicatum) and mud samples taken from Lake Balaton (Paloznak, Balatonfuezfoe) in June 1978 were analyzed for Se, Cr, Sc, Rb, Fe, Zn, Co by neutron activation analysis and for Cd, Pb, Hg by atomic absorption spectrometry. The concentration values found for Se ranged between 0.25-1.2 ppm (plant) and 0.99-1.47 ppm (mud), for Cr 1.6-6 ppm (plant) and 4.85-40.75 ppm (mud), for Sc 0.4-0.75 ppm (plant) and 3.25-5.87 ppm (mud), for Rb 6.75-16 ppm (plant) and 17-48.75 ppm (mud), for Fe 636.7-4491 ppm (plant) and 11034-12057 ppm (mud), for Zn 20.5-38.5 ppm (plant) and 29.75-41.75 ppm (mud), for Co 0.77-4.75 ppm (plant) and 4.87-5.5 ppm (mud), for Pb 4.5-23.5 ppm (plant) and 18-28 ppm (mud), for Cd <0.03 ppm (plant, mud), for Hg <0.01-0.07 ppm (plant) and 0.04-0.08 ppm (mud). (author)

Experiment data report for semiscale MOD-1 tests S-03-A, S-03-B, S-03-C, and S-03-D (reflood heat transfer tests)

International Nuclear Information System (INIS)

1976-05-01

Recorded test data are presented for Tests S-03-A, S-03-B, S-03-C, and S-03-D of the Semiscale Mod-1 reflood heat transfer series (Test Series 3). The tests conducted in this series are separate effects core reflood tests performed to determine the reflood heat transfer characteristics of the 5.5 foot Mod-1 rod bundle. Tests S-03-A through S-03-D were forced-feed reflood tests in which the reflood rate was held constant during each test. The tests were conducted to investigate the effects on system response resulting from variations in operating conditions of pressure, temperature, core power, reflood coolant, subcooling, and peak heater rod thermocouple temperature at reflood initiation. Test S-03-A was conducted from an initial system temperature of about 230 0 F at a pressure of 20 psia. Tests S-03-B through S-03-D were conducted from an initial system temperature of about 290 0 F at a pressure of 60 psia. In all four tests, reflood coolant was injected directly into the core barrel by means of a specially designed core inlet manifold. The electrically heated core was used in the pressure vessel to simulate the effects of a nuclear core during reflood. All four tests were conducted with a flat radial power profile. During reflood, core power was reduced from the initial level according to the American Nuclear Society (ANS) decay heat curve plus 20 percent for pressurized water reactor (PWR) core decay heat. The cold leg broken loop piping was open to the pressure suppression system (PSS). A separate steam supply system connected to the PSS was controlled to maintain constant pressure during the tests

Lanthanide-doped NaScF4 nanoprobes: crystal structure, optical spectroscopy and biodetection.

Science.gov (United States)

Ai, Yu; Tu, Datao; Zheng, Wei; Liu, Yongsheng; Kong, Jintao; Hu, Ping; Chen, Zhuo; Huang, Mingdong; Chen, Xueyuan

2013-07-21

Trivalent lanthanide ions (Ln(3+))-doped inorganic nanoparticles (NPs) as potential luminescent bioprobes have been attracting tremendous interest because of their unique upconversion (UC) and downconversion (DC) luminescence properties. NaScF4, as an important host material, has been rarely reported and its crystal structure remains unclear. Herein, based on the single crystal X-ray diffraction, the space group of NaScF4 crystals was determined to be P31 containing multiple sites of Sc(3+) with crystallographic site symmetry of C1, which was verified by high-resolution photoluminescence spectroscopy of Eu(3+) at low temperature (10 K). Furthermore, monodisperse and size-controllable NaScF4:Ln(3+) NPs were synthesized via a facile thermal decomposition method. The biotinylated NaScF4:Er(3+)/Yb(3+) NPs were demonstrated for their applications as a heterogeneous UC luminescence bioprobe to detect avidin with a detection limit of 180 pM. After bioconjugation with amino-terminal fragment (ATF) of urokinase plasminogen activator (uPA), NaScF4:Ln(3+) NPs also exhibited specific recognition of cancer cells overexpressed with uPA receptor (uPAR, an important marker of tumor biology and metastasis), showing great potentials in tumor-targeted bioimaging.

Reduction of the thermal conductivity of the thermoelectric material ScN by Nb alloying

DEFF Research Database (Denmark)

Tureson, Nina; Van Nong, Ngo; Fournier, Daniele

2017-01-01

) orientation. The crystal structure, morphology, thermal conductivity, and thermoelectric and electrical properties were investigated. The ScN reference film exhibited a Seebeck coefficient of −45 μV/K and a power factor of 6 × 10−4 W/m K2 at 750 K. Estimated from room temperature Hall measurements, all...... samples exhibit a high carrier density of the order of 1021 cm−3. Inclusion of heavy transition metals into ScN enables the reduction in thermal conductivity by an increase in phonon scattering. The Nb inserted ScN thin films exhibited a thermal conductivity lower than the value of the ScN reference (10.......5 W m−1 K−1) down to a minimum value of 2.2 Wm−1 K−1. Insertion of Nb into ScN thus resulted in a reduction in thermal conductivity by a factor of ∼5 due to the mass contrast in ScN, which increases the phonon scattering in the material....

TRAC posttest calculations of Semiscale Test S-06-3

International Nuclear Information System (INIS)

Ireland, J.R.; Bleiweis, P.B.

1980-01-01

A comparison of Transient Reactor Analysis Code (TRAC) steady-state and transient results with Semiscale Test S-06-3 (US Standard Problem 8) experimental data is discussed. The TRAC model used employs fewer mesh cells than normal data comparison models so that TRAC's ability to obtain reasonable results with less computer time can be assessed. In general, the TRAC results are in good agreement with the data and the major phenomena found in the experiment are reproduced by the code with a substantial reduction in computing times

2003 Reson 8101ER Multibeam Sonar Data from Cruise OES-03-06/AHI-03-06, Data Set Name Midway.

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Reson 8101ER multibeam Data were collected between 29 July - 8 August 2003 (JD 210-220) aboard NOAA Survey Launch Acoustic Habitat Investigator (AHI) at Midway...

Final Scientific/Technical Report from Hofstra University on DE-SC0001985

Energy Technology Data Exchange (ETDEWEB)

Farmer, E. Christa [Hofstra Univ., Hempstead, NY (United States)

2016-12-20

The U.S. Department of Energy award DE-SC0001985 funded the Hofstra University Center for Climate Study (HUCCS) from 29 September 2009 through 1 October 2016. This support enabled several activities over the period of the grant, including 1) the pursuit of several research projects, including sediment coring of coastal marshes, analysis of habitat impact due to climate change, and effects of raindrops of CO2 transfer; 2) support for multiple graduate and undergraduate students, and sponsorship of research projects that involved high school students; 3) fostering mentoring relationships and networking; 4) the design, creation, and installation of an exhibit on climate change at the Cradle of Aviation Museum in Garden City, NY as an effort of public outreach. A total of 11 presentations at conferences, one book, and one peer-reviewed journal article resulted from these activities.

Optimizing complex scandium-3,3 benzilidene BIS [4-hydroxycoumarin] with 46Sc radiotracer

International Nuclear Information System (INIS)

Khanza Aktari Dewi; Muhamad Basit Febrian; Duyeh Setiawan

2015-01-01

Coumarin, coumarin derivatives and coumarin complex compounds known to possess biological activities such as anticancer and antiviral. The reaction between the active compound coumarin derivatives with radioisotopes Sc-46 is expected to give a complex that will be marked for further investigation of its biological activity in purpose of drug development based on coumarin. This study aims to determine the optimum conditions in the synthesis of its complex compounds as well as the physico chemical characteristics including physical properties and radiochemical purity of the complex. 3.3 benzilidene bis [4-hydroxycoumarin] ligand has successfully synthesized by reacting 4-hydroxycoumarin with benzaldehyde. Complex solids formed instantly when the solution ScCl 3 labeled by Sc-46 with a pH of 5 is reacted with a ligand solution with a pH of 11 with the optimum ratio of Sc: ligand were 1:2 with optimum labeling percentage of 99,75 ± 0,02%. FTIR analysis of complex compounds and ligands show some shift in absorption due to the formation of complex. Melting point of ligand was 234°C whilst complex compound was not yet melted in maximum range of Fischer-Jons instrument at 300°C. The complex was white reddish coloured and well soluble in DMSO. Radiochemical purity of the complex Sc-(3,3 benzilidene bis [4-hydroxycoumarin]) 2 .2H 2 O was 91.22%. Complex compound of coumarin labeled by Sc-46 has been successfully synthesized and characterized with proposed molecular formula of Sc-(3,3 benzilidene bis [4-hydroxycoumarin]) 2 .2H 2 O. (author)

High Reflectance Nanoscale V/Sc Multilayer for Soft X-ray Water Window Region.

Science.gov (United States)

Huang, Qiushi; Yi, Qiang; Cao, Zhaodong; Qi, Runze; Loch, Rolf A; Jonnard, Philippe; Wu, Meiyi; Giglia, Angelo; Li, Wenbin; Louis, Eric; Bijkerk, Fred; Zhang, Zhong; Wang, Zhanshan

2017-10-10

V/Sc multilayer is experimentally demonstrated for the first time as a high reflectance mirror for the soft X-ray water window region. It primarily works at above the Sc-L edge (λ = 3.11 nm) under near normal incidence while a second peak appears at above the V-L edge (λ = 2.42 nm) under grazing incidence. The V/Sc multilayer fabricated with a d-spacing of 1.59 nm and 30 bilayers has a smaller interface width (σ = 0.27 and 0.32 nm) than the conventional used Cr/Sc (σ = 0.28 and 0.47 nm). For V/Sc multilayer with 30 bilayers, the introduction of B 4 C barrier layers has little improvement on the interface structure. As the number of bilayers increasing to 400, the growth morphology and microstructure of the V/Sc layers evolves with slightly increased crystallization. Nevertheless, the surface roughness remains to be 0.25 nm. A maximum soft X-ray reflectance of 18.4% is measured at λ = 3.129 nm at 9° off-normal incidence using the 400-bilayers V/Sc multilayer. According to the fitted model, an s-polarization reflectance of 5.2% can also be expected at λ = 2.425 nm under 40° incidence. Based on the promising experimental results, further improvement of the reflectance can be achieved by using a more stable deposition system, exploring different interface engineering methods and so on.

An Original Transformer and Switched-Capacitor (T & SC-Based Extension for DC-DC Boost Converter for High-Voltage/Low-Current Renewable Energy Applications: Hardware Implementation of a New T & SC Boost Converter

Directory of Open Access Journals (Sweden)

Sanjeevikumar Padmanaban

2018-03-01

Full Text Available In this article a new Transformer and Switched Capacitor-based Boost Converter (T & SC-BC is proposed for high-voltage/low-current renewable energy applications. The proposed T & SC-BC is an original extension for DC-DC boost converter which is designed by utilizing a transformer and switched capacitor (T & SC. Photovoltaic (PV energy is a fast emergent segment among the renewable energy systems. The proposed T & SC-BC combines the features of the conventional boost converter and T & SC to achieve a high voltage conversion ratio. A Maximum Power Point Tracking (MPPT controller is compulsory and necessary in a PV system to extract maximum power. Thus, a photovoltaic MPPT control mechanism also articulated for the proposed T & SC-BC. The voltage conversion ratio (Vo/Vin of proposed converter is (1 + k/(1 − D where, k is the turns ratio of the transformer and D is the duty cycle (thus, the converter provides 9.26, 13.88, 50/3 voltage conversion ratios at 78.4 duty cycle with k = 1, 2, 2.6, respectively. The conspicuous features of proposed T & SC-BC are: (i a high voltage conversion ratio (Vo/Vin; (ii continuous input current (Iin; (iii single switch topology; (iv single input source; (v low drain to source voltage (VDS rating of control switch; (vi a single inductor and a single untapped transformer are used. Moreover, the proposed T & SC-BC topology was compared with recently addressed DC-DC converters in terms of number of components, cost, voltage conversion ratio, ripples, efficiency and power range. Simulation and experimental results are provided which validate the functionality, design and concept of the proposed approach.

Superconducting accelerating structures for very low velocity ion beams

Energy Technology Data Exchange (ETDEWEB)

Xu, J.; Shepard, K.W.; Ostroumov, P.N.; Fuerst, J.D.; Waldschmidt, G.; /Argonne; Gonin, I.V.; /Fermilab

2008-01-01

This paper presents designs for four types of very-low-velocity superconducting accelerating cavity capable of providing several MV of accelerating potential per cavity, and suitable for particle velocities in the range 0.006 < v/c < 0.06. Superconducting TEM-class cavities have been widely applied to CW acceleration of ion beams. SC linacs can be formed as an array of independently-phased cavities, enabling a variable velocity profile to maximize the output energy for each of a number of different ion species. Several laboratories in the US and Europe are planning exotic beam facilities based on SC linacs. The cavity designs presented here are intended for the front-end of such linacs, particularly for the post-acceleration of rare isotopes of low charge state. Several types of SC cavities have been developed recently to cover particle velocities above 0.06c. Superconducting four-gap quarter-wave resonators for velocities 0.008 < {beta} = v/c < 0.05 were developed about two decades ago and have been successfully operated at the ATLAS SC linac at Argonne National Laboratory. Since that time, progress in simulation tools, cavity fabrication and processing have increased SC cavity gradients by a factor of 3-4. This paper applies these tools to optimize the design of a four-gap quarter-wave resonator for exotic beam facilities and other low-velocity applications.

Ferromagnetism carried by highly delocalized hybrid states in Sc-doped ZnO thin films

KAUST Repository

Benali Kanoun, Mohammed

2012-05-29

We present first-principles results for Sc-doped ZnOthin films. Neighboring Sc atoms in the surface and/or subsurface layers are found to be coupled ferromagnetically, where only two of the possible configurations induce spin polarization. In the first configuration, the polarization is carried by the Sc d states as expected for transition metaldoping. However, there is a second configuration which is energetically favorable. It is governed by polarized hybrid states of the Zns, O p, and Sc d orbitals. Such highly delocalized states can be an important ingredient for understanding the magnetism of dopedZnOthin films.

Magnetic ground state of Ti{sub 1-x}Sc{sub x}Fe{sub 2} system

Energy Technology Data Exchange (ETDEWEB)

Saoudi, M.; Deportes, J.; Ouladdiaf, B. E-mail: ouladdiaf@ill.fr

2001-06-01

The magnetic ground states of the Laves phases Ti{sub 1-x}Sc{sub x}Fe{sub 2} system have been investigated by means of powder neutron diffraction and magnetisation techniques. For x=0.23, a transition is observed from a collinear ferromagnet along the c-axis to a canted one at T{sub f}=200 K. For x=0.27, 0.3, 0.33, an additional first-order transition is observed at T{sub t1}{approx}120 K accompanied by a large magnetovolume anomaly associated to a jump of the magnetic moment of the Fe atoms at the 2a site. The magnetic moment instability in a frustrated lattice should be considered to interpret this transition, although most of the other magnetic states can be discussed within Moriya's theory for itinerant electron systems with competing ferromagnetic and antiferromagnetic spin fluctuations.

Attenuation of short-period P, PcP, ScP, and pP waves in the earth's mantle

International Nuclear Information System (INIS)

Bock, G.; Clements, J.R.

1982-01-01

The parameter t* (ratio of body wave travel time to the average quality factor Q) was estimated under various assumptions of the nature of the earthquake sources for short-period P, PcP, and ScP phases originating from earthquakes in the Fiji-Tonga region and recorded at the Warramunga Seismic Array at Tennant Creek (Northern Territory, Australia). Spectral ratios were calculated for the amplitudes of PcP to P and of pP to P. The data reveal a laterally varying Q structure in the Fiji-Tonga region. The high-Q lithosphere descending beneath the Tonga Island arc is overlain above 350 km depth by a wedgelike zone of high attenuation with an average Q/sub α/ between 120 and 200 at short periods. The upper mantle farther to the west of the Tonga island arc is less attenuating, with Q/sub α/, between 370 and 560. Q/sub α/ is about 500 in the upper mantle on the oceanic side of the subduction zone. The t* estimates of this study are much smaller than estimates from the free oscillation model SL8. This can be partly explained by regional variations of Q in the upper mantle. If no lateral Q variations occur in the lower mantle, a frequency-dependent Q can make the PcP and ScP observations consistent with model SL8. Adopting the absorption band model to describe the frequency dependence of Q, the parameter tau 2 , the cut-off period of the high-frequency end of the absorption band, was determined. For different source models with finite corner frequencies, the average tau 2 for the mantle is between 0.01 and 0.10 s (corresponding to frequencies between 16 and 1.6 Hz) as derived from the PcP data, and between 0.06 and 0.12 s (2.7 and 1.3 Hz), as derived from the ScP data

The Effect of Radiation on the Electrical Properties of Aluminum Gallium Nitride/Gallium Nitride Heterostructures

Science.gov (United States)

2008-06-01

potentials used in the discussion. ........... 41 15. Energy band diagram of an unpassivated HFET using Davinci showing the relative heights and...integration into a dose received in the material of interest. The tool used to perform these calculations is the TIGER Monte Carlo electron transport code [30...height and width of the second barrier a model of the HFETs was built in the Davinci modeling program [61]. The resulting energy band diagram is shown in

Update on the NSF PAARE Program at SC State

Science.gov (United States)

Walter, Donald K.; Ajello, Marco; Brittain, Sean D.; Cash, Jennifer; Hartmann, Dieter; Ho, Shirley; Howell, Steve B.; King, Jeremy R.; Leising, Mark D.; Smith, Daniel M.

2017-01-01

We report on results from our NSF PAARE program during Year 2 of the project. Our partnership under this PAARE award includes South Carolina State University (a Historically Black College/University), Clemson University (a Ph.D. granting institution) as well as individual investigators at NASA Ames and Carnegie Mellon University. Our recent work on variable and peculiar stars, work with the Kepler Observatory and our educational products in cosmology for non-STEM majors will be presented. We have successfully piloted sharing our teaching resources by offering an upper-level astrophysics course taught at Clemson via video conferencing , allowing a graduating senior from SC State to take a course not available through his home institution. Additionally, we are working on a memorandum of agreement between the two institutions that will allow for the seamless transfer of an undergraduate from SC State to Clemson’s graduate program in physics and astronomy. Our curriculum work includes new web-based cosmology activities and laboratory experiments. SC State undergraduates are reporting at this conference on their work with the light curves of semiregular variables using Kepler data. Additionally, we are heavily involved in the Citizen CATE Experiment. A PAARE scholarship student from SC State and the PAARE PI traveled to Indonesia for the March 2016 solar eclipse. Their results are also being presented elsewhere at this conference (see Myles McKay’s poster). Support for this work includes our NSF PAARE award AST-1358913 as well as resources and support provided by Clemson University and the National Optical Astronomy Observatory. Additional support has been provided by the South Carolina Space Grant Consortium and from NASA to SC State under awards NNX11AB82G and NNX13AC24G. CATE work has been supported by NASA SMD award NNX16AB92A to the National Solar Observatory. Additional details can be found at: http://physics.scsu.edu

Isospin excitation of nucleus in 42,44,48Ca (p,n)42,44,48Sc

International Nuclear Information System (INIS)

Suzuki, Keiji

2002-01-01

To obtain information of (p,n) reaction of heavy nucleus in 100 MeV or less, 42,44,48 Ca(p,n) 42,44,48 Sc was observed on the Cyclotron Radio Isotope Center in Tohoku University. The experimental results showed that 7, 8 and 10 spin parities were determined for 42 Sc, 44 Sc and 48 SC, respectively. It was the first determination of one and two negative parity transition of 42 Sc and 48 Sc,respectively, by (p,n) reaction. The full space wave function made by 0f1p shell effective interaction by Richter,et al is good accuracy and reliability. On the (p,n) reaction at E p =35 MeV, the transition matrix elements of 42 Ca, 44 Ca and 48 Ca were derived. On the experiment of 42 Ca(p,n) 42 Sc at E p 2 on energy was agreed with the calculation results by Franey and Love. The nuclear structure of 42 Ca was thought to show more stronger U(4) symmetry, because strong GT transition at T=1 was not observed, which was expected by j-j bonding shell model calculation. (S.Y.)

Crystal, magnetic, calorimetric and electronic structure investigation of GdScGe1-x Sb x compounds

Science.gov (United States)

Guillou, F.; Pathak, A. K.; Hackett, T. A.; Paudyal, D.; Mudryk, Y.; Pecharsky, V. K.

2017-12-01

Experimental investigations of crystal structure, magnetism and heat capacity of compounds in the pseudoternary GdScGe-GdScSb system combined with density functional theory projections have been employed to clarify the interplay between the crystal structure and magnetism in this series of RTX materials (R  =  rare-earth, T   =  transition metal and X  =  p-block element). We demonstrate that the CeScSi-type structure adopted by GdScGe and CeFeSi-type structure adopted by GdScSb coexist over a limited range of compositions 0.65 ≤slant x ≤slant 0.9 . Antimony for Ge substitutions in GdScGe result in an anisotropic expansion of the unit cell of the parent that is most pronounced along the c axis. We believe that such expansion acts as the driving force for the instability of the double layer CeScSi-type structure of the parent germanide. Extensive, yet limited Sb substitutions 0 ≤slant x disappearance of the induced magnetic moments on Sc. For the parent antimonide, heat capacity measurements indicate an additional transition below the main antiferromagnetic transition.

Fast conversion of scFv to Fab antibodies using type IIs restriction enzymes.

Science.gov (United States)

Sanmark, Hanna; Huovinen, Tuomas; Matikka, Tero; Pettersson, Tiina; Lahti, Maria; Lamminmäki, Urpo

2015-11-01

Single chain variable fragment (scFv) antibody libraries are widely used for developing novel bioaffinity reagents, although Fab or IgG molecules are the preferred antibody formats in many final applications. Therefore, rapid conversion methods for combining multiple DNA fragments are needed to attach constant domains to the scFv derived variable domains. In this study we describe a fast and easy cloning method for the conversion of single framework scFv fragments to Fab fragments using type IIS restriction enzymes. All cloning steps excluding plating of the Fab transformants can be done in 96 well plates and the procedure can be completed in one working day. The concept was tested by converting 69 scFv clones into Fab format on 96 well plates, which resulted in 93% success rate. The method is particularly useful as a high-throughput tool for the conversion of the chosen scFv clones into Fab molecules in order to analyze them as early as possible, as the conversion can significantly affect the binding properties of the chosen clones. Copyright © 2015 Elsevier B.V. All rights reserved.

The Constitutional Review Chamber of the Republic of Estonia judgment : no. of the case 3-4-1-1-03 : date of decision 17 February 2003

Index Scriptorium Estoniae

2003-01-01

Riigikohtu lahendi 3-4-1-1-03 (Vabariigi Valitsuse 06. 11. 1996 määrusega nr. 268 kinnitatud "Maa enampakkumisega erastamise korra" p. 47 vastavuse kontrollimiseks Põhiseaduse §-ga 11) tekst inglise keeles

ESO65-SC03, Teutsch 106, Turner 6

Indian Academy of Sciences (India)

GIREESH C. JOSHI

2017-11-27

Nov 27, 2017 ... and two colour magnitude ratio (TCMR) values of each cluster is determined by utilizing the WISE and PPMXL .... In some cases, the stellar density of two identified sequences ...... The multi-band catalogue seems to be more ...

β decay and isomeric properties of neutron-rich Ca and Sc isotopes

International Nuclear Information System (INIS)

Crawford, H. L.; Mantica, P. F.; Berryman, J. S.; Stoker, J. B.; Janssens, R. V. F.; Carpenter, M. P.; Kay, B. P.; Lauritsen, T.; Zhu, S.; Broda, R.; Cieplicka, N.; Fornal, B.; Grinyer, G. F.; Minamisono, K.; Hoteling, N.; Stefanescu, I.; Walters, W. B.

2010-01-01

The isomeric and β-decay properties of neutron-rich 53-57 Sc and 53,54 Ca nuclei near neutron number N=32 are reported, and the low-energy level schemes of 53,54,56 Sc and 53-57 Ti are presented. The low-energy level structures of the 21 Sc isotopes are discussed in terms of the coupling of the valence 1f 7/2 proton to states in the corresponding 20 Ca cores. Implications with respect to the robustness of the N=32 subshell closure are discussed, as well as the repercussions for a possible N=34 subshell closure.

Investigating the local structure of B-site cations in (1-x)BaTiO3-xBiScO3 and (1-x)PbTiO3-xBiScO3 using X-ray absorption spectroscopy

Science.gov (United States)

Blanchard, Peter E. R.; Grosvenor, Andrew P.

2018-05-01

The structural properties of (1-x)BaTiO3-xBiScO3 and (1-x)PbTiO3-xBiScO3 were investigated using powder X-ray diffraction and X-ray absorption spectroscopy. Diffraction measurements confirmed that substituting small amounts of BiScO3 into BaTiO3 initially stabilizes a cubic phase at x = 0.2 before impurity phases begin to form at x = 0.5. BiScO3 substitution also resulted in noticeable changes in the local coordination environment of Ti4+. X-ray absorption near-edge spectroscopy (XANES) analysis showed that replacing Ti4+ with Sc3+ results in an increase in the off-centre displacement of Ti4+ cations. Surprisingly, BiScO3 substitution has no effect on the displacement of the Ti4+ cation in the (1-x)PbTiO3-xBiScO3 solid solution.

Roberts-SC phocomelia syndrome.

Science.gov (United States)

Maheshwari, A; Kumar, P; Dutta, S; Narang, A

2001-06-01

A severely growth retarded baby was born at 38 weeks gestation. He had multiple craniofacial anomalies, microbrachycephaly, phocomelia in the upper limbs and renal cysts visible on ultrasound. He died of recurrent apneas. The autopsy showed left sided multicystic dysplastic kidney and absence of one testis. Cytogenetic studies did not reveal any abnormality. The phenotypic features match those described in the Roberts-SC phocomelia syndrome. A literature review revealed that 50% of these patients have chromosomal defects and antenatal detection is possible on ultrasound and by chromosome analysis of the amniocytes.

Original Research: Use of hydroxyurea and phlebotomy in pediatric patients with hemoglobin SC disease.

Science.gov (United States)

Summarell, Carly C Ginter; Sheehan, Vivien A

2016-04-01

Hydroxyurea is an excellent therapeutic agent for the pharmacological induction of HbF in patients with sickle cell disease (SCD). However, all completed clinical trials of hydroxyurea have excluded patients with hemoglobin SC (HbSC) disease. HbSC differs significantly in pathophysiology from HbSS, as HbC does not sickle, but instead causes cellular dehydration which potentiates sickling of HbS. Many severely affected HbSC patients have been placed on hydroxyurea on a case by case basis, but there are no large scale prospective data on safety or efficacy of hydroxyurea in this subset of patients with SCD. Here, we report a case series of 14 pediatric patients with HbSC treated to maximum tolerated dose (MTD) with hydroxyurea. Those who failed to show clinical improvement after at least six months at MTD were offered phlebotomy in addition to hydroxyurea. Five out of 11 patients with HbSC who achieved MTD failed to demonstrate clinical improvement on hydroxyurea. Of the four placed on dual hydroxyurea and phlebotomy therapy, all showed at least partial clinical improvement. Percent dense red blood cells (%DRBC) were measured via an ADVIA hematology analyzer. A marked rise in percent dense cells preceded clinical complications in three patients. Dual therapy with hydroxyurea and phlebotomy may be an effective approach to patients with HbSC that do not experience improvement with hydroxyurea alone. Monitoring of %DRBC may predict adverse events and aid in assessing hydroxyurea compliance. Large scale clinical trials are needed to evaluate the safety and efficacy of hydroxyurea and hydroxyurea with phlebotomy in patients with HbSC disease. © 2016 by the Society for Experimental Biology and Medicine.

Timescale differences between SC-PDSI and SPEI for drought monitoring in China

Science.gov (United States)

Zhao, Haiyan; Gao, Ge; An, Wei; Zou, Xukai; Li, Haitao; Hou, Meiting

2017-12-01

The Palmer Drought Severity Index (PDSI) has been widely used to monitor drought. Its characteristics are more suitable for measuring droughts of longer timescales, and this fact has not received much attention. The Standardized Precipitation Evapotranspiration Index (SPEI) can better reflect the climatic water balance, owing to its combination of precipitation and potential evapotranspiration. In this study, we selected monthly average air temperature and precipitation data from 589 meteorological stations of China's National Meteorological Information Center, to compare the effects of applying a self-calibrating PDSI (SC-PDSI) and SPEI to monitor drought events in the station regions, with a special focus on differences of event timescale. The results show the following. 1) Comparative analysis using SC-PDSI and SPEI for drought years and characters of three dry periods from 1961 to 2011 in the Beijing region showed that durations of SC-PDSI-based dry spells were longer than those of 3-month and 6-month SPEIs, but equal to those of 12-month or longer timescale SPEIs. 2) For monitoring evolution of the fall 2009 to spring 2010 Southwest China drought and spring 2000 Huang-Huai drought, 3-month SPEI could better monitor the initiation, aggravation, alleviation and relief of drought in the two regions, whereas the SC-PDSI was insensitive to drought recovery because of its long-term memory of previous climate conditions. 3) Analysis of the relationship between SC-PDSI for different regions and SPEI for different timescales showed that correlation of the two indexes changed with region, and SC-PDSI was maximally correlated with SPEI of 9-19 months in China. Therefore, SC-PDSI is only suitable for monitoring mid- and long-term droughts, owing to the strong lagged autocorrelation such as 0.4786 for 12-month lagged ones in Beijing, whereas SPEI is suitable for both short- and long-term drought-monitoring and should have greater application prospects in China.

The use of the Fourier Transform Infrared spectroscopy to determine adulterants in raw milk

Directory of Open Access Journals (Sweden)

Laerte Dagher Cassoli

2011-11-01

Full Text Available The objective of this study was to develop calibrations to determine the concentration of some milk adulterants by using the automated methodology of Fourier Transform Infrared (FTIR. For construction of calibrations, samples were collected from 100 farms in the states of São Paulo and Minas Gerais. Samples were tainted with three different adulterants commonly used in the adulteration of raw milk: sodium bicarbonate (SB, sodium citrate (SC and cheese whey (W. Each adulterant was used at three different concentrations (SB: 0.05, 0.10 and 0.25%; SC: 0.025, 0.050 and 0.075% and W: 5, 10 and 20%. For validation, 60 samples were collected in other farms, which were not considered at the development stage of calibration. Adulterants were added at the following concentrations: 0.03, 0.06, 0.10 and 0.12% for SB; 0.02, 0.04, 0.06 and 0.08% for SC and 5, 10 and 20% for W. Performance of each calibration was evaluated in terms of accuracy (Se, detection limit (DL and determination coefficient (R². All calibrations presented R² higher than 0.91 with DL of 0.015%; 0.017% and 3.9% for SB, SC and W, respectively. Accuracy was 0.005%, 0.009% and 2.26% for SB, SC and W, respectively. Results show that the FTIR methodology can be used for determining the concentration of sodium bicarbonate, sodium citrate and whey in raw milk. Associated with automated equipment, it is a viable option for monitoring these adulterants, having low operational costs and high analytical performance as additional features.

Cytogenetic diagnosis of Roberts SC phocomelia syndrome: First ...

African Journals Online (AJOL)

Tahir M. Malla

2015-07-14

/licenses/by-nc-nd/4.0/). 1. Introduction. Roberts SC phocomelia syndrome is an autosomal recessive developmental disorder characterized by pre and postnatal growth retardation, microcephaly, craniofacial anomalies,.

77 FR 51475 - Safety Zone; Apache Pier Labor Day Fireworks; Myrtle Beach, SC

Science.gov (United States)

2012-08-24

...-AA00 Safety Zone; Apache Pier Labor Day Fireworks; Myrtle Beach, SC AGENCY: Coast Guard, DHS. ACTION... Atlantic Ocean in the vicinity of Apache Pier in Myrtle Beach, SC, during the Labor Day fireworks... [[Page 51476

Intracellular scFvs against the viral E6 oncoprotein provoke apoptosis in human papillomavirus-positive cancer cells

International Nuclear Information System (INIS)

Lagrange, Magali; Boulade-Ladame, Charlotte; Mailly, Laurent; Weiss, Etienne; Orfanoudakis, Georges; Deryckere, Francois

2007-01-01

The E6 protein of human papillomavirus type 16 (16E6) is involved in the tumorigenesis of human cervical cells by targeting numerous cellular proteins. We have designed a strategy for neutralizing 16E6 based on the intracellular expression of single-chain Fv antibodies (scFvs) specific to 16E6. Recombinant adenovirus vectors were constructed to allow expression of two 16E6-binding scFvs and one 16E6-non-binding scFv in HPV16-positive and -negative cells. Expression of the scFvs provoked two types of effects: (i) inhibition of proliferation of all cell lines tested, this aspecific toxicity being likely due to the aggregation of unfolded scFvs; and (ii) apoptosis observed only in HPV16-positive cervical cancer cell lines after expression of 16E6-binding scFvs, this specific effect being proportional to the intracellular solubility of the scFvs. These data demonstrate the feasibility of intracellular immunization with anti-16E6 scFvs and highlight the importance of the solubility of the intracellular antibodies

High speed heterostructure devices

CERN Document Server

Beer, Albert C; Willardson, R K; Kiehl, Richard A; Sollner, T C L Gerhard

1994-01-01

Volume 41 includes an in-depth review of the most important, high-speed switches made with heterojunction technology. This volume is aimed at the graduate student or working researcher who needs a broad overview andan introduction to current literature. Key Features * The first complete review of InP-based HFETs and complementary HFETs, which promise very low power and high speed * Offers a complete, three-chapter review of resonant tunneling * Provides an emphasis on circuits as well as devices.

Synthesis and crystal structure of the first Sc-Nb-O-N phases

Energy Technology Data Exchange (ETDEWEB)

Orthmann, Steven; Lerch, Martin [Institut fuer Chemie, Technische Universitaet Berlin (Germany)

2017-11-17

Synthesis of phase-pure materials in the system Sc-Nb-O-N is challenging. In this contribution we report on the preparation of the first scandium niobium oxide nitrides via reaction of water-saturated gaseous ammonia or an ammonia-oxygen mixture with amorphous scandium niobium oxides. Two new phases were obtained: rutile-type ScNb{sub 4}O{sub 7}N{sub 3}, which crystallizes in space group P4{sub 2}/mnm, and an anion-deficient fluorite-type Sc{sub 2}Nb(O,N,⬜){sub 6} phase crystallizing in space group Fm anti 3m. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

Magnet measuring equipment of SC2

CERN Multimedia

1974-01-01

Checking the positioning of the magnet measuring equipment installed between the poles of SC2. The steel structure in front of the magnet is designed to house the rotary condenser and to shield it from the stray magnetic field of the accelerator. On the left, Marinus van Gulik. (See Photo Archive 7402005 and Annual Report 1974, p. 44.)

Generalized magnetic susceptibilities in metals: application of the analytic tetrahedron linear energy method to Sc

International Nuclear Information System (INIS)

Rath, J.; Freeman, A.J.

1975-01-01

A detailed study of the generalized susceptibility chi(vector q) of Sc metal determined from an accurate augmented-plane-wave method calculation of its energy-band structure is presented. The calculations were done by means of a computational scheme for chi(vector q) derived as an extension of the work of Jepsen and Andersen and Lehmann and Taut on the density-of-states problem. The procedure yields simple analytic expressions for the chi(vector q) integral inside a tetrahedral microzone of the Brillouin zone which depends only on the volume of the tetrahedron and the differences of the energies at its corners. Constant-matrix-element results have been obtained for Sc which show very good agreement with the results of Liu, Gupta, and Sinha (but with one less peak) and exhibit a first maximum in chi(vector q) at (0, 0, 0.31) 2π/c [vs (0, 0, 0.35) 2π/c obtained by Liu et al.] which relates very well to dilute rare-earth alloy magnetic ordering at vector q/sub m/ = (0, 0, 0.28) 2π/c and to the kink in the LA-phonon dispersion curve at (0, 0, 0.27) 2π/c. (U.S.)

Measurement of the elastic tensor of SmScO3 and NdScO3 using resonant ultrasound spectroscopy with ab initio calculations

Directory of Open Access Journals (Sweden)

K. A. Pestka II

2011-09-01

Full Text Available The complete elastic tensors of SmScO3 and NdScO3 were measured using resonant ultrasound spectroscopy (RUS in combination with ab-initio calculations. Measurement of the elastic tensor of these recently synthesized single crystal RE scandates is essential for understanding dynamic lattice applications including phonon confinement, strain induced thin film growth and superlattice construction. On average, the experimental elastic constants differed by less than 5% of the theoretical values, further validating the accuracy of modern ab-initio calculations as a means of estimating the initial elastic constants used in RUS measurements.

A novel fusion protein of IP10-scFv retains antibody specificity and chemokine function

International Nuclear Information System (INIS)

Guo Junqing; Chen Liu; Ai Hongwu; Jing Jiannian; Zhou Jiyong; Zhang Chuyu; You Shangyou

2004-01-01

We combined the specificity of tumor-specific antibody with the chemokine function of interferon-γ inducible protein 10 (IP-10) to recruit immune effector cells in the vicinity of tumor cells. A novel fusion protein of IP10-scFv was constructed by fusing mouse IP-10 to V H region of single-chain Fv fragment (scFv) against acidic isoferritin (AIF), and expressed in NS0 murine myeloma cells. The IP10-scFv fusion protein was shown to maintain the specificity of the antiAIF scFv with similar affinity constant, and bind to the human hepatocarcinoma SMMC 7721 cells secreting AIF as well as the activated mouse T lymphocytes expressing CXCR3 receptor. Furthermore, the IP10-scFv protein either in solution or bound on the surface of SMMC 7721 cells induced significant chemotaxis of mouse T cells in vitro. The results indicate that the IP10-scFv fusion protein possesses both bioactivities of the tumor-specific antibody and IP-10 chemokine, suggesting its possibility to induce an enhanced immune response against the residual tumor cells in vivo

Conductivity ageing studies on 1M10ScSZ (M4+=Ce, Hf)

DEFF Research Database (Denmark)

Omar, Shobit; Bin Najib, Waqas; Bonanos, Nikolaos

2011-01-01

The long-term conductivity stability is tested on zirconia based electrolyte materials for solid oxide fuel cell applications. The ageing studies have been performed on the samples of ZrO2 co-doped with 10mol% of Sc2O3 and 1mol% MO2, where M = Ce or Hf (denoted respectively 1Ce10ScSZ and 1Hf10Sc......SZ) in oxidising and reducing atmospheres, at 600°C for 3000h. At 600°C, these compositions show initial conductivity of around 9–12mS∙cm−1 in air. After 3000h of ageing, no phase transitions are observed in any of the samples. For the first 1000h, the degradation rate is higher than in the subsequent 2000h......; thereafter, conductivity degrades linearly with time for all samples. In air, the loss in the conductivity is lower than in reducing conditions. The 1Ce10ScSZ shows the highest degradation rate of 3.8%/1000h in wet H2/N2 after the first 1000h of ageing. A colour change of the 1Ce10ScSZ sample from white...

TU-G-213-01: IEC and US Committee Activities and Organizational Structure

Energy Technology Data Exchange (ETDEWEB)

Ibbott, G. [UT MD Anderson Cancer Center (United States)

2015-06-15

The International Electrotechnical Commission (IEC) writes standards that manufacturers of electrical equipment must comply with. Medical electrical equipment, such as medical imaging, radiation therapy, and radiation dosimetry devices, fall under Technical Committee 62. Of particular interest to medical physicists are the standards developed within Subcommittees (SC) 62B, which addresses diagnostic radiological imaging equipment, and 62C, which addresses equipment for radiation therapy, nuclear medicine and dosimetry. For example, a Working Group of SC 62B is responsible for safety and quality assurance standards for CT scanners and a Working Group of SC 62C is responsible for standards that set requirements for dosimetric safety and accuracy of linacs and proton accelerators. IEC standards thus have an impact on every aspect of a medical physicist’s job, including equipment testing, shielding design, room layout, and workflow. Consequently, it is imperative that US medical physicists know about existing standards, as well as have input on those under development or undergoing revision. The structure of the IEC and current standards development work will be described in detail. The presentation will explain how US medical physicists can learn about IEC standards and contribute to their development. Learning Objectives: Learn about the structure of the IEC and the influence that IEC standards have on the design of equipment for radiology and radiation therapy. Learn about the mechanisms by which the US participates in the development and revision of standards. Understand the specific requirements of several standards having direct relevance to diagnostic and radiation therapy physicists.

Cytogenetic diagnosis of Roberts SC phocomelia syndrome: First report from Kashmir

Directory of Open Access Journals (Sweden)

Tahir M. Malla

2016-01-01

Full Text Available There are several syndromes in which specific mitotic chromosomal abnormalities can be seen, like premature centromere separation, premature (sister chromatid separation, and somatic aneuploidies. Identifications of such specific cytogenetic findings can be the key factor that leads towards the diagnosis of syndromes like Roberts SC phocomelia. The case presented here as Roberts SC phocomelia syndrome was identified as a child with multiple congenital anomalies and dysmorphic features. Conventional cytogenetic analysis of the case revealed premature sister chromatid separation. The premature centromeric separation was also confirmed by C banding analysis of the child. It is the first and the only case of Roberts SC phocomelia diagnosed from this part of the world. The present case report emphasizes the importance of conventional cytogenetics in the diagnosis of such syndromes.

Magnetic properties of Sc{sub x}Ti{sub 1-x}Fe{sub 2}

Energy Technology Data Exchange (ETDEWEB)

Kessler, M. [Lab. de Cristallographie, CNRS, 38 - Grenoble (France); Deportes, J. [Lab. Louis Neel, CNRS, 38 - Grenoble (France); Ouladdiaf, B. [Institut Laue-Langevin, 38 - Grenoble (France); Sayetat, F. [Lab. de Cristallographie, CNRS, 38 - Grenoble (France)

1995-02-09

The magnetic properties and their thermal dependences of Sc{sub 0.1}Ti{sub 0.9}Fe{sub 1.96}, Sc{sub 0.1}Ti{sub 0.9}Fe{sub 2} and Sc{sub 0.1}Ti{sub 0.9}Fe{sub 2.04} are compared with those of TiFe{sub 2}. The substitution changes the iron-iron distances. Consequently, the Fe atoms on the 6h site show in addition to the antiferromagnetic component a small ferromagnetic one, and a weak magnetic moment appears on the 2a site. ((orig.)).

Piezoelectric characterization of Sc0.26Al0.74N layers on Si (001) substrates

Science.gov (United States)

Sinusía Lozano, M.; Pérez-Campos, A.; Reusch, M.; Kirste, L.; Fuchs, Th; Žukauskaitė, A.; Chen, Z.; Iriarte, G. F.

2018-03-01

Scandium aluminum nitride (ScAlN) films have been synthesized by pulsed-DC reactive magnetron sputtering. The degree of c-axis orientation as well as piezoelectric characteristics of the Sc0.26Al0.74N thin films grown on Si (001) at various discharge powers and processing pressures values have been investigated. According to x-ray diffraction (XRD) measurements, the texture of the as-grown Sc0.26Al0.74N thin films becomes more prominent in the [0001]-direction at the highest target power (700 W) and at the lowest processing pressure (4 mTorr). The piezoelectric response, as determined by measuring the d33 piezoelectric constant, shows a maximum value of -12 pC/N also at 4 mTorr and 700 W, confirming a direct correlation between the d33 piezoelectric constant and the degree of orientation in the [0001]-direction. The atomic concentration of Sc and Al in the synthesized ScAlN thin film, determined by secondary ion mass spectroscopy (SIMS), reveals a Sc concentration lower than in the ScAl alloy target. The piezoresponse force microscopy (PFM) shows homogeneous polarity distribution with no inversion domains. The piezoelectric layers have been used to fabricate and measure surface acoustic wave (SAW) resonators on a Sc0.26Al0.74N/Si (001) bilayer system with resonance frequency of 1.4 GHz and coupling coefficient of 0.567. Such characteristic in the frequency response reveals the potential of these materials for advanced SAW devices in applications such as next generation (5 G) wireless communication systems.

Early Stages of Precipitation Process in Al-(Mn-)Sc-Zr Alloy Characterized by Positron Annihilation

KAUST Repository

Vlach, Martin; Cizek, Jakub; Melikhova, Oksana; Stulikova, Ivana; Smola, Bohumil; Kekule, Tomas; Kudrnova, Hana; Gemma, Ryota; Neubert, Volkmar

2015-01-01

Thermal effects on the precipitation stages in as-cast Al-0.70 at. pct Mn-0.15 at. pct Sc-0.05 at. pct Zr alloy were studied. The role of lattice defects was elucidated by positron annihilation spectroscopy (lifetime and coincidence Doppler broadening) enabling investigation of solutes clustering at the atomic scale. This technique has never been used in the Al-Sc- and/or Al-Zr-based alloys so far. Studies by positron annihilation were combined with resistometry, hardness measurements, and microstructure observations. Positrons trapped at defects are preferentially annihilated by Sc electrons. Lifetime of trapped positrons indicates that Sc atoms segregate at dislocations. Maximum fraction of positrons annihilated by Sc electrons occurring at 453 K (180 °C) suggests that clustering of Sc bound with vacancies takes place. It is followed by peak of this fraction at 573 K (300 °C). A rise of the contribution of trapped positrons annihilated by Zr electrons starting at 513 K (240 °C) and attaining maximum also at 573 K (300 °C) confirms that Zr participates in precipitation of the Al3Sc particles already at these temperatures. The pronounced hardening at 573 K (300 °C) has its nature in the precipitation of the Al3Sc particles with a Zr-rich shell. The contribution of trapped positrons annihilated by Mn electrons was found to be negligible. © 2015, The Minerals, Metals & Materials Society and ASM International.

Early Stages of Precipitation Process in Al-(Mn-)Sc-Zr Alloy Characterized by Positron Annihilation

KAUST Repository

Vlach, Martin

2015-01-29

Thermal effects on the precipitation stages in as-cast Al-0.70 at. pct Mn-0.15 at. pct Sc-0.05 at. pct Zr alloy were studied. The role of lattice defects was elucidated by positron annihilation spectroscopy (lifetime and coincidence Doppler broadening) enabling investigation of solutes clustering at the atomic scale. This technique has never been used in the Al-Sc- and/or Al-Zr-based alloys so far. Studies by positron annihilation were combined with resistometry, hardness measurements, and microstructure observations. Positrons trapped at defects are preferentially annihilated by Sc electrons. Lifetime of trapped positrons indicates that Sc atoms segregate at dislocations. Maximum fraction of positrons annihilated by Sc electrons occurring at 453 K (180 °C) suggests that clustering of Sc bound with vacancies takes place. It is followed by peak of this fraction at 573 K (300 °C). A rise of the contribution of trapped positrons annihilated by Zr electrons starting at 513 K (240 °C) and attaining maximum also at 573 K (300 °C) confirms that Zr participates in precipitation of the Al3Sc particles already at these temperatures. The pronounced hardening at 573 K (300 °C) has its nature in the precipitation of the Al3Sc particles with a Zr-rich shell. The contribution of trapped positrons annihilated by Mn electrons was found to be negligible. © 2015, The Minerals, Metals & Materials Society and ASM International.

Flexural behavior and design of steel-plate composite (SC) walls for accident thermal loading

Energy Technology Data Exchange (ETDEWEB)

Booth, Peter N., E-mail: boothpn@purdue.edu [Lyles School of Civil Engineering, Purdue University, West Lafayette, IN (United States); Varma, Amit H., E-mail: ahvarma@purdue.edu [Lyles School of Civil Engineering, Purdue University, West Lafayette, IN (United States); Sener, Kadir C., E-mail: ksener@purdue.edu [Lyles School of Civil Engineering, Purdue University, West Lafayette, IN (United States); Malushte, Sanjeev R. [Bechtel Corp., Frederick, MD (United States)

2015-12-15

Modular steel-plate composite (SC) safety-related nuclear power plant structures must be designed to resist accident thermal and mechanical loads. The design accident thermal load represents the condition where high pressure and temperature steam is released as result of a mechanical failure and applied against the surfaces of power plant structural walls. The effect of heating and pressure can have both short and long term effects on the mechanical integrity of SC structures including degradation and cracking of concrete infill, residual stresses, and out-of-plane deformations. The purpose of this research is to study the effects of thermal and mechanical loads on the out-of-plane flexural response of SC walls and to develop simplified equations that can be used to predict behavior. Four experimental beam tests are reported that represent full-scale cross-sections of SC walls subjected to combinations of mechanical and thermal loads. The study determined that thermal loads reduce the out-of-plane flexural stiffness of SC walls. For the ambient condition, the flexural stiffness closely matches a conventional elastic cracked-transformed model, and at elevated temperatures, the stiffness is reduced to a fully-cracked flexural stiffness that only takes into account the stiffness of the steel faceplates. A method is presented for estimating the thermal curvature, ϕ{sub th}, and thermal moment, M{sub th}, resulting from unequal heating of opposing faces of an SC wall. Based on the tests in this study, the application of accident thermal loads did not result in a reduction of the flexural strength of the SC section.

Properties of InGaAs/GaAs metal-oxide-semiconductor heterostructure field-effect transistors modified by surface treatment

Energy Technology Data Exchange (ETDEWEB)

Gregušová, D., E-mail: Dagmar.Gregusova@savba.sk [Institute of Electrical Engineering, Slovak Academy of Sciences, Dúbravská cesta 9, Bratislava SK-84104 (Slovakia); Gucmann, F.; Kúdela, R. [Institute of Electrical Engineering, Slovak Academy of Sciences, Dúbravská cesta 9, Bratislava SK-84104 (Slovakia); Mičušík, M. [Polymer Institute of Slovak Academy of Sciences, Dúbravská cesta 9, Bratislava SK-84541 (Slovakia); Stoklas, R.; Válik, L. [Institute of Electrical Engineering, Slovak Academy of Sciences, Dúbravská cesta 9, Bratislava SK-84104 (Slovakia); Greguš, J. [Faculty of Mathematics, Physics and Informatics, Comenius University, Mlynská dolina, Bratislava SK-84248 (Slovakia); Blaho, M. [Institute of Electrical Engineering, Slovak Academy of Sciences, Dúbravská cesta 9, Bratislava SK-84104 (Slovakia); Kordoš, P. [Institute of Electronics and Photonics, Faculty of Electrical Engineering and Information Technology STU, Ilkovičova 3, Bratislava SK-81219 (Slovakia)

2017-02-15

Highlights: • AlGaAs/InGaAs/GaAs-based metal oxide semiconductor transistors-MOSHFET. • Thin Al-layer deposited in-situ and oxidize in air – gate insulator. • MOSHFET vs HFET transistor properties, density of traps evaluated. - Abstract: GaAs-based heterostructures exhibit excellent carrier transport properties, mainly the high carrier velocity. An AlGaAs-GaAs heterostructure field-effect transistor (HFET) with an InGaAs channel was prepared using metal-organic chemical vapor deposition (MOVPE). An AlOx layer was formed on the AlGaAs barrier layer by the air-assisted oxidation of a thin Al layer deposited in-situ in an MOVPE reactor immediately after AlGaAs/InGaAs growth. The HFETs and MOSHFETs exhibited a very low trap state density in the order of 10{sup 11} cm{sup −2} eV{sup −1}. Capacitance measurement yielded no significant difference between the HFET and MOSHFET structures. The formation of an AlOx layer modified the surface by partially eliminating surface states that arise from Ga-and As-based native oxides. The presence of an AlOx layer reflected in a reduced gate leakage current, which was evidenced by the two-terminal transistor measurement. Presented preparation procedure and device properties show great potential of AlGaAs/InGaAs-based MOSHFETs.

Roberts-SC syndrome, a rare syndrome and cleft palate repair

Directory of Open Access Journals (Sweden)

Murthy Jyotsna

2008-01-01

Full Text Available Roberts SC syndrome is a rare syndrome with only 17 previously recognized patients reported in medical literature. The syndrome is characterized by multiple malformations, particularly, symmetrical limb reduction, craniofacial anomalies such as bilateral cleft lip and palate, micrognathia, and severe growth and mental retardation. Our patient, a young child of five years having Roberts-SC, was successfully operated for cleft palate under general anesthesia. The main features of the syndrome and the technical problems of anesthesia and surgery are discussed in this report.

Cytogenetic diagnosis of Roberts SC phocomelia syndrome: First report from Kashmir

OpenAIRE

Tahir M. Malla; Arshad A. Pandith; Fayaz A. Dar; Mahrukh H. Zargar

2016-01-01

There are several syndromes in which specific mitotic chromosomal abnormalities can be seen, like premature centromere separation, premature (sister) chromatid separation, and somatic aneuploidies. Identifications of such specific cytogenetic findings can be the key factor that leads towards the diagnosis of syndromes like Roberts SC phocomelia. The case presented here as Roberts SC phocomelia syndrome was identified as a child with multiple congenital anomalies and dysmorphic features. Conve...

Assaults on Days of Campaign Rallies During the 2016 US Presidential Election.

Science.gov (United States)

Morrison, Christopher N; Ukert, Benjamin; Palumbo, Aimee; Dong, Beidi; Jacoby, Sara F; Wiebe, Douglas J

2018-07-01

This study investigates whether assault frequency increased on days and in cities where candidates Donald Trump and Hillary Clinton held campaign rallies prior to the 2016 US Presidential election. We calculated city-level counts of police-reported assaults for 31 rallies for Donald Trump and 38 rallies for Hillary Clinton. Negative binomial models estimated the assault incidence on rally days (day 0) relative to that on eight control days for the same city (days -28, -21, -14, -7, +7, +14, +21, and +28). Cities experienced an increase in assaults (incidence rate ratio [IRR] = 1.12, 95% CI: 1.03-1.22) on the days of Donald Trump's rallies, and no change in assaults on the days of Hillary Clinton's rallies (IRR = 1.00; 95% CI: 0.94-1.06). Assaults increased on days when cities hosted Donald Trump's rallies during the 2016 Presidential election campaign.

Thermal neutron capture and resonance integral cross sections of {sup 45}Sc

Energy Technology Data Exchange (ETDEWEB)

Van Do, Nguyen; Duc Khue, Pham; Tien Thanh, Kim [Institute of Physics, Vietnam Academy of Science and Technology, 10 Dao Tan, Hanoi (Viet Nam); Thi Hien, Nguyen [Institute of Physics, Vietnam Academy of Science and Technology, 10 Dao Tan, Hanoi (Viet Nam); Department of Physics and Center for High Energy Physics, Kyungpook National University, Daegu 702-701 (Korea, Republic of); Kim, Guinyun, E-mail: gnkim@knu.ac.kr [Department of Physics and Center for High Energy Physics, Kyungpook National University, Daegu 702-701 (Korea, Republic of); Kim, Kwangsoo [Department of Physics and Center for High Energy Physics, Kyungpook National University, Daegu 702-701 (Korea, Republic of); Shin, Sung-Gyun; Cho, Moo-Hyun [Department of Advanced Nuclear Engineering, Pohang University of Science and Technology, Pohang 790-784 (Korea, Republic of); Lee, Manwoo [Research Center, Dongnam Institute of Radiological and Medical Science, Busan 619-953 (Korea, Republic of)

2015-11-01

The thermal neutron cross section (σ{sub 0}) and resonance integral (I{sub 0}) of the {sup 45}Sc(n,γ){sup 46}Sc reaction have been measured relative to that of the {sup 197}Au(n,γ){sup 198}Au reaction by means of the activation method. High-purity natural scandium and gold foils without and with a cadmium cover of 0.5 mm thickness were irradiated with moderated pulsed neutrons produced from the Pohang Neutron Facility (PNF). The induced activities in the activated foils were measured with a high purity germanium (HPGe) detector. In order to improve the accuracy of the experimental results the counting losses caused by the thermal (G{sub th}) and resonance (G{sub epi}) neutron self-shielding, the γ-ray attenuation (F{sub g}) and the true γ-ray coincidence summing effects were made. In addition, the effect of non-ideal epithermal spectrum was also taken into account by determining the neutron spectrum shape factor (α). The thermal neutron cross-section and resonance integral of the {sup 45}Sc(n,γ){sup 46}Sc reaction have been determined relative to the reference values of the {sup 197}Au(n,γ){sup 198}Au reaction, with σ{sub o,Au} = 98.65 ± 0.09 barn and I{sub o,Au} = 1550 ± 28 barn. The present thermal neutron cross section has been determined to be σ{sub o,Sc} = 27.5 ± 0.8 barn. According to the definition of cadmium cut-off energy at 0.55 eV, the present resonance integral cross section has been determined to be I{sub o,Sc} = 12.4 ± 0.7 barn. The present results are compared with literature values and discussed.

40 CFR 425.06 - Monitoring requirements.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Monitoring requirements. 425.06 Section 425.06 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS LEATHER TANNING AND FINISHING POINT SOURCE CATEGORY General Provisions § 425.06...

Compact Nd:YAG laser operating at 1.06, 1.32, and 1.44 μm for dental caries effective disinfection

Science.gov (United States)

Dostálová, Tat'jana; Jelínková, Helena; Kadlecová, Martina; Němec, Michal; Å ulc, Jan; Fibrich, Martin; Nejezchleb, Karel; Kapitch, Nickalai; Å koda, Václav

2017-02-01

The analysis of the disinfection effect of Nd:YAG laser radiation was investigated for patients with high concentration of Streptococcus mutans in saliva (positive result in Saliva-check mutans test). For the interaction the Nd:YAG laser system generated separate switchable wavelengths with the maximum output energies 1.1, 0.6, and 0.3 J for wavelength 1.06 μm, 1.32, μm and 1.44 μm, respectively, was used. Our study proved that after the laser irradiation the Saliva-check test showed negative presence of Streptococcus mutans. The disinfection effect was confirmed for all used radiation wavelength. For 1.44 μm this effect was reached with a smallest energy density.

Ionic conductivity of co-doped Sc2O3-ZrO2 ceramics

DEFF Research Database (Denmark)

Omar, Shobit; bin Najib, Waqas; Chen, Weiwu

2012-01-01

The oxide ionic conductivity of Sc0.18Zr0.82O1.91 doped with 0.5 mol.% of both Yb2O3 and In2O3 is evaluated at various temperatures in air. Among various co-doped compositions, In0.02Sc0.18Zr0.80O1.90 exhibits the highest grain ionic conductivity followed by Yb0.02Sc0.18Zr0.80O1.90 at 500°C....... However, it also possesses phase transformation from c- to β-phase at 475°C on cooling. In the present work, an attempt is made to completely stabilize the cphase in In0.02Sc0.18Zr0.80O1.90 by substituting 0.5 mol.% of In2O3 with Yb2O3, which can enhance the ionic conductivity in co-doped compositions....

Crystal structure of Na3Sc2(PO4)3 at 60 deg C

International Nuclear Information System (INIS)

Lazoryak, B.I.; Kalinin, V.B.; Stefanovich, S.Yu.; Efremov, V.A.

1980-01-01

The structure of the ferroelectric phase of Na 3 Sc 2 (PO 4 ) 3 compound was studied. Na 3 Sc 2 (PO 4 ) 3 monocrystal heated by a jet of warm N 2 was investigated at 60 deg C. The rhombohedron modification was determined: a=8.927(3), c=22.34(4) A, Z=6, space group R anti 3c. Interatomic distances and inner angles of polyhedrons in Na 3 Sc 2 (PO 4 ) 3 structure were determined

Reaction of intermetallic compounds of the ScT composition (T=Ag, Cu, Zn, Ni) with hydrogen

International Nuclear Information System (INIS)

Shilkin, S.P.; Volkova, L.S.; Tarasov, B.P.

1995-01-01

Reaction of intermetallic compounds of ScT composition (T=Ag, Cu, Zn, Ni), crystallized in CsCl structural type, with hydrogen at 0.2-10 MPa pressure and 293-673 K temperature is studied by chemical, x-ray phase and complex thermogravimetry analysis methods. It is shown that under such conditions hydrogen absorption by ScAg and ScCu is accompanied by the decay of their source matrices into scandium dihydride and metal silver and copper respectively. For ScZn a fine-dispersion mixture of scandium dihydride with zinc and hydride phase of a new zinc-containing intermetallic compound appears to be the finite reaction product. In case of ScNi a hydride phase of ScNiH 2.6 composition is produced, which is crystallized in a rhombic syngony with the lattice periods: a=0.5281±0.0007, b=0.7393±0.0009 and c=0.3327±0.0004 nm. 9 refs.; 2 tabs

The Synchrocyclotron (SC) in building 300

CERN Multimedia

Maximilien Brice

2012-01-01

The red magnet of CERN's first accelerator, the Synchrocyclotron (SC), has occupied a large part of Hall 300 since it was installed in the late 1950s. The remaining part of the 300-square-metre building has been used as a storage room since the accelerator was shut down in 1990. Now a public exhibition will breathe new life into the hall.

In the presence of fluoride, free Sc³⁺ is not a good predictor of Sc bioaccumulation by two unicellular algae: possible role of fluoro-complexes.

Science.gov (United States)

Crémazy, Anne; Campbell, Peter G C; Fortin, Claude

2014-08-19

We investigated the effect of fluoride complexation on scandium accumulation by two unicellular algae, Chlamydomonas reinhardtii and Pseudokirchneriella subcapitata. This trivalent metal was selected for its chemical similarities with aluminum and for its convenient radioisotope (Sc-46), which can be used as a tracer in short-term bioaccumulation studies. Scandium surface-bound concentrations (Sc(ads)) and uptake fluxes (J(int)) were estimated in the two algae over short-term (organisms.

44Sc for labeling of DOTA- and NODAGA-functionalized peptides: preclinical in vitro and in vivo investigations.

Science.gov (United States)

Domnanich, Katharina A; Müller, Cristina; Farkas, Renata; Schmid, Raffaella M; Ponsard, Bernard; Schibli, Roger; Türler, Andreas; van der Meulen, Nicholas P

2017-01-01

Recently, 44 Sc (T 1/2  = 3.97 h, Eβ + av  = 632 keV, I = 94.3 %) has emerged as an attractive radiometal candidate for PET imaging using DOTA-functionalized biomolecules. The aim of this study was to investigate the potential of using NODAGA for the coordination of 44 Sc. Two pairs of DOTA/NODAGA-derivatized peptides were investigated in vitro and in vivo and the results obtained with 44 Sc compared with its 68 Ga-labeled counterparts.DOTA-RGD and NODAGA-RGD, as well as DOTA-NOC and NODAGA-NOC, were labeled with 44 Sc and 68 Ga, respectively. The radiopeptides were investigated with regard to their stability in buffer solution and under metal challenge conditions using Fe 3+ and Cu 2+ . Time-dependent biodistribution studies and PET/CT imaging were performed in U87MG and AR42J tumor-bearing mice. Both RGD- and NOC-based peptides with a DOTA chelator were readily labeled with 44 Sc and 68 Ga, respectively, and remained stable over at least 4 half-lives of the corresponding radionuclide. In contrast, the labeling of NODAGA-functionalized peptides with 44 Sc was more challenging and the resulting radiopeptides were clearly less stable than the DOTA-derivatized matches. 44 Sc-NODAGA peptides were clearly more susceptible to metal challenge than 44 Sc-DOTA peptides under the same conditions. Instability of 68 Ga-labeled peptides was only observed if they were coordinated with a DOTA in the presence of excess Cu 2+ . Biodistribution data of the 44 Sc-labeled peptides were largely comparable with the data obtained with the 68 Ga-labeled counterparts. It was only in the liver tissue that the uptake of 68 Ga-labeled DOTA compounds was markedly higher than for the 44 Sc-labeled version and this was also visible on PET/CT images. The 44 Sc-labeled NODAGA-peptides showed a similar tissue distribution to those of the DOTA peptides without any obvious signs of in vivo instability. Although DOTA revealed to be the preferred chelator for stable coordination of 44

Spectrophotometric determination of Sc in eriochrome cyanine R(chrome azurol S) - phosphatidyl choline system

International Nuclear Information System (INIS)

Xu, Y.; Chen, X.; Hu, Z.

1987-01-01

Eriochrome cyanine R(chrome azurol S) is used as a color reagent to determine Sc in the presence of phosphatidyl choline, eta = 3.7 * 10 4 (4.5 * 10 4 ). This method has been connected to extraction separation to determine Sc in the presence of rare earth elements, and good results have been obtained. Phosphatidyl choline(PC) is a biochemical reagent, which can be used as a surfactant. It has been reported that chrome azurol S(CAS) can be used to determine Be in the presence of PC but it has not been reported that eriochrome cyanine R(ECR) and CAS can been used to determine Sc in the presence of PC. This paper has put forward a method by which Sc can be determined. ECR (CAS) has been used as a color reagent and PC as a surfactant. Conditional experiments have been made and this method has been connected to extraction separation. Tributyl phosphate (TBP) extracts Sc from rare earth elements to make a determination and good results have been obtained

Issues associated with the metalorganic chemical vapor deposition of ScGaN and YGaN alloys.

Energy Technology Data Exchange (ETDEWEB)

Koleske, Daniel David; Knapp, James Arthur; Lee, Stephen Roger; Crawford, Mary Hagerott; Creighton, James Randall; Cross, Karen Charlene; Thaler, Gerald

2009-07-01

The most energy efficient solid state white light source will likely be a combination of individually efficient red, green, and blue LED. For any multi-color approach to be successful the efficiency of deep green LEDs must be significantly improved. While traditional approaches to improve InGaN materials have yielded incremental success, we proposed a novel approach using group IIIA and IIIB nitride semiconductors to produce efficient green and high wavelength LEDs. To obtain longer wavelength LEDs in the nitrides, we attempted to combine scandium (Sc) and yttrium (Y) with gallium (Ga) to produce ScGaN and YGaN for the quantum well (QW) active regions. Based on linear extrapolation of the proposed bandgaps of ScN (2.15 eV), YN (0.8 eV) and GaN (3.4 eV), we expected that LEDs could be fabricated from the UV (410 nm) to the IR (1600 nm), and therefore cover all visible wavelengths. The growth of these novel alloys potentially provided several advantages over the more traditional InGaN QW regions including: higher growth temperatures more compatible with GaN growth, closer lattice matching to GaN, and reduced phase separation than is commonly observed in InGaN growth. One drawback to using ScGaN and YGaN films as the active regions in LEDs is that little research has been conducted on their growth, specifically, are there metalorganic precursors that are suitable for growth, are the bandgaps direct or indirect, can the materials be grown directly on GaN with a minimal defect formation, as well as other issues related to growth. The major impediment to the growth of ScGaN and YGaN alloys was the low volatility of metalorganic precursors. Despite this impediment some progress was made in incorporation of Sc and Y into GaN which is detailed in this report. Primarily, we were able to incorporate up to 5 x 10{sup 18} cm{sup -3} Y atoms into a GaN film, which are far below the alloy concentrations needed to evaluate the YGaN optical properties. After a no-cost extension was

Lanthanide-doped Na xScF 3+ x nanocrystals: Crystal structure evolution and multicolor tuning

KAUST Repository

Teng, Xue

2012-05-23

Rare-earth-based nanomaterials have recently drawn considerable attention because of their unique energy upconversion (UC) capabilities. However, studies of Sc 3+-based nanomaterials are still absent. Herein we report the synthesis and fine control of Na xScF 3+x nanocrystals by tuning of the ratio of oleic acid (OA, polar surfactant) to 1-octadecene (OD, nonpolar solvent). When the OA:OD ratio was increased from low (3:17) to high (3:7), the nanocrystals changed from pure monoclinic phase (Na 3ScF 6) to pure hexagonal phase (NaScF 4) via a transition stage at an intermediate OA:OD ratio (3:9) where a mixture of nanocrystals in monoclinic and hexagonal phases was obtained and the coexistence of the two phases inside individual nanocrystals was also observed. More significantly, because of the small radius of Sc 3+, Na xScF 3+x:Yb/Er nanocrystals show different UC emission from that of NaYF 4:Yb/Er nanocrystals, which broadens the applications of rare-earth-based nanomaterials ranging from optical communications to disease diagnosis. © 2012 American Chemical Society.

A novel fusion protein of IP10-scFv retains antibody specificity and chemokine function

Energy Technology Data Exchange (ETDEWEB)

Junqing, Guo; Liu, Chen; Hongwu, Ai; Jiannian, Jing; Jiyong, Zhou; Chuyu, Zhang; Shangyou, You

2004-07-23

We combined the specificity of tumor-specific antibody with the chemokine function of interferon-{gamma} inducible protein 10 (IP-10) to recruit immune effector cells in the vicinity of tumor cells. A novel fusion protein of IP10-scFv was constructed by fusing mouse IP-10 to V{sub H} region of single-chain Fv fragment (scFv) against acidic isoferritin (AIF), and expressed in NS0 murine myeloma cells. The IP10-scFv fusion protein was shown to maintain the specificity of the antiAIF scFv with similar affinity constant, and bind to the human hepatocarcinoma SMMC 7721 cells secreting AIF as well as the activated mouse T lymphocytes expressing CXCR3 receptor. Furthermore, the IP10-scFv protein either in solution or bound on the surface of SMMC 7721 cells induced significant chemotaxis of mouse T cells in vitro. The results indicate that the IP10-scFv fusion protein possesses both bioactivities of the tumor-specific antibody and IP-10 chemokine, suggesting its possibility to induce an enhanced immune response against the residual tumor cells in vivo.

US Urban Forest Statistics, Values, and Projections

Science.gov (United States)

David J Nowak; Eric J. Greenfield

2018-01-01

U.S. urban land increased from 2.6% (57.9 million acres) in 2000 to 3.0% (68.0 million acres) in 2010. States with the greatest amount of urban growth were in the South/Southeast (TX, FL, NC, GA and SC). Between 2010 and 2060, urban land is projected to increase another 95.5 million acres to 163.1 million acres (8.6%) with 18 states projected to have an increase of...

Complementary HFET technology for wireless digital and microwave applications

Energy Technology Data Exchange (ETDEWEB)

Baca, A.G.; Zolper, J.C.; Dubbert, D.F. [and others

1996-09-01

Development of a complementary heterostructure field effect transistor (CHFET) technology for low-power, mixed-mode digital-microwave applications is presented. Digital CHFET technology with independently optimizable transistors has been shown to operate with 319 ps loaded gate delays at 8.9 fJ. Power consumption is dominated by leakage currents of the p-channel FET, while performance is determined by the characteristics of 0.7 {mu}m gate length devices. As a microwave technology, the nJFET forms the basis of low-power cirucitry without any modification to the digital process. Narrow band amplification with a 0.7x100 {mu}m nJFET has been demonstrated at 2.1-2.4 GHz with gains of 8-10 dB at 1 mW power. These amplifiers showed a minimum noise figure of 2.5 dB. Next generation CHFET transistors with sub 0.5 {mu}m gate lengths have also been developed. Cutoff frequencies of 49 and 11.5 GHz were achieved for n- and p-channel FETs with 0.3 and 0.4 {mu}m gates, respectively. These FETs will enable enhancements in both digital and microwave circuits.

Complementary HFET technology for low-power mixed-mode applications

Energy Technology Data Exchange (ETDEWEB)

Baca, A.G.; Sherwin, M.E.; Zolper, J.C.; Dubbert, D.F.; Hietala, V.M.; Shul, R.J.; Sloan, L.R.; Hafich, M.J.

1996-06-01

Development of a complementary heterostructure field effect transistor (CHFET) technology for low-power, mixed-mode digital-microwave applications is presented. An earlier digital CHFET technology with independently optimizable transistors which operated with 319 ps loaded gate delays at 8.9 fJ is reviewed. Then work demonstrating the applicability of the digital nJFET device as a low-power microwave transistor in a hybrid microwave amplifier without any modification to the digital process is presented. A narrow band amplifier with a 0.7 {times} 100 {micro}m nJFET as the active element was designed, constructed, and tested. At 1 mW operating power, the amplifier showed 9.7 dB of gain at 2.15 GHz and a minimum noise figure of 2.5 dB. In addition, next generation CHFET transistors with sub 0.5 {micro}m gate lengths were developed. Cutoff frequencies, f{sub t} of 49 GHz and 11.5 GHz were achieved for n- and p-channel FETs with 0.3 and 0.4 {micro}m gates, respectively. These FETs will enable both digital and microwave circuits with enhanced performance.

A single amino acid mutation in Spo0A results in sporulation deficiency of Paenibacillus polymyxa SC2.

Science.gov (United States)

Hou, Xiaoyang; Yu, Xiaoning; Du, Binghai; Liu, Kai; Yao, Liangtong; Zhang, Sicheng; Selin, C; Fernando, W G D; Wang, Chengqiang; Ding, Yanqin

2016-01-01

Sporulating bacteria such as Bacillus subtilis and Paenibacillus polymyxa exhibit sporulation deficiencies during their lifetime in a laboratory environment. In this study, spontaneous mutants SC2-M1 and SC2-M2, of P. polymyxa SC2 lost the ability to form endospores. A global genetic and transcriptomic analysis of wild-type SC2 and spontaneous mutants was carried out. Genome resequencing analysis revealed 14 variants in the genome of SC2-M1, including three insertions and deletions (indels), 10 single nucleotide variations (SNVs) and one intrachromosomal translocation (ITX). There were nine variants in the genome of SC2-M2, including two indels and seven SNVs. Transcriptomic analysis revealed that 266 and 272 genes showed significant differences in expression in SC2-M1 and SC2-M2, respectively, compared with the wild-type SC2. Besides sporulation-related genes, genes related to exopolysaccharide biosynthesis (eps), antibiotic (fusaricidin) synthesis, motility (flgB) and other functions were also affected in these mutants. In SC2-M2, reversion of spo0A resulted in the complete recovery of sporulation. This is the first global analysis of mutations related to sporulation deficiency in P. polymyxa. Our results demonstrate that a SNV within spo0A caused the sporulation deficiency of SC2-M2 and provide strong evidence that an arginine residue at position 211 is essential for the function of Spo0A. Copyright © 2016 The Author(s). Published by Elsevier Masson SAS.. All rights reserved.

AlScN thin film based surface acoustic wave devices with enhanced microfluidic performance

OpenAIRE

Wang, Wenbo; Fu, Yong Qing; Chen, Jinju; Xuan, Weipeng; Chen, Jinkai; Mayrhofer, Paul; Duan, Pengfei; Bittner, Elmar; Luo, Jikui

2016-01-01

This paper reports the characterization of scandium aluminum nitride (Al1−x Sc x N, x  =  27%) films and discusses surface acoustic wave (SAW) devices based on them. Both AlScN and AlN films were deposited on silicon by sputtering and possessed columnar microstructures with (0 0 0 2) crystal orientation. The AlScN/Si SAW devices showed improved electromechanical coupling coefficients (K 2, ~2%) compared with pure AlN films (

Avance normativo del SC 8 de AENOR “Conservación, restauración y rehabilitación de edificios” = Standardisation Advance of AENOR SC 8 “Conservation, Restoration and Rehabilitation of Buildings”

OpenAIRE

Recopar, Editor

2014-01-01

Avance normativo del SC 8 de AENOR “Conservación, restauración y rehabilitación de edificios” = Standardisation Advance of AENOR SC 8 “Conservation, Restoration and Rehabilitation of Buildings”

Cross-sections of 45Sc(n,2n)44m,gSc reaction from the reaction threshold to 20 MeV

International Nuclear Information System (INIS)

Luo, J.; Peking Univ., Beijing; Liu, R.; Jiang, L.; Liu, Z.; Sun, G.; Ge, S.

2013-01-01

Cross sections of 45 Sc(n,2n) 44m,g Sc reactions and their isomeric cross section ratios σ m /σ g have been measured at three neutron energies between 13.5 and 14.8 MeV using the activation technique. The pure cross section of the groundstate was then obtained by utilizing the absolute cross section of the metastable state and analysis methods of residual nuclear decay. The monoenergetic neutron beam was produced via the 3 H(d, n) 4 He reaction. The cross sections were also estimated with the TALYS-1.2 nuclear model code using different level density options, at neutron energies varying from the reaction threshold to 20 MeV. Results are also discussed and compared with some corresponding values found in the literature. (orig.)

Experimental Conditions: SE3_S02_M03_D03 [Metabolonote[Archive

Lifescience Database Archive (English)

Full Text Available SE3_S02_M03_D03 SE3 Comparison of fruit metabolites among tomato varieties 1 SE3_S0...2 Solanum lycopersicum House Momotaro fruit SE3_S02_M03 6.7 mg [MassBase ID] MDLC1_25531 SE3_MS1 LC-FT-ICR-M

Effect of Trace Be and Sc Additions on the Mechanical Properties of A357 Alloys

Directory of Open Access Journals (Sweden)

Yu-Chih Tzeng

2018-03-01

Full Text Available The effect of the addition of Be and Sc on the microstructure and mechanical properties of A357 alloy were systematically investigated. The results show that the addition of small amounts of Be and Sc could change the acicular structure of iron-bearing intermetallic compounds to harmless compact Al-Fe-Si and Sc-Fe iron-bearing intermetallic compounds. Compact iron-bearing intermetallic compounds could improve fluidity, causing a reduction in interdendritic shrinkage during solidification. The addition of 0.05 wt % Be enhanced the quality index of the A357 alloy by 11% and increased the notch-yield ratio of fracture toughness by 4.5%. In contrast, the addition of 0.05 wt % Sc increased the quality index and the notch to yield ratio of fracture toughness up to 17% and 9%, respectively. Therefore, the microstructure and mechanical properties of the A357 alloy could be improved by substituting Be with Sc.

Are U.S. Schools Filling the Gap With Programs that Promote Weight Stigma?

Centers for Disease Control (CDC) Podcasts

In this edition of PCD Sound Bites, author Erica Kenney, ScD, answers questions about her study, which looked at how frequently U.S. schools used evidence-based obesity prevention programs and how often schools implement programs that may unintentionally worsen weight stigma among students.

Ferromagnetism carried by highly delocalized hybrid states in Sc-doped ZnO thin films

KAUST Repository

Benali Kanoun, Mohammed; Goumri-Said, Souraya; Manchon, Aurelien; Schwingenschlö gl, Udo

2012-01-01

We present first-principles results for Sc-doped ZnOthin films. Neighboring Sc atoms in the surface and/or subsurface layers are found to be coupled ferromagnetically, where only two of the possible configurations induce spin polarization

Effect of lectin (ScLL on fibroblasts stimulated with LPS - an in vitro study

Directory of Open Access Journals (Sweden)

Manuella Verdinelli de Paula REIS

Full Text Available Abstract: The lectin (ScLL extracted from the Synadenium carinatum plant has been evaluated as an immunomodulator in diseases such as asthma, neosporosis and leishmaniasis. However, it has not yet been evaluated in the oral cavity. This study evaluated the effect of ScLL on viability, proliferation and release of IL-10 in human gingival fibroblasts (HGF stimulated with lipopolysaccharide (LPS. HGF were stimulated with LPS 1 µg/ml and treated with ScLL in concentrations of 10, 5 and 2 µg/ml for 1 and 5 h, and evaluated by flow cytometry for viability, apoptosis (initial/advanced and necrosis. The supernatant was collected to detect release of IL-10 by ELISA. The proliferation was assessed with the BrdU assay. Positive control consisted of cells maintained in Dulbecco's Modified Eagles Medium (DMEM, and the negative control, of those kept in tap water. Data were analyzed by ANOVA and Dunnett's test (α = 0.05. No significant difference was found for ScLL concentrations regarding viability or initial and advanced apoptosis (p=0.455. All the groups, including the positive control, had a significantly lower necrosis parameter than negative control at 5 h (p < 0.001. No difference was found for proliferation among the experimental groups (p = 0.832. ScLL at 5 and 2 µg/ml resulted in a lower release of IL-10 than positive and negative controls at 5 h (p = 0.047. The results indicated that ScLL concentrations tested were not cytotoxic, and had no effect on proliferation and release of IL-10 parameters. A thorough understanding of ScLL, regarding its immunomodulatory potential, may open the door to new perspectives for dentistry.

17 CFR 8.06 - Investigations.

Science.gov (United States)

2010-04-01

....06 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION EXCHANGE PROCEDURES FOR DISCIPLINARY, SUMMARY, AND MEMBERSHIP DENIAL ACTIONS Disciplinary Procedure § 8.06 Investigations. (a) Each exchange shall establish and maintain a disciplinary procedure which requires the enforcement staff of the...

Isolation and characterization of anti c-met single chain fragment variable (scFv) antibodies.

Science.gov (United States)

Qamsari, Elmira Safaie; Sharifzadeh, Zahra; Bagheri, Salman; Riazi-Rad, Farhad; Younesi, Vahid; Abolhassani, Mohsen; Ghaderi, Sepideh Safaei; Baradaran, Behzad; Somi, Mohammad Hossein; Yousefi, Mehdi

2017-12-01

The receptor tyrosine kinase (RTK) Met is the cell surface receptor for hepatocyte growth factor (HGF) involved in invasive growth programs during embryogenesis and tumorgenesis. There is compelling evidence suggesting important roles for c-Met in colorectal cancer proliferation, migration, invasion, angiogenesis, and survival. Hence, a molecular inhibitor of an extracellular domain of c-Met receptor that blocks c-Met-cell surface interactions could be of great thera-peutic importance. In an attempt to develop molecular inhibitors of c-Met, single chain variable fragment (scFv) phage display libraries Tomlinson I + J against a specific synthetic oligopeptide from the extracellular domain of c-Met receptor were screened; selected scFv were then characterized using various immune techniques. Three c-Met specific scFv (ES1, ES2, and ES3) were selected following five rounds of panning procedures. The scFv showed specific binding to c-Met receptor, and significantly inhibited proliferation responses of a human colorectal carcinoma cell line (HCT-116). Moreover, anti- apoptotic effects of selected scFv antibodies on the HCT-116 cell line were also evaluated using Annexin V/PI assays. The results demonstrated rates of apoptotic cell death of 46.0, 25.5, and 37.8% among these cells were induced by use of ES1, ES2, and ES3, respectively. The results demonstrated ability to successfully isolate/char-acterize specific c-Met scFv that could ultimately have a great therapeutic potential in immuno-therapies against (colorectal) cancers.

Topological phase, electronic, magnetic and optical properties of ScPdBi compound with Gd, Np and Cm impurities

Energy Technology Data Exchange (ETDEWEB)

Narimani, Mitra; Nourbakhsh, Zahra, E-mail: z.nourbakhsh@sci.ui.ac.ir

2017-07-15

Highlights: • Gd, Np and Cm impurities induce the magnetic moment in ScPdBi compound. • ScPdBi compound with Gd, Np and Cm impurities has normal band order. • The ε(0) and R(0) increase by increasing the atomic number of X atom. - Abstract: The electronic, magnetic and optical properties of X-doped ScPdBi (X = Gd, Np, Cm) are investigated in the framework of density functional theory. The exchange-correlation potential is treated using generalized gradient approximation with Coulomb interaction parameter. The band order and energy band gap of X-doped ScPdBi are investigated by calculation of band structure. The effect of doping impurity on magnetic properties of ScPdBi compound is studied by calculation of total and partial magnetic moments of X-doped ScPdBi compound. Furthermore, the optical properties of X-doped ScPdBi are calculated and compared in the energy range of 0–25 eV.

Design and initial characterization of the SC-200 proteomics standard mixture.

Science.gov (United States)

Bauman, Andrew; Higdon, Roger; Rapson, Sean; Loiue, Brenton; Hogan, Jason; Stacy, Robin; Napuli, Alberto; Guo, Wenjin; van Voorhis, Wesley; Roach, Jared; Lu, Vincent; Landorf, Elizabeth; Stewart, Elizabeth; Kolker, Natali; Collart, Frank; Myler, Peter; van Belle, Gerald; Kolker, Eugene

2011-01-01

High-throughput (HTP) proteomics studies generate large amounts of data. Interpretation of these data requires effective approaches to distinguish noise from biological signal, particularly as instrument and computational capacity increase and studies become more complex. Resolving this issue requires validated and reproducible methods and models, which in turn requires complex experimental and computational standards. The absence of appropriate standards and data sets for validating experimental and computational workflows hinders the development of HTP proteomics methods. Most protein standards are simple mixtures of proteins or peptides, or undercharacterized reference standards in which the identity and concentration of the constituent proteins is unknown. The Seattle Children's 200 (SC-200) proposed proteomics standard mixture is the next step toward developing realistic, fully characterized HTP proteomics standards. The SC-200 exhibits a unique modular design to extend its functionality, and consists of 200 proteins of known identities and molar concentrations from 6 microbial genomes, distributed into 10 molar concentration tiers spanning a 1,000-fold range. We describe the SC-200's design, potential uses, and initial characterization. We identified 84% of SC-200 proteins with an LTQ-Orbitrap and 65% with an LTQ-Velos (false discovery rate = 1% for both). There were obvious trends in success rate, sequence coverage, and spectral counts with protein concentration; however, protein identification, sequence coverage, and spectral counts vary greatly within concentration levels.

Effects of co-sintering in self-standing CGO/YSZ and CGO/ ScYSZ dense bi-layers

DEFF Research Database (Denmark)

Teocoli, Francesca; Ni, De Wei; Brodersen, Karen

2014-01-01

-layers are critical due to the mismatch of thermo-mechanical and sintering properties among the materials. Despite the better sinteractivity of ScYSZ, the self-standing CGO/ScYSZ bilayer presents more challenges in terms of densification compared with the CGO/YSZ bi-layer. In particular, above 1200 C, ScYSZ and CGO......-standing bi-layered electrolyte system. The combined use of thermo-mechanical analysis, optical dilatometry, and scanning electron microscopy ensures a systematic characterization of both the individual layers and CGO/YSZ and CGO/ScYSZ bi-layered laminates. The results of the co-firing process of the bi...

Effect of Recrystallization and Natural Aging on Mechanical Properties of Al-Zn-Mg-Cu-Sc Alloys

International Nuclear Information System (INIS)

Yu, Min Kyu; Hong, Soon Hyung; Kwon, Oh Yeol; Lee, Yong Yeon

2015-01-01

In this study, the recrystallization volume fraction of the Al-Zn-Mg-Cu-Sc alloy after solid solution heat treatment varied with different temperatures (445℃ - 465℃). The highest elongation of the Al-Zn-Mg-Cu-Sc alloy was obtained at 465℃. Further, the hardness and strength of the solid solution heat treated Al-Zn-Mg-Cu-Sc alloy increased at room temperature due to G.P zone precipitates. The results confirmed that we can obtain advanced mechanical properties for the Al-Zn-Mg-Cu-Sc alloy from solid solution heat treatment and natural aging.

UK-Nuclear decommissioning authority and US Salt-stone waste management issues

International Nuclear Information System (INIS)

Lawless, William; Whitton, John

2007-01-01

Available in abstract form only. Full text of publication follows: We update two case studies of stakeholder issues in the UK and US. Earlier versions were reported at Waste Management 2006 and 2007 and at ICEM 2005. UK: The UK nuclear industry has begun to consult stakeholders more widely in recent years. Historically, methods of engagement within the industry have varied, however, recent discussions have generally been carried out with the explicit understanding that engagement with stakeholders will be 'dialogue based' and will 'inform' the final decision made by the decision maker. Engagement is currently being carried out at several levels within the industry; at the national level (via the Nuclear Decommissioning Authority's (NDA) National Stakeholder Group (NSG)); at a local site level (via Site Stakeholder Groups) and at a project level (usually via the Best Practicable Environmental Option process (BPEO)). This paper updates earlier results by the co-author with findings from a second questionnaire issued to the NSG in Phase 2 of the engagement process. An assessment is made regarding the development of stakeholder perceptions since Phase 1 towards the NDA process. US: The US case study reviews the resolution of issues on salt-stone by Department of Energy's (DOE) Savannah River Site (SRS) Citizens Advisory Board (CAB), in Aiken, SC. Recently, SRS-CAB encouraged DOE and South Carolina's regulatory Department of Health and Environmental Control (SC-DHEC) to resolve a conflict preventing SC-DHEC from releasing a draft permit to allow SRS to restart salt-stone operations. It arose with a letter sent from DOE blaming the Governor of South Carolina for delay in restarting salt processing. In reply, the Governor blamed DOE for failing to assure that Salt Waste Processing Facility (SWPF) would be built. SWPF is designed to remove most of the radioactivity from HLW prior to vitrification, the remaining fraction destined for salt-stone. (authors)

Production of in vivo biotinylated scFv specific to almond (Prunus dulcis) proteins by recombinant Pichia pastoris.

Science.gov (United States)

de la Cruz, Silvia; Alcocer, Marcos; Madrid, Raquel; García, Aina; Martín, Rosario; González, Isabel; García, Teresa

2016-06-10

The methylotropic yeast Pichia pastoris has demonstrated its suitability for large-scale production of recombinant proteins. As an eukaryotic organism P. pastoris presents a series of advantages at expression and processing of heterologous proteins when compared with Escherichia coli. In this work, P. pastoris has been used to express a scFv from a human synthetic library previously shown to bind almond proteins. In order to facilitate purification and post processing manipulations, the scFv was engineered with a C-terminal tag and biotinylated in vivo. After purification, biotinylated scFv were bound to avidin conjugated with HRP producing a multimeric scFv. The multimeric scFv showed to maintain their ability to recognize almond protein when assayed in ELISA, reaching a LOD of 470mgkg(-1). This study describes an easy method to produce large quantities of in vivo biotinylated scFv in P. pastoris. By substituting the enzyme or fluorochromes linked to avidin, it will be possible to generate a diverse number of multimeric scFv as probes to suit different analytical platforms in the detection of almond in food products. Copyright © 2016 Elsevier B.V. All rights reserved.

Calibration of the DLP-SC-3300-02 probe

DEFF Research Database (Denmark)

Pivnenko, Sergey; Breinbjerg, Olav

This report douments the calibration measurement of the DLP-SC-3300-02 dual-linearly polarized near-field probe. The measurement comprises radiation pattern, diretivity, gain, spetra of spherial wave coefients, polarization charateristis, and complex channel balance at 41 frequencies, as well...

Marsh soils as potential sinks for Bacteroides fecal indicator bacteria, Waccamaw National Wildlife Refuge, Georgetown, SC, USA

Science.gov (United States)

Drexler, Judith Z.; Johnson, Heather E.; Duris, Joseph W.; Krauss, Ken W.

2014-01-01

A soil core collected in a tidal freshwater marsh in the Waccamaw National Wildlife Refuge (Georgetown, SC) exuded a particularly strong odor of cow manure upon extrusion. In order to test for manure and determine its provenance, we carried out microbial source tracking using DNA markers for Bacteroides, a noncoliform, anaerobic bacterial group that represents a broad group of the fecal population. Three core sections from 0-3 cm, 9-12 cm and 30-33 were analyzed for the presence of Bacteroides. The ages of core sediments were estimated using 210Pb and 137Cs dating. All three core sections tested positive for Bacteroides DNA markers related to cow or deer feces. Because cow manure is stockpiled, used as fertilizer, and a source of direct contamination in the Great Pee Dee River/Winyah Bay watershed, it is very likely the source of the Bacteroides that was deposited on the marsh. The mid-points of the core sections were dated as follows: 0-3 cm: 2009; 9-12 cm: 1999, and 30-33 cm: 1961. The presence of Bacteroides at different depths/ages in the soil profile indicates that soils in tidal freshwater marshes are, at the least, capable of being short-term sinks for Bacteroides and, may have the potential to be long-term sinks of stable, naturalized populations.

Zero lattice mismatch and twin-free single crystalline ScN buffer layers for GaN growth on silicon

Energy Technology Data Exchange (ETDEWEB)

Lupina, L.; Zoellner, M. H.; Dietrich, B.; Capellini, G. [IHP, Im Technologiepark 25, 15236 Frankfurt, Oder (Germany); Niermann, T.; Lehmann, M. [Technische Universität Berlin, Institut für Optik und Atomare Physik, Straße des 17. Juni 135, 10623 Berlin (Germany); Thapa, S. B.; Haeberlen, M.; Storck, P. [SILTRONIC AG, Hanns-Seidel-Platz 4, 81737 München (Germany); Schroeder, T. [IHP, Im Technologiepark 25, 15236 Frankfurt, Oder (Germany); BTU Cottbus, Konrad-Zuse-Str. 1, 03046 Cottbus (Germany)

2015-11-16

We report the growth of thin ScN layers deposited by plasma-assisted molecular beam epitaxy on Sc{sub 2}O{sub 3}/Y{sub 2}O{sub 3}/Si(111) substrates. Using x-ray diffraction, Raman spectroscopy, and transmission electron microscopy, we find that ScN films grown at 600 °C are single crystalline, twin-free with rock-salt crystal structure, and exhibit a direct optical band gap of 2.2 eV. A high degree of crystalline perfection and a very good lattice matching between ScN and GaN (misfit < 0.1%) makes the ScN/Sc{sub 2}O{sub 3}/Y{sub 2}O{sub 3} buffer system a very promising template for the growth of high quality GaN layers on silicon.

X-ray spectra, chemical bonding, and electron structure of ScM2Si2 (M = Fe, Co, Ni)

International Nuclear Information System (INIS)

Shcherba, I.D.; Kotur, B.Ya.

1990-01-01

In a study of the interaction of the components in the ternary systems Sc-M-Si (where M is a 3d transition metal) it was established that there are compounds of the empirical formula ScM 2 Si 2 (M = Fe, Co, Ni). They crystallize in two structural types, HfFe 2 Si 2 (the compound ScFe 2 Si 2 ) and CeGa 2 Al 2 (ScCo 2 Si 2 and ScNi 2 Si 2 ) (ref. 1), leading to different coordination environment of the atoms in the structures of the compounds. With the aim of investigating the electron structure and the type ofin these compounds, they authors made a systematic x-ray spectral investigation with simultaneous analysis of the crystal structures of ScM 2 Si 2

40 CFR 256.06 - Definitions.

Science.gov (United States)

2010-07-01

... AND IMPLEMENTATION OF STATE SOLID WASTE MANAGEMENT PLANS Purpose, General Requirements, Definitions... public (including interstate) solid or hazardous waste management authority, or other public agency below... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Definitions. 256.06 Section 256.06...

Bulk viscosity in 2SC quark matter

International Nuclear Information System (INIS)

Alford, Mark G; Schmitt, Andreas

2007-01-01

The bulk viscosity of three-flavour colour-superconducting quark matter originating from the nonleptonic process u + s ↔ u + d is computed. It is assumed that up and down quarks form Cooper pairs while the strange quark remains unpaired (2SC phase). A general derivation of the rate of strangeness production is presented, involving contributions from a multitude of different subprocesses, including subprocesses that involve different numbers of gapped quarks as well as creation and annihilation of particles in the condensate. The rate is then used to compute the bulk viscosity as a function of the temperature, for an external oscillation frequency typical of a compact star r-mode. We find that, for temperatures far below the critical temperature T c for 2SC pairing, the bulk viscosity of colour-superconducting quark matter is suppressed relative to that of unpaired quark matter, but for T ∼> T c /30 the colour-superconducting quark matter has a higher bulk viscosity. This is potentially relevant for the suppression of r-mode instabilities early in the life of a compact star

The Effect of Surfactant Content over Cu-Ni Coatings Electroplated by the sc-CO₂ Technique.

Science.gov (United States)

Chuang, Ho-Chiao; Sánchez, Jorge; Cheng, Hsiang-Yun

2017-04-19

Co-plating of Cu-Ni coatings by supercritical CO₂ (sc-CO₂) and conventional electroplating processes was studied in this work. 1,4-butynediol was chosen as the surfactant and the effects of adjusting the surfactant content were described. Although the sc-CO₂ process displayed lower current efficiency, it effectively removed excess hydrogen that causes defects on the coating surface, refined grain size, reduced surface roughness, and increased electrochemical resistance. Surface roughness of coatings fabricated by the sc-CO₂ process was reduced by an average of 10%, and a maximum of 55%, compared to conventional process at different fabrication parameters. Cu-Ni coatings produced by the sc-CO₂ process displayed increased corrosion potential of ~0.05 V over Cu-Ni coatings produced by the conventional process, and 0.175 V over pure Cu coatings produced by the conventional process. For coatings ~10 µm thick, internal stress developed from the sc-CO₂ process were ~20 MPa lower than conventional process. Finally, the preferred crystal orientation of the fabricated coatings remained in the (111) direction regardless of the process used or surfactant content.

Simultaneous reduction and adsorption for immobilization of uranium from aqueous solution by nano-flake Fe-SC

Energy Technology Data Exchange (ETDEWEB)

Kong, Lingjun, E-mail: kongl_jun@163.com [School of Environmental Science and Engineering, Guangzhou University, Guangzhou, 510275 (China); Guangdong Provincial Key Laboratory of radioactive contamination control and resources, Guangzhou University, Guangzhou, 510275 (China); Guangdong Provincial Key Laboratory of Environmental Pollution Control and Remediation Technology, Sun Yat-sen University, Guangzhou, 510275 (China); Zhu, Yuting; Wang, Min; Li, Zhixuan; Tan, Zhicong; Xu, Ruibin; Tang, Hongmei; Chang, Xiangyang [School of Environmental Science and Engineering, Guangzhou University, Guangzhou, 510275 (China); Guangdong Provincial Key Laboratory of radioactive contamination control and resources, Guangzhou University, Guangzhou, 510275 (China); Xiong, Ya [Guangdong Provincial Key Laboratory of Environmental Pollution Control and Remediation Technology, Sun Yat-sen University, Guangzhou, 510275 (China); Chen, Diyun, E-mail: cdy@gzhu.edu.cn [School of Environmental Science and Engineering, Guangzhou University, Guangzhou, 510275 (China); Guangdong Provincial Key Laboratory of radioactive contamination control and resources, Guangzhou University, Guangzhou, 510275 (China)

2016-12-15

Uranium containing radioactive wastewater is seriously hazardous to the natural environment if it is being discharged directly. Herein, nano-flake like Fe loaded sludge carbon (Fe-SC) is synthesized by carbothermal process from Fe-rich sludge waste and applied in the immobilization of uranium in aqueous. Batch isotherm and kinetic adsorption experiments are adopted to investigate the adsorption behavior of Fe-SC to uranium in aqueous. XPS analyses were conducted to evaluate the immobilized mechanism. It was found that the carbonized temperature played significant role in the characteristics and immobilization ability of the resulted Fe-SC. The Fe-SC-800 carbonized at 800 °C takes more advantageous ability in immobilization of uranium from aqueous than the commercial available AC and powder zero valent iron. The adsorption behavior could be fitted well with the Langmuir isotherm adsorption model and pseudo-second order model. The equilibrium adsorption amount and rate for Fe-SC-800 is high to 148.99 mg g{sup -1} and 0.015 g mg{sup -1} min{sup -1}, respectively. Both reductive precipitation and physical adsorption are the main mechanisms of immobilization of uranium from aqueous by Fe-SC-800.

Preliminary Analysis of the Social and Scientific Impact of the UAEM-ININ M.Sc. and D.Sc. Graduate Programme in Medical Physics

Science.gov (United States)

Mitsoura, Eleni; Isaac-Olive, Keila; Torres-Garcia, Eugenio; Camacho-Lopez, Miguel Angel; Hardy-Perez, Alberto

2010-12-01

Sponsored by the International Atomic Energy Agency (IAEA) in 1994, the Instituto Nacional de Investigaciones Nucleares (ININ) started in Mexico a teaching and training programme (Diplomado) in Radiotherapy Medical Physics. Based on this experience, the Universidad Autónoma del Estado de México (UAEM) and the Instituto Nacional de Investigaciones Nucleares (ININ) launched two years later, the first Graduate Programme in Science (M.Sc. and D.Sc.), specialised in Medical Physics in Mexico. A preliminary analysis of the social and scientific impact of the UAEM-ININ Programme is presented in this work based on the achievements attained, regarding the number of graduated Medical Physicists, their geographic and academic origin, their current professional activities and the number of scientific publications produced as a result of the thesis, as well as their citations.

Zooplankton biomass data collected by Research Institute of Marine Fisheries & Oceanography (PINRO) from 1958-03-25 to 1964-06-18 (NODC Accession 0070127)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Zooplankton biomass data collected in North Atlantic Ocean, Greenland Sea, North Sea, Norwegian Sea, and Bering Sea from 03 Mar 1958 to 18 Jun 1964 by PINRO. Data...

Assessment of the GLLB-SC potential for solid-state properties and attempts for improvement

Science.gov (United States)

Tran, Fabien; Ehsan, Sohaib; Blaha, Peter

2018-02-01

Based on the work of Gritsenko et al. (GLLB) [Phys. Rev. A 51, 1944 (1995), 10.1103/PhysRevA.51.1944], the method of Kuisma et al. [Phys. Rev. B 82, 115106 (2010), 10.1103/PhysRevB.82.115106] to calculate the band gap in solids was shown to be much more accurate than the common local density approximation (LDA) and generalized gradient approximation (GGA). The main feature of the GLLB-SC potential (SC stands for solid and correlation) is to lead to a nonzero derivative discontinuity that can be conveniently calculated and then added to the Kohn-Sham band gap for a comparison with the experimental band gap. In this work, a thorough comparison of GLLB-SC with other methods, e.g., the modified Becke-Johnson (mBJ) potential [Tran and Blaha, Phys. Rev. Lett. 102, 226401 (2009), 10.1103/PhysRevLett.102.226401], for electronic, magnetic, and density-related properties is presented. It is shown that for the band gap, GLLB-SC does not perform as well as mBJ for systems with a small band gap and strongly correlated systems, but is on average of similar accuracy as hybrid functionals. The results on itinerant metals indicate that GLLB-SC overestimates significantly the magnetic moment (much more than mBJ does), but leads to excellent results for the electric field gradient, for which mBJ is in general not recommended. In the aim of improving the results, variants of the GLLB-SC potential are also tested.

Properties of the low-lying negative parity states in 45Sc

International Nuclear Information System (INIS)

Chevallier, J.; Haas, B.; Schulz, N.; Toulemonde, M.

1975-01-01

The electromagnetic decay of negative parity states in 45 Sc up to an excitation energy of 2107keV have been investigated via the 42 Ca(α,pγ) 45 Sc reaction at a bombarding energy of 10.5MeV. Spin and lifetime of the levels as well as branching and mixing ratios of their decay γ-rays have been obtained from proton-gamma angular correlation measurements. Calculations based on the strong coupling model have been performed. The results are compared with experiment [fr

Structural characteristics of ScBx genes controlling the biosynthesis of hydroxamic acids in rye (Secale cereale L.).

Science.gov (United States)

Bakera, Beata; Makowska, Bogna; Groszyk, Jolanta; Niziołek, Michał; Orczyk, Wacław; Bolibok-Brągoszewska, Hanna; Hromada-Judycka, Aneta; Rakoczy-Trojanowska, Monika

2015-08-01

Benzoxazinoids (BX) are major secondary metabolites of gramineous plants that play an important role in disease resistance and allelopathy. They also have many other unique properties including anti-bacterial and anti-fungal activity, and the ability to reduce alfa-amylase activity. The biosynthesis and modification of BX are controlled by the genes Bx1 ÷ Bx10, GT and glu, and the majority of these Bx genes have been mapped in maize, wheat and rye. However, the genetic basis of BX biosynthesis remains largely uncharacterized apart from some data from maize and wheat. The aim of this study was to isolate, sequence and characterize five genes (ScBx1, ScBx2, ScBx3, ScBx4 and ScBx5) encoding enzymes involved in the synthesis of DIBOA, an important defense compound of rye. Using a modified 3D procedure of BAC library screening, seven BAC clones containing all of the ScBx genes were isolated and sequenced. Bioinformatic analyses of the resulting contigs were used to examine the structure and other features of these genes, including their promoters, introns and 3'UTRs. Comparative analysis showed that the ScBx genes are similar to those of other Poaceae species, especially to the TaBx genes. The polymorphisms present both in the coding sequences and non-coding regions of ScBx in relation to other Bx genes are predicted to have an impact on the expression, structure and properties of the encoded proteins.

A Computational Model of the SC Multisensory Neurons: Integrative Capabilities, Maturation, and Plasticity

Directory of Open Access Journals (Sweden)

Cristiano Cuppini

2011-10-01

Full Text Available Different cortical and subcortical structures present neurons able to integrate stimuli of different sensory modalities. Among the others, one of the most investigated integrative regions is the Superior Colliculus (SC, a midbrain structure whose aim is to guide attentive behaviour and motor responses toward external events. Despite the large amount of experimental data in the literature, the neural mechanisms underlying the SC response are not completely understood. Moreover, recent data indicate that multisensory integration ability is the result of maturation after birth, depending on sensory experience. Mathematical models and computer simulations can be of value to investigate and clarify these phenomena. In the last few years, several models have been implemented to shed light on these mechanisms and to gain a deeper comprehension of the SC capabilities. Here, a neural network model (Cuppini et al., 2010 is extensively discussed. The model considers visual-auditory interaction, and is able to reproduce and explain the main physiological features of multisensory integration in SC neurons, and their acquisition during postnatal life. To reproduce a neonatal condition, the model assumes that during early life: 1 cortical-SC synapses are present but not active; 2 in this phase, responses are driven by non-cortical inputs with very large receptive fields (RFs and little spatial tuning; 3 a slight spatial preference for the visual inputs is present. Sensory experience is modeled by a “training phase” in which the network is repeatedly exposed to modality-specific and cross-modal stimuli at different locations. As results, Cortical-SC synapses are crafted during this period thanks to the Hebbian rules of potentiation and depression, RFs are reduced in size, and neurons exhibit integrative capabilities to cross-modal stimuli, such as multisensory enhancement, inverse effectiveness, and multisensory depression. The utility of the modelling

Crystal structure and magnetic properties of the solid-solution phase Ca3Co2-v Sc v O6

International Nuclear Information System (INIS)

Hervoches, Charles H.; Fredenborg, Vivian Miksch; Kjekshus, Arne; Fjellvag, Helmer; Hauback, Bjorn C.

2007-01-01

The two crystallographically non-equivalent Co atoms of the quasi-one-dimensional crystal structure of Ca 3 Co 2 O 6 form chains with alternating, face-sharing polyhedra of Co2O 6 trigonal prisms and Co1O 6 octahedra. This compound forms a substitutional solid-solution phase with Sc, in which the Sc atoms enter the Co2 sublattice exclusively. The homogeneity range of Ca 3 Co 2- v Sc v O 6 (more specifically Ca 3 Co1Co2 1- v Sc v O 6 ) extends up to v∼0.55. The crystal structure belongs to space group R3-barc with lattice parameters (in hexagonal setting): 9.0846(3)≤a≤9.1300(2) A and 10.3885(4)≤c≤10.4677(4) A. The magnetic moment decreases rapidly with increasing amount of the non-magnetic Sc solute in the lattice. - Graphical abstract: The quasi-one-dimensional Ca 3 Co 2 O 6 phase forms a substitutional solid-solution system with Sc, in which the Sc atoms enter the Co2 sublattice exclusively. The homogeneity range of Ca 3 Co 2- v Sc v O 6 extends up to v∼0.55. The magnetic moment decreases rapidly with increasing amount of the non-magnetic Sc solute in the lattice

TSE strain differentiation in mice by immunohistochemical PrP(Sc) profiles and triplex Western blot.

Science.gov (United States)

van Keulen, Lucien J M; Langeveld, Jan P M; Dolstra, Corry H; Jacobs, Jorg; Bossers, Alex; van Zijderveld, Fred G

2015-10-01

TSE strains are routinely identified by their incubation period and vacuolation profile in the brain after intracerebral inoculation and serial passaging in inbred mouse lines. There are some major drawbacks to this method that are related to the variation in vacuolation that exists in the brains of mice infected with the same TSE strain and to variation between observers and laboratories in scoring vacuolation and determining the final incubation period. We investigated the potential of PrP(Sc) immunohistochemistry and triplex Western blotting as possible alternative methods to differentiate between TSE strains. TSE reference strains ME7, 87A/87V, 22A/22C, 79A/79V and 301C/301V were intracerebrally inoculated in RIII or VM inbred mice that differ in their PrP genotype. Immunohistochemical PrP(Sc) profiles were drawn up by scanning light microscopy both on coronal and sagittal sections. On the basis of the localization of PrP(Sc) in the cerebral cortex, hippocampus, and cerebellar cortex and the overall type of PrP(Sc) staining, all TSE strains could be well differentiated from each other through their typical strain dependent characteristics. In addition, Western blot showed that the combination of glycosylation profile and 12B2 epitope content of PrP(Sc) allowed to distinguish between all reference strains except for ME7 and 22A in VM mice. TSE strains in mice can be identified on the basis of their PrP(Sc) profile alone. The potential to identify TSE strains in ruminants with these PrP(Sc) profiles after a single primary passage in mice will be the topic of future studies. © 2014 British Neuropathological Society.

Dicty_cDB: FC-AI06 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI06 (Link to dictyBase) - - - Contig-U16465-1 FC-AI06E (Li...nk to Original site) - - - - - - FC-AI06E 1138 Show FC-AI06 Library FC (Link to library) Clone ID FC-AI06 (L...//dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI06Q.Seq.d/ Representative seq. ID FC-AI...06E (Link to Original site) Representative DNA sequence >FC-AI06 (FC-AI06Q) /CSM/FC/FC-AI/FC-AI06Q.Seq...FGRGIDIERVNVVINYDMAESADTYLHRVGRAGRFGTK GLAISFVPSKEDPVLEQVQSKFVVSIKELVATPDPSTYMSG*kkkkkkkknlfvlksikk k*kkk*in

AlScN thin film based surface acoustic wave devices with enhanced microfluidic performance

International Nuclear Information System (INIS)

Wang, W B; Xuan, W P; Chen, J K; Wang, X Z; Luo, J K; Fu, Y Q; Chen, J J; Duan, P F; Mayrhofer, P; Bittner, A; Schmid, U

2016-01-01

This paper reports the characterization of scandium aluminum nitride (Al 1−xS c xN , x   =  27%) films and discusses surface acoustic wave (SAW) devices based on them. Both AlScN and AlN films were deposited on silicon by sputtering and possessed columnar microstructures with (0 0 0 2) crystal orientation. The AlScN/Si SAW devices showed improved electromechanical coupling coefficients ( K 2 , ∼2%) compared with pure AlN films (<0.5%). The performance of the two types of devices was also investigated and compared, using acoustofluidics as an example. The AlScN/Si SAW devices achieved much lower threshold powers for the acoustic streaming and pumping of liquid droplets, and the acoustic streaming and pumping velocities were 2  ×  and 3  ×  those of the AlN/Si SAW devices, respectively. Mechanical characterization showed that the Young’s modulus and hardness of the AlN film decreased significantly when Sc was doped, and this was responsible for the decreased acoustic velocity and resonant frequency, and the increased temperature coefficient of frequency, of the AlScN SAW devices. (paper)

Experimental Studies on the Interaction of scCO2 and scCO2-SO2 With Rock Forming Minerals at Conditions of Geologic Carbon Storages - First Results

Science.gov (United States)

Erzinger, J.; Wilke, F.; Wiersberg, T.; Vasquez Parra, M.

2010-12-01

Co-injection of SO2 (plus possibly NOx and O2) during CO2 storage in deep saline aquifers may cause stronger brine acidification than CO2 alone. Because of that, we investigate chemical corrosion of rocks and rock-forming minerals with impure supercritical CO2 (scCO2) at possible storage conditions of >73.7 bar and >31°C. Contaminates were chosen with respect to the composition of CO2 captured industrially from coal-fired power plants using the oxyfuel technology. The resulting data should build a base for the long-term prediction of the behavior of CO2 in geologic storage reservoirs. Experiments of up to 1000 hrs duration have been performed with 10 natural mineral concentrates (calcite, dolomite, siderite, anhydrite, hematite, albite, microcline, kaolinite, muscovite, biotite) in 3n NaCl solution and pure scCO2 or scCO2+SO2 (99.5+0.5 vol%). The NaCl reaction fluid resembles the average salinity of deep formation waters of the North German Basin and is not free of oxygen. To increase reaction rates all minerals were ground and the reagents agitated either by stirring or shaking in autoclaves of about one liter in volume. The autoclaves consist of Hastelloy™ or ferromagnetic stainless steel fully coated with PTFE. We used in average 15 g of solids, 700 ml liquid, and the vessels were pressurized up to 100 bars with CO2 or CO2-SO2 mixture. Experiments were run at temperatures up to 90°C. Before, during and after the experiments small amounts fluids were sampled and analyzed for dissolved constituents and pH. Solid phases were characterized by XRF, XRD, and EMPA before and after the experiments. Pure scCO2 corrodes all carbonates, reacts only slightly with anhydrite, albite, and microcline at a minimum pH of 4, and does not recognizably interact with the others. After the experiment, albite has gained in a, not yet fully identified, carbonate phase which might be dawsonite. Reaction fluids of the experiments with scCO2+SO2 have mostly lower pH than using scCO2

Characterization of Anti-Citrinin Specific ScFvs Selected from Non-Immunized Mouse Splenocytes by Eukaryotic Ribosome Display.

Directory of Open Access Journals (Sweden)

Haiwei Cheng

Full Text Available Single chain variable fragments (scFvs against citrinin (CIT were selected from a scFv library constructed from the splenocytes of non-immunized mice by an improved eukaryotic ribosome display technology in this study. Bovine serum albumin (BSA/ CIT-BSA and ovalbumin (OVA/ CIT-OVA were used as the antigens to select specific anti-CIT scFvs. Eukaryotic in situ RT-PCR method was used to recover the selected mRNA after every affinity selection. After six rounds of ribosome display, expression vector pTIG-TRX carrying specific scFv DNAs were constructed and transformed into Escherichia coli BL21 (DE3 for protein expression. Thirteen positive clones were selected out of which three (designated 23, 68 and 109 showed high binding activity and specificity to CIT by indirect ELISA, while no clone showed binding activity with carrier proteins. The three scFvs showed high specificity to CIT and the cross reactivity with other mycotoxins was below 0.01% as determined by indirect competitive ELISA. These specific scFvs offer a potential novel immunoassay method for CIT residues. This study confirmed the effectiveness of the improved eukaryotic ribosome display system and could be used as a reference for the selection of scFvs specific to other small molecules using ribosome display.

Charge movement in a GaN-based hetero-structure field effect transistor structure with carbon doped buffer under applied substrate bias

International Nuclear Information System (INIS)

Pooth, Alexander; Uren, Michael J.; Cäsar, Markus; Kuball, Martin; Martin, Trevor

2015-01-01

Charge trapping and transport in the carbon doped GaN buffer of a GaN-based hetero-structure field effect transistor (HFET) has been investigated under both positive and negative substrate bias. Clear evidence of redistribution of charges in the carbon doped region by thermally generated holes is seen, with electron injection and capture observed during positive bias. Excellent agreement is found with simulations. It is shown that these effects are intrinsic to the carbon doped GaN and need to be controlled to provide reliable and efficient GaN-based power HFETs

Recombinant norovirus-specific scFv inhibit virus-like particle binding to cellular ligands

Directory of Open Access Journals (Sweden)

Hardy Michele E

2008-01-01

Full Text Available Abstract Background Noroviruses cause epidemic outbreaks of gastrointestinal illness in all age-groups. The rapid onset and ease of person-to-person transmission suggest that inhibitors of the initial steps of virus binding to susceptible cells have value in limiting spread and outbreak persistence. We previously generated a monoclonal antibody (mAb 54.6 that blocks binding of recombinant norovirus-like particles (VLP to Caco-2 intestinal cells and inhibits VLP-mediated hemagglutination. In this study, we engineered the antigen binding domains of mAb 54.6 into a single chain variable fragment (scFv and tested whether these scFv could function as cell binding inhibitors, similar to the parent mAb. Results The scFv54.6 construct was engineered to encode the light (VL and heavy (VH variable domains of mAb 54.6 separated by a flexible peptide linker, and this recombinant protein was expressed in Pichia pastoris. Purified scFv54.6 recognized native VLPs by immunoblot, inhibited VLP-mediated hemagglutination, and blocked VLP binding to H carbohydrate antigen expressed on the surface of a CHO cell line stably transfected to express α 1,2-fucosyltransferase. Conclusion scFv54.6 retained the functional properties of the parent mAb with respect to inhibiting norovirus particle interactions with cells. With further engineering into a form deliverable to the gut mucosa, norovirus neutralizing antibodies represent a prophylactic strategy that would be valuable in outbreak settings.

DiSC aitab käitumist parandada / Ain Kivesti

Index Scriptorium Estoniae

Kivesti, Ain

2008-01-01

DiSC testi abil on võimalik saada ülevaade personaalsetest käitumishoiakutest ning vastavalt olukorrale on võimalik harjumuspärast reageerimisstiili radikaalselt muuta. Kommenteerivad Jorma Sarv ja Paavo Pilv

Cosmogenic 45Sc in Gibeon iron meteorite by radioanalytical neutron activation analysis

International Nuclear Information System (INIS)

Oura, Y.; Honda, M.; Ebihara, M.; Bajo, K.; Nagao, K.

2011-01-01

Cosmogenic nuclides in many fragments of Gibeon iron meteorite have been studied by Honda and coworkers. They observed that their concentrations varied by 5 orders and found that Gibeon gives two different exposure ages using pair of stable noble gas isotopes and radinuclide. To assess one possible cause for the difference, namely loss of partial noble gases due to atmospheric heating of the incoming meteoroid, concentrations of non-volatile and stable cosmogenic 45 Sc of Gibeon were determined by radiochemical neutron activation analysis (RNAA). For RNAA, a radiochemical procedure using extraction chromatography was developed to separate Sc from an iron meteorite. Concentrations of 45 Sc in 7 fragments ranged from 0.0064 to 0.11 ppb and correlated with cosmogenic 4 He concentrations. This correlation suggests that noble gases in Gibeon were not lost during the fall to the earth. (orig.)

Electronic structure and physical properties of ScN in pressure: density-functional theory calculations

International Nuclear Information System (INIS)

Guan Pengfei; Wang Chongyu; Yu Tao

2008-01-01

Local density functional is investigated by using the full-potential linearized augmented plane wave (FP-LAPW) method for ScN in the hexagonal structure and the rocksalt structure and for hexagonal structures linking a layered hexagonal phase with wurtzite structure along a homogeneous strain transition path. It is found that the wurtzite ScN is unstable and the layered hexagonal phase, labelled as h o , in which atoms are approximately fivefold coordinated, is metastable, and the rocksalt ScN is stable. The electronic structure, the physical properties of the intermediate structures and the energy band structure along the transition are presented. It is found that the band gaps change from 4.0 to 1.0 eV continuously when c/a value varies from 1.68 to 1.26. It is noticeable that the study of ScN provides an opportunity to apply this kind of material (in wurtzite[h]-derived phase). (condensed matter: electronic structure, electrical, magnetic, and optical properties)

17 CFR 15.06 - Delegations.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Delegations. 15.06 Section 15... § 15.06 Delegations. (a) The Commission hereby delegates, until the Commission orders otherwise, the... Director of the Division of Market Oversight, to be exercised by such Director or by such other employee or...

Linking Gateway Technical College with Workforce Development: The SC Johnson-A Family Company Story.

Science.gov (United States)

Knudson, Edward

2004-01-01

Seven years ago, SC Johnson--A Family Company approached Gateway Technical College with a need to further strengthen their incumbent workforce's technical training and education. Retirements, brain drain, and competition for technical expertise were the forces driving SC Johnson to develop a comprehensive, flexible, and timely workplace education…

33 CFR 165.708 - Safety/Security Zone; Charleston Harbor and Cooper River, Charleston, SC.

Science.gov (United States)

2010-07-01

... Harbor and Cooper River, Charleston, SC. 165.708 Section 165.708 Navigation and Navigable Waters COAST... Guard District § 165.708 Safety/Security Zone; Charleston Harbor and Cooper River, Charleston, SC. (a... Cooper River. All coordinates referenced use datum: NAD 1983. (2) All waters within 100 yards of the...

International Conference on Nitride Semiconductors (10th) Held in Washington, DC on August 25-30, 2013

Science.gov (United States)

2014-08-17

Honorary Chair: M. Asif Khan, University of South Carolina, US ’ Program Chair - Russell Dupuis , Georgia Institute of Technology, US - Subject Chair...Russel D. Dupuis 11:00 am-11:15am B4.04 Andrew Armstrong 11:15am-11:30am B4.05 H/lichael Binder 11:30 am-11:46 am B4.06 Marco Ulises...00 pm 87.03 Xiang Zhou 4:00pm-4:15pm B7.04 Christopher J.Lewis 4:15 pm-4:30 pm B7.06 Yamina Andre 4:30 pm-4:45 pm B7.06 Hideaki

Production of a germline-humanized cetuximab scFv and evaluation of its activity in recognizing EGFR- overexpressing cancer cells.

Science.gov (United States)

Banisadr, Arsham; Safdari, Yaghoub; Kianmehr, Anvarsadat; Pourafshar, Mahdieh

2018-04-03

The aim of this study was to produce a humanized single chain antibody (scFv) as a potential improved product design to target EGFR (Epidermal Growth Factor Receptor) overexpressing cancer cells. To this end, CDR loops of cetuximab (an FDA-approved anti-EGFR antibody) were grafted on framework regions derived from type 3 (VH3 and VL3 kappa) human germline sequences to obtain recombinant VH and VL domainslinked together with a flexible linker [(Gly 4 Ser) 3 ] to form a scFv. Codon optimized synthetic gene encoding the scFv (with NH2-VH-linker-VL-COOH orientation) was expressed in E. coli Origami™ 2(DE3) cells and the resultant scFv purified by using Ni-NTA affinity chromatography. The scFv, called cet.Hum scFv, was evaluated in ELISA and immunoblot to determine whether it can recognize EGFR. The scFv was able to recognize EGFR over-expressing cancer cells (A-431) but failed to detect cancer cells with low levels of EGFR (MCF-7 cells). Although the affinity of the scFv forA-431 cells was 9 fold lower than that of cetuximab, it was strong enough to recognize these cells. Considering its ability to bind EGFR molecules, the scFv may exhibit a potential application for the detection of EGFR-overexpressing cancer cells.

First measurement of the nonlinear coefficient for Gd_1-xLu_x Ca₄O(BO₃)₃ and Gd_1-xSc_xCa₄O(BO₃)₃ crystals

DEFF Research Database (Denmark)

Andersen, Martin Thalbitzer; Mortensen, Jesper Liltorp; Germershausen, Sven

2007-01-01

The effective nonlinear coefficient and temperature acceptance bandwidth of three Lu and Sc co-doped GdCa4O(B03)3 type nonlinear crystals were measured. NCPM for SHG in to the blue-UV spectral region can be obtained by controlling the co-dopant concentration. Measurements were based on intra-cavi...

Evaluation of the first 44Sc-labeled Affibody molecule for imaging of HER2-expressing tumors

International Nuclear Information System (INIS)

Honarvar, Hadis; Müller, Cristina; Cohrs, Susan; Haller, Stephanie; Westerlund, Kristina; Karlström, Amelie Eriksson; Meulen, Nicholas P. van der; Schibli, Roger; Tolmachev, Vladimir

2017-01-01

Introduction: Affibody molecules are small (58 amino acids) high-affinity proteins based on a tri-helix non-immunoglobulin scaffold. A clinical study has demonstrated that PET imaging using Affibody molecules labeled with 68 Ga (T ½ = 68 min) can visualize metastases of breast cancer expressing human epidermal growth factor receptor type 2 (HER2) and provide discrimination between tumors with high and low expression level. This may help to identify breast cancer patients benefiting from HER2-targeting therapies. The best discrimination was at 4 h post injection. Due to longer half-life, a positron-emitting radionuclide 44 Sc (T ½ = 4.04 h) might be a preferable label for Affibody molecules for imaging at several hours after injection. Methods: A synthetic second-generation anti-HER2 Affibody molecule Z HER2:2891 was labeled with 44 Sc via a DOTA-chelator conjugated to the N-terminal amino group. Binding specificity, affinity and cellular processing 44 Sc-DOTA-Z HER2:2891 and 68 Ga-DOTA-Z HER2:2891 were compared in vitro using HER2-expressing cells. Biodistribution and imaging properties of 44 Sc-DOTA-Z HER2:2891 and 68 Ga-DOTA-Z HER2:2891 were evaluated in Balb/c nude mice bearing HER2-expression xenografts. Results: The labeling yield of 98 ± 2% and specific activity of 7.8 GBq/μmol were obtained. The conjugate demonstrated specific binding to HER2-expressing SKOV3.ip cells in vitro and to SKOV3.ip xenografts in nude mice. The distribution of radioactivity at 3 h post injection was similar for 44 Sc-DOTA-Z HER2:2891 and 68 Ga-DOTA-Z HER2:2891 , but the blood clearance of the 44 Sc-labeled variant was slower and the tumor-to-blood ratio was reduced (15 ± 2 for 44 Sc-DOTA-Z HER2:2891 vs 46 ± 9 for 68 Ga-DOTA-Z HER2:2891 ). At 6 h after injection of 44 Sc-DOTA-Z HER2:2891 the tumor uptake was 8 ± 2% IA/g and the tumor-to-blood ratio was 51 ± 8. Imaging using small-animal PET/CT demonstrated that 44 Sc-DOTA-Z HER2:2891 provides specific and high

M.Sc. in Civil and Structural Engineering

DEFF Research Database (Denmark)

The following pages contain a list of project ideas proposed by the scientific staff at the Department of Civil Engineering, Aalborg University, and a number of companies. Most of the project ideas in this catalogue may form the basis for long and short master projects as well as regular 3rd...... semester projects at the M.Sc. programme in Civil and Structural Engineering....

M.Sc. in Civil and Structural Engineering

DEFF Research Database (Denmark)

Clausen, Johan

The report contain a list of project ideas proposed by the scientific staff at the Department of Civil Engineering, Aalborg University, and a number of companies. Most of the project ideas in this catalogue may form the basis for long and short candidate projects as well as regular 3rd semester...... projects at the M.Sc. programme in Civil and Structural Engineering....

M.Sc. in Civil and Structural Engineering

DEFF Research Database (Denmark)

The catalogue contain a list of project ideas proposed by the scientific staff at the Department of Civil Engineering, Aalborg University, and a number of companies. Most of the project ideas in this catalogue may form the basis for long and short candidate projects as well as regular 3rd semester...... projects at the M.Sc. programme in Civil and Structural Engineering....

M.Sc. in Civil and Structural Engineering

DEFF Research Database (Denmark)

This catalogue contains a list of project ideas proposed by the scientific staff at the Department of Civil Engineering, Aalborg University, and a number of companies. Most of the project ideas in this catalogue may form the basis for long and short candidate projects as well as regular 3rd...... semester projects at the M.Sc. programme in Civil and Structural Engineering....

Solution Synthesis, Structure, and CO2 Reduction Reactivity of a Scandium(II) Complex, {Sc[N(SiMe3 )2 ]3 }.

Science.gov (United States)

Woen, David H; Chen, Guo P; Ziller, Joseph W; Boyle, Timothy J; Furche, Filipp; Evans, William J

2017-02-13

The first crystallographically characterizable complex of Sc 2+ , [Sc(NR 2 ) 3 ] - (R=SiMe 3 ), has been obtained by LnA 3 /M reactions (Ln=rare earth metal; A=anionic ligand; M=alkali metal) involving reduction of Sc(NR 2 ) 3 with K in the presence of 2.2.2-cryptand (crypt) and 18-crown-6 (18-c-6) and with Cs in the presence of crypt. Dark maroon [K(crypt)] + , [K(18-c-6)] + , and [Cs(crypt)] + salts of the [Sc(NR 2 ) 3 ] - anion are formed, respectively. The formation of this oxidation state of Sc is also indicated by the eight-line EPR spectra arising from the I=7/2 45 Sc nucleus. The Sc(NR 2 ) 3 reduction differs from Ln(NR 2 ) 3 reactions (Ln=Y and lanthanides) in that it occurs under N 2 without formation of isolable reduced dinitrogen species. [K(18-c-6)][Sc(NR 2 ) 3 ] reacts with CO 2 to produce an oxalate complex, {K 2 (18-c-6) 3 }{[(R 2 N) 3 Sc] 2 (μ-C 2 O 4 -κ 1 O:κ 1 O'')}, and a CO 2 - radical anion complex, [(R 2 N) 3 Sc(μ-OCO-κ 1 O:κ 1 O')K(18-c-6)] n . © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

Safety and adverse events of neoadjuvant short-course hyperfractionated accelerated radiotherapy (SC-HART) for rectal cancer

International Nuclear Information System (INIS)

Doi, Hiroshi; Kamikonya, Norihiko; Hirota, Shozo; Beppu, Naohito; Yanagi, Hidenori

2014-01-01

We presented good tolerability and short-term outcomes of neoadjuvant short-course hyperfractionated accelerated radiotherapy (SC-HART; 25 Gy in 10 fractions for 5 days) combined with chemotherapy in a total of 73 patients with lower rectal cancer. Age, gender, tumor differentiation, and the type of surgery seemed to have no apparent effects on toxicity of SC-HART. SC-HART appeared to have a good feasibility for use in further clinical trials. (author)

First-in-Human PET/CT Imaging of Metastatic Neuroendocrine Neoplasms with Cyclotron-Produced 44Sc-DOTATOC: A Proof-of-Concept Study.

Science.gov (United States)

Singh, Aviral; van der Meulen, Nicholas P; Müller, Cristina; Klette, Ingo; Kulkarni, Harshad R; Türler, Andreas; Schibli, Roger; Baum, Richard P

2017-05-01

44 Sc is a promising positron emission tomography (PET) radionuclide (T 1/2  = 4.04 hours, E β+average  = 632 keV) and can be made available, using a cyclotron production route, in substantial quantities as a highly pure product. Herein, the authors report on a first-in-human PET/CT study using 44 Sc-DOTATOC prepared with cyclotron-produced 44 Sc. The production of 44 Sc was carried out through the 44 Ca(p,n) 44 Sc nuclear reaction at Paul Scherrer Institut, Switzerland. After separation, 44 Sc was shipped to Zentralklinik Bad Berka, Germany, where radiolabeling was performed, yielding radiochemically pure 44 Sc-DOTATOC. Two patients, currently followed up after peptide receptor radionuclide therapy of metastatic neuroendocrine neoplasms, participated in this proof-of-concept study. Blood sampling was performed before and after application of 44 Sc-DOTATOC. PET/CT acquisitions, performed at different time points after injection of 44 Sc-DOTATOC, allowed detection of even very small lesions on delayed scans. No clinical adverse effects were observed and the laboratory hematological, renal, and hepatic profiles remained unchanged. In this study, cyclotron-produced 44 Sc was used in the clinic for the first time. It is attractive for theranostic application with 177 Lu, 90 Y, or 47 Sc as therapeutic counterparts. 44 Sc-based radiopharmaceuticals will be of particular value for PET facilities without radiopharmacy, to which they can be shipped from a centralized production site.

AAZTA: an ideal chelating agent for the development of {sup 44}Sc PET imaging agents

Energy Technology Data Exchange (ETDEWEB)

Nagy, Gabor; Szikra, Dezso; Trencsenyi, Gyoergy [Scanomed Ltd., Debrecen (Hungary); University of Debrecen, Medical Imaging Clinic (Hungary); Fekete, Aniko [University of Debrecen, Medical Imaging Clinic (Hungary); Garai, Ildiko [Scanomed Ltd., Debrecen (Hungary); Giani, Arianna M.; Negri, Roberto [Dipartimento di Scienze del Farmaco, Universita del Piemonte Orientale, Novara (Italy); Masciocchi, Norberto [Dipartimento di Scienza e Alta Tecnologia e To.Sca.Lab, Universita degli Studi dell' Insubria, Como (Italy); Maiocchi, Alessandro; Uggeri, Fulvio [Bracco Imaging spa, Bracco Research Centre, Colleretto Giacosa (Italy); Toth, Imre [Department of Inorganic and Analytical Chemistry, University of Debrecen (Hungary); Aime, Silvio [Dipartimento di Biotecnologie Molecolari e Scienze della Salute, Centro di Imaging Molecolare e Preclinico, Universita degli Studi di Torino (Italy); Giovenzana, Giovanni B. [Dipartimento di Scienze del Farmaco, Universita del Piemonte Orientale, Novara (Italy); CAGE Chemicals srl, Novara (Italy); Baranyai, Zsolt [Bracco Imaging spa, Bracco Research Centre, Colleretto Giacosa (Italy); Department of Inorganic and Analytical Chemistry, University of Debrecen (Hungary)

2017-02-13

Unprecedented fast and efficient complexation of Sc{sup III} was demonstrated with the chelating agent AAZTA (AAZTA=1,4-bis(carboxymethyl)-6-[bis(carboxymethyl)] amino-6-methylperhydro-1,4-d iazepine) under mild experimental conditions. The robustness of the {sup 44}Sc(AAZTA){sup -} chelate and conjugated biomolecules thereof is further shown by in vivo PET imaging in healthy and tumor mice models. The new results pave the way towards development of efficient Sc-based radiopharmaceuticals using the AAZTA chelator. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

Test Results of the LARP Nb$_3$Sn Quadrupole HQ03a

CERN Document Server

DiMarco, J; Anerella, M; Bajas, H; Chlachidze, G; Borgnolutti, F; Bossert, R; Cheng, D W; Dietderich, D; Felice, H; Pan, H; Ferracin, P; Ghosh, A; Godeke, A; Hafalia, A R; Marchevsky, M; Orris, D; Ravaioli, E; Sabbi, G; Salmi, T; Schmalzle, J; Stoynev, S; Strauss, T; Sylvester, C; Tartaglia, M; Todesco, E; Wanderer, P; Wang, X R; Yu, M

2016-01-01

The US LHC Accelerator Research Program (LARP) has been developing $Nb_3Sn$ quadrupoles of progressively increasing performance for the high luminosity upgrade of the Large Hadron Collider. The 120 mm aperture High-field Quadrupole (HQ) models are the last step in the R&D; phase supporting the development of the new IR Quadrupoles (MQXF). Three series of HQ coils were fabricated and assembled in a shell-based support structure, progressively optimizing the design and fabrication process. The final set of coils consistently applied the optimized design solutions, and was assembled in the HQ03a model. This paper reports a summary of the HQ03a test results, including training, mechanical performance, field quality and quench studies.

AGE RELATED DEGRADATION OF STEAM GENERATOR INTERNALS BASED ON INDUSTRY RESPONSES TO GENERIC LETTER 97-06

International Nuclear Information System (INIS)

SUBUDHI, M.; SULLIVAN, JR. E.J.

2002-01-01

THIS PAPER PRESENTS THE RESULTS OF AN AGING ASSESSMENT OF THE NUCLEAR POWER INDUSTRY RESPONSES TO NRC GENERIC LETTER 97-06 ON THE DEGRADATION OF STEAM GENERATOR INTERNALS EXPERIENCED AT ELECTRICITE DE FRANCE (EDF) PLANTS IN FRANCE AND AT A UNITED STATES PRESSURIZED WATER REACTOR (PWR). WESTINGHOUSE (W), COMBUSTION ENGINEERING (CE), AND BABCOCK AND WILCOX (BW) STEAM GENERATOR MODELS, CURRENTLY IN SERVICE AT U.S. NUCLEAR POWER PLANTS, POTENTIALLY COULD EXPERIENCE DEGRADATION SIMILAR TO THATFOUND AT EDF PLANTS AND THE U.S. PLANT. THE STEAM GENERATORS IN MANY OF THE U.S. PWRS HAVE BEEN REPLACED WITH STEAM GENERATORS WITH STEAM GENERATORS WITH IMPROVED DESIGNS AND MATERIALS. THESE REPLACEMENT STEAM GENERATORS HAVE BEEN MANUFACTURED IN THE U.S. AND ABROAD. DURING THIS ASSESSMENT, EACH OF THE THREE OWNERS GROUPS (W,CE, AND BW) IDENTIFIED FOR ITS STEAM GENERATOR, MODELS ALL THE POTENTIAL INTERNAL COMPONENTS THAT ARE VULNERABLE TO DEGRADATION WHILE IN SERVICE. EACH OWNERS GROUPDEVELOPED INSPEC TION AND MONITORING GUIDANCE AND RECOMMENDATIONS FOR ITS PARTICULAR STEAM GENERATOR MODELS. THE NUCLEAR ENERGY INSTITUTE INCORPORATED IN NEI 97-06 STEAM GENERATOR PROGRAM GUIDELINES, A REQUIREMENT TO MONITOR SECONDARY SIDE STEAM GENERATOR COMPONENTS IF THEIR FAILURE COULD PREVENT THE STEAM GENERATOR FROM FULFILLING ITS INTENDED SAFETY-RELATED FUNCTION. LICENSEES INDICATED THAT THEY IMPLEMENTED OR PLANNED TO IMPLEMENT, AS APPROPRIATE FOR THEIR STEAM GENERATORS, THEIR OWNERS GROUPRECOMMENDATIONS TO ADDRESS THE LONG-TERM EFFECTS OF THE POTENTIAL DEGRADATION MECHANISMS ASSOCIATED WITH THE STEAM GENERATOR INTERNALS

Calibration of the 46Sc sand tracer detector and it's application

International Nuclear Information System (INIS)

Li Zhangsu; Du Xiaoyun

1993-01-01

The authors describe the process and result for the calibration of radioactive 46 Sc detector in details. The calibration was carried out under the hydrological conditions similar to the field test. The relation between the intensity of the scattered γ-rays and the various water depths was studied by using a 46 Sc plane source. The purpose of calibration of the detector with the plane source is to determine both the detector sensitivity factor and the γ-ray absorption coefficient for san/water mixture in order to calculate the thickness of the mobile water layer by means of the count rate balance method. The relation curve between the various thicknesses of the mobile layers and count rates was studied in detailed in details by using a slab source and the uniformly mixed layers with 46 Sc glass. The curve is used as the calibration curve for determining the recovery of tracking radioactive tracer in situ. The recovery of tracer shows whether the field tracer data can be used to calculate the transport sediment rate or the in fill rate of sediment

Dietary trace element intakes of a selected sample of Canadian elderly women

International Nuclear Information System (INIS)

Gibson, R.S.; MacDonald, A.C.; Martinez, O.B.

1984-01-01

Energy, and selected trace intakes of a sample of 90 noninstitutionalized Canadian women (mean age 66.2 +/- 6.2 years) living in a University community and consuming self-selected diets were assessed by chemical analysis of one-day duplicate diets and via 1-day dietary records collected by the subjects. Mean gross energy intake (determined via bomb calorimetry was 6.0 +/- 2.4 MJ (1435 +/- 580 kcal) and mean intakes of Cu and Mn (determined via atomic absorption spectrophotometry) were 1.2 +/- 0.6 mg and 3.8 +/- 2.1 mg/day, respectively. Instrumental neutron activation analysis was used for Cr - median = 77.4 μg/day; Se - median = 69.6 μg/day; Zn - mean + SD = 7.7 +/- 3.6 mg/day; Ag - median = 26.9 μg/day; Cs - median = 4.8 μg/day; Rb - median = 1.6 mg/day; Sb - median = 1.8 μg/day; Sc - median = 0.3 μg/day. Dietary intakes of Cr, Mn and Se for the majority of the subjects fell within the US safe and adequate range. In contrast, a high proportion of subjects had apparently low intakes of dietary Cu and Zn in relation to current US dietary recommendations

PEGylation of polylysine dendrimers improves absorption and lymphatic targeting following SC administration in rats.

Science.gov (United States)

Kaminskas, Lisa M; Kota, Jagannath; McLeod, Victoria M; Kelly, Brian D; Karellas, Peter; Porter, Christopher Jh

2009-12-03

Polylysine dendrimers have potential as highly flexible, biodegradable nanoparticular carriers that may also promote lymphatic transport. The current study was undertaken to determine the impact of PEGylation on the absorption and lymphatic transport of polylysine dendrimers modified by surface derivatisation with PEG (200, 570 or 2000Da) or 4-benzene sulphonate following SC or IV dosing. PEGylation led to the PEG(200) derived dendrimer being rapidly and completely absorbed into the blood after SC administration, however only 3% of the administered dose was recovered in pooled thoracic lymph over 30h. Increasing the PEG chain length led to a systematic decrease in absorption into the blood and an enhancement of the proportion recovered in the lymphatics (up to 29% over 30h). For the PEG(570) and PEG(2000) derived dendrimers, indirect access to the lymph via equilibration across the capillary beds also appeared to play a role in lymphatic targeting after both IV and SC dosing. In contrast, the anionic benzene sulphonate-capped dendrimer was not well absorbed from the SC injection site (26% bioavailability) into either the blood or the lymph. The data suggest that PEGylated poly-L-lysine dendrimers are well absorbed from SC injection sites and that the extent of lymphatic transport may be enhanced by increasing the size of the PEGylated dendrimer complex.

GASIFICATION TEST RUN TC06

Energy Technology Data Exchange (ETDEWEB)

Southern Company Services, Inc.

2003-08-01

This report discusses test campaign TC06 of the Kellogg Brown & Root, Inc. (KBR) Transport Reactor train with a Siemens Westinghouse Power Corporation (Siemens Westinghouse) particle filter system at the Power Systems Development Facility (PSDF) located in Wilsonville, Alabama. The Transport Reactor is an advanced circulating fluidized-bed reactor designed to operate as either a combustor or a gasifier using a particulate control device (PCD). The Transport Reactor was operated as a pressurized gasifier during TC06. Test run TC06 was started on July 4, 2001, and completed on September 24, 2001, with an interruption in service between July 25, 2001, and August 19, 2001, due to a filter element failure in the PCD caused by abnormal operating conditions while tuning the main air compressor. The reactor temperature was varied between 1,725 and 1,825 F at pressures from 190 to 230 psig. In TC06, 1,214 hours of solid circulation and 1,025 hours of coal feed were attained with 797 hours of coal feed after the filter element failure. Both reactor and PCD operations were stable during the test run with a stable baseline pressure drop. Due to its length and stability, the TC06 test run provided valuable data necessary to analyze long-term reactor operations and to identify necessary modifications to improve equipment and process performance as well as progressing the goal of many thousands of hours of filter element exposure.

Transmission/reception of a partial sc-fdm symbol

DEFF Research Database (Denmark)

2017-01-01

A method is disclosed for signal processing in a radio system. The method comprises generating (801), in an apparatus (602), a single carrier frequency division multiplexing SC-FDM signal having a shorter duration than a time symbol duration defined by a radio standard applied in the radio system...

Meta-DiSc: a software for meta-analysis of test accuracy data.

Science.gov (United States)

Zamora, Javier; Abraira, Victor; Muriel, Alfonso; Khan, Khalid; Coomarasamy, Arri

2006-07-12

Systematic reviews and meta-analyses of test accuracy studies are increasingly being recognised as central in guiding clinical practice. However, there is currently no dedicated and comprehensive software for meta-analysis of diagnostic data. In this article, we present Meta-DiSc, a Windows-based, user-friendly, freely available (for academic use) software that we have developed, piloted, and validated to perform diagnostic meta-analysis. Meta-DiSc a) allows exploration of heterogeneity, with a variety of statistics including chi-square, I-squared and Spearman correlation tests, b) implements meta-regression techniques to explore the relationships between study characteristics and accuracy estimates, c) performs statistical pooling of sensitivities, specificities, likelihood ratios and diagnostic odds ratios using fixed and random effects models, both overall and in subgroups and d) produces high quality figures, including forest plots and summary receiver operating characteristic curves that can be exported for use in manuscripts for publication. All computational algorithms have been validated through comparison with different statistical tools and published meta-analyses. Meta-DiSc has a Graphical User Interface with roll-down menus, dialog boxes, and online help facilities. Meta-DiSc is a comprehensive and dedicated test accuracy meta-analysis software. It has already been used and cited in several meta-analyses published in high-ranking journals. The software is publicly available at http://www.hrc.es/investigacion/metadisc_en.htm.

HRTEM Study of Oxide Nanoparticles in 16Cr-4Al-2W-0.3Ti-0.3Y2O3 ODS Steel

Energy Technology Data Exchange (ETDEWEB)

Hsiung, L; Fluss, M; Wall, M; Kimura, A

2009-11-18

Crystal and interfacial structures of oxide nanoparticles in 16Cr-4Al-2W-0.3Ti-0.3Y{sub 2}O{sub 3} ODS ferritic steel have been examined using high-resolution transmission electron microscopy (HRTEM) techniques. Oxide nanoparticles with a complex-oxide core and an amorphous shell were frequently observed. The crystal structure of complex-oxide core is identified to be mainly monoclinic Y{sub 4}Al{sub 2}O{sub 9} (YAM) oxide compound. Orientation relationships between the oxide and matrix are found to be dependent on the particle size. Large particles (> 20 nm) tend to be incoherent and have a spherical shape, whereas small particles (< 10 nm) tend to be coherent or semi-coherent and have a faceted interface. The observations of partially amorphous nanoparticles lead us to propose three-stage mechanisms to rationalize the formation of oxide nanoparticles containing core/shell structures in as-fabricated ODS steels.

Tunable band gap and optical properties of surface functionalized Sc2C monolayer

International Nuclear Information System (INIS)

Wang Shun; Du Yu-Lei; Liao Wen-He

2017-01-01

Using the density functional theory, we have investigated the electronic and optical properties of two-dimensional Sc 2 C monolayer with OH, F, or O chemical groups. The electronic structures reveal that the functionalized Sc 2 C monolayers are semiconductors with a band gap of 0.44–1.55 eV. The band gap dependent optical parameters, like dielectric function, absorption coefficients, reflectivity, loss function, and refraction index were also calculated for photon energy up to 20 eV. At the low-energy region, each optical parameter shifts to red, and the peak increases obviously with the increase of the energy gap. Consequently, Sc 2 C monolayer with a tunable band gap by changing the type of surface chemical groups is a promising 2D material for optoelectronic devices. (paper)

QUALITY MANAGEMENT OF BAKERY PRODUCTS: A CASE STUDY IN SC

Directory of Open Access Journals (Sweden)

Nicoleta- Luminiţa STRÂMBEANU RISTEA

2013-01-01

Full Text Available The paper aimed to present the benefits of implementing HACCP (Hazard Analysis and Critical Control Points to company S.C. "DOBRE AND SONS" S.R.L. Constanta, Romania. The data have been provided by the above mentioned manufacturer. The objectives of S.C. "DOBRE AND SONS" S.R.L. are protecting the health of the consumers of the products and their satisfaction regarding the consumption of products that are nutritional, tasty, fresh, free from microbiological, chemical and physical hazard, as well as possessing stable properties during the validity for consumption. In this respect, there has been implemented and maintained an integrated management system of food quality and safety according to SR EN ISO 9001:2008, SR EN ISO 22000:2005 and according to IFS standard, version 5/2007, which consists of determining the potential biological, chemical and physical hazards that might affect the safety of bread and bakery products, or the health of the consumer. HACCP team is analyzing hazard using one of the recommended techniques: brainstorming or the cause - effect diagram. In conclusion, the company S.C. "DOBRE AND SONS" S.R.L. Constanta, Romania provides awareness and employee involvement at all levels in achieving the appointed objectives.

Semisolid slurry of 7A04 aluminum alloy prepared by electromagnetic stirring and Sc, Zr additions

Directory of Open Access Journals (Sweden)

Jun-wen Zhao

2017-05-01

Full Text Available Slurry preparation is one of the most critical steps for semisolid casting, and its primary goal is to prepare slurry with uniformly distributed fine globules. In this work, electromagnetic stirring (EMS and the addition of Sc and Zr elements were used to prepare semisolid slurry of 7A04 aluminum alloy in a large diameter slurry maker. The effects of different treatments on the microstructure, composition and their radial homogeneity were investigated. The results show that, compared to the slurry without any treatment, large volume slurry with finer and more uniform microstructure can be obtained when treated by EMS, Sc, or Zr additions individually. EMS is more competent in the microstructural and chemical homogenization of the slurry while Sc and Zr additions are more excellent in its microstructural refinement. The combined treatment of EMS, Sc and Zr produces premium 7A04 aluminum alloy slurry with uniformly distributed fine α-Al globules and composition. The interaction mechanism between EMS and Sc and Zr additions was also discussed.

Behavior of Equipment Support Beam Joint Directly Connected to A Steel-plate Concrete(SC) Wall

International Nuclear Information System (INIS)

Kim, K. S.; Kwon, K. J.

2008-01-01

To decrease the time for building nuclear power plants, a modular construction method, 'Steel-plate Concrete(SC)', has been investigated for over a decade. To construct a SC wall, a pair of steel plates are placed in parallel similar to a form-work in conventional reinforced concrete (RC) structures, and concrete is filled between the steel plates. Instead of removing the steel plates after the concrete has cured, the steel plates serve as components of the structural member. The exposed steel plate of SC structures serves as the base plate for the equipment support, and the headed studs welded to the steel plates are used as anchor bolts. Then, a support beam can be directly welded to the surface of the steel plate in any preferred position. In this study, we discuss the behavior and evaluation method of the equipment support joint directly connected to exposed steel plate of SC wall

Comparison of renal allograft (AG) biopsy diagnosis and temporal quantitation of Tc-99m sulfur colloid (SC) in clinically suspected AG rejection

International Nuclear Information System (INIS)

George, E.A.; Brown, W.N.; Carney, K.; Naidu, R.G.; Palmer, D.C.

1984-01-01

The purpose of this study was to evaluate the diagnostic efficacy of temporal quantitation of SC compared to tissue diagnosis of AG needle biopsy (Bx). The principal clinical criteria for patient selection were sequential or persistent reduction (at least 40-50%) of AG function as determined by serial serum creatinine levels. Thirty-four AG recipients were examined with SC and subsequent AG Bx in 37 instances. %SC AG accumulation and bone marrow extraction were interpreted in view of the significant sequential of persistent reduction of Ag function. Each AG Bx was collected from multiple needle aspirates and processed for light microscopy and immunoflorescent staining. Bx and SC exam were evaluated for acute rejection (AR), chronic rejection (CR) or other, non-rejection pathology. Acute tissue changes superimposed on chronic were regarded as AR. Acute tissue changes and % SC AG accumulation in the rejection range were graded as mild, moderate and marked. In AR there was 28/28 agreement of Bx and SC diagnosis; of which 7/28 were superimposed on CR. In Cr Bx and SC agreed in 3/7 instances, in 3/7 SC Dx was AR and in 1/7 SC exam was normal. Sensitivity and specificity of the SC diagnosis in this series was 100% and 63% for AR, 43% and 100% for CR and 97% and 100% in all instances of rejection. Bx and SC grading of AR agreed in 64%. In conclusion, temporal quantitation of SC demonstrated overall good correlation with AG Bx diagnosis in this series. The poor sensitivity of 43% of SC in Cr and only 64% correlation in grading AR may be due to inherent Bx sampling and SC data analysis error

Synthesis, microstructural characterization and optical properties of undoped, V and Sc doped ZnO thin films

International Nuclear Information System (INIS)

Amezaga-Madrid, P.; Antunez-Flores, W.; Ledezma-Sillas, J.E.; Murillo-Ramirez, J.G.; Solis-Canto, O.; Vega-Becerra, O.E.; Martinez-Sanchez, R.; Miki-Yoshida, M.

2011-01-01

Research highlights: → Undoped, V and Sc doped ZnO thin films by Aerosol Assisted Chemical Vapour Deposition. → Optimum substrate temperatures of 673 K and 623 K for Sc and V doped films. → Around one third of the dopants in solution were deposited into the films. → Crystallite and grain size decreased with the increase of dopant concentration. → Optical band gap increased from 3.29 to 3.32 eV for undoped to 7 Sc/Zn at. %. - Abstract: Many semiconductor oxides (ZnO, TiO 2 , SnO 2 ) when doped with a low percentage of non-magnetic (V, Sc) or magnetic 3d (Co, Mn, Ni, Fe) cation behave ferromagnetically. They have attracted a great deal of interest due to the integration of semiconducting and magnetic properties in a material. ZnO is one of the most promising materials to carry out these tasks in view of the fact that it is optically transparent and has n or p type conductivity. Here, we report the synthesis, microstructural characterization and optical properties of undoped, V and Sc doped zinc oxide thin films. ZnO based thin films with additions of V and Sc were deposited by the Aerosol Assisted Chemical Vapour Deposition method. V and Sc were incorporated separately in the precursor solution. The films were uniform, transparent and non-light scattering. The microstructure of the films was characterized by Grazing Incidence X-ray Diffraction, Scanning Electron Microscopy, and Scanning Probe Microscopy. Average grain size and surface rms roughness were estimated by the measurement of Atomic Force Microscopy. The microstructure of doped ZnO thin films depended on the type and amount of dopant material incorporated. The optical properties were determined from specular reflectance and transmittance spectra. Results were analyzed to determine the optical constant and band gap of the films. An increase in the optical band gap with the content of Sc dopant was obtained.

Temperature profiles from XBT casts from a World-Wide distribution from MULTIPLE PLATFORMS from 1979-06-03 to 1988-05-27 (NODC Accession 8800182)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Temperature profiles were collected from XBT casts from a World-Wide distribution. Data were collected from MULTIPLE PLATFORMS from 03 June 1979 to 27 May 1988. Data...

Influence of Sc on microstructure and mechanical properties of Al-Si-Mg-Cu-Zr alloy

Science.gov (United States)

Li, Yukun; Du, Xiaodong; Zhang, Ya; Zhang, Zhen; Fu, Junwei; Zhou, Shi'ang; Wu, Yucheng

2018-02-01

In the present study, the effects of Mg, Cu, Sc and Zr combined additions on the microstructure and mechanical properties of hypoeutectic Al-Si cast alloy were systematically investigated. Characterization techniques such as optical microscopy (OM), scanning electron microscope (SEM), energy dispersive spectrometer (EDS), electron back-scatter diffraction (EBSD), atomic force microscopy (AFM), transmission electron microscope (TEM), Brinell hardness tester and universal testing machine were employed to analyze the microstructure and mechanical properties. The results showed that Sc served as modifier on the microstructure of Al-3Si-0.45Mg-0.45Cu-0.2Zr alloys, including modification of eutectic Si and grains. Extraordinarily, grain refinement was found to be related to the primary particles, which exhibited a close orientation to matrix. After T6 heat treatment, the grain structures were composed of nano-scaled secondary Al3(Sc, Zr) precipitates and spherical eutectic Si. Combined with T6 heat treatment, the highest hardness, yield strength, ultimate tensile strength and elongation were achieved in 0.56 wt.% Sc-modified alloy. Interestingly, the strength and ductility had a similar tendency. This paper demonstrated that combined additions of Mg, Cu, Sc and Zr could significantly improve the microstructure and performance of the hypoeutectic Al-Si cast alloy.

Purification and refolding of anti-T-antigen single chain antibodies (scFvs) expressed in Escherichia coli as inclusion bodies.

Science.gov (United States)

Yuasa, Noriyuki; Koyama, Tsubasa; Fujita-Yamaguchi, Yoko

2014-02-01

T-antigen (Galβ1-3GalNAcα-1-Ser/Thr) is an oncofetal antigen that is commonly expressed as a carbohydrate determinant in many adenocarcinomas. Since it is associated with tumor progression and metastasis, production of recombinant antibodies specific for T-antigen could lead to the development of cancer diagnostics and therapeutics. Previously, we isolated and characterized 11 anti-T-antigen phage clones from a phage library displaying human single-chain antibodies (scFvs) and purified one scFv protein, 1G11. More recently, we purified and characterized 1E8 scFv protein using a Drosophila S2 expression system. In the current study, four anti-T-antigen scFv genes belonging to Groups 1-4 were purified from inclusion bodies expressed in Escherichia coli cells. Inclusion bodies isolated from E. coli cells were denatured in 3.5 M Gdn-HCl. Solubilized His-tagged scFv proteins were purified using Ni(2+)-Sepharose column chromatography in the presence of 3.5 M Gdn-HCl. Purified scFv proteins were refolded according to a previously published method of step-wise dialysis. Two anti-T-antigen scFv proteins, 1E6 and 1E8 that belong to Groups 1 and 2, respectively, were produced in sufficient amounts, thus allowing further characterization of their binding activity with T-antigen. Specificity and affinity constants determined using enzyme-linked immunosorbent assay (ELISA) and surface plasmon resonance (SPR), respectively, provided evidence that both 1E8 and 1E6 scFv proteins are T-antigen specific and suggested that 1E8 scFv protein has a higher affinity for T-antigen than 1E6 scFv protein.

Comparative study of Tm-doped and Tm-Sc co-doped Lu3Al5O12 scintillator

International Nuclear Information System (INIS)

Sugiyama, Makoto; Yanagida, Takayuki; Fujimoto, Yutaka

2014-01-01

The crystals of Tm doped and Tm-Sc co-doped Lu 3 Al 5 O 12 (LuAG) grown by the floating zone (FZ) method were examined for their optical and scintillation properties. In transmittance spectra, strong absorption lines due to Tm 3+ 4f–4f transitions were observed. X-ray excited radioluminescence spectra were measured and broad and sharp emission peaks were detected. The former one was attributed to Sc 3+ and the latter one was due to Tm 3+ 4f–4f transitions. Scintillation yield enhancement due to Sc co-doping was observed by means of 137 Cs pulse height spectra. Scintillation decay times were several tens of μs under pulse X-ray excitation. - Highlights: • LuAG:Tm and LuAG:Tm, Sc single crystals have been grown by the FZ method. • Tm 3+ 4f–4f absorption has been observed in transmittance spectra. • Scintillation yield of Tm-doped LuAG has been enhanced by Sc co-doping

Cross-sections of {sup 45}Sc(n,2n){sup 44m,g}Sc reaction from the reaction threshold to 20 MeV

Energy Technology Data Exchange (ETDEWEB)

Luo, J. [Hexi Univ., Zhangye (China). School of Physics and Electromechanical Engineering; Peking Univ., Beijing (China). State Key Laboratory of Nuclear Physics and Technology; Liu, R.; Jiang, L. [Chinese Academy of Engineering Physics, Mianyang (China). Inst. of Nuclear Physics and Chemistry; Liu, Z.; Sun, G.; Ge, S. [Hexi Univ., Zhangye (China). School of Physics and Electromechanical Engineering

2013-07-01

Cross sections of {sup 45}Sc(n,2n){sup 44m,g}Sc reactions and their isomeric cross section ratios {sigma}{sub m}/{sigma}{sub g} have been measured at three neutron energies between 13.5 and 14.8 MeV using the activation technique. The pure cross section of the groundstate was then obtained by utilizing the absolute cross section of the metastable state and analysis methods of residual nuclear decay. The monoenergetic neutron beam was produced via the {sup 3}H(d, n){sup 4}He reaction. The cross sections were also estimated with the TALYS-1.2 nuclear model code using different level density options, at neutron energies varying from the reaction threshold to 20 MeV. Results are also discussed and compared with some corresponding values found in the literature. (orig.)

SC: A NOVEL FUZZY CRITERION FOR SOLVING ENGINEERING AND CONSTRAINED OPTIMIZATION PROBLEMS

Directory of Open Access Journals (Sweden)

Sergio G. De los Cobos Silva

2017-04-01

Full Text Available In this paper a novel fuzzy convergence system (SC and its fundamentals are presented. The model was implemented on a monoobjetive PSO algorithm with three phases: 1 Stabilization, 2 generation and breadth-first search, and 3 generation and depth-first. The system SC-PSO-3P was tested with several benchmark engineering problems and with several CEC2006 problems. The computing experience and comparison with previously reported results is presented. In some cases the results reported in the literature are improved.

Results on testing pilot industrial batch of SC magnets for the UNK

International Nuclear Information System (INIS)

Ageev, A.I.; Andreev, N.I.; Balbekov, V.I.; Chirkov, P.N.; Dolzhenkov, V.I.; Gertsev, K.F.; Gridasov, V.I.; Myznikov, K.P.; Smirnov, N.L.; Sychev, V.A.

1992-01-01

IHEP has developed and studied the superconducting dipoles and quadrupoles of the regular part of the UNK main ring which satisfy the requirements imposed on them. The pilot-industrial batch of the UNK SC magnets has been produced now. The reproducibility of the magnet characteristics is studied and the mass production technology is optimized with this batch. The results of the cryogenic tests and the magnetic field measurements for the UNK SC dipoles of the pilot-industrial batch are presented. (author) 5 refs.; 6 figs.; 1 tab

Electrical characterization of high-pressure reactive sputtered ScOx films on silicon

International Nuclear Information System (INIS)

Castan, H.; Duenas, S.; Gomez, A.; Garcia, H.; Bailon, L.; Feijoo, P.C.; Toledano-Luque, M.; Prado, A. del; San Andres, E.; Lucia, M.L.

2011-01-01

Al/ScO x /SiN x /n-Si and Al/ScO x /SiO x /n-Si metal-insulator-semiconductor capacitors have been electrically characterized. Scandium oxide was grown by high-pressure sputtering on different substrates to study the dielectric/insulator interface quality. The substrates were silicon nitride and native silicon oxide. The use of a silicon nitride interfacial layer between the silicon substrate and the scandium oxide layer improves interface quality, as interfacial state density and defect density inside the insulator are decreased.

pPKCδ activates SC35 splicing factor during H9c2 myoblastic differentiation.

Science.gov (United States)

Zara, Susi; Falconi, Mirella; Rapino, Monica; Zago, Michela; Orsini, Giovanna; Mazzotti, Giovanni; Cataldi, Amelia; Teti, Gabriella

2011-01-01

Although Protein Kinase C (PKC) isoforms' role in the neonatal and adult cardiac tissue development and ageing has been widely described "in vivo", the interaction of such enzymes with specific nuclear substrates needs to be investigated. The aim of our research has been the study of the expression, localization and interaction with the splicing factor SC35 of PKC isoforms (α, δ, ε, ζ) and their potential role in modulating the transcription machinery. H9c2 cells induced to myoblast differentiation in the presence of 1% Horse Serum (HS) have represented our experimental model. The expression of PKC isoforms, their distribution and interaction with SC35 have been evaluated by western blotting, co-immunoprecipitation and double gold immunolabeling for transmission and scanning electron microscopy. Our results show PKCδ as the most expressed isoform in differentiated cells. Surprisingly, the distribution of PKCδ and SC35 does not show any significant modification between 10%FBS and 1%HS treated samples and no co-localization is observed. Moreover the interaction between the phosphorylated form of PKCδ (pPKCδ) and SC35 increases, is distributed and co-localizes within the nucleus of differentiated H9c2. These data represent reasonable evidence of pPKCδ mediated SC35 splicing factor activation, suggesting its direct effect on transcription via interaction with the transcription machinery. Furthermore, this co-localization represents a crucial event resulting in downstream changes in transcription of components which determine the morphological modifications related to cardiomyoblast differentiated phenotype.

Medialogi (Dansk informations brochure om Medialogi-uddannelsen, 1. til 10. semester (B.Sc. & Cand.Scient))

DEFF Research Database (Denmark)

Nordahl, Rolf; Andersen, Hans Jørgen

2006-01-01

Informationsbrochure, 28 sider, om Medialogi uddannelsen (Cand. Scient.), der udbydes af Aalborg Universitet i Aalborg, Esbjerg og København. Brochuren beskriver 1. til 10. semester af uddannelsen (B.Sc. og M.Sc.). Informationen er primært rettet mod potentielle ansøgere til Medialogi uddannelsen...

Effect of Sc addition and T6 aging treatment on the microstructure modification and mechanical properties of A356 alloy

Energy Technology Data Exchange (ETDEWEB)

Pramod, S.L. [Department of Metallurgical and Materials Engineering, Indian Institute of Technology Madras, Chennai 600036 (India); Ravikirana [Department of Metallurgical and Materials Engineering, Indian Institute of Technology Madras, Chennai 600036 (India); Department of Physics and Nanotechnology, SRM University, Chennai 603203 (India); Rao, A.K. Prasada [College of Engineering and Design, Alliance University, Bengaluru 562106 (India); Murty, B.S., E-mail: murty@iitm.ac.in [Department of Metallurgical and Materials Engineering, Indian Institute of Technology Madras, Chennai 600036 (India); Bakshi, Srinivasa R., E-mail: sbakshi@iitm.ac.in [Department of Metallurgical and Materials Engineering, Indian Institute of Technology Madras, Chennai 600036 (India)

2016-09-30

Effect of Sc addition and T6 aging treatment on the secondary dendritic arm spacing (SDAS), modification of eutectic Si morphology, β-Al{sub 5}FeSiand π-Al{sub 8}Mg{sub 3}Si{sub 6}Fe{sub 1} phases and its effect on mechanical properties in A356 alloy has been investigated. Addition of 0.4 wt%Sc in A356 alloy resulted in a 50%reduction in the secondary dendritic arm spacing (SDAS). Sc addition changed the morphology of eutectic Si from plate like to fibrous and globular. The needle like morphology of β-Al{sub 5}FeSi phase in A356 alloy changed to Al{sub 5}Fe(Si,Sc) phase having smaller size and irregular morphology. Transmission electron microscopy (TEM) diffraction pattern and Energy dispersive spectroscopy (EDS) analysis revealed the presence of β-Al{sub 5}FeSiand π-Al{sub 8}Mg{sub 3}Si{sub 6}Fe{sub 1} phases in A356 alloy which changed to β-Al{sub 5}Fe(Si,Sc), π-Al{sub 8}Mg{sub 3}(Si,Sc){sub 6}Fe{sub 1} and additional V-AlSi{sub 2}Sc{sub 2}phase was observed in Sc containing alloys. Addition of 0.4 wt%Sc to A356 alloy improved its Vickers hardness, Ultimate tensile strength (UTS), Yield strength (YS) and ductility by 20%, 25%, 20% and 30% respectively. Artificial aging treatment resulted in significant improvement in the tensile properties for both A356 and Sc added A356 alloys.

Magnetic anisotropy in the incommensurate ScFe{sub 4}Al{sub 8} system

Energy Technology Data Exchange (ETDEWEB)

Rećko, K., E-mail: k.recko@uwb.edu.pl [Faculty of Physics, University of Białystok, K. Ciołkowskiego 1L, 15-245 Białystok (Poland); Dobrzyński, L. [National Centre for Nuclear Research, A. Soltan 7, 05-400 Otwock-Świerk (Poland); Waliszewski, J.; Szymański, K. [Faculty of Physics, University of Białystok, K. Ciołkowskiego 1L, 15-245 Białystok (Poland)

2015-08-15

Neutron scattering and magnetization data are used for estimation of the spin ordering in ScFe{sub 4}Al{sub 8}. Results of experimental measurements are compared with the ground state configurations obtained by simulated annealing algorithms. The origins of the magnetocrystalline anisotropy of the scandium intermetallic alloy and the conditions of the coexistence of two different magnetic modulations as a function of the exchange integrals are discussed. The influence of the dipolar interactions for the noncollinearity and incommensurability in ScFe{sub 4}Al{sub 8} was determined. - Highlights: • We found dipolar and DM interactions as the anisotropy origins of 3d–3d–3p alloy. • We covered the explanation of incommensurability and noncollinearity of ScFe{sub 4}Al{sub 8}. • We discussed the magnetism resulting from competitiveness of exchange effects.

Extended defects in epitaxial Sc2O3 films grown on (111) Si

International Nuclear Information System (INIS)

Klenov, Dmitri O.; Edge, Lisa F.; Schlom, Darrell G.; Stemmer, Susanne

2005-01-01

Epitaxial Sc 2 O 3 films with the cubic bixbyite structure were grown on (111) Si by reactive molecular beam epitaxy. High-resolution transmission electron microscopy (HRTEM) revealed an abrupt, reaction-layer free interface between Sc 2 O 3 and Si. The ∼10% lattice mismatch between Si and Sc 2 O 3 was relieved by the formation of a hexagonal misfit dislocation network with Burgers vectors of 1/2 Si and line directions parallel to Si . A high density of planar defects and threading dislocations was observed. Analysis of lattice shifts across the planar defects in HRTEM showed that these faults were likely antiphase boundaries (APBs). ABPs form when film islands coalesce during growth because films nucleate with no unique arrangement of the ordered oxygen vacancies in the bixbyite structure relative to the Si lattice

Distances to Supernova Remnants G31.9+0.0 and G54.4−0.3 Associated with Molecular Clouds

Energy Technology Data Exchange (ETDEWEB)

Ranasinghe, S.; Leahy, D. A. [Department of Physics and Astronomy, University of Calgary, Calgary, AB T2N 1N4 (Canada)

2017-07-10

New distances to the supernova remnants (SNRs) G31.9+0.0 and G54.4−0.3 have been found. The analysis method uses H i absorption spectra and CO channel maps. Individual H i channel maps are used to verify absorption features in the H i absorption spectrum or to determine if they have noise. Both of the SNRs are associated with molecular clouds so accurate kinematic velocities are determined. The H iabsorption is used to resolve the kinematic distance ambiguity. The resulting new distance for G31.9+0.0 is 7.1 ± 0.4 kpc and for G54.4−0.3 it is 6.6 ± 0.6 kpc. These are significant revisions to the previous values.

Luminescence of La3+ and Sc3+ impurity centers in YAlO3 single-crystalline films

International Nuclear Information System (INIS)

Zorenko, Yu.; Gorbenko, V.; Voznyak, T.; Zorenko, T.; Nikl, M.; Nejezchleb, K.

2008-01-01

The luminescence of La Y 3+ and Sc Y 3+ and Sc Al 3+ centers created by lanthanum and scandium ions at Y 3+ and Al 3+ cation sites of YAlO 3 perovskite lattice was investigated. The features of emission of excitons localized at the mentioned centers in YAlO 3 :La and YAlO 3 :Sc single-crystalline films were analyzed by means of time-resolved emission spectroscopy and luminescence decay kinetics measurements under excitation by synchrotron radiation at 9 and 300 K

Implementation of LTE SC-FDMA on the USRP2 Software Defined Radio Platform

DEFF Research Database (Denmark)

Jørgensen, Peter Bjørn; Hansen, Thomas Lundgaard; Sørensen, Troels Bundgaard

2011-01-01

In this paper we discuss the implementation of a Single Carrier Frequency Division Multiple Access (SC-FDMA) transceiver running over the Universal Software Radio Peripheral 2 (USRP2). SC-FDMA is the air interface which has been selected for the uplink in the latest Long Term Evolution (LTE....../s. Experimental results on the Bit Error Rate (BER) versus Signal-to-Noise Ratio (SNR) are presented and compared to theoretical and simulated performance....

Enrichment of Sc{sub 2}O{sub 3} and TiO{sub 2} from bauxite ore residues

Energy Technology Data Exchange (ETDEWEB)

Deng, Bona; Li, Guanghui, E-mail: liguangh@csu.edu.cn; Luo, Jun; Ye, Qing; Liu, Mingxia; Peng, Zhiwei; Jiang, Tao

2017-06-05

Highlights: • Sc{sub 2}O{sub 3} and TiO{sub 2} from bauxite ore residue were successfully enriched. • H{sub 3}PO{sub 4} and NaOH were efficient for enriching Sc{sub 2}O{sub 3} and TiO{sub 2} by removing SiO{sub 2}, Al{sub 2}O{sub 3}, and partial Fe{sub 2}O{sub 3} and CaO. • Enriching mechanism of Sc{sub 2}O{sub 3} and TiO{sub 2} was explicitly explained. - Abstract: As a major byproduct generated in the alumina industry, bauxite ore residue is an important reserve of scandium and titanium. In this study, the feasibility and mechanism of enriching Sc{sub 2}O{sub 3} and TiO{sub 2} from a non-magnetic material, which was obtained from carbothermal reductive roasting and magnetic separation of bauxite ore residue, were investigated based on a two-step (acidic and alkali) leaching process. It was revealed that approximately 78% SiO{sub 2} and 30–40% of CaO, FeO and Al{sub 2}O{sub 3} were removed from a non-magnetic material with 0.0134 wt.% Sc{sub 2}O{sub 3} and 7.64 wt.% TiO{sub 2} by phosphoric acidic leaching, while about 95% Al{sub 2}O{sub 3} and P{sub 2}O{sub 5} were further leached by subsequent sodium hydroxide leaching of the upper-stream leach residue. A Sc{sub 2}O{sub 3}-, TiO{sub 2}- rich material containing 0.044 wt.% Sc{sub 2}O{sub 3} and 25.5 wt.% TiO{sub 2} was obtained, the recovery and the enrichment factor of Sc{sub 2}O{sub 3} and TiO{sub 2} were about 85% and 5, respectively. The enrichment of Sc{sub 2}O{sub 3} was attributed to higher pH (>3.3) of phosphoric acid solution than its dissolution pH{sup 0}, and the enrichment of TiO{sub 2} was mainly associated with the insoluble perovskite (CaTiO{sub 3}) in the acidic solution at ambient temperature. As Sc{sub 2}O{sub 3} and TiO{sub 2} cannot be dissolved in the alkali solution, they were further enriched in the leach residue.

Isothermal cross-sections of Hf-Sc-Ga(800 deg C) and Hf-Ti-Ga (750 deg C) phase diagrams

International Nuclear Information System (INIS)

Markiv, V.Ya.; Belyavina, N.N.

1981-01-01

Isothermal cross sections of Hf-Sc-Ga (800 deg C) and Hf-Ti-Ga (750 deg C) state diagrams are plotted. The existence of two ternary Hfsub(0.1-0.8)Scsub(0.9)-sub(0.2)Ga and Hfsub(0.8)Scsub(0.2)Gasub(3) phases is stated in the Hf-Sc-Ga system. The crystal structure of these compounds investigated by the powder method belongs to the structural α-MoB and ZrAl 3 types respectively. Continuous rows of (Hf, Sc 5 Ga 5 , (Hf, Ti)Ga 3 and (Hf, Ti)Ga 2 solid solutions are formed in the investigated systems. Essential quantity of the third component dissolve binary Sc 5 Ga 4 , Sc 2 Ga 3 (15 and 30 at % Hf respectively), Hf 5 Ga 4 , HfGa 2 (20, 10 at. % Sc), Hf 5 Ga 4 , HfGa, Hf 5 Ga 3 , Hf 2 Ga 3 (48, 30, 46, 20 at. % Ti) gallides [ru

Fabrication and characterization of novel antimicrobial films derived from thymol-loaded zein-sodium caseinate (SC) nanoparticles.

Science.gov (United States)

Li, Kang-Kang; Yin, Shou-Wei; Yang, Xiao-Quan; Tang, Chuan-He; Wei, Zi-Hao

2012-11-21

The objective of this research was to fabricate novel antimicrobial films based on zein colloidal nanoparticles coated with sodium caseinate (SC), an emulsifier/stabilizer. Thymol-loaded zein-SC nanoparticles were prepared using an antisolvent technique, with the average particle size and zeta potential about 200 ± 20 nm and -40 mV, respectively. Zein-SC nanoparticle-based films exhibited higher mechanical resistance and water barrier capacity than the SC films and concomitant good extensibility as compared with zein films. Thymol loadings endowed zein-SC nanoparticle-based films with antimicrobial activity against Escherichia coli and Salmonella as well as DPPH radical scavenging activity. Water vapor permeability, microstructure, mechanical, and controlled release properties of the films were evaluated. The possible relationship between some selected physical properties and microstructure were also discussed. Atomic force microscopy (AFM) analysis indicated that thymol loadings resulted in the emergence phenomena of the nanoparticles to form large particles or packed structure, consisting of clusters of nanoparticles, within the film matrix, in a thymol loading dependent manner. The appearance of large particles or an agglomerate of particles may weaken the compactness of protein network of films and thus impair the water barrier capacity, mechanical resistance, and extensibility of the films. The release kinetics of thymol from nanoparticle-based films can be described as a two-step biphasic process, that is, an initial burst effect followed by subsequent slower release, and zein-SC nanoparticles within the films matrices gave them the ability to sustain the release of thymol. In addition, a schematic illustration of the formation pathway of zein-SC nanoparticle-based films with or without thymol was proposed to illuminate the possible relationship between some selected physical properties and the microstructure of the films.

Effect of Agri-SC as a soil conditioner on runoff, soil loss and crust ...

African Journals Online (AJOL)

This study was carried out to determine the effect of Agri-SC as a soil conditioner at different doses (0, 18.50, 37.00, 55.50 and 74.00 l ha-1) on water erosion and crust strengths under laboratory conditions with three replicates. The Agri-SC solutions were sprayed and two consecutive simulated rainfalls (60 mm h-1) were ...

A comprehensive framework for optimising the effects of inverse logistics practices in SC sustainability

Directory of Open Access Journals (Sweden)

Cristina López Vargas

2017-06-01

Full Text Available With growing sustainability concern in mind, firms seek to implement reverse logistic systems in their operations. However, if these practices were not properly implemented, they would be costly and even ineffective. In order to guide company efforts, the present study provide a comprehensive framework based on two dimensions. On one hand, it suits a reverse logistic management model stage-by-stage. On the other hand, the framework brings together concrete measures to optimize SC sustainability from three perspectives: operative, economical and environmental. The proposed framework thus allow to balance reverse logistic practices and SC sustainability. Furthermore, we validated it by analysing six real case in different industries. Findings highlight how reverse logistic activities may improve each SC sustainability dimension.

Primary beam-loading tests on DC-SC photoinjector at Peking University

International Nuclear Information System (INIS)

Hao Jiankui; Lu Xiangyang; Ding, Yuantao; Quan Shengwen; Huang Senlin; Zhao Kui; Zhang Baocheng; Wang Lifang; Lin Lin; Jiao Fei; Wang Guimei; Xie Datao; Zhu Feng; Xiao Binping; Xiang Rong; Chen Jia'er

2006-01-01

The DC-SC photoinjector is a compact electron gun integrating a DC pierce gun with a 1.3 GHz 1+1/2 cell superconducting cavity. A test facility of the DC-SC photoinjector had been installed in Peking University and beam-loading tests at 4.4 K have been finished. To date the gradient of 6 MV/m has been achieved. The maximum energy gain is 1.1 MeV at 4.4 K. With average beam current of 270 μA, the measured rms emittance is about 5 mm mrad at the beam energy of 500 keV. In this paper some of the experimental results are summarized

40 CFR 192.03 - Monitoring.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Monitoring. 192.03 Section 192.03... of Residual Radioactive Materials from Inactive Uranium Processing Sites § 192.03 Monitoring. A groundwater monitoring plan shall be implemented, to be carried out over a period of time commencing upon...

Crystal structure and luminescence properties of (Ca{sub 2.94-x}Lu{sub x}Ce{sub 0.06})(Sc{sub 2-y}Mg{sub y})Si{sub 3}O{sub 12} phosphors for white LEDs with excellent colour rendering and high luminous efficiency

Energy Technology Data Exchange (ETDEWEB)

Liu Yongfu; Zhang Xia; Hao Zhendong; Lu Wei; Liu Xingyuan; Zhang Jiahua [Key Laboratory of Excited State Processes, Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences, 3888 Eastern South Lake Road, Changchun 130033 (China); Wang Xiaojun, E-mail: zhangjh@ciomp.ac.cn [Department of Physics, Georgia Southern University, Statesboro, GA 30460 (United States)

2011-02-23

Lu-modified (Ca{sub 2.94-x}Lu{sub x}Ce{sub 0.06})(Sc{sub 2-y}Mg{sub y})Si{sub 3}O{sub 12} (CLSMS : Ce{sup 3+}) yellow emitting phosphors are prepared by a solid-state reaction. Controllable luminescent intensity and emitting colour are studied as a function of Lu and Mg contents. Fixing the Mg content to be 1, the effect of Lu content on crystal phase formation, luminescence properties and temperature characteristics is studied. It is revealed that the Lu-induced luminescent enhancement is the result of an increase in absorbance of Ce{sup 3+} rather than the internal quantum efficiency. Intense and broadband emission is realized by controlling the Lu content to obtain a pure CLSMS crystal phase. The maximum luminescence intensity is obtained at x = 0.54, which is as high as 156% of the Lu-free phosphor. The Lu-containing phosphor also exhibits better temperature characteristics for its big activation energy (0.20 eV) than the Lu-free one (0.18 eV). Combining the present phosphor with a blue light-emitting diode (LED) chip, a white LED with an excellent colour rendering index R{sub a} of 86 and a high luminous efficiency of 86 lm W{sup -1} is obtained. The results of the present study demonstrate that the CLSMS : Ce{sup 3+} phosphors show a good performance and are attractive candidates for commercial applications when used in white LEDs.

Safety and Efficacy of an Artificial Tear Containing 0.3% Hyaluronic Acid in the Management of Moderate-to-Severe Dry Eye Disease.

Science.gov (United States)

López-de la Rosa, Alberto; Pinto-Fraga, José; Blázquez Arauzo, Francisco; Urbano Rodríguez, Rubén; González-García, María J

2017-11-01

To evaluate the safety and efficacy of a new 0.3% hyaluronic acid artificial tear compared with 0.9% saline solution (0.9% NaCl) in moderate-to-severe dry eye patients after 1 month's use. A total of 16 patients with moderate-to-severe dry eye were included in this crossover study. After a 1-week washout period, patients used the experimental (Visaid 0.3%) or control solution (0.9% NaCl), selected randomly, applying three to eight drops daily for a month. After another washout period, patients used the other solution in the same way. Percentage of change (ΔY) was calculated and analyzed for (1) safety variables: visual acuity, intraocular pressure, and ophthalmoscopy evaluation; (2) efficacy variable: Ocular Surface Disease Index (OSDI) questionnaire; and (3) secondary variables: biomicroscopy findings, fluorescein corneal staining, lissamine green conjunctival staining, tear breakup time (TBUT), contrast sensitivity, Schirmer test, and subject satisfaction. There were no significant differences in the safety parameters for either solution. After using Visaid 0.3%, patients showed significant improvements in OSDI score (ΔY: -9.66%±10.90), tarsal hyperemia (ΔY: -16.67%±27.89), corneal staining extension (ΔY: -34.90%±42.41), TBUT (ΔY: 13.98%±26.19), and subjective satisfaction (ΔY: 38.06%±47.06). When using 0.9% NaCl, Schirmer test results were significantly worse (ΔY: -11.47%±19.27). A significant difference between the 2 solutions was found in TBUT (ΔY: 13.98%±26.19 vs. 10.15%±42.34, respectively; P=0.0214). Visaid 0.3% is a safe product with some benefits over 0.9% NaCl in reducing ocular symptoms and improving some ocular signs in patients with moderate-to-severe dry eye.

Investigations towards the use of Gd0.7Ca0.3CoOx as membrane in an exhaust gas sensor for NOx

NARCIS (Netherlands)

Romer, E.W.J.; Nigge, Ulrich; Schulte, Thomas; Wiemhöfer, Hans-Dieter; Bouwmeester, Henricus J.M.

2001-01-01

Application of a material with the nominal composition Gd0.7Ca0.3CoOx is considered for use as membrane material in an exhaust gas sensor for NOx. SEM–EDX and XRD measurements revealed that after sintering at 1200°C in air, three co-existing phases are present: (Gd0.6Ca0.4)2CoOx (60 vol.%), GdCoO3

Valence electron structure analysis of refining mecha-nism of Sc and Ti additions on aluminum

Institute of Scientific and Technical Information of China (English)

LI PieJie; YE YiCong; HE LiangJu

2009-01-01

The mechanism of the difference of refining effect between Sc and Ti adding to aluminum can not be explained substantially with traditional theory. Valence electron structures of AI-Ti and Al-Sc alloys have been studied by using the empirical electron theory of solids and molecules (EET). The covalent bond electron numbers and interfacial electron density differences are calculated. The conclusion is that, in the two alloys, different covalent bond electron numbers of nucleation particles, and different electron densities on the interface between the second phase particles and the matrix, fundamentally lead to the difference of refining effect between Sc and Ti adding to aluminum.

Reliability of Direct Behavior Ratings--Social Competence (DBR-SC) Data: How Many Ratings Are Necessary?

Science.gov (United States)

Kilgus, Stephen P.; Riley-Tillman, T. Chris; Stichter, Janine P.; Schoemann, Alexander M.; Bellesheim, Katie

2016-01-01

The purpose of this investigation was to evaluate the reliability of Direct Behavior Ratings--Social Competence (DBR-SC) ratings. Participants included 60 students identified as possessing deficits in social competence, as well as their 23 classroom teachers. Teachers used DBR-SC to complete ratings of 5 student behaviors within the general…

Annual evapotranspiration of a forested wetland watershed, SC

Science.gov (United States)

Devendra M. Amatya; Carl Trettin

2007-01-01

In this study, hydro-meteorological data collected from 1 964 to 1 9 76 on an approximately 5, 000 ha predominantly forested coastal watershed (Turkey Creek) at the Francis Marion National Forest near Charleston, SC were analyzed to estimate annual evapotranspiration (E T) using four different empirical methods. The first one, reported by Zhang et a/. (2001), that...

78 FR 42532 - Prospective Grant of Start-Up Exclusive Evaluation Option License: Methods of Treating Giardiasis...

Science.gov (United States)

2013-07-16

.../US2011/055902 filed October 12, 2011 (E-211-2010/2-PCT-01); US patent application No. 13/878,832 filed April 11, 2013 (E-211-2010/2-US-06); European patent application No. 11773158.8 filed May 2, 2013 (E-211-2010/2-EP-04); Canadian application No. 2,814,694 filed April 11, 2013 (E-211-2010/2-CA-03); Australia...

44gSc from metal calcium targets for PET

DEFF Research Database (Denmark)

Severin, Gregory; Gagnon, K.; Engle, J. W.

2012-01-01

A low-cost and efficient method for producing pre-clinical scale quantities of 44gSc is presented. Production involves proton irradiation of natural unenriched calcium metal followed by rapid separation of radioscandium from the target using hydroxmate functionalized resin.© 2012 American Institute...

Laboratory oscillator strengths of Sc i in the near-infrared region for astrophysical applications

Science.gov (United States)

Pehlivan, A.; Nilsson, H.; Hartman, H.

2015-10-01

Context. Atomic data is crucial for astrophysical investigations. To understand the formation and evolution of stars, we need to analyse their observed spectra. Analysing a spectrum of a star requires information about the properties of atomic lines, such as wavelengths and oscillator strengths. However, atomic data of some elements are scarce, particularly in the infrared region, and this paper is part of an effort to improve the situation on near-IR atomic data. Aims: This paper investigates the spectrum of neutral scandium, Sc I, from laboratory measurements and improves the atomic data of Sc I lines in the infrared region covering lines in R, I, J, and K bands. Especially, we focus on measuring oscillator strengths for Sc I lines connecting the levels with 4p and 4s configurations. Methods: We combined experimental branching fractions with radiative lifetimes from the literature to derive oscillator strengths (f-values). Intensity-calibrated spectra with high spectral resolution were recorded with Fourier transform spectrometer from a hollow cathode discharge lamp. The spectra were used to derive accurate oscillator strengths and wavelengths for Sc I lines, with emphasis on the infrared region. Results: This project provides the first set of experimental Sc I lines in the near-infrared region for accurate spectral analysis of astronomical objects. We derived 63 log(gf) values for the lines between 5300 Å and 24 300 Å. The uncertainties in the f-values vary from 5% to 20%. The small uncertainties in our values allow for an increased accuracy in astrophysical abundance determinations.

33 CFR 64.03 - Scope.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Scope. 64.03 Section 64.03... STRUCTURES, SUNKEN VESSELS AND OTHER OBSTRUCTIONS General § 64.03 Scope. (a) Except as provided in paragraph... jurisdiction of the United States and, on the high seas, structures owned or operated by persons subject to the...

Density-functional band-structure calculations for La-, Y-, and Sc-filled CoP3-based skutterudite structures

International Nuclear Information System (INIS)

Loevvik, O.M.; Prytz, O.

2004-01-01

The crystal structure, thermodynamic stability, and electronic structure of La-, Y-, and Sc-filled CoP 3 are predicted from density-functional band-structure calculations. The size of the cubic voids in the skutterudite structure is changed much less than the difference in size between the different filling atoms, and we expect that the larger rattling amplitude of the smaller Sc and Y atoms may decrease the lattice thermal conductivity of Sc- and Y-filled structures significantly compared to La-filled structures. The solubility of La, Y, and Sc in CoP 3 is calculated to be around 5, 3-6 %, and below 1% at 0 K, respectively. Based on similar systems, this is expected to increase considerably if Fe is substituted for Co. Fe substitution is also expected to compensate the increased charge carrier concentration of the filled structures that is seen in the calculated electron density of states. In conclusion, Sc- or Y-filled (FeCo)P 3 skutterudite structures are promising materials for thermoelectric applications

Extraction mechanism of Sc(III) from sulphuric acid solution by primary amine N1923

International Nuclear Information System (INIS)

Le Shaoming; Li Deqian; Ni Jiazan

1987-01-01

The extraction mechanism of Sc(III) from sulphuric acid solution by primary amine N 1923 (RNH 2 ) has been investigated by means of slope, isomolar continuous variation and saturation methods. The effect of temperature on the extraction of Sc(III) is observed. The extraction equilibrium constant and thermodynamic functions (ΔH, ΔS and ΔG) are obtained. The IR and NMR of extracted compound are measured

Sc2C2@D3h(14246)-C74: A Missing Piece of the Clusterfullerene Puzzle.

Science.gov (United States)

Wang, Yaofeng; Tang, Qiangqiang; Feng, Lai; Chen, Ning

2017-02-20

Clusterfullerenes with variable carbon cages have been extensively studied in recent years. However, despite all these efforts, C 74 cage-based clusterfullerene remains a missing piece of the puzzle. Herein, we show that single-crystal X-ray crystallographic analysis unambiguously assigns the previously reported dimetallofullerene Sc 2 @C 76 to a novel carbide clusterfullerene, Sc 2 C 2 @D 3h (14246)-C 74 , the first experimentally proven clusterfullerene with a C 74 cage. In addition, Sc 2 C 2 @D 3h (14246)-C 74 was charaterized by mass spectrometry, ultraviolet-visible-near-infrared absorption spectroscopy, 45 Sc nuclear magnetic resonance, and cyclic voltammetry. Comparative studies of the motion of the carbide cluster in Sc 2 C 2 @D 3h (14246)-C 74 and Sc 2 C 2 @C 2n (n = 40-44) revealed that a combination of factors, involving both the shape and size of the cage, is crucial in dictating the cluster motion. Moreover, structural studies of D 3h (14246)-C 74 revealed that it can be easily converted to C s (10528)-C 72 and T d (19151)-C 76 cages via C 2 desertion/insertion and Stone-Wales transformation. This suggests that D 3h (14246)-C 74 might play an important role in the growth pathway of clusterfullerenes.

33 CFR 151.06 - Special areas.

Science.gov (United States)

2010-07-01

....06 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) POLLUTION... Pertains to Pollution from Ships General § 151.06 Special areas. (a) For the purposes of this part, the... that portion of the Atlantic Ocean within the boundary constituted by the 30° N parallel from Florida...

Development of Field-Controlled Smart Optic Materials (ScN, AlN) with Rare Earth Dopants

Science.gov (United States)

Kim, Hyun-Jung; Park, Yeonjoon; King, Glen C.; Choi, Sang H.

2012-01-01

The purpose of this investigation is to develop the fundamental materials and fabrication technology for field-controlled spectrally active optics that are essential for industry, NASA, and DOD applications such as: membrane optics, filters for LIDARs, windows for sensors, telescopes, spectroscopes, cameras, flat-panel displays, etc. ScN and AlN thin films were fabricated on c-axis Sapphire (0001) or quartz substrate with the RF and DC magnetron sputtering. The crystal structure of AlN in fcc (rocksalt) and hcp (wurtzite) were controlled. Advanced electrical characterizations were performed, including I-V and Hall Effect Measurement. ScN film has a free carrier density of 5.8 x 10(exp 20)/per cubic centimeter and a conductivity of 1.1 x 10(exp 3) per centimeter. The background ntype conductivity of as-grown ScN has enough free electrons that can readily interact with the photons. The high density of free electrons and relatively low mobility indicate that these films contain a high level of shallow donors as well as deep levels. Also, the UV-Vis spectrum of ScN and AlN thin films with rare earth elements (Er or Ho) were measured at room temperature. Their optical band gaps were estimated to be about 2.33eV and 2.24eV, respectively, which are obviously smaller than that of undoped thin film ScN (2.4eV). The red-shifted absorption onset gives direct evidence for the decrease of band gap (Eg) and the energy broadening of valence band states are attributable to the doping. As the doped elements enter the ScN crystal lattices, the localized band edge states form at the doped sites with a reduction of Eg. Using a variable angle spectroscopic ellipsometer, the decrease in refractive index with applied field is observed with a smaller shift in absorption coefficient.

Negative thermal expansion in Sc2(WO4)3

International Nuclear Information System (INIS)

Evans, J.S.O.; Mary, T.A.; Sleight, A.W.

1998-01-01

Sc 2 (WO 4 ) 3 has been found to show the highly unusual property of negative thermal expansion over a temperature range of 10 to 1,073 K. Powder neutron diffraction data from 10 to 450 K shows an essentially linear decrease in cell volume as a function of temperature. The intrinsic linear coefficient of thermal expansion from this data is -2.2 x 10 -6 K -1 . The linear coefficient of thermal expansion measured on a ceramic bar of Sc 2 (WO 4 ) 3 can be as negative as -11 x 10 -6 K -1 due to microstructure changes as a function of temperature. Rietveld refinement as a function of temperature suggests that the intrinsic negative thermal expansion can be related to transverse vibrations of bridging oxygen atoms in the structure. The anharmonic nature of these vibrations leads to a coupled tilting of the quasi-rigid framework polyhedra. This tilting in turn causes the structure to become more dense with increasing temperature

Subject Categorization Guide for Defense Science and Technology