Directory of Open Access Journals (Sweden)
Bárbara Toncic Neves
2011-12-01
Full Text Available O presente trabalho consiste no levantamento dos táxons da tribo Andropogoneae (Panicoideae - Poaceae ocorrentes na Ilha de Santa Catarina, Florianópolis, Brasil. A partir da revisão de materiais de herbários e coletas a campo foi confirmada a ocorrência de 10 gêneros e 20 espécies, 17 nativas e duas subespontâneas: Andropogon L. (7 spp., Bothriochloa Kuntze (2, Eriochrysis P. Beauv. (1, Hyparrhenia Andersson ex E. Fourn. (1, Imperata Cirillo (1, Ischaemum L. (1, Rhytachne Desv. (1, Saccharum L. (3, Schizachyrium Nees (2 e Sorghum Moench (1. Os gêneros Bothriochloa e Rhytachne são registrados pela primeira vez para a Ilha de Santa Catarina. São apresentadas chaves de identificação para gêneros e espécies, ilustrações, informações sobre distribuição geográfica, habitat, período de floração e comentários para cada táxon.The present work is a survey of the taxa in the tribe Andropogoneae (Panicoideae - Poaceae that occur on the Island of Santa Catarina, Florianópolis, Brazil. Based on a review of herbarium specimens and fieldwork, 20 species were recorded in the following 10 genera: Andropogon L. (7 spp., Bothriochloa Kuntze (2, Eriochrysis P. Beauv. (1, Hyparrhenia Andersson ex E. Fourn. (1, Imperata Cirillo (1, Ischaemum L. (1, Rhytachne Desv. (1, Saccharum L. (3, Schizachyrium Nees (2 and Sorghum Moench (1. Seventeen of the species are native, and two species are subspontaneous. Bothriochloa and Rhytachne are recorded here, for the first time, for the Island of Santa Catarina. This work provides key to the genera and species, as well as illustrations, information about geographic distribution, habitat, phenology, and comments about each taxon presented in the study.
IDENTIFIKASI TUMBUHAN SUKU POACEAE SEBAGAI SUPLEMEN MATAKULIAH KEANEKARAGAMAN TUMBUHAN
Directory of Open Access Journals (Sweden)
Desy Yanuarita Wulandari
2017-01-01
Full Text Available Poaceae known as plants used as food ingredients in Indonesian. One area thas has high level diversity of plants Poaceae is Tahura R. Soerjo. Morphological characterization Poaceae in that region are still rare. The Goal for this research are to identify Poaceae tribes, and make photography Poaceae data that can be used as a supplement on Diversity of Plants course. This study included descriptive exploratory study with free cruising method. The species Poaceae has identified are Bambusa multiplex, Dendrocalamus asper, Digitaria radicosa, Echinochloa sp, Eragrostis unioloides, Lophatherum gracile, Oplismenus burmanni, Paspalidium flavidum, Pennisetum alopecuroides, Phragmites karka, Setaria parviflor. Suku Poaceae dikenal sebagai tumbuhan yang dimanfaatkan sebagai bahan pangan masyarakat Indonesia. Salah satu daerah yang memiliki tingkat keanekaragaman tumbuhan Poaceae adalah di Tahura R. Soerjo. Karakterisasi morfologi terkait suku Poaceae di daerah tersebut masih sedikit. Tujuan dalam penelitian ini adalah untuk identifikasi suku Poaceae, membuat data fotografi suku Poaceae sehingga dapat digunakan sebagai suplemen keanekaragaman tumbuhan. Penelitian ini termasuk penelitian deskriptif eksploratif dengan metode jelajah bebas. Sebelas spesies suku Poaceae yang telah teridentifikasi, yaitu Bambusa multiplex, Dendrocalamus asper, Digitaria radicosa, Echinochloa sp, Eragrostis unioloides, Lophatherum gracile, Oplismenus burmanni, Paspalidium flavidum, Pennisetum alopecuroides, Phragmites karka, Setaria parviflora.
Forma de crecimiento en Leptochloa Chloridiformis (Poaceae
Directory of Open Access Journals (Sweden)
Mariel G. Perreta
2000-01-01
Full Text Available Perreta, M. G., Tivano, J. C. & Vegetti, A. C. 2000. Forma de crecimiento en Leptochloachloridiformis (Poaceae. Darwiniana 38(3-4: 219-226.El objetivo de este trabajo fue analizar la forma de crecimiento de Leptochloa chloridiformis (Hack.Parodi. En esta especie perenne la ramificación ocurre principalmente a través de yemas axilarespresentes en la zona de innovación. Este sistema de ramificación genera una planta cespitosa, en la cual lasconexiones entre unidades estructurales son rizomas cortos. Dependiendo de su posición estas conexio-nes muestran diferentes tendencias en relación a la desarticulación estructural. En algunas plantas seobservó ramificación en la zona de entrenudos largos posiblemente debido a cambios ambientalesrelacionados con las distintas estaciones
Nature of ergastic substances in some Poaceae seeds | Idu | African ...
African Journals Online (AJOL)
Seeds of 48 species of Poaceae were examined for the presence of alkaloid, protein, fats and oil, inulin, starch and tannins. All taxa investigated indicated the presence of starch, fats and oils and protein and were devoid of tannins and inulin. Only 12 seed samples indicated the presence of alkaloids. The Positively ...
Nature of ergastic substances in some Poaceae seeds
African Journals Online (AJOL)
ajl yemi
2011-08-29
Aug 29, 2011 ... 2Department of Botany, Ambrose Alli University, PMB. 14, Ekpoma, Edo State, Nigeria. Accepted 6 May, 2011. Seeds of 48 species of Poaceae were examined for the presence of alkaloid, protein, fats and oil, inulin, starch and tannins. All taxa investigated indicated the presence of starch, fats and oils and ...
Dwergkroos (Lemna minuscula Herter) nieuw voor Nederland
Schaminée, Joop H.J.; Hermans, Jan T.
1989-01-01
Lemna minuscula was found for the first time in the Netherlands in the Meggelveld area, a complex of claypits in Central Limburg. This American species, in Europe first recorded in southern France in 1966, is expanding its area to the north and east. The habitat and growth form in the Meggelveld
Poaceae pollen as the leading aeroallergen worldwide: A review.
García-Mozo, H
2017-12-01
The Poaceae family comprises over 12 000 wind-pollinated species, which release large amounts of pollen into the atmosphere. Poaceae pollen is currently regarded as the leading airborne biological pollutant and the chief cause of pollen allergy worldwide. Sensitization rates vary by country, and those variations are reviewed here. Grass pollen allergens are grouped according to their protein structure and function. In Poaceae, although species belonging to different subfamilies are characterized by distinct allergen subsets, there is a considerable degree of cross-reactivity between many species. Cross-reactivity between grass pollen protein and fresh fruit pan-allergens is associated with the appearance of food allergies. The additional influence of urban pollution may prompt a more severe immunological response. The timing and the intensity of the pollen season are governed by species genetics, but plant phenology is also influenced by climate; as a result, climate changes may affect airborne pollen concentrations. This article reviews the findings of worldwide research which has highlighted the major impact of climate change on plant phenology and also on the prevalence and severity of allergic disease. © 2017 EAACI and John Wiley and Sons A/S. Published by John Wiley and Sons Ltd.
O gênero Chloris (Poaceae) em Pernambuco, Brasil
Maciel, Jefferson Rodrigues; Silva, Wegliane Campelo da; Costa-e-Silva, Maria Bernadete
2013-01-01
Com o objetivo de colaborar com o conhecimento da riqueza de Poaceae em Pernambuco, foi estudado o gênero Chloris Sw. As coletas foram realizadas no estado, bem como dados foram coligidos de levantamento em herbários da região. Foram registradas sete espécies de Chloris em Pernambuco: C. barbata Sw., C. elata Desv., C. exilis Renv., C. gayana Kunth, C. orthonoton Döll, C. pycnothrix Trin. e C. virgata Sw. O gênero apresenta distribuição ampla em todas as zonas fitogeográficas do estado. Chlor...
Chemotaxonomy as a tool for interpreting the cryptic diversity of Poaceae pollen
Julier, A.C.M.; Jardine, P.E.; Coe, A.L.; Gosling, W.D.; Lomax, B.H.; Fraser, W.T.
2016-01-01
The uniform morphology of different species of Poaceae (grass) pollen means that identification to below family level using light microscopy is extremely challenging. Poor taxonomic resolution reduces recoverable information from the grass pollen record, for example, species diversity and
Révision du genre Digitaria Haller (Poaceae) au Sénégal ...
African Journals Online (AJOL)
Le genre Digitaria Haller (Poaceae) constitue l'un des genres les plus diversifiés des Poaceae du Sénégal avec 19 espèces. Bien qu'il y ait une monographie mondiale du genre, la détermination des espèces reste difficile et repose essentiellement sur les caractères de l'appareil reproducteur. Ce travail, qui est une ...
CATÁLOGO DE LA FAMILIA POACEAE EN COLOMBIA
Directory of Open Access Journals (Sweden)
Diego Giraldo-Cañas
2011-01-01
Full Text Available Se presenta un inventario de las especies de Poaceae de Colombia junto con un análisis de la diversidad específica de esta familia según las regiones naturales colombianas, los gradientes de altitud y de precipitaciones, y la distribución sistemática. Se realizaron 96 expediciones de campo a las diez grandes regiones naturales de Colombia (Amazonia, Andes, Caribe, Chocó Biogeográfico, Guayana, islas caribeñas, Orinoquia, Sierra Nevada de Santa Marta, valle del río Cauca y valle del río Magdalena con un muestreo total de alrededor de 5800 ejemplares. Además, se consultaron colecciones de los herbarios CAUP, COAH, COL, CUVC, CHOCO, HFAB, HUA, HUQ, JAUM, MEDEL, MEXU, MO, NY, PSO, RSA, SI, UDBC, UIS, US, VALLE y VEN, y se realizó una investigación bibliográfica exhaustiva. Las Poaceae están representadas en Colombia por 840 especies y 173 géneros. Se reconocieron 74 especies y un género (Agrostopoa endémicos. Por otra parte, se documentaron 83 especies introducidas-naturalizadas y 50 introducidas-cultivadas. Los géneros más ricos en especies son Paspalum (89 especies, Panicum (42, Festuca (36, Eragrostis (29, Calamagrostis (25, Chusquea (25, Digitaria (24, Axonopus (21, Setaria (20, Cenchrus (18, Poa (17, Muhlenbergia (16, Andropogon (15, Aristida (15, Agrostis (14, Lasiacis (12, Urochloa (12, Pariana (11, Sporobolus (11, Arthrostylidium (10, Cortaderia (10, Nassella (10, Neurolepis (10 y Schizachyrium (10. Durante el desarrollo de esta investigación, se descubrieron 10 nuevos registros para la flora colombiana. La regiones Andina, Orinocense, Caribe y Guayanesa son las más ricas en especies, con 583, 233, 186 y 179 especies, respectivamente. La Región Andina presenta el mayor número de especies endémicas (57 especies. Los gradientes altitudinales más diversos corresponden a los de las tierras bajas (por debajo de 1200 m s.m.. Al igual que en otras áreas tropicales, en Colombia las subfamilias de Poaceae muestran una
Genome-wide distribution comparative and composition analysis of the SSRs in Poaceae.
Wang, Yi; Yang, Chao; Jin, Qiaojun; Zhou, Dongjie; Wang, Shuangshuang; Yu, Yuanjie; Yang, Long
2015-02-15
The Poaceae family is of great importance to human beings since it comprises the cereal grasses which are the main sources for human food and animal feed. With the rapid growth of genomic data from Poaceae members, comparative genomics becomes a convinent method to study genetics of diffierent species. The SSRs (Simple Sequence Repeats) are widely used markers in the studies of Poaceae for their high abundance and stability. In this study, using the genomic sequences of 9 Poaceae species, we detected 11,993,943 SSR loci and developed 6,799,910 SSR primer pairs. The results show that SSRs are distributed on all the genomic elements in grass. Hexamer is the most frequent motif and AT/TA is the most frequent motif in dimer. The abundance of the SSRs has a positive linear relationship with the recombination rate. SSR sequences in the coding regions involve a higher GC content in the Poaceae than that in the other species. SSRs of 70-80 bp in length showed the highest AT/GC base ratio among all of these loci. The result shows the highest polymorphism rate belongs to the SSRs ranged from 30 bp to 40 bp. Using all the SSR primers of Japonica, nineteen universal primers were selected and located on the genome of the grass family. The information of SSR loci, the SSR primers and the tools of mining and analyzing SSR are provided in the PSSRD (Poaceae SSR Database, http://biodb.sdau.edu.cn/pssrd/). Our study and the PSSRD database provide a foundation for the comparative study in the Poaceae and it will accelerate the study on markers application, gene mapping and molecular breeding.
Building supertrees: an empirical assessment using the grass family (Poaceae).
Salamin, Nicolas; Hodkinson, Trevor R; Savolainen, Vincent
2002-02-01
Large and comprehensive phylogenetic trees are desirable for studying macroevolutionary processes and for classification purposes. Such trees can be obtained in two different ways. Either the widest possible range of taxa can be sampled and used in a phylogenetic analysis to produce a "big tree," or preexisting topologies can be used to create a supertree. Although large multigene analyses are often favored, combinable data are not always available, and supertrees offer a suitable solution. The most commonly used method of supertree reconstruction, matrix representation with parsimony (MRP), is presented here. We used a combined data set for the Poaceae to (1) assess the differences between an approach that uses combined data and one that uses different MRP modifications based on the character partitions and (2) investigate the advantages and disadvantages of these modifications. Baum and Ragan and Purvis modifications gave similar results. Incorporating bootstrap support associated with pre-existing topologies improved Baum and Ragan modification and its similarity with a combined analysis. Finally, we used the supertree reconstruction approach on 55 published phylogenies to build one of most comprehensive phylogenetic trees published for the grass family including 403 taxa and discuss its strengths and weaknesses in relation to other published hypotheses.
Anther and pollen development in some species of Poaceae (Poales
Directory of Open Access Journals (Sweden)
AT. Nakamura
Full Text Available Anther and pollen development were studied in Olyra humilis Nees, Sucrea monophylla Soderstr, (Bambusoideae, Axonopus aureus P. Beauv., Paspalum polyphyllum Nees ex Trin. (Panicoideae, Eragrostis solida Nees, and Chloris elata Desv. (Chloridoideae. The objective of this study was to characterise, embryologically, these species of subfamilies which are considered basal, intermediate and derivate, respectively. The species are similar to each other and to other Poaceae. They present the following characters: tetrasporangiate anthers; monocotyledonous-type anther wall development, endothecium showing annular thickenings, secretory tapetum; successive microsporogenesis; isobilateral tetrads; spheroidal, tricellular, monoporate pollen grains with annulus and operculum. Nevertheless, the exine patterns of the species studied are distinct. Olyra humilis and Sucrea monophylla (Bambusoideae show a granulose pattern, whereas in the other species, it is insular. In addition, Axonopus aureus and Paspalum polyphyllum (Panicoideae have a compactly insular spinule pattern, while Chloris elata and Eragrostis solida (Chloridoideae show a sparsely insular spinule pattern. The exine ornamentation may be considered an important feature at the infrafamiliar level.
Late Cretaceous origin of the rice tribe provides evidence for early diversification in Poaceae.
Prasad, V; Strömberg, C A E; Leaché, A D; Samant, B; Patnaik, R; Tang, L; Mohabey, D M; Ge, S; Sahni, A
2011-09-20
Rice and its relatives are a focal point in agricultural and evolutionary science, but a paucity of fossils has obscured their deep-time history. Previously described cuticles with silica bodies (phytoliths) from the Late Cretaceous period (67-65 Ma) of India indicate that, by the latest Cretaceous, the grass family (Poaceae) consisted of members of the modern subclades PACMAD (Panicoideae-Aristidoideae-Chloridoideae-Micrairoideae-Arundinoideae-Danthonioideae) and BEP (Bambusoideae-Ehrhartoideae-Pooideae), including a taxon with proposed affinities to Ehrhartoideae. Here we describe additional fossils and show that, based on phylogenetic analyses that combine molecular genetic data and epidermal and phytolith features across Poaceae, these can be assigned to the rice tribe, Oryzeae, of grass subfamily Ehrhartoideae. The new Oryzeae fossils suggest substantial diversification within Ehrhartoideae by the Late Cretaceous, pushing back the time of origin of Poaceae as a whole. These results, therefore, necessitate a re-evaluation of current models for grass evolution and palaeobiogeography.
Novedades nomenclaturales en Cenchrus s.l. (Poaceae: Panicoideae: Paniceae
Directory of Open Access Journals (Sweden)
Hugo F Gutiérrez
2012-06-01
Full Text Available Recientes estudios filogenéticos con datos morfológicos y moleculares aportaron evidencia sobre la monofilia de los géneros Cenchrus, Pennisetum y Odontelytrum y, por ello, se propuso su unificación y transferencia a Cenchrus, el cual tiene prioridad. Resultados preliminares de la revisión taxonómica del género Cenchrus s.l. para América (Gutiérrez, en preparación permitieron detectar problemas nomenclaturales. Para resolver dichos inconvenientes, en el presente trabajo se presentan nueve lectotipificaciones: Cenchrus bambusoides Caro & E.A. Sánchez, C. brevisetus E. Fourn., C. pennisetiformis Hochst. & Steud. var. intermedia Chiov., C. roseus E. Fourn., Gymnotrix mexicana E. Fourn., Hymenachne montana Griseb., Pennisetum amoenum Hochst. ex A. Rich., P. cenchroides Rich. var. hamphilahense Terracc., P. ciliare (L. Link var. anachoreticum Chiov., P. petraeum Steud., P. pringlei Leeke, P. tristachyum (Kunth Spreng. subsp. boliviense Chase, y se propone un nombre nuevo para Gymnotrix crinita Kunth.Nomenclatural novelties in Cenchrus s.l. (Poaceae: Panicoideae: Paniceae. Recent phylogenetic studies with morphological and molecular data provided evidence on the monophyly of the genera Cenchrus, Pennisetum and Odontelytrum. Therefore, these studies propose the unification and transfer of species of Pennisetum and Odontelytrum to the genus Cenchrus, which has priority. Nomenclatural problems were detected when conducting a preliminary taxonomic revision of the genus Cenchrus s.l. from America (Gutiérrez, in preparation. To resolve these inconveniences, nine lectotypifications: Cenchrus bambusoides Caro & E.A. Sánchez, C. brevisetus E. Fourn., C. pennisetiformis Hochst. & Steud. var. intermedia Chiov., C. roseus E. Fourn., Gymnotrix mexicana E. Fourn., Hymenachne montana Griseb., Pennisetum amoenum Hochst. ex A. Rich., P. cenchroides Rich. var. hamphilahense Terracc., P. ciliare (L. Link var. anachoreticum Chiov., P. petraeum Steud., P
Cogongrass, Imperata cylindrica (L.) Palisot de Beauvois (Cyperales: Poaceae), is a noxious invasive weed in the southeastern USA. Surveys for potential biological control agents of cogongrass were conducted in Asia and East Africa from 2013 to 2016. Several insect herbivores were found that may hav...
Directory of Open Access Journals (Sweden)
Adriana Tiemi Nakamura
2009-03-01
Full Text Available O presente estudo objetivou verificar a existência de um padrão do desenvolvimento pós-seminal em Poaceae. Para tanto, foram estudadas as seguintes espécies: Olyra humilis Nees (Bambusoideae; Axonopus aureus P. Beauv. e Paspalum polyphyllum Nees ex Trin. (Panicoideae; Chloris elata Nees e Eragrostis solida Desv. (Chloridoideae. Procurou-se também comparar as estruturas da plântula de Poaceae com as demais monocotiledôneas. As espécies estudadas são plantas perenes, rizomatosas, cespitosas e apresentam cariopses de tamanhos diferentes. Apresentam sementes albuminosas; embrião lateral, diferenciado, com raiz endógena (adventícia; cotilédone dividido em hiperfilo (escutelo, bainha reduzida e hipofilo (coleóptilo; coleorriza (raiz primária reduzida e mesocótilo (eixo localizado entre o escutelo e coleóptilo. A presença de epiblasto (folha embrionária foi observada em Olyra humilis, Chloris elata e Eragrostis solida. O desenvolvimento pós-seminal é semelhante nas espécies estudadas e forma um padrão em Poaceae. Primeiramente, observa-se a emissão da coleorriza, que cresce no sentido geotrópico positivo, seguida do coleóptilo e plúmula que crescem em sentido contrário, a partir do desenvolvimento do mesocótilo. As primeiras folhas são semelhantes às folhas definitivas (metafilos das espécies, exceto em Olyra humilis, que são modificadas em catafilos e podem ser interpretadas como caráter basal em Bambusoideae. Raiz primária reduzida (coleorriza e hipofilo modificado em coleóptilo são considerados caracteres derivados em Poaceae, quando comparados com as demais monocotiledôneas.This work has aimed to verify the existence of a pattern of the post-seminal development in Poaceae. Thus, Olyra humilis Nees (Bambusoideae; Axonopus aureus P. Beauv. e Paspalum polyphyllum Nees ex Trin. (Panicoideae; Chloris elata Nees e Eragrostis solida Desv. (Chloridoideae have been studied. Besides, it was compared the structures of
Wesseling, Anne-Maria; Demetrowitsch, Tobias J.; Schwarz, Karin; Ober, Dietrich
2017-01-01
Pyrrolizidine alkaloids (PAs) are a class of secondary metabolites found in various unrelated angiosperm lineages including cool-season grasses (Poaceae, subfamily Pooideae). Thesinine conjugates, saturated forms of PA that are regarded as non-toxic, have been described to occur in the two grass species Lolium perenne and Festuca arundinacea (Poaceae, subfamily Pooideae). In a wider screen, we tested various species of the Pooideae lineage, grown under controlled conditions, for their ability to produce thesinine conjugates or related structures. Using an LC-MS based targeted metabolomics approach we were able to show that PA biosynthesis in grasses is limited to a group of very closely related Pooideae species that produce a limited diversity of PA structures. High variability in PA levels was observed even between individuals of the same species. These individual accumulation patterns are discussed with respect to a possible function and evolution of this type of alkaloid. PMID:29250094
Variability of Pyrrolizidine Alkaloid Occurrence in Species of the Grass Subfamily Pooideae (Poaceae
Directory of Open Access Journals (Sweden)
Anne-Maria Wesseling
2017-11-01
Full Text Available Pyrrolizidine alkaloids (PAs are a class of secondary metabolites found in various unrelated angiosperm lineages including cool-season grasses (Poaceae, subfamily Pooideae. Thesinine conjugates, saturated forms of PA that are regarded as non-toxic, have been described to occur in the two grass species Lolium perenne and Festuca arundinacea (Poaceae, subfamily Pooideae. In a wider screen, we tested various species of the Pooideae lineage, grown under controlled conditions, for their ability to produce thesinine conjugates or related structures. Using an LC-MS based targeted metabolomics approach we were able to show that PA biosynthesis in grasses is limited to a group of very closely related Pooideae species that produce a limited diversity of PA structures. High variability in PA levels was observed even between individuals of the same species. These individual accumulation patterns are discussed with respect to a possible function and evolution of this type of alkaloid.
Burke, Sean V.; Wysocki, William P.; Clark, Lynn G.
2018-01-01
The systematics of grasses has advanced through applications of plastome phylogenomics, although studies have been largely limited to subfamilies or other subgroups of Poaceae. Here we present a plastome phylogenomic analysis of 250 complete plastomes (179 genera) sampled from 44 of the 52 tribes of Poaceae. Plastome sequences were determined from high throughput sequencing libraries and the assemblies represent over 28.7 Mbases of sequence data. Phylogenetic signal was characterized in 14 partitions, including (1) complete plastomes; (2) protein coding regions; (3) noncoding regions; and (4) three loci commonly used in single and multi-gene studies of grasses. Each of the four main partitions was further refined, alternatively including or excluding positively selected codons and also the gaps introduced by the alignment. All 76 protein coding plastome loci were found to be predominantly under purifying selection, but specific codons were found to be under positive selection in 65 loci. The loci that have been widely used in multi-gene phylogenetic studies had among the highest proportions of positively selected codons, suggesting caution in the interpretation of these earlier results. Plastome phylogenomic analyses confirmed the backbone topology for Poaceae with maximum bootstrap support (BP). Among the 14 analyses, 82 clades out of 309 resolved were maximally supported in all trees. Analyses of newly sequenced plastomes were in agreement with current classifications. Five of seven partitions in which alignment gaps were removed retrieved Panicoideae as sister to the remaining PACMAD subfamilies. Alternative topologies were recovered in trees from partitions that included alignment gaps. This suggests that ambiguities in aligning these uncertain regions might introduce a false signal. Resolution of these and other critical branch points in the phylogeny of Poaceae will help to better understand the selective forces that drove the radiation of the BOP and PACMAD
HABER, Ricardus M.; SEMAAN, Myrna T.
2007-01-01
Chamaesyce nutans (Lag.) Small (Euphorbiaceae) and Eleusine indica (L.) Gaertner (Poaceae) are described as new records for the flora of Lebanon. Specimens of C. nutans collected from roadsides and rocks in a middle mountain forest confirm the occurrence of the species on the western slopes of the Mount Lebanon Range. Additionally, specimens of E. indica were collected from wasteland and roadsides in the coastal town of Kaslik. The species were observed to thrive abundantly in similar habitat...
Novedades nomenclaturales en la tribu Stipeae (Poaceae, Pooideae) para la Flora Argentina
Ana María Cialdella
2010-01-01
Durante la revisión de los géneros de Stipeae (Poaceae) para la flora argentina y de acuerdo a los últimos estudios filogenéticos en la tribu, se confirmó la necesidad de transferir algunos taxones recientemente descriptos de Stipa a Nassella, Jarava o Pappostipa. En este trabajo se presentan 12 nuevas combinaciones: Jarava ichu var. pungens, Nassella brachyglumis, N. macrotricha, Pappostipa arenicola, P. choconensis, P. colloncurensis, P. frigida var. longifolia, P. jucunda, P. kieslingii, P...
Hussain, Fatma; Ahmed, Nisar; Ghorbani, Abdolbaset
2018-01-01
In pursuit of developing fast and accurate species-level molecular identification methods, we tested six DNA barcodes, namely ITS2, matK, rbcLa, ITS2+matK, ITS2+rbcLa, matK+rbcLa and ITS2+matK+rbcLa, for their capacity to identify frequently consumed but geographically isolated medicinal species of Fabaceae and Poaceae indigenous to the desert of Cholistan. Data were analysed by BLASTn sequence similarity, pairwise sequence divergence in TAXONDNA, and phylogenetic (neighbour-joining and maximum-likelihood trees) methods. Comparison of six barcode regions showed that ITS2 has the highest number of variable sites (209/360) for tested Fabaceae and (106/365) Poaceae species, the highest species-level identification (40%) in BLASTn procedure, distinct DNA barcoding gap, 100% correct species identification in BM and BCM functions of TAXONDNA, and clear cladding pattern with high nodal support in phylogenetic trees in both families. ITS2+matK+rbcLa followed ITS2 in its species-level identification capacity. The study was concluded with advocating the DNA barcoding as an effective tool for species identification and ITS2 as the best barcode region in identifying medicinal species of Fabaceae and Poaceae. Current research has practical implementation potential in the fields of pharmaco-vigilance, trade of medicinal plants and biodiversity conservation. PMID:29576968
Directory of Open Access Journals (Sweden)
Stancik Daniel
2001-07-01
Full Text Available The genus Festuca L. (Poaceae includes about 350-400 herbaceous species with wide cosmopolitan distribution (Watson & Dallwitz 1992. The center of distribution ofthe genus is in the meadows and steppes of North America and Eurasia. Sorne species are present in Australia, Tasmania, New Zealand, and W and SE Africa. High species diversity is found in the pampas of Argentina and the puna of the Andes, with approximately 40 species in Peru (Tovar 1993,30 in Bolivia (Renvoize 1998, and 30 in Argentina (Türpe 1969. So far, 26 native species are known from the páramos of the northern South America; about seven new species from this region will be described soon (author's unpublished data.The genus Festuca L. (Poaceae includes about 350-400 herbaceous species with wide cosmopolitan distribution (Watson & Dallwitz 1992. The center of distribution ofthe genus is in the meadows and steppes of North America and Eurasia. Sorne species are present in Australia, Tasmania, New Zealand, and W and SE Africa. High species diversity is found in the pampas of Argentina and the puna of the Andes, with approximately 40 species in Peru (Tovar 1993,30 in Bolivia (Renvoize 1998, and 30 in Argentina (Türpe 1969. So far, 26 native species are known from the páramos of the northern South America; about seven new species from this region will be described soon (author's unpublished data.
Directory of Open Access Journals (Sweden)
Doria Maria Saiter Gomes
2009-06-01
Full Text Available This study presents data on leaf micromorphology of 13 species of Merostachys Spreng. (Poaceae: Bambusoideae, a neotropical genus with numerous endemic species. Greatest species richness is found in Central and Southern Brazil, with 41 of the 46 species described. Species were collected in the field at the localities: Itatiaia National Park and Tijuca National Park, Rio de Janeiro State; Fontes do Ipiranga State Park, São Paulo state; Santa Teresa, Espírito Santo State and Rio Doce State Park, Minas Gerais State. Dried plant material came from the herbarium at the São Paulo Botany Institute. The presence of prickles, silica bodies and macro hairs may be especially useful in delimiting species.São apresentados dados relativos à micromorfologia foliar de 13 espécies de Merostachys Spreng. (Poaceae:Bambusoideae, um gênero neotropical, com numerosas espécies endêmicas, que tem sua maior diversidade nas regiões central e sul do Brasil, onde ocorrem 41 das 46 espécies descritas. O material coletado foi obtido nas seguintes localidades: Parque Nacional do Itatiaia e Parque Nacional da Tijuca (RJ; Parque Estadual das Fontes do Ipiranga (SP; Propriedade dos Irmãos Martinelli, Vargem Alta, Santa Teresa (ES e Parque Estadual do Rio Doce (MG. As espécies herborizadas são provenientes do herbário do Instituto de Botânica de São Paulo (SP. Atenção especial é dada à presença de cerdas, corpúsculos silicosos e macropêlos, características que podem ser úteis na delimitação das espécies.
Poaceae vs. Abiotic Stress: Focus on Drought and Salt Stress, Recent Insights and Perspectives
Directory of Open Access Journals (Sweden)
Simone Landi
2017-07-01
Full Text Available Poaceae represent the most important group of crops susceptible to abiotic stress. This large family of monocotyledonous plants, commonly known as grasses, counts several important cultivated species, namely wheat (Triticum aestivum, rice (Oryza sativa, maize (Zea mays, and barley (Hordeum vulgare. These crops, notably, show different behaviors under abiotic stress conditions: wheat and rice are considered sensitive, showing serious yield reduction upon water scarcity and soil salinity, while barley presents a natural drought and salt tolerance. During the green revolution (1940–1960, cereal breeding was very successful in developing high-yield crops varieties; however, these cultivars were maximized for highest yield under optimal conditions, and did not present suitable traits for tolerance under unfavorable conditions. The improvement of crop abiotic stress tolerance requires a deep knowledge of the phenomena underlying tolerance, to devise novel approaches and decipher the key components of agricultural production systems. Approaches to improve food production combining both enhanced water use efficiency (WUE and acceptable yields are critical to create a sustainable agriculture in the future. This paper analyzes the latest results on abiotic stress tolerance in Poaceae. In particular, the focus will be directed toward various aspects of water deprivation and salinity response efficiency in Poaceae. Aspects related to cell wall metabolism will be covered, given the importance of the plant cell wall in sensing environmental constraints and in mediating a response; the role of silicon (Si, an important element for monocots' normal growth and development, will also be discussed, since it activates a broad-spectrum response to different exogenous stresses. Perspectives valorizing studies on landraces conclude the survey, as they help identify key traits for breeding purposes.
Novy, Ari; Flory, S Luke; Honig, Joshua A; Bonos, Stacy; Hartman, Jean Marie
2012-02-01
Microsatellite markers were developed for the invasive plant Microstegium vimineum (Poaceae) to assess its population structure and to facilitate tracking of invasion expansion. Using 454 sequencing, 11 polymorphic and six monomorphic microsatellite primer sets were developed for M. vimineum. The primer sets were tested on individuals sampled from six populations in the United States and China. The polymorphic primers amplified di-, tri-, and tetranucleotide repeats with three to 10 alleles per locus. These markers will be useful for a variety of applications including tracking of invasion dynamics and population genetics studies.
Cross-species amplification of 105 Lolium perenne SSR loci in 23 species within the Poaceae
DEFF Research Database (Denmark)
Jensen, Louise Bach; Holm, Preben Bach; Lübberstedt, Thomas
2007-01-01
Amplification of 105 Lolium perenne SSR markers was studied in 23 grass species representing seven tribes from three subfamilies of Poaceae. Twelve of the SSR markers are published for the first time. Between 2% and 96% of the SSR markers could be amplified within a given species. A subset of eight...... SSR markers was evaluated for polymorphism across nine of the 23 grass species. Four to seven of the markers were polymorphic within each species, with an average detection of 2.4 alleles per species....
Novedades nomenclaturales en la tribu Stipeae (Poaceae, Pooideae para la Flora Argentina
Directory of Open Access Journals (Sweden)
Ana María Cialdella
2010-01-01
Full Text Available Durante la revisión de los géneros de Stipeae (Poaceae para la flora argentina y de acuerdo a los últimos estudios filogenéticos en la tribu, se confirmó la necesidad de transferir algunos taxones recientemente descriptos de Stipa a Nassella, Jarava o Pappostipa. En este trabajo se presentan 12 nuevas combinaciones: Jarava ichu var. pungens, Nassella brachyglumis, N. macrotricha, Pappostipa arenicola, P. choconensis, P. colloncurensis, P. frigida var. longifolia, P. jucunda, P. kieslingii, P. mapuche, P. marqueziana y P. zulmae. Se incluye también una clave para identificar los géneros de Stipeae en la Argentina.
Phalaris canariensis L. (Poaceae: A new alien plant record for Kashmir Himalaya, India
Directory of Open Access Journals (Sweden)
Shugufta Rasheed
2016-03-01
Full Text Available The correct taxonomic identification assumes first and foremost priority in the scientific documentation of biodiversity. The Kashmir Himalaya, located in the north-western side of the Himalayan biodiversity hotspot, is well-known for its diverse flora which merits immediate scientific documentation. In this context, the present study reports Phalaris canariensis L. (Poaceae as a new alien plant record to the flora of Kashmir Himalaya, India. In this paper, a detailed description, photographs, and comparison of diagnostic characters with allied species are provided to scientifically validate this alien plant record for this Himalayan region.
Hidalgo, Nicolás Pérez; Martínez-Torres, David; Collantes-Alegre, Jorge Mariano; Muller, William Villalobos; Nafría, Juan M. Nieto
2012-01-01
Abstract The new species Rhopalosiphum chusqueae Pérez Hidalgo & Villalobos Muller, is described from apterous viviparous females caught on Chusquea tomentosa in Cerro de la Muerte (Costa Rica). The identity of the species is supported both by the morphological features and by a molecular phylogenetic analysis based on a fragment of the mitochondrial DNA containing the 5’ region of the cytochrome c oxidase 1 (COI) and on the nuclear gene coding for the Elongation factor-1 alpha (EF1α). The taxonomic position of the new species is discussed. An identification key to the Aphidinae species living on plants of Bambusoideae (Poaceae) is presented. PMID:22328859
Preston, Jill C.; Kellogg, Elizabeth A.
2006-01-01
Gene duplication is an important mechanism for the generation of evolutionary novelty. Paralogous genes that are not silenced may evolve new functions (neofunctionalization) that will alter the developmental outcome of preexisting genetic pathways, partition ancestral functions (subfunctionalization) into divergent developmental modules, or function redundantly. Functional divergence can occur by changes in the spatio-temporal patterns of gene expression and/or by changes in the activities of their protein products. We reconstructed the evolutionary history of two paralogous monocot MADS-box transcription factors, FUL1 and FUL2, and determined the evolution of sequence and gene expression in grass AP1/FUL-like genes. Monocot AP1/FUL-like genes duplicated at the base of Poaceae and codon substitutions occurred under relaxed selection mostly along the branch leading to FUL2. Following the duplication, FUL1 was apparently lost from early diverging taxa, a pattern consistent with major changes in grass floral morphology. Overlapping gene expression patterns in leaves and spikelets indicate that FUL1 and FUL2 probably share some redundant functions, but that FUL2 may have become temporally restricted under partial subfunctionalization to particular stages of floret development. These data have allowed us to reconstruct the history of AP1/FUL-like genes in Poaceae and to hypothesize a role for this gene duplication in the evolution of the grass spikelet. PMID:16816429
Complete plastid genome sequence of goosegrass (Eleusine indica) and comparison with other Poaceae.
Zhang, Hui; Hall, Nathan; McElroy, J Scott; Lowe, Elijah K; Goertzen, Leslie R
2017-02-05
Eleusine indica, also known as goosegrass, is a serious weed in at least 42 countries. In this paper we report the complete plastid genome sequence of goosegrass obtained by de novo assembly of paired-end and mate-paired reads generated by Illumina sequencing of total genomic DNA. The goosegrass plastome is a circular molecule of 135,151bp in length, consisting of two single-copy regions separated by a pair of inverted repeats (IRs) of 20,919 bases. The large (LSC) and the small (SSC) single-copy regions span 80,667 bases and 12,646 bases, respectively. The plastome of goosegrass has 38.19% GC content and includes 108 unique genes, of which 76 are protein-coding, 28 are transfer RNA, and 4 are ribosomal RNA. The goosegrass plastome sequence was compared to eight other species of Poaceae. Although generally conserved with respect to Poaceae, this genomic resource will be useful for evolutionary studies within this weed species and the genus Eleusine. Copyright © 2016. Published by Elsevier B.V.
In silico characterization of boron transporter (BOR1 protein sequences in Poaceae species
Directory of Open Access Journals (Sweden)
Ertuğrul Filiz
2013-01-01
Full Text Available Boron (B is essential for the plant growth and development, and its primary function is connected with formation of the cell wall. Moreover, boron toxicity is a shared problem in semiarid and arid regions. In this study, boron transporter protein (BOR1 sequences from some Poaceae species (Hordeum vulgare subsp. vulgare, Zea mays, Brachypodium distachyon, Oryza sativa subsp. japonica, Oryza sativa subsp. indica, Sorghum bicolor, Triticum aestivum were evaluated by bioinformatics tools. Physicochemical analyses revealed that most of BOR1 proteins were basic character and had generally aliphatic amino acids. Analysis of the domains showed that transmembrane domains were identified constantly and three motifs were detected with 50 amino acids length. Also, the motif SPNPWEPGSYDHWTVAKDMFNVPPAYIFGAFIPATMVAGLYYFDHSVASQ was found most frequently with 25 repeats. The phylogenetic tree showed divergence into two main clusters. B. distachyon species were clustered separately. Finally, this study contributes to the new BOR1 protein characterization in grasses and create scientific base for in silico analysis in future.
La familia Poaceae del distrito de Arahuay (Canta, Lima, Perú
Directory of Open Access Journals (Sweden)
Paúl Gonzáles
2011-08-01
Full Text Available Se reportan para el distrito de Arahuay (Canta, Lima, Perú (zona baja y media un total de 49 especies de la familia Poaceae agrupadas en 28 géneros, 14 tribus y 4 subfamilias. El género Poa es el más diverso con cinco especies, seguido por Eragrostis y Nassella con cuatro especies cada una. Las especies Calamagrostis spiciformis Hack. ex Stuck., Chloris halophila Parodi, Lamprothyrsus peruvianus Hitchc., Festuca glyceriantha Pilg., Lolium multiflorum Lam. y Poa supina Schrad. son nuevos reportes para el departamento de Lima. Se presentan claves dicotómicas para la determinación de los géneros y para las especies en los casos pertinentes. Para cada especie se incluye datos sobre su hábitat, distribución y el material estudiado.
Indian Academy of Sciences (India)
Department of Bioengineering and Biotechnology, Qingdao University of Science and Technology, Qingdao, Shandong ... entire chloroplast DNA sequence of common wheat (T. aes- ... a CTAB method as previously described by Liu et al.
Indian Academy of Sciences (India)
1987; Bernini and Marin-Morales. 2001; Mendes-Bonato et al. 2002, 2006; Utsunomiya et al. 2005). More recently, a new number, x = 6, was determined for several accessions of B. dictyoneura (Risso-Pascotto et al. 2006), a species suggested to belong to the same agamic complex as B. humidicola (Renvoize et al. 1996).
Characterization of novel multi-seeded (msd) mutants of sorghum for increasing grain number
The tribe Andropogoneae of the Poaceae family exhibits highly branched inflorescence known as panicle or tassel. Characteristically, each spikelet in a panicle or tassel comprise of a combination of sessile/fertile and sterile florets. In sorghum, (Sorghum bicolor L. Moench), the existing cultivars ...
Lin, Heng-Sheng; Chiang, Chih-Yun; Chang, Song-Bin; Kuoh, Chang-Sheng
2011-01-01
Foxtail millet is one of the world's oldest cultivated crops. It has been adopted as a model organism for providing a deeper understanding of plant biology. In this study, 45 simple sequence repeats (SSR) markers of Setaria italica were developed. These markers showing polymorphism were screened in 223 samples from 12 foxtail millet populations around Taiwan. The most common dinucleotide and trinucleotide repeat motifs are AC/TG (84.21%) and CAT (46.15%). The average number of alleles (N(a)), the average heterozygosities observed (H(o)) and expected (H(e)) are 3.73, 0.714, 0.587, respectively. In addition, 24 SSR markers had shown transferability to six related Poaceae species. These new markers provide tools for examining genetic relatedness among foxtail millet populations and other related species. It is suitable for germplasm management and protection in Poaceae.
Directory of Open Access Journals (Sweden)
Chih-Yun Chiang
2011-11-01
Full Text Available Foxtail millet is one of the world’s oldest cultivated crops. It has been adopted as a model organism for providing a deeper understanding of plant biology. In this study, 45 simple sequence repeats (SSR markers of Setaria italica were developed. These markers showing polymorphism were screened in 223 samples from 12 foxtail millet populations around Taiwan. The most common dinucleotide and trinucleotide repeat motifs are AC/TG (84.21% and CAT (46.15%. The average number of alleles (Na, the average heterozygosities observed (Ho and expected (He are 3.73, 0.714, 0.587, respectively. In addition, 24 SSR markers had shown transferability to six related Poaceae species. These new markers provide tools for examining genetic relatedness among foxtail millet populations and other related species. It is suitable for germplasm management and protection in Poaceae.
Mameaux, Sabine; Cockram, James; Thiel, Thomas; Steuernagel, Burkhard; Stein, Nils; Taudien, Stefan; Jack, Peter; Werner, Peter; Gray, John C; Greenland, Andy J; Powell, Wayne
2012-01-01
The genomes of cereals such as wheat (Triticum aestivum) and barley (Hordeum vulgare) are large and therefore problematic for the map-based cloning of agronomicaly important traits. However, comparative approaches within the Poaceae permit transfer of molecular knowledge between species, despite their divergence from a common ancestor sixty million years ago. The finding that null variants of the rice gene cytokinin oxidase/dehydrogenase 2 (OsCKX2) result in large yield increases provides an opportunity to explore whether similar gains could be achieved in other Poaceae members. Here, phylogenetic, molecular and comparative analyses of CKX families in the sequenced grass species rice, brachypodium, sorghum, maize and foxtail millet, as well as members identified from the transcriptomes/genomes of wheat and barley, are presented. Phylogenetic analyses define four Poaceae CKX clades. Comparative analyses showed that CKX phylogenetic groupings can largely be explained by a combination of local gene duplication, and the whole-genome duplication event that predates their speciation. Full-length OsCKX2 homologues in barley (HvCKX2.1, HvCKX2.2) and wheat (TaCKX2.3, TaCKX2.4, TaCKX2.5) are characterized, with comparative analysis at the DNA, protein and genetic/physical map levels suggesting that true CKX2 orthologs have been identified. Furthermore, our analysis shows CKX2 genes in barley and wheat have undergone a Triticeae-specific gene-duplication event. Finally, by identifying ten of the eleven CKX genes predicted to be present in barley by comparative analyses, we show that next-generation sequencing approaches can efficiently determine the gene space of large-genome crops. Together, this work provides the foundation for future functional investigation of CKX family members within the Poaceae. © 2011 National Institute of Agricultural Botany (NIAB). Plant Biotechnology Journal © 2011 Society for Experimental Biology, Association of Applied Biologists and Blackwell
Huang, Ya-Yi; Cho, Shu-Ting; Haryono, Mindia; Kuo, Chih-Horng
2017-01-01
Common bermudagrass (Cynodon dactylon (L.) Pers.) belongs to the subfamily Chloridoideae of the Poaceae family, one of the most important plant families ecologically and economically. This grass has a long connection with human culture but its systematics is relatively understudied. In this study, we sequenced and investigated the chloroplast genome of common bermudagrass, which is 134,297 bp in length with two single copy regions (LSC: 79,732 bp; SSC: 12,521 bp) and a pair of inverted repeat (IR) regions (21,022 bp). The annotation contains a total of 128 predicted genes, including 82 protein-coding, 38 tRNA, and 8 rRNA genes. Additionally, our in silico analyses identified 10 sets of repeats longer than 20 bp and predicted the presence of 36 RNA editing sites. Overall, the chloroplast genome of common bermudagrass resembles those from other Poaceae lineages. Compared to most angiosperms, the accD gene and the introns of both clpP and rpoC1 genes are missing. Additionally, the ycf1, ycf2, ycf15, and ycf68 genes are pseudogenized and two genome rearrangements exist. Our phylogenetic analysis based on 47 chloroplast protein-coding genes supported the placement of common bermudagrass within Chloridoideae. Our phylogenetic character mapping based on the parsimony principle further indicated that the loss of the accD gene and clpP introns, the pseudogenization of four ycf genes, and the two rearrangements occurred only once after the most recent common ancestor of the Poaceae diverged from other monocots, which could explain the unusual long branch leading to the Poaceae when phylogeny is inferred based on chloroplast sequences.
Fauteux, François; Strömvik, Martina V
2009-01-01
Background Accurate computational identification of cis-regulatory motifs is difficult, particularly in eukaryotic promoters, which typically contain multiple short and degenerate DNA sequences bound by several interacting factors. Enrichment in combinations of rare motifs in the promoter sequence of functionally or evolutionarily related genes among several species is an indicator of conserved transcriptional regulatory mechanisms. This provides a basis for the computational identification of cis-regulatory motifs. Results We have used a discriminative seeding DNA motif discovery algorithm for an in-depth analysis of 54 seed storage protein (SSP) gene promoters from three plant families, namely Brassicaceae (mustards), Fabaceae (legumes) and Poaceae (grasses) using backgrounds based on complete sets of promoters from a representative species in each family, namely Arabidopsis (Arabidopsis thaliana (L.) Heynh.), soybean (Glycine max (L.) Merr.) and rice (Oryza sativa L.) respectively. We have identified three conserved motifs (two RY-like and one ACGT-like) in Brassicaceae and Fabaceae SSP gene promoters that are similar to experimentally characterized seed-specific cis-regulatory elements. Fabaceae SSP gene promoter sequences are also enriched in a novel, seed-specific E2Fb-like motif. Conserved motifs identified in Poaceae SSP gene promoters include a GCN4-like motif, two prolamin-box-like motifs and an Skn-1-like motif. Evidence of the presence of a variant of the TATA-box is found in the SSP gene promoters from the three plant families. Motifs discovered in SSP gene promoters were used to score whole-genome sets of promoters from Arabidopsis, soybean and rice. The highest-scoring promoters are associated with genes coding for different subunits or precursors of seed storage proteins. Conclusion Seed storage protein gene promoter motifs are conserved in diverse species, and different plant families are characterized by a distinct combination of conserved motifs
Directory of Open Access Journals (Sweden)
Fauteux François
2009-10-01
Full Text Available Abstract Background Accurate computational identification of cis-regulatory motifs is difficult, particularly in eukaryotic promoters, which typically contain multiple short and degenerate DNA sequences bound by several interacting factors. Enrichment in combinations of rare motifs in the promoter sequence of functionally or evolutionarily related genes among several species is an indicator of conserved transcriptional regulatory mechanisms. This provides a basis for the computational identification of cis-regulatory motifs. Results We have used a discriminative seeding DNA motif discovery algorithm for an in-depth analysis of 54 seed storage protein (SSP gene promoters from three plant families, namely Brassicaceae (mustards, Fabaceae (legumes and Poaceae (grasses using backgrounds based on complete sets of promoters from a representative species in each family, namely Arabidopsis (Arabidopsis thaliana (L. Heynh., soybean (Glycine max (L. Merr. and rice (Oryza sativa L. respectively. We have identified three conserved motifs (two RY-like and one ACGT-like in Brassicaceae and Fabaceae SSP gene promoters that are similar to experimentally characterized seed-specific cis-regulatory elements. Fabaceae SSP gene promoter sequences are also enriched in a novel, seed-specific E2Fb-like motif. Conserved motifs identified in Poaceae SSP gene promoters include a GCN4-like motif, two prolamin-box-like motifs and an Skn-1-like motif. Evidence of the presence of a variant of the TATA-box is found in the SSP gene promoters from the three plant families. Motifs discovered in SSP gene promoters were used to score whole-genome sets of promoters from Arabidopsis, soybean and rice. The highest-scoring promoters are associated with genes coding for different subunits or precursors of seed storage proteins. Conclusion Seed storage protein gene promoter motifs are conserved in diverse species, and different plant families are characterized by a distinct combination
Directory of Open Access Journals (Sweden)
Pavlović Ivan
2017-01-01
Full Text Available The plants of genus Cymbopogon are well known for their use in traditional medicine and for their high content of essential oils that are widely used as flavoring agents, fragrances, cosmetics, and pharmaceuticals. Essential oils isolated from the dried stems and inflorescence of cultivated Cymbopogon schoenanthus (L. Spreng. (Poaceae collected from Khartoum state (Sudan in two periods were studied. The results of chemical analysis of C. schoenanthus revealed that this plant is rich in essential oil which is a valuable source of the commercially important monoterpene, piperitone (47.7-71.5%. Other abundant constituents of the oils were intermedeol (6.1-17.3%, δ-2-carene (4.5-10.0% and elemol (2.7-9.0%. The essential oil from the inflorescence was tested for spasmolytic activity using three different experimental models: against spontaneous contractions, contractions induced with acetylcholine and contractions induced with potassium chloride. The oil exhibited strong, significant and dose-dependent spasmolytic activity, indicating the possibility for further investigations of this essential oil for its medicinal purposes or application in food industry. [Project of the Serbian Ministry of Education, Science and Technological Development, Grant no.173021 and Grant no. III41018
Wang, Qiuxia; Liu, Huitao; Gao, Ainong; Yang, Xinming; Liu, Weihua; Li, Xiuquan; Li, Lihui
2012-01-01
Polyploidization is a major evolutionary process. Approximately 70-75% species of Triticeae (Poaceae) are polyploids, involving 23 genomes. To investigate intergenomic rearrangements after polyploidization of Triticeae species and to determine the effects of environmental factors on them, nine populations of a typical polyploid Triticeae species, Kengyilia thoroldiana (Keng) J.L.Yang et al. (2n = 6x = 42, StStPPYY), collected from different environments, were studied using genome in situ hybridization (GISH). We found that intergenomic rearrangements occurred between the relatively large P genome and the small genomes, St (8.15%) and Y (22.22%), in polyploid species via various types of translocations compared to their diploid progenitors. However, no translocation was found between the relatively small St and Y chromosomes. Environmental factors may affect rearrangements among the three genomes. Chromosome translocations were significantly more frequent in populations from cold alpine and grassland environments than in populations from valley and lake-basin habitats (P<0.05). The relationship between types of chromosome translocations and altitude was significant (r = 0.809, P<0.01). Intergenomic rearrangements associated with environmental factors and genetic differentiation of a single basic genome should be considered as equally important genetic processes during species' ecotype evolution.
Morphology and anatomy of the diaspores and seedling of Paspalum (Poaceae, Poales
Directory of Open Access Journals (Sweden)
MAYRA T. EICHEMBERG
2013-09-01
Full Text Available ABSTRACT The knowledge regarding of the diaspore and post-seminal development of Paspalum L. is important for grassland biodiversity conservation, based on their representativeness and genetic improvement of forage. The morphology of the diaspore and the post-seminal development of Paspalum dilatatum Poir. (rhizomatous, P. mandiocanum Trin. var. subaequiglume Barreto (stoloniferous, P. pumilum Nees. (decumbent caespitose and P. urvillei Steud. (erect caespitose was described to distinguish species with different growth forms and to survey the characters useful for taxonomy. P. dilatatum differs by presenting oval diaspores larger than the others, with five prominent nerves and trichomes; P. urvillei presents diaspores with one central nerve that is more developed than the two lateral nerves and trichomes; P. mandiocanum var. subaequiglume presents diaspores with trichomes only in the margin; and P. pumilum differs by presenting glabrous diaspores. The caryopsis involves the seed that presents the differentiated embryo and disposed laterally, an elliptical hilum in all of the studied species and a rostellum in P. dilatatum and P. mandiocanum var. subaequiglume. The post-seminal development is similar in the four species and begins with germination that is marked by the emergence of the coleorhiza, followed by the coleoptile. These characteristics are common to other Poaceae previously studied, indicating a pattern to the family and do not distinguish the growth forms.
Directory of Open Access Journals (Sweden)
Qiuxia Wang
Full Text Available Polyploidization is a major evolutionary process. Approximately 70-75% species of Triticeae (Poaceae are polyploids, involving 23 genomes. To investigate intergenomic rearrangements after polyploidization of Triticeae species and to determine the effects of environmental factors on them, nine populations of a typical polyploid Triticeae species, Kengyilia thoroldiana (Keng J.L.Yang et al. (2n = 6x = 42, StStPPYY, collected from different environments, were studied using genome in situ hybridization (GISH. We found that intergenomic rearrangements occurred between the relatively large P genome and the small genomes, St (8.15% and Y (22.22%, in polyploid species via various types of translocations compared to their diploid progenitors. However, no translocation was found between the relatively small St and Y chromosomes. Environmental factors may affect rearrangements among the three genomes. Chromosome translocations were significantly more frequent in populations from cold alpine and grassland environments than in populations from valley and lake-basin habitats (P<0.05. The relationship between types of chromosome translocations and altitude was significant (r = 0.809, P<0.01. Intergenomic rearrangements associated with environmental factors and genetic differentiation of a single basic genome should be considered as equally important genetic processes during species' ecotype evolution.
Hou, Siyu; Sun, Zhaoxia; Li, Yaoshen; Wang, Yijie; Ling, Hubin; Xing, Guofang; Han, Yuanhuai; Li, Hongying
2017-07-01
Proso millet ( Panicum miliaceum ; Poaceae) is a minor crop with good nutritional qualities and strong tolerance to drought stress and soil infertility. However, studies on genetic diversity have been limited due to a lack of efficient genetic markers. Illumina sequencing technology was used to generate short read sequences of proso millet, and de novo transcriptome assemblies were used to develop a de novo assembly of proso millet. Genic simple sequence repeat (SSR) markers were identified and used to detect polymorphism among 56 accessions. Population structure and genetic similarity coefficient were estimated. In total, 25,341 unique gene sequences and 4724 SSR loci were obtained from the transcriptome, of which 229 pairs of SSR primers were validated, which resulted in 14 polymorphic genic SSR primers exhibiting 43 total alleles. According to the ratio of polymorphic markers (6.1%, 14/229), there are potentially 288 polymorphic genic SSR markers available for genetic assay development in the future. Bayesian population analyses showed that the 56 accessions comprised two distinct groups. A genetic structure and cluster assay indicated that the accessions from the Loess Plateau of China shared a high genetic similarity coefficient with those from other regions and that there was no correlation between genetic diversity and geographic origin. The transcriptome sequencing data and millet-specific SSR markers developed in this study establish an excellent resource for gene discovery and may improve the development of breeding programs in proso millet in the future.
Hou, Siyu; Sun, Zhaoxia; Li, Yaoshen; Wang, Yijie; Ling, Hubin; Xing, Guofang; Han, Yuanhuai; Li, Hongying
2017-01-01
Premise of the study: Proso millet (Panicum miliaceum; Poaceae) is a minor crop with good nutritional qualities and strong tolerance to drought stress and soil infertility. However, studies on genetic diversity have been limited due to a lack of efficient genetic markers. Methods: Illumina sequencing technology was used to generate short read sequences of proso millet, and de novo transcriptome assemblies were used to develop a de novo assembly of proso millet. Genic simple sequence repeat (SSR) markers were identified and used to detect polymorphism among 56 accessions. Population structure and genetic similarity coefficient were estimated. Results: In total, 25,341 unique gene sequences and 4724 SSR loci were obtained from the transcriptome, of which 229 pairs of SSR primers were validated, which resulted in 14 polymorphic genic SSR primers exhibiting 43 total alleles. According to the ratio of polymorphic markers (6.1%, 14/229), there are potentially 288 polymorphic genic SSR markers available for genetic assay development in the future. Bayesian population analyses showed that the 56 accessions comprised two distinct groups. Discussion: A genetic structure and cluster assay indicated that the accessions from the Loess Plateau of China shared a high genetic similarity coefficient with those from other regions and that there was no correlation between genetic diversity and geographic origin. The transcriptome sequencing data and millet-specific SSR markers developed in this study establish an excellent resource for gene discovery and may improve the development of breeding programs in proso millet in the future. PMID:28791202
International Nuclear Information System (INIS)
Satish Rao, B.S.; Upadhya, D.; Adiga, S.K.
2007-01-01
The exposure of humans to ionizing radiations may be advertently by routine diagnostic and therapeutic purposes or inadvertently during natural, occupational and nuclear accident situations. Therefore, in order to overcome the deleterious biological effects of radiation several chemical agents have been studied for their radioprotective potential. The medicinal plants being one of the resources for such clinically important natural agents, used extensively in several drug discovery related research. Here the radiomodulatory potential of hydroalcoholic extract of a medicinal plant Cynodon dactylon (Family: Poaceae), against radiation-induced cytogenetic damage was analyzed using Chinese hamster fibroblast cells (V79) and human peripheral blood lymphocytes (HPBLs) growing in vitro is reported
Diop, Serigne Mbacké; Guèye, Momar Talla; Ndiaye, Ibrahima; Diop, Michel Bakar; Ndiaye, El Hadji Barka; Thiam, Abdoulaye; Fauconnier, Marie-Laure; Lognay, Georges
2017-01-01
This work aimed to study the chemical composition of essential oils and floral waters of Cymbopogon citratus (DC.) Stapf (Poaceae) from Senegal. The plants were collected in two different localities, Dakar and Kaolack. The extracts were obtained by steam distillation from both fresh and dried plants and analyses carried out by GC/FID and GC/MS. Oils from Dakar were dominated by geranial which represented 46.0-43.9%, neral 31.8-31.0%, myrcene 10.8-11.7% and geraniol 2.7-4.2% in the fresh and d...
Phylogenomics and taxonomy of Lecomtelleae (Poaceae), an isolated panicoid lineage from Madagascar.
Besnard, Guillaume; Christin, Pascal-Antoine; Malé, Pierre-Jean G; Coissac, Eric; Ralimanana, Hélène; Vorontsova, Maria S
2013-10-01
An accurate characterization of biodiversity requires analyses of DNA sequences in addition to classical morphological descriptions. New methods based on high-throughput sequencing may allow investigation of specimens with a large set of genetic markers to infer their evolutionary history. In the grass family, the phylogenetic position of the monotypic genus Lecomtella, a rare bamboo-like endemic from Madagascar, has never been appropriately evaluated. Until now its taxonomic treatment has remained controversial, indicating the need for re-evaluation based on a combination of molecular and morphological data. The phylogenetic position of Lecomtella in Poaceae was evaluated based on sequences from the nuclear and plastid genomes generated by next-generation sequencing (NGS). In addition, a detailed morphological description of L. madagascariensis was produced, and its distribution and habit were investigated in order to assess its conservation status. The complete plastid sequence, a ribosomal DNA unit and fragments of low-copy nuclear genes (phyB and ppc) were obtained. All phylogenetic analyses place Lecomtella as an isolated member of the core panicoids, which last shared a common ancestor with other species >20 million years ago. Although Lecomtella exhibits morphological characters typical of Panicoideae, an unusual combination of traits supports its treatment as a separate group. The study showed that NGS can be used to generate abundant phylogenetic information rapidly, opening new avenues for grass phylogenetics. These data clearly showed that Lecomtella forms an isolated lineage, which, in combination with its morphological peculiarities, justifies its treatment as a separate tribe: Lecomtelleae. New descriptions of the tribe, genus and species are presented with a typification, a distribution map and an IUCN conservation assessment.
Braun, Uwe; Crous, Pedro W; Nakashima, Chiharu
2014-12-01
Cercosporoid fungi (formerly Cercospora s. lat.) represent one of the largest groups of hyphomycetes belonging to the Mycosphaerellaceae (Ascomycota). They include asexual morphs, asexual holomorphs, or species with mycosphaerella-like sexual morphs. Most of them are leaf-spotting plant pathogens with special phytopathological relevance. In the first part of a new monographic work, cercosporoid hyphomycetes occurring on other fungi (fungicolous species), on ferns (pteridophytes) and gymnosperms were treated. This second part deals with cercosporoid fungi on monocots (Liliopsida; Equisetopsida, Magnoliidae, Lilianae), which covers species occurring on host plants belonging to families arranged in alphabetical order from Acoraceae to Xyridaceae, excluding Poaceae (cereals and grasses) which requires a separate treatment. The species are described and illustrated in alphabetical order under the particular cercosporoid genera, supplemented by keys to the species concerned. A detailed introduction, a survey of currently recognised cercosporoid genera, a key to the genera concerned, and a discussion of taxonomically relevant characters were published in the first part of this series. Neopseudocercospora, an additional recently introduced cercosporoid genus, is briefly discussed. The following taxonomic novelties are introduced: Cercospora alpiniigena sp. nov., C. neomaricae sp. nov., Corynespora palmicola comb. nov., Exosporium miyakei comb. nov., E. petersii comb. nov., Neopseudocercospora zambiensis comb. nov., Passalora caladiicola comb. nov., P. streptopi comb. nov., P. togashiana comb. nov., P. tranzschelii var. chinensis var. nov., Pseudocercospora beaucarneae comb. nov., P. constrictoflexuosa comb. et stat. nov., P. curcumicola sp. nov., P. dispori comb. nov., P. smilacicola sp. nov., P. urariigena nom. nov., Zasmidium agavicola comb. nov., Z. cercestidis-afzelii comb. nov., Z. citri-griseum comb. nov., Z. cyrtopodii comb. nov., Z. gahnae comb. nov., Z. indicum
Lepidopteran larvae were discovered boring in the basal stems of Imperata cylindrica (L.) Beauv. (Poaceae) in Itoshima city, Fukuoka Prefecture, Kyushu, Japan. Adults reared from these larvae were identified as Acrapex azumai Sugi (Lepidoptera: Noctuidae). Sequencing of the CO1 (cytochrome oxidase 1...
Ma, Peng-Fei; Zhang, Yu-Xiao; Zeng, Chun-Xia; Guo, Zhen-Hua; Li, De-Zhu
2014-11-01
The temperate woody bamboos constitute a distinct tribe Arundinarieae (Poaceae: Bambusoideae) with high species diversity. Estimating phylogenetic relationships among the 11 major lineages of Arundinarieae has been particularly difficult, owing to a possible rapid radiation and the extremely low rate of sequence divergence. Here, we explore the use of chloroplast genome sequencing for phylogenetic inference. We sampled 25 species (22 temperate bamboos and 3 outgroups) for the complete genome representing eight major lineages of Arundinarieae in an attempt to resolve backbone relationships. Phylogenetic analyses of coding versus noncoding sequences, and of different regions of the genome (large single copy and small single copy, and inverted repeat regions) yielded no well-supported contradicting topologies but potential incongruence was found between the coding and noncoding sequences. The use of various data partitioning schemes in analysis of the complete sequences resulted in nearly identical topologies and node support values, although the partitioning schemes were decisively different from each other as to the fit to the data. Our full genomic data set substantially increased resolution along the backbone and provided strong support for most relationships despite the very short internodes and long branches in the tree. The inferred relationships were also robust to potential confounding factors (e.g., long-branch attraction) and received support from independent indels in the genome. We then added taxa from the three Arundinarieae lineages that were not included in the full-genome data set; each of these were sampled for more than 50% genome sequences. The resulting trees not only corroborated the reconstructed deep-level relationships but also largely resolved the phylogenetic placements of these three additional lineages. Furthermore, adding 129 additional taxa sampled for only eight chloroplast loci to the combined data set yielded almost identical
García de León, David; García-Mozo, Herminia; Galán, Carmen; Alcázar, Purificación; Lima, Mauricio; González-Andújar, José L
2015-10-15
Pollen allergies are the most common form of respiratory allergic disease in Europe. Most studies have emphasized the role of environmental processes, as the drivers of airborne pollen fluctuations, implicitly considering pollen production as a random walk. This work shows that internal self-regulating processes of the plants (negative feedback) should be included in pollen dynamic systems in order to give a better explanation of the observed pollen temporal patterns. This article proposes a novel methodological approach based on dynamic systems to investigate the interaction between feedback structure of plant populations and climate in shaping long-term airborne Poaceae pollen fluctuations and to quantify the effects of climate change on future airborne pollen concentrations. Long-term historical airborne Poaceae pollen data (30 years) from Cordoba city (Southern Spain) were analyzed. A set of models, combining feedback structure, temperature and actual evapotranspiration effects on airborne Poaceae pollen were built and compared, using a model selection approach. Our results highlight the importance of first-order negative feedback and mean annual maximum temperature in driving airborne Poaceae pollen dynamics. The best model was used to predict the effects of climate change under two standardized scenarios representing contrasting temporal patterns of economic development and CO2 emissions. Our results predict an increase in pollen levels in southern Spain by 2070 ranging from 28.5% to 44.3%. The findings from this study provide a greater understanding of airborne pollen dynamics and how climate change might impact the future evolution of airborne Poaceae pollen concentrations and thus the future evolution of related pollen allergies. Copyright © 2015 Elsevier B.V. All rights reserved.
Attigala, Lakshmi; De Silva, Nuwan I; Clark, Lynn G
2016-04-01
Programs that are user-friendly and freely available for developing Web-based interactive keys are scarce and most of the well-structured applications are relatively expensive. WEBiKEY was developed to enable researchers to easily develop their own Web-based interactive keys with fewer resources. A Web-based multiaccess identification tool (WEBiKEY) was developed that uses freely available Microsoft ASP.NET technologies and an SQL Server database for Windows-based hosting environments. WEBiKEY was tested for its usability with a sample data set, the temperate woody bamboo genus Kuruna (Poaceae). WEBiKEY is freely available to the public and can be used to develop Web-based interactive keys for any group of species. The interactive key we developed for Kuruna using WEBiKEY enables users to visually inspect characteristics of Kuruna and identify an unknown specimen as one of seven possible species in the genus.
Directory of Open Access Journals (Sweden)
Anna Maria Mercuri
2016-12-01
Full Text Available Aerobiological data have especially demonstrated that there is correlation between climate warming and the pollination season of plants. This paper focuses on airborne pollen monitoring of Betulaceae and Poaceae, two of the main plant groups with anemophilous pollen and allergenic proprieties in Northern Italy. The aim is to investigate plant responses to temperature variations by considering long-term pollen series. The 15-year aerobiological analysis is reported from the monitoring station of Vignola (located near Modena, in the Emilia-Romagna region that had operated in the years 1990–2004 with a Hirst spore trap. The Yearly Pollen Index calculated for these two botanical families has shown contrasting trends in pollen production and release. These trends were well identifiable but fairly variable, depending on both meteorological variables and anthropogenic causes. Based on recent reference literature, we considered that some oscillations in pollen concentration could have been a main effect of temperature variability reflecting global warming. The duration of pollen seasons of Betulaceae and Poaceae, depending on the different species included in each family, has not unequivocally been determined. Phenological responses were particularly evident in Alnus and especially in Corylus as a general moving up of the end of pollination. The study shows that these trees can be affected by global warming more than other, more tolerant, plants. The research can be a contribution to the understanding of phenological plant responses to climate change and suggests that alder and hazelnut trees have to be taken into high consideration as sensible markers of plant responses to climate change.
Mercuri, Anna Maria; Torri, Paola; Fornaciari, Rita; Florenzano, Assunta
2016-01-01
Aerobiological data have especially demonstrated that there is correlation between climate warming and the pollination season of plants. This paper focuses on airborne pollen monitoring of Betulaceae and Poaceae, two of the main plant groups with anemophilous pollen and allergenic proprieties in Northern Italy. The aim is to investigate plant responses to temperature variations by considering long-term pollen series. The 15-year aerobiological analysis is reported from the monitoring station of Vignola (located near Modena, in the Emilia-Romagna region) that had operated in the years 1990–2004 with a Hirst spore trap. The Yearly Pollen Index calculated for these two botanical families has shown contrasting trends in pollen production and release. These trends were well identifiable but fairly variable, depending on both meteorological variables and anthropogenic causes. Based on recent reference literature, we considered that some oscillations in pollen concentration could have been a main effect of temperature variability reflecting global warming. The duration of pollen seasons of Betulaceae and Poaceae, depending on the different species included in each family, has not unequivocally been determined. Phenological responses were particularly evident in Alnus and especially in Corylus as a general moving up of the end of pollination. The study shows that these trees can be affected by global warming more than other, more tolerant, plants. The research can be a contribution to the understanding of phenological plant responses to climate change and suggests that alder and hazelnut trees have to be taken into high consideration as sensible markers of plant responses to climate change. PMID:27929423
Linder, H P; Lehmann, Caroline E R; Archibald, Sally; Osborne, Colin P; Richardson, David M
2018-05-01
Poaceae (the grasses) is arguably the most successful plant family, in terms of its global occurrence in (almost) all ecosystems with angiosperms, its ecological dominance in many ecosystems, and high species richness. We suggest that the success of grasses is best understood in context of their capacity to colonize, persist, and transform environments (the "Viking syndrome"). This results from combining effective long-distance dispersal, efficacious establishment biology, ecological flexibility, resilience to disturbance and the capacity to modify environments by changing the nature of fire and mammalian herbivory. We identify a diverse set of functional traits linked to dispersal, establishment and competitive abilities. Enhanced long-distance dispersal is determined by anemochory, epizoochory and endozoochory and is facilitated via the spikelet (and especially the awned lemma) which functions as the dispersal unit. Establishment success could be a consequence of the precocious embryo and large starch reserves, which may underpin the extremely short generation times in grasses. Post-establishment genetic bottlenecks may be mitigated by wind pollination and the widespread occurrence of polyploidy, in combination with gametic self-incompatibility. The ecological competitiveness of grasses is corroborated by their dominance across the range of environmental extremes tolerated by angiosperms, facilitated by both C 3 and C 4 photosynthesis, well-developed frost tolerance in several clades, and a sympodial growth form that enabled the evolution of both annual and long-lived life forms. Finally, absence of investment in wood (except in bamboos), and the presence of persistent buds at or below ground level, provides tolerance of repeated defoliation (whether by fire, frost, drought or herbivores). Biotic modification of environments via feedbacks with herbivory or fire reinforce grass dominance leading to open ecosystems. Grasses can be both palatable and productive
Sharifi-Rad, M; Iriti, M; Sharifi-Rad, M; Gibbons, S; Sharifi-Rad, J
2016-08-29
In this study, we evaluated the effects of the extracts of the leaves of species from the Rubiaceae (Galium aparine L. and Asperula arvensis L.), Fabaceae (Lathyrus aphaca L. and Vicia narbonensis L.) and Poaceae (Digitaria sanguinalis (L.) Scop. and Hordeum murinum L.) plant families on a wide and extensive panel of isolated methicillin-resistant Staphylococcus aureus strains (MRSA). The effects of the methanolic leaf extracts of Rubiaceae, Fabaceae and Poaceae plants on MRSA were evaluated by the disc diffusion assay and the broth dilution method. Among a total of 177 S. aureus isolates, 92 (51.97%) were found to be methicillin-resistant in an antibiogram and this was confirmed by the presence of the mecA gene in polymerase chain reaction method. All MRSA isolates were sensitive to all extracts. There were dose-dependent inhibitions on tested microorganisms for all plant extracts which showed maximum inhibition zones at a concentration of 300 mg/L. L. aphaca, G. aparine and H. murinum exhibited the highest antibacterial activity on the MRSA strains compared to the positive control (P Fabaceae), G. aparine (Rubiaceae), and H. murinum (Poaceae) proved to have high antibacterial activity on MRSA isolates, thus representing promising antimicrobial agents in clinical settings.
Yao, Peng-Cheng; Gao, Hai-Yan; Wei, Ya-Nan; Zhang, Jian-Hang; Chen, Xiao-Yong; Li, Hong-Qing
2017-01-01
Environmental conditions in coastal salt marsh habitats have led to the development of specialist genetic adaptations. We evaluated six DNA barcode loci of the 53 species of Poaceae and 15 species of Chenopodiaceae from China's coastal salt marsh area and inland area. Our results indicate that the optimum DNA barcode was ITS for coastal salt-tolerant Poaceae and matK for the Chenopodiaceae. Sampling strategies for ten common species of Poaceae and Chenopodiaceae were analyzed according to optimum barcode. We found that by increasing the number of samples collected from the coastal salt marsh area on the basis of inland samples, the number of haplotypes of Arundinella hirta, Digitaria ciliaris, Eleusine indica, Imperata cylindrica, Setaria viridis, and Chenopodium glaucum increased, with a principal coordinate plot clearly showing increased distribution points. The results of a Mann-Whitney test showed that for Digitaria ciliaris, Eleusine indica, Imperata cylindrica, and Setaria viridis, the distribution of intraspecific genetic distances was significantly different when samples from the coastal salt marsh area were included (P Imperata cylindrica and Chenopodium album, average intraspecific distance tended to reach stability. These results indicate that the sample size for DNA barcode of globally distributed species should be increased to 11-15.
Directory of Open Access Journals (Sweden)
AT. Nakamura
2010-05-01
Full Text Available Anther and pollen development were studied in Olyra humilis Nees, Sucrea monophylla Soderstr, (Bambusoideae, Axonopus aureus P. Beauv., Paspalum polyphyllum Nees ex Trin. (Panicoideae, Eragrostis solida Nees, and Chloris elata Desv. (Chloridoideae. The objective of this study was to characterise, embryologically, these species of subfamilies which are considered basal, intermediate and derivate, respectively. The species are similar to each other and to other Poaceae. They present the following characters: tetrasporangiate anthers; monocotyledonous-type anther wall development, endothecium showing annular thickenings, secretory tapetum; successive microsporogenesis; isobilateral tetrads; spheroidal, tricellular, monoporate pollen grains with annulus and operculum. Nevertheless, the exine patterns of the species studied are distinct. Olyra humilis and Sucrea monophylla (Bambusoideae show a granulose pattern, whereas in the other species, it is insular. In addition, Axonopus aureus and Paspalum polyphyllum (Panicoideae have a compactly insular spinule pattern, while Chloris elata and Eragrostis solida (Chloridoideae show a sparsely insular spinule pattern. The exine ornamentation may be considered an important feature at the infrafamiliar level.O desenvolvimento da antera e do grão de pólen de Olyra humilis Nees, Sucrea monophylla Soderstr. (Bambusoideae, Axonopus aureus P. Beauv., Paspalum polyphyllum Nees ex Trin. (Panicoideae, Eragrostis solida Nees and Chloris elata Desv. (Chloridoideae foi estudado visando caracterizar embriologicamente essas espécies de subfamílias consideradas basal, intermediária e derivada, respectivamente. As espécies são similares entre si e entre as demais Poaceae. Apresentam os seguintes caracteres: anteras tetrasporangiadas; desenvolvimento da parede da antera do tipo monocotiledôneo, endotécio com espessamento de parede anelar, tapete secretor; microsporogênese sucessiva; tétrades isobilaterais; grãos de
Anatomía ecológica de algunas especies del género Paspalum (Poaceae, Panicoideae, Paniceae
Directory of Open Access Journals (Sweden)
Sandra S. Aliscioni
2000-01-01
Full Text Available Aliscioni, S. S. 2000. Anatomía ecológica de algunas especies del género Paspalum(Poaceae, Panicoideae, Paniceae. Darwiniana 38(3-4: 187-207.El género Paspalum L. presenta un elevado número de especies, con una amplia variabilidadmorfológica y una extensa distribución geográfica. Sus especies crecen en hábitats sumamente diversos,desde ambientes muy húmedos o acuáticos, a lugares secos de suelos arcillosos o arenosos, muchas vecessalinos. Dada la diversidad de ambientes en los que puede hallarse Paspalum, se estudiaron lascaracterísticas anatómico-foliares presentes en el género con la finalidad de interpretar diferentesestrategias adaptativas en distintas especies. Se presenta una descripción general de la anatomía foliar delgénero y se discuten ciertos caracteres anatómicos, interpretando su posible relación con las condicionesdel hábitat
Hwang, Sun-Nyoung; Kim, Jae-Cheon; Bhuiyan, Mohammad Iqbal Hossain; Kim, Joo Youn; Yang, Ji Seon; Yoon, Shin Hee; Yoon, Kee Dong; Kim, Seong Yun
2018-04-01
Rice is the most commonly consumed grain in the world. Black rice has been suggested to contain various bioactive compounds including anthocyanin antioxidants. There is currently little information about the nutritional benefits of black rice on brain pathology. Here, we investigated the effects of black rice ( Oryza sativa L ., Poaceae) extract (BRE) on the hippocampal neuronal damage induced by ischemic insult. BRE (300 mg/kg) was orally administered to adult male C57BL/6 mice once a day for 21 days. Bilateral common carotid artery occlusion (BCCAO) was performed for 23 min on the 8th day of BRE or vehicle administration. Histological analyses conducted on the 22nd day of BRE or vehicle administration revealed that administering BRE profoundly attenuated neuronal cell death, inhibited reactive astrogliosis, and prevented loss of glutathione peroxidase expression in the hippocampus when compared to vehicle treatment. In addition, BRE considerably ameliorated BCCAO-induced memory impairment on the Morris water maze test from the 15th day to the 22nd day of BRE or vehicle administration. These results indicate that chronic administration of BRE is potentially beneficial in cerebral ischemia.
Kaur, H; Kumari, S; Gupta, R C
2013-01-01
The present paper deals with cytological studies on the population basis of 21 species belonging to 9 genera of tribe Paniceae of family Poaceae from cytologically unexplored area of Western Himalayas i.e. district Kangra of Himachal Pradesh for the assessment of genetic diversity of grass flora. On world-wide basis, the chromosome counts have been made for the first time for three species such as Brachiaria remota (n = 16), Digitaria granularis (n = 36) and Isachne albens (n = 5). Similarly, on India basis, altogether new records are made for two species such as Echinochloa cruspavonis (n = 27) and Paspalum distichum (2n = 50). A comparison of the different euploid cytotypes studied at present for Digitaria adscendens, D. setigera and Oplismenus compositus revealed significant variations in their morphology, depicting increase in some of the characters of polyploid cytotypes. The course of meiosis has been observed to be normal in all the studied populations with high pollen fertility except for two species such as Paspalum dilatatum and P. distichum marked with abnormal meiosis and reduced pollen fertility.
International Nuclear Information System (INIS)
Yilmaz, R.; Cabi, E.; Dogan, M.
2014-01-01
RAPD-PCR (Random Amplified Polymorphic DNA Polymerase Chain Reaction) and Post PCR (Polymerase Chain Reaction) Melting Curve Analysis (MCA) have been used to investigate the pattern of genetic variation among some species in the genera Eremopyrum (Ledeb.) Jaub. and Spach and Agropyron Gaertner (Poaceae). Thirteen primers have been used in the study based on the RAPD-PCR and MCA analyses. Each species produced a distinct pattern of DNA fragments which have been used as a measure of the degree of relationship between species by means of using the RAPD-PCR results with three primers selected for identifying the genetic similarities. Polymorphic melting profiles have been obtained with Post PCR MCA method using three primers. Genetic similarities are calculated for all the species studied with RAPD-PCR and MCA methods, the dendrograms are obtained with the MVSP (Multi Variate Statistical Package) software using UPGMA (Unweighted Pair Group Method with Arithmetic Averages) and Jaccard's Coefficient. Polymorphism between 18 populations of Eremopyrum and 6 Agropyron populations and within the species are determined by using RAPD-PCR and Post PCR melting curve analysis (MCA) respectively. (author)
Phylogeny of Eleusine (Poaceae: Chloridoideae) based on nuclear ITS and plastid trnT-trnF sequences.
Neves, Susana S; Swire-Clark, Ginger; Hilu, Khidir W; Baird, Wm Vance
2005-05-01
Phylogenetic relationships in the genus Eleusine (Poaceae: Chloridoideae) were investigated using nuclear ITS and plastid trnT-trnF sequences. Separate and combined data sets were analyzed using parsimony, distance, and likelihood based methods, including Bayesian. Data congruence was examined using character and topological measures. Significant data heterogeneity was detected, but there was little conflict in the topological substructure measures for triplets and quartets, and resolution and clade support increased in the combined analysis. Data incongruence may be a result of noise and insufficient information in the slower evolving trnT-trnF. Monophyly of Eleusine is strongly supported in all analyses, but basal relationships in the genus remain uncertain. There is good support for a CAIK clade (E. coracana subsp. coracana and africana, E. indica, and E. kigeziensis), with E. tristachya as its sister group. Two putative ITS homeologues (A and B loci) were identified in the allotetraploid E. coracana; the 'B' locus sequence type was not found in the remaining species. Eleusine coracana and its putative 'A' genome donor, the diploid E. indica, are confirmed close allies, but sequence data contradicts the hypothesis that E. floccifolia is its second genome donor. The 'B' genome donor remains unidentified and may be extinct.
Directory of Open Access Journals (Sweden)
Flávia V. Moreira
2010-08-01
Full Text Available Cymbopogon citratus DC. Stapf, Poaceae, is used in the folk medicine for hypertension treatment. This work investigated the chemical composition and cardiovascular effects in rats of C. citratus essential oil (EOCC. A phytochemical screening demonstrated the presence of eight constituents, being geranial the major compound (43.08%. In rats, EOCC (1, 5, 10, and 20 mg/kg, i.v. induced transient hypotension and bradycardia that were attenuated by atropine and sodium thiopental, but not by L-NAME or indomethacin. In rings of rat superior mesenteric artery pre-contracted with phenylephrine, EOCC (1 to 3000 µg/mL induced relaxation that was not affected after removal of the endothelium, after TEA or in rings pre-contracted with KCl (80 mM. Furthermore, EOCC (1000 µg/mL was not able to induce additional effect on maximal relaxation of nifedipine (10 µM. In conclusions, EOCC induces hypotension, possibly by reduction in vascular resistance caused by inhibition of the Ca2+ influx, and bradycardia probably due to an activation of cardiac muscarinic receptors.
Directory of Open Access Journals (Sweden)
Peng-Cheng Yao
Full Text Available Environmental conditions in coastal salt marsh habitats have led to the development of specialist genetic adaptations. We evaluated six DNA barcode loci of the 53 species of Poaceae and 15 species of Chenopodiaceae from China's coastal salt marsh area and inland area. Our results indicate that the optimum DNA barcode was ITS for coastal salt-tolerant Poaceae and matK for the Chenopodiaceae. Sampling strategies for ten common species of Poaceae and Chenopodiaceae were analyzed according to optimum barcode. We found that by increasing the number of samples collected from the coastal salt marsh area on the basis of inland samples, the number of haplotypes of Arundinella hirta, Digitaria ciliaris, Eleusine indica, Imperata cylindrica, Setaria viridis, and Chenopodium glaucum increased, with a principal coordinate plot clearly showing increased distribution points. The results of a Mann-Whitney test showed that for Digitaria ciliaris, Eleusine indica, Imperata cylindrica, and Setaria viridis, the distribution of intraspecific genetic distances was significantly different when samples from the coastal salt marsh area were included (P < 0.01. These results suggest that increasing the sample size in specialist habitats can improve measurements of intraspecific genetic diversity, and will have a positive effect on the application of the DNA barcodes in widely distributed species. The results of random sampling showed that when sample size reached 11 for Chloris virgata, Chenopodium glaucum, and Dysphania ambrosioides, 13 for Setaria viridis, and 15 for Eleusine indica, Imperata cylindrica and Chenopodium album, average intraspecific distance tended to reach stability. These results indicate that the sample size for DNA barcode of globally distributed species should be increased to 11-15.
Dowd, Patrick F; Sattler, Scott E
2015-01-01
The presence of lignin within biomass impedes the production of liquid fuels. Plants with altered lignin content and composition are more amenable to lignocellulosic conversion to ethanol and other biofuels but may be more susceptible to insect damage where lignin is an important resistance factor. However, reduced lignin lines of switchgrasses still retained insect resistance in prior studies. Therefore, we hypothesized that sorghum lines with lowered lignin content will also retain insect resistance. Sorghum excised leaves and stalk pith Sorghum bicolor (L.) Moench (Poales: Poaceae) from near isogenic brown midrib (bmr) 6 and 12 mutants lines, which have lowered lignin content and increased lignocellulosic ethanol conversion efficiency, were examined for insect resistance relative to wild-type (normal BTx623). Greenhouse and growth chamber grown plant tissues were fed to first-instar larvae of corn earworms, Helicoverpa zea (Boddie) and fall armyworms Spodoptera frugiperda (J.E. Smith) (Lepidoptera: Noctuidae), two sorghum major pests. Younger bmr leaves had significantly greater feeding damage in some assays than wild-type leaves, but older bmr6 leaves generally had significantly less damage than wild-type leaves. Caterpillars feeding on the bmr6 leaves often weighed significantly less than those feeding on wild-type leaves, especially in the S. frugiperda assays. Larvae fed the pith from bmr stalks had significantly higher mortality compared with those larvae fed on wild-type pith, which suggested that bmr pith was more toxic. Thus, reducing lignin content or changing subunit composition of bioenergy grasses does not necessarily increase their susceptibility to insects and may result in increased resistance, which would contribute to sustainable production. Published by Oxford University Press on behalf of the Entomological Society of America 2015. This work is written by US Government employees and is in the public domain in the US.
Directory of Open Access Journals (Sweden)
Ryan Dierking
2015-03-01
Full Text Available Temperate grasses belonging to the complex are important throughout the world in pasture and grassland agriculture. Tall fescue ( Schreb. is the predominant species in the United States, covering approximately 15 million ha. Tall fescue has distinctive morphotypes, two of which are Continental (summer active and Mediterranean (summer semidormant. This is the first report of a linkage map created for Mediterranean tall fescue, while updating the Continental map with additional simple sequence repeat and sequence-tagged site markers. Additionally, this is the first time that diversity arrays technology (DArT markers were used in the construction of a tall fescue map. The male parent (Continental, R43-64, map consisted of 594 markers arranged in 22 linkage groups (LGs and covered a total of 1577 cM. The female parent (Mediterranean, 103-2, map was shorter (1258 cM and consisted of only 208 markers arranged in 29 LGs. Marker densities for R43-64 and 103-2 were 2.65 and 6.08 cM per marker, respectively. When compared with the other Poaceae species, meadow fescue ( Huds., annual ryegrass ( Lam., perennial ryegrass ( L., (L. Beauv., and barley ( L., a total of 171 and 98 orthologous or homologous sequences, identified by DArT analysis, were identified in R43-64 and 103-2, respectively. By using genomic in situ hybridization, we aimed to identify potential progenitors of both morphotypes. However, no clear conclusion on genomic constitution was reached. These maps will aid in the search for quantitative trait loci of various traits as well as help define and distinguish genetic differences between the two morphotypes.
Birch, Joanne L; Walsh, Neville G; Cantrill, David J; Holmes, Gareth D; Murphy, Daniel J
2017-01-01
In Australia, Poaceae tribe Poeae are represented by 19 genera and 99 species, including economically and environmentally important native and introduced pasture grasses [e.g. Poa (Tussock-grasses) and Lolium (Ryegrasses)]. We used this tribe, which are well characterised in regards to morphological diversity and evolutionary relationships, to test the efficacy of DNA barcoding methods. A reference library was generated that included 93.9% of species in Australia (408 individuals, [Formula: see text] = 3.7 individuals per species). Molecular data were generated for official plant barcoding markers (rbcL, matK) and the nuclear ribosomal internal transcribed spacer (ITS) region. We investigated accuracy of specimen identifications using distance- (nearest neighbour, best-close match, and threshold identification) and tree-based (maximum likelihood, Bayesian inference) methods and applied species discovery methods (automatic barcode gap discovery, Poisson tree processes) based on molecular data to assess congruence with recognised species. Across all methods, success rate for specimen identification of genera was high (87.5-99.5%) and of species was low (25.6-44.6%). Distance- and tree-based methods were equally ineffective in providing accurate identifications for specimens to species rank (26.1-44.6% and 25.6-31.3%, respectively). The ITS marker achieved the highest success rate for specimen identification at both generic and species ranks across the majority of methods. For distance-based analyses the best-close match method provided the greatest accuracy for identification of individuals with a high percentage of "correct" (97.6%) and a low percentage of "incorrect" (0.3%) generic identifications, based on the ITS marker. For tribe Poeae, and likely for other grass lineages, sequence data in the standard DNA barcode markers are not variable enough for accurate identification of specimens to species rank. For recently diverged grass species similar challenges are
Yoshioka, Akira; Takada, Mayura; Washitani, Izumi
2011-10-01
Source populations of polyphagous pests often occur on host plants other than the economically damaged crop. We evaluated the contribution of patches of a non-native meadow grass, Lolium multiflorum Lam. (Poaceae), and other weeds growing in fallow fields or meadows as source hosts of an important native pest of rice, Stenotus rubrovittatus (Matsumura) (Hemiptera: Miridae), in an agricultural landscape of northern Japan. Periodical censuses of this mirid bug by using the sweeping method, vegetation surveys, and statistical analysis revealed that L. multiflorum was the only plant species that was positively correlated with the density of adult S. rubrovittatus through two generations and thus may be the most stable and important host of the mirid bug early in the season before the colonization of rice paddies. The risk and cost of such an indirect negative effect on a crop plant through facilitation of a native pest by a non-native plant in the agricultural landscape should not be overlooked.
Directory of Open Access Journals (Sweden)
Jörg Dörrstein
2018-04-01
Full Text Available This article presents experimental data of organosolv lignin from Poacea grass and structural changes after compounding and injection molding as presented in the research article “Effects of high-lignin-loading on thermal, mechanical, and morphological properties of bioplastic composites” [1]. It supplements the article with morphological (SEM, spectroscopic (31P NMR, FT-IR and chromatographic (GPC, EA data of the starting lignin as well as molar mass characteristics (mass average molar mass (Mw and Polydispersity (D of the extracted lignin. Refer to Schwarz et al. [2] for a detailed description of the production of the organosolv residue and for further information on the raw material used for lignin extraction. The dataset is made publicly available and can be useful for extended lignin research and critical analyzes.
Directory of Open Access Journals (Sweden)
Dunn Sade N
2008-06-01
Full Text Available Abstract Background Quantitative Real Time RT-PCR (q2(RTPCR is a maturing technique which gives researchers the ability to quantify and compare very small amounts of nucleic acids. Primer design and optimization is an essential yet time consuming aspect of using q2(RTPCR. In this paper we describe the design and empirical optimization of primers to amplify and quantify plastid RNAs from Zea mays that are robust enough to use with other closely related species. Results Primers were designed and successfully optimized for 57 of the 104 reported genes in the maize plastome plus two nuclear genes. All 59 primer pairs produced single amplicons after end-point reverse transcriptase polymerase chain reactions (RT-PCR as visualized on agarose gels and subsequently verified by q2(RTPCR. Primer pairs were divided into several categories based on the optimization requirements or the uniqueness of the target gene. An in silico test suggested the majority of the primer sets should work with other members of the Poaceae family. An in vitro test of the primer set on two unsequenced species (Panicum virgatum and Miscanthus sinensis supported this assumption by successfully producing single amplicons for each primer pair. Conclusion Due to the highly conserved chloroplast genome in plant families it is possible to utilize primer pairs designed against one genomic sequence to detect the presence and abundance of plastid genes or transcripts from genomes that have yet to be sequenced. Analysis of steady state transcription of vital system genes is a necessary requirement to comprehensively elucidate gene expression in any organism. The primer pairs reported in this paper were designed for q2(RTPCR of maize chloroplast genes but should be useful for other members of the Poaceae family. Both in silico and in vitro data are presented to support this assumption.
Directory of Open Access Journals (Sweden)
Ethel Lourenzi Barbosa Novelli
2002-05-01
Full Text Available Este experimento foi conduzido para avaliar a seletividade em plantas dos herbicidas acetochlor, atrazine e oxyfluorfen em relação à atividade da glutationa S-transferase (GST em plantas de milho (Zea mays L., sorgo (Sorghum bicolor L. e trigo (Triticum aestivum L. (Poaceae. A atividade da GST foi detectada às 24, 48 e 72 horas após as aplicaç��es dos tratamentos. Os tratamentos do experimento consistiram de aplicação com água (controle, acetochlor (3 L.ha-1, atrazine (4 L.ha-1 e oxyfluorfen (1 L.ha-1. As maiores atividades de GST foram observadas na presença de acetochlor, principalmente às 48 horas após o tratamento. Esses aumentos foram 105, 148 e 118% em relação ao controle para milho, sorgo e trigo, respectivamente. É sugerido que a GST pode ter papel na degradação de acetochlor e pode ser uma das razões para a seletividade desse herbicida para essas culturas.This experiment was conducted to evaluate the acetochlor, atrazine and oxyfluorfen herbicides plant selectivity, in relation to glutathione S-transferase activity (GST in maize (Zea mays L., sorghum (Sorghum bicolor L. and wheat (Triticum aestivum L (Poaceae plants. GST activity was detected 24, 48 and 72 hours after treatment applications. The experiment's treatments consisted of spraying plants with water (control, acetochlor (3 L.ha-1`, atrazine (4 L.ha-1 and oxyfluorfen (1 L.ha-1. The highest GST activities were observed in presence of acetochlor, mainly at 48 hours after treatment. These increments were 105, 148 and 118% when compared to maize, sorghum and wheat control groups, respectively. It is suggested that the GST may have a role in acetochlor degradation and it may be a reason for this herbicide's selectivity in these crops.
Magnano, Andrea L.; Nanni, Analía S.; Krug, Pamela; Astrada, Elizabeth; Vicari, Ricardo; Quintana, Rubén D.
2018-01-01
In Argentina, the intensification of soybean production has displaced a substantial proportion of cattle ranching to fluvial wetlands such as those in the Delta of the Paraná River. Cattle grazing affects structure and dynamics of native forage plants but there is little information on this impact in populations from fluvial wetlands. This study addresses the effect of cattle ranching on density, survival, mean life-span and aerial biomass of Hymenachne pernambucense (Poaceae), an important forage species in the region. The study was carried out monthly for one year in permanents plots subject to continuous grazing and plots excluded from grazing in the Middle Delta of the Paraná River. In plots excluded from grazing, tillers showed significantly higher population density and survival, and a two-fold increase in mean life-span, while continuous grazing decreased survival of cohorts. The largest contribution to tiller density in ungrazed and grazed populations was made by spring and summer cohorts, respectively. Total and green biomass were significantly higher in the ungrazed population, with highest differences in late spring-early summer. Cattle grazing affected the relationship between tiller density and green biomass suggesting that cattle prefer sprouts because they are more palatable and nutritious than older tissue.
Winterfeld, Grit; Becher, Hannes; Voshell, Stephanie; Hilu, Khidir; Röser, Martin
2018-01-01
Karyotype characteristics can provide valuable information on genome evolution and speciation, in particular in taxa with varying basic chromosome numbers and ploidy levels. Due to its worldwide distribution, remarkable variability in morphological traits and the fact that ploidy change plays a key role in its evolution, the canary grass genus Phalaris (Poaceae) is an excellent study system to investigate the role of chromosomal changes in species diversification and expansion. Phalaris comprises diploid species with two basic chromosome numbers of x = 6 and 7 as well as polyploids based on x = 7. To identify distinct karyotype structures and to trace chromosome evolution within the genus, we apply fluorescence in situ hybridisation (FISH) of 5S and 45S rDNA probes in four diploid and four tetraploid Phalaris species of both basic numbers. The data agree with a dysploid reduction from x = 7 to x = 6 as the result of reciprocal translocations between three chromosomes of an ancestor with a diploid chromosome complement of 2n = 14. We recognize three different genomes in the genus: (1) the exclusively Mediterranean genome A based on x = 6, (2) the cosmopolitan genome B based on x = 7 and (3) a genome C based on x = 7 and with a distribution in the Mediterranean and the Middle East. Both auto- and allopolyploidy of genomes B and C are suggested for the formation of tetraploids. The chromosomal divergence observed in Phalaris can be explained by the occurrence of dysploidy, the emergence of three different genomes, and the chromosome rearrangements accompanied by karyotype change and polyploidization. Mapping the recognized karyotypes on the existing phylogenetic tree suggests that genomes A and C are restricted to sections Phalaris and Bulbophalaris, respectively, while genome B occurs across all taxa with x = 7.
Directory of Open Access Journals (Sweden)
Grit Winterfeld
Full Text Available Karyotype characteristics can provide valuable information on genome evolution and speciation, in particular in taxa with varying basic chromosome numbers and ploidy levels. Due to its worldwide distribution, remarkable variability in morphological traits and the fact that ploidy change plays a key role in its evolution, the canary grass genus Phalaris (Poaceae is an excellent study system to investigate the role of chromosomal changes in species diversification and expansion. Phalaris comprises diploid species with two basic chromosome numbers of x = 6 and 7 as well as polyploids based on x = 7. To identify distinct karyotype structures and to trace chromosome evolution within the genus, we apply fluorescence in situ hybridisation (FISH of 5S and 45S rDNA probes in four diploid and four tetraploid Phalaris species of both basic numbers. The data agree with a dysploid reduction from x = 7 to x = 6 as the result of reciprocal translocations between three chromosomes of an ancestor with a diploid chromosome complement of 2n = 14. We recognize three different genomes in the genus: (1 the exclusively Mediterranean genome A based on x = 6, (2 the cosmopolitan genome B based on x = 7 and (3 a genome C based on x = 7 and with a distribution in the Mediterranean and the Middle East. Both auto- and allopolyploidy of genomes B and C are suggested for the formation of tetraploids. The chromosomal divergence observed in Phalaris can be explained by the occurrence of dysploidy, the emergence of three different genomes, and the chromosome rearrangements accompanied by karyotype change and polyploidization. Mapping the recognized karyotypes on the existing phylogenetic tree suggests that genomes A and C are restricted to sections Phalaris and Bulbophalaris, respectively, while genome B occurs across all taxa with x = 7.
Liu, Qing; Triplett, Jimmy K; Wen, Jun; Peterson, Paul M
2011-11-01
Eleusine (Poaceae) is a small genus of the subfamily Chloridoideae exhibiting considerable morphological and ecological diversity in East Africa and the Americas. The interspecific phylogenetic relationships of Eleusine are investigated in order to identify its allotetraploid origin, and a chronogram is estimated to infer temporal relationships between palaeoenvironment changes and divergence of Eleusine in East Africa. Two low-copy nuclear (LCN) markers, Pepc4 and EF-1α, were analysed using parsimony, likelihood and Bayesian approaches. A chronogram of Eleusine was inferred from a combined data set of six plastid DNA markers (ndhA intron, ndhF, rps16-trnK, rps16 intron, rps3, and rpl32-trnL) using the Bayesian dating method. The monophyly of Eleusine is strongly supported by sequence data from two LCN markers. In the cpDNA phylogeny, three tetraploid species (E. africana, E. coracana and E. kigeziensis) share a common ancestor with the E. indica-E. tristachya clade, which is considered a source of maternal parents for allotetraploids. Two homoeologous loci are isolated from three tetraploid species in the Pepc4 phylogeny, and the maternal parents receive further support. The A-type EF-1α sequences possess three characters, i.e. a large number of variations of intron 2; clade E-A distantly diverged from clade E-B and other diploid species; and seven deletions in intron 2, implying a possible derivation through a gene duplication event. The crown age of Eleusine and the allotetraploid lineage are 3·89 million years ago (mya) and 1·40 mya, respectively. The molecular data support independent allotetraploid origins for E. kigeziensis and the E. africana-E. coracana clade. Both events may have involved diploids E. indica and E. tristachya as the maternal parents, but the paternal parents remain unidentified. The habitat-specific hypothesis is proposed to explain the divergence of Eleusine and its allotetraploid lineage.
Directory of Open Access Journals (Sweden)
Marcos R. Furlan
2010-11-01
Full Text Available O óleo essencial extraído de Cymbopogon citratus (DC Staf, Poaceae, é rico em citral sendo amplamente empregado na indústria química e farmacêutica. Os objetivos desse estudo foram avaliar o conteúdo de citral entre populações de C. citratus coletados em duas regiões diferentes (Ibiúna e Pindamonhangaba, Estado de São Paulo. O óleo essencial extraído de uma população cultivada em Pindamonhangaba-SP apresentou uma concentração alta de citral (aproximadamente 96,0%, enquanto que o óleo extraído da população de Ibiúna-SP apresentou, além de citral, proporções elevadas de outro monoterpeno, o geraniol. Adicionalmente, os óleos essenciais obtidos desta população de C. citratus foram extraídos e analisados ao longo de 24 h (a cada 3 h, sendo que o teor de citral foi maior no período da noite, o que mostra a importância de estudos que avaliam as diferenças químicas associadas às mudanças circadianas. Os componentes dos óleos essenciais foram identificados por RMN de 13C, CG/EM e CG através do índice de Kovats.The essential oil extracted from Cymbopogon citratus (DC Staf, Poaceae, is rich in citral and has many applications in chemical and pharmaceutical industry. The aims of this study were evaluate the amount of citral in populations of C. citratus collected in two different regions (Ibiúna and Pindamonhangaba, São Paulo State. The essential oil extracted of a cultivated population in Pidamonhangaba-SP, showed a high content of citral (approximately 96.0%, while the essential oil from Ibiuna-SP, showed citral and high amounts of another monoterpene, geraniol. Additionally, the essential oils from this population of C. citratus were extracted and analyzed during 24 h (each 3 h, being the major concentration of citral in the night period, indicating that studies which evaluated the chemical differences associated to circadian changes. The components of essential oils were identified through 13C NMR, GC/MS, GC and
Directory of Open Access Journals (Sweden)
A.P.S. Souza Filho
2010-01-01
Full Text Available A alelopatia é um importante mediador de interferências que alteram a dinâmica de espécies de plantas em sistemas agrícolas. Neste trabalho, procurou-se determinar a existência de padrão de respostas das plantas daninhas Mimosa pudica e Senna obtusifolia a espécies da família Poaceae, via interação entre espécies e frações e ordenamento dos efeitos. Bioensaios de germinação de sementes e alongamento da radícula e do hipocótilo foram desenvolvidos, em condições controladas. Os testes foram realizados utilizando-se extratos hidroalcoólicos na concentração de 1,0% das frações folha, raiz e sementes de quatro espécies de Poaceae. Diferenças na intensidade dos efeitos para os fatores espécie e fração foram verificadas. O padrão de atividade observado foi de Paspalum maritimum apresentar as inibições mais intensas. Entre as espécies de Brachiaria, as inibições mais intensas foram produzidas por B. brizantha. Houve resposta efetiva para a especificidade entre espécies e fração para a germinação e alongamento da radícula, especialmente na espécie Mimosa pudica. Apenas para os extratos de P. maritimum foram observadas especificidade e efetividade em relação à germinação de sementes e alongamento da radícula da espécie Senna obtusifolia. A fração folha foi mais efetiva nas inibições, sobretudo na espécie P. maritimum. Comparativamente, a espécie Mimosa pudica foi mais sensível aos efeitos dos extratos, especialmente em relação ao desenvolvimento da radícula e do hipocótilo. A intensidade dos efeitos alelopáticos variou na seguinte ordem: alongamento da radícula > germinação de sementes > alongamento do hipocótilo. A ordenação dos resultados, para os indicadores de inibição, indicou discriminação no padrão para as espécies receptoras, o que sugere especificidade dos extratos.Allelopathy is an important device to measure interferences affecting the dynamics of plant species in
Directory of Open Access Journals (Sweden)
Flávia V. Moreira
2010-12-01
Full Text Available Cymbopogon citratus DC. Stapf, Poaceae, is used in the folk medicine for hypertension treatment. This work investigated the chemical composition and cardiovascular effects in rats of C. citratus essential oil (EOCC. A phytochemical screening demonstrated the presence of eight constituents, being geranial the major compound (43.08%. In rats, EOCC (1, 5, 10, and 20 mg/kg, i.v. induced transient hypotension and bradycardia that were attenuated by atropine and sodium thiopental, but not by L-NAME or indomethacin. In rings of rat superior mesenteric artery pre-contracted with phenylephrine, EOCC (1 to 3000 µg/mL induced relaxation that was not affected after removal of the endothelium, after TEA or in rings pre-contracted with KCl (80 mM. Furthermore, EOCC (1000 µg/mL was not able to induce additional effect on maximal relaxation of nifedipine (10 µM. In conclusions, EOCC induces hypotension, possibly by reduction in vascular resistance caused by inhibition of the Ca2+ influx, and bradycardia probably due to an activation of cardiac muscarinic receptors.C. citratus é utilizada na medicina popular para tratar hipertensão. Este trabalho investigou a composição química e os efeitos cardiovasculares do óleo essencial do C. citratus (OECC. Foram identificados oito constituintes no OECC, sendo geranial o majoritário (43,08%. Em ratos, o OECC (1, 5, 10 e 20 mg/kg, i.v. induziu hipotensão e bradicardia que foram atenuadas pela atropina e tiopental sódico, mas não por L-NAME ou indometacina. Em anéis de artéria mesentérica de ratos pré-contraídos com fenilefrina, o OECC (1 a 3000 µg/mL induziu relaxamento que não foi afetado após remoção do endotélio, após TEA ou em anéis pré-contraídos com KCl (80 mM. Além disso, o OECC (1000 µg/mL não induziu efeito adicional sobre o relaxamento máximo da nifedipina (10 µM. Em conclusão, o OECC induz hipotensão possivelmente devido à redução da resistência vascular que pode ser causada
Directory of Open Access Journals (Sweden)
Marcos R. Furlan
2010-10-01
Full Text Available O óleo essencial extraído de Cymbopogon citratus (DC Staf, Poaceae, é rico em citral sendo amplamente empregado na indústria química e farmacêutica. Os objetivos desse estudo foram avaliar o conteúdo de citral entre populações de C. citratus coletados em duas regiões diferentes (Ibiúna e Pindamonhangaba, Estado de São Paulo. O óleo essencial extraído de uma população cultivada em Pindamonhangaba-SP apresentou uma concentração alta de citral (aproximadamente 96,0%, enquanto que o óleo extraído da população de Ibiúna-SP apresentou, além de citral, proporções elevadas de outro monoterpeno, o geraniol. Adicionalmente, os óleos essenciais obtidos desta população de C. citratus foram extraídos e analisados ao longo de 24 h (a cada 3 h, sendo que o teor de citral foi maior no período da noite, o que mostra a importância de estudos que avaliam as diferenças químicas associadas às mudanças circadianas. Os componentes dos óleos essenciais foram identificados por RMN de 13C, CG/EM e CG através do índice de Kovats.
Genome Evolution in the Genus Sorghum (Poaceae)
PRICE, H. JAMES; DILLON, SALLY L.; HODNETT, GEORGE; ROONEY, WILLIAM L.; ROSS, LARRY; JOHNSTON, J. SPENCER
2005-01-01
• Background and Aims The roles of variation in DNA content in plant evolution and adaptation remain a major biological enigma. Chromosome number and 2C DNA content were determined for 21 of the 25 species of the genus Sorghum and analysed from a phylogenetic perspective.
Bromus interruptus (Hack.) Druce (Poaceae) in Nederland
Rich, Tim C.G.
2001-01-01
Bromus interruptus is a grass which was endemic to England but is now extinct in the wild. Attention is drawn to the two historic records from the Netherlands, where it was probably introduced with agricultural seed, in case it still survives in the wild. It is readily recognised from the contracted
Monograph of Diplachne (Poaceae, Chloridoideae, Cynodonteae).
Snow, Neil; Peterson, Paul M; Romaschenko, Konstantin; Simon, Bryan K
2018-01-01
Diplachne P. Beauv. comprises two species with C 4 (NAD-ME) photosynthesis. Diplachne fusca has a nearly pantropical-pantemperate distribution with four subspecies: D. fusca subsp. fusca is Paleotropical with native distributions in Africa, southern Asia and Australia; the widespread Australian endemic D. f. subsp. muelleri; and D. f. subsp. fascicularis and D. f. subsp. uninervia occurring in the New World. Diplachne gigantea is known from a few widely scattered, older collections in east-central and southern Africa, and although Data Deficient clearly is of conservation concern. A discussion of previous taxonomic treatments is provided, including molecular data supporting Diplachne in its newer, restricted sense. Many populations of Diplachne fusca are highly tolerant of saline substrates and most prefer seasonally moist to saturated soils, often in disturbed areas. Some populations of Diplachne fusca in southern Asia combine nitrogen-fixation, high salinity tolerance and palatibilty to livestock, which should be pursued with further research for purposes of soil reclamation. Diplachne fusca subsp. uninervia is the most invasive of the subspecies and is becoming weedy in some non-native areas, including in the Old World. This monograph provides detailed descriptions of all taxa, a key to the species and subspecies, geographic distributions and information on the anatomy of leaves, stems, lemmatal micromorphology and discussions of the chromosome numbers. Lectotypes are designated for: Atropis carinata Grisb.; Diplachne acuminata Nash; Diplachne capensis (Nees) Nees var. concinna Nees; Diplachne capensis (Nees) Nees var. obscura Nees, Diplachne capensis (Nees) Nees var. prolifera subvar. minor Nees, Diplachne halei Nash, Diplachne maritima E.P. Bicknel, Diplachne muelleri Benth., Diplachne reverchonii Vasey, Diplachne tectoneticola Backer, Leptochloa imbricata Thurb., Leptochloa neuroglossa Peter, Leptochloa uninervia var. typica fo. abbreviata Parodi, Triodia ambigua R. Br. and Triodia parviflora R. Br.
Early inflorescence development in the grasses (Poaceae
Directory of Open Access Journals (Sweden)
Elizabeth A. Kellogg
2013-07-01
Full Text Available The shoot apical meristem of grasses produces the primary branches of the inflorescence, controlling inflorescence architecture and hence seed production. Whereas leaves are produced in a distichous pattern, with the primordia separated from each other by an angle of 180o, inflorescence branches are produced in a spiral in most species. The morphology and developmental genetics of the shift in phyllotaxis have been studied extensively in maize and rice. However, in wheat, Brachypodium, and oats, all in the grass subfamily Pooideae, the change in phyllotaxis does not occur; primary inflorescence branches are produced distichously. It is unknown whether the distichous inflorescence originated at the base of Pooideae, or whether it appeared several times independently. In this study, we show that Brachyelytrum, the genus sister to all other Pooideae has spiral phyllotaxis in the inflorescence, but that in the remaining 3000+ species of Pooideae, the phyllotaxis is two-ranked. These two-ranked inflorescences are not perfectly symmetrical, and have a clear front and back; this developmental axis has never been described in the literature and it is unclear what establishes its polarity. Strictly distichous inflorescences appear somewhat later in the evolution of the subfamily. Two-ranked inflorescences also appear in a few grass outgroups and sporadically elsewhere in the family, but unlike in Pooideae do not generally correlate with a major radiation of species. After production of branches, the inflorescence meristem may be converted to a spikelet meristem or may simply abort; this developmental decision appears to be independent of the branching pattern.
Two New American Species of Hordeum (Poaceae)
DEFF Research Database (Denmark)
Bothmer, Roland Von; Jacobsen, Niels; Bagger Jørgensen, Rikke
1985-01-01
Two new species of Hordeum are described, viz. the diploid H. erectifolium, native to Argentina, and H. guatemalense, native to Guatemala.......Two new species of Hordeum are described, viz. the diploid H. erectifolium, native to Argentina, and H. guatemalense, native to Guatemala....
Distribution of Vulpia species (Poaceae in Poland
Directory of Open Access Journals (Sweden)
Ludwik Frey
2011-01-01
Full Text Available The distribution of four species of the genus Vulpia [V. myuros (L. C.C. Gmel., V. bromoides (L. S.F. Gray, V. ciliata Dumort. and V. geniculata (L. Link] reported in Poland has been studied. Currently, V. myuros and especially V. bromoides are very rare species, and their greatest concentration can be found only in the Lower Silesia region. The number of their localities decreased after 1950 and it seems resonable to include both species in the "red list" of threatened plants in Poland: V. myuros in the EN category, V. bromoides in the CR category. V. ciliata and V. geniculata are very rare ephemerophytes and their localities not confirmed during ca 60 years are of historical interest only.
Karyotype asymmetry in Cynodon Rich. (Poaceae) accessions.
Chiavegatto, R B; Paula, C M P; Souza Sobrinho, F; Benites, F R G; Techio, V H
2016-12-02
Cynodon is a genus of plants with forage potential that has attracted the interest of breeders. These species have high morphological variability in a large number of varieties and cytotypes, hampering identification. This study aimed to determine the karyotype asymmetry index among accessions of Cynodon to discriminate between them. Karyotype symmetry was based on three estimates, which were compared. The basic number for the genus is x = 9. The results of the chromosome count and DNA quantification, respectively, were as follows: two diploid accessions (2n = 2x = 18 and 1.08 ± 0.094 to 1.17 ± 0.036 pg DNA and ± standard deviation), one triploid accession (2n = 3x = 27 and 1.63 ± 0.017 pg DNA), four tetraploid accessions (2n = 4x = 36 and 1.88 ± 0.069 to 2.10 ± 0.07 pg DNA), and one pentaploid accession (2n = 5x = 45 and 2.55 ± 0.098 pg DNA). C. incompletus var. hirsutus had the longest total length of the haploid lot (29.05 µm), with chromosomes that ranged from 1.7 to 6.2 µm in length. On the basis of the karyotype asymmetry indices, the accessions were divided into two groups: 1) C. dactylon var. dactylon, C. transvaalensis, C. dactylon var. polevansii, three accessions of Cynodon sp, and C. nlemfuensis; and 2) C. incompletus var. hirsutus. This is the first description of tetraploidy in C. transvaalensis. The karyotypic data facilitated a determination of the degree of proximity between the accessions.
International Nuclear Information System (INIS)
Ardic, M.; Sezer, O.; Ozgdsd, K.; Yaylaci, O. K.; Koyuncu, O.; Olgun, M.; Bascdftcd, Z. B.; Ayter, N. G.
2015-01-01
The aim of this study is to determine anatomical differences and classification of leaf and leaf cell characteristics (cuticle thickness, upper epidermis thickness, lower epidermis thickness, mesophyll thickness, parenchyma thickness and leaf thickness) between 10 bread wheat cultivars (Triticum aestivum L.) and 10 barley cultivars (Hordeum vulgare L.). Classification of leaf characteristics in bread wheat and barley cultivars and relationship between leaf characteristics are made by principal component and correlation analyses. Highest thickness belongs to W8 Mufitbey cultivar in mesophyll and lower epidermis and W1 Sonmez 01 cultivar have the lowest thickness of upper epidermis in bread wheat. In Barley, B1 Ince cultivar has highest leaf thickness mesophyll and parenchyma; lowest thickness of cuticle is included B7 Cumhuriyet 50 cultivar. All other cultivars have homogenous contents of leaf characteristics. (author)
Taxonomy, Variation, and Relationships in the Hordeum parodii Group (Poaceae)
DEFF Research Database (Denmark)
Von Bothmer, R.; Jacobsen, N.; Bagger Jørgensen, Rikke
1986-01-01
The Hordeum parodii group contains three species, viz. H. parodii Covas (6x), H. tetraploidum Covas (4x), and H. fuegianum Bothmer, Jacobsen, et Jorgensen, sp. nov. (4x). The former two species mainly occur in C and S Argentina, while H. fuegianum is native to Tierra del Fuego. All three species...
Cynodon dactylon (L) Pers (Poaceae) root extract induces apoptotic ...
African Journals Online (AJOL)
has also been used for the treatment of weak vision, urinary tract infection, .... with an alternating 12 h dark/light cycle in ... detected by Western blot analysis as described previously .... the cyclin signaling pathways, induced apoptotic cell death ...
In vitro anthelmintic and cytotoxicity activities the Digitaria insularis (Poaceae).
Santos, Francianne Oliveira; de Lima, Hélimar Gonçalves; de Souza Santos, Nathália Silva; Serra, Taiane Menezes; Uzeda, Rosângela Soares; Reis, Isabella Mary Alves; Botura, Mariana Borges; Branco, Alexsandro; Batatinha, Maria José Moreira
2017-10-15
This study aimed to evaluate the in vitro activity of D. insularis extracts and fractions against gastrointestinal nematodes of goats and its cytotoxicity on Vero cells. The egg hatch (EHT) and larval motility (LMT) tests were conducted to investigate the anthelmintic effects of the crude hydroethanolic (CH), ethyl acetate (EA), butanolic (BT) and residual hydroethanolic (RH) extracts. The elution of the active extract (EA) on column chromatography (SiO 2 ) using organic solvents furnished six fractions (FR1 to FR6), which were also tested. Cytotoxicity was determined using 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide (MTT) and Trypan Blue exclusion assays. All extracts, FR2 and FR3, inhibited egg hatching in a concentration-dependent manner. The EHT led to EC 50 values (effective concentration 50%) of 0.64; 0.69; 0.77; 0.96; 0.27 and 0.65mg/mL for CH, EA, BT, RH, FR2 and FR3, respectively. However, the extracts exhibited low effect on the motility of L 3. In the cytotoxicity evaluation (MTT assay), the IC 50 (inhibitory concentration 50%) was 1.18 (EA), 1.65 (FR2) and 1.59mg/mL (FR3), which was relatively high (low toxicity) in comparison to the EC 50 values in EHT, mainly for FR2. The chemical analyses of most active fractions (FR2) by Liquid Chromatography coupled to Mass Spectrometry (LC-MS) led the characterization of the flavones tricin and diosmetin. These results showed the high anthelmintic effect and low cytotoxicity of D. insularis and also that the flavones can be probably responsible for the nematocidal activity of this plant. Copyright © 2017 Elsevier B.V. All rights reserved.
Genomic homeology between Pennisetum purpureum and Pennisetum glaucum (Poaceae
Directory of Open Access Journals (Sweden)
Gabriela Barreto dos Reis
2014-08-01
Full Text Available The genus Pennisetum (Richard, 1805 includes two economically important tropical forage plants: Pennisetum purpureum (Schumacher, 1827 (elephant grass, with 2n = 4x = 28 chromosomes and genomes A'A'BB, and Pennisetum glaucum (Linnaeus, 1753 (pearl millet, with 2n = 2x = 14 chromosomes and genomes AA. The genetic proximity between them allows obtaining hybrids (2n = 3x = 21 that yield forage of higher quality in relation to the parents. The study of genomic relationships provides subsidies for the knowledge about phylogenetic relations and evolution, and is useful in breeding programs seeking gene introgression. Concerning elephant grass and pearl millet, the homeology between the genomes A and A', and between these and the genome B, has been reported by conventional cytogenetic techniques. The objective of the present study was to demonstrate the degree of homeology between these genomes by means of genomic in situ hybridization (GISH. The results confirmed the homeology between the genomes A of pearl millet and A'B of elephant grass, and showed that there are differences in the distribution and proportion of homologous regions after hybridization. Discussion regarding the evolutionary origin of P. purpureum and P. glaucum was also included.
Ecological Genetics of Vernalization Response in Bromus tectorum L. (Poaceae)
MEYER, SUSAN E.; NELSON, DAVID L.; CARLSON, STEPHANIE L.
2004-01-01
• Background and Aims Bromus tectorum (cheatgrass or downy brome) is an exotic annual grass that is dominant over large areas of former shrubland in western North America. To flower in time for seed production in early summer, B. tectorum plants generally require vernalization at winter temperatures, either as imbibed seeds or as established seedlings. • Methods Variation in response to increasing periods of vernalization as seeds or seedlings for progeny of ten full‐sib families from each of four B. tectorum populations from contrasting habitats was studied. • Key Results As vernalization was increased from 0 to 10 weeks, the proportion of plants flowering within 20 weeks increased, weeks to initiation of flowering decreased, and seed yield per plant increased, regardless of whether plants were vernalized as seeds or seedlings. Most of the variation was accounted for by differences among populations. Plants of the warm desert population flowered promptly even without vernalization, while those of the cold desert, foothill and montane populations showed incremental changes in response variables as a function of vernalization period. Populations differed in among‐family variance, with the warm desert population generally showing the least variance and the cold desert population the most. Variation among populations and among families within populations decreased as vernalization period increased, whereas the non‐genetic component of variance showed no such pattern. • Conclusions Variation in vernalization response was found to be adaptively significant and apparently represents the result of contrasting selection regimes on a range of founder genotypes. PMID:15087300
Sequencing and De Novo Transcriptome Assembly of Brachypodium sylvaticum (Poaceae
Directory of Open Access Journals (Sweden)
Samuel E. Fox
2013-03-01
Full Text Available Premise of the study: We report the de novo assembly and characterization of the transcriptomes of Brachypodium sylvaticum (slender false-brome accessions from native populations of Spain and Greece, and an invasive population west of Corvallis, Oregon, USA. Methods and Results: More than 350 million sequence reads from the mRNA libraries prepared from three B. sylvaticum genotypes were assembled into 120,091 (Corvallis, 104,950 (Spain, and 177,682 (Greece transcript contigs. In comparison with the B. distachyon Bd21 reference genome and GenBank protein sequences, we estimate >90% exome coverage for B. sylvaticum. The transcripts were assigned Gene Ontology and InterPro annotations. Brachypodium sylvaticum sequence reads aligned against the Bd21 genome revealed 394,654 single-nucleotide polymorphisms (SNPs and >20,000 simple sequence repeat (SSR DNA sites. Conclusions: To our knowledge, this is the first report of transcriptome sequencing of invasive plant species with a closely related sequenced reference genome. The sequences and identified SNP variant and SSR sites will provide tools for developing novel genetic markers for use in genotyping and characterization of invasive behavior of B. sylvaticum.
Ecological genetics of floret mass variation in Bromus tectorum (Poaceae)
Susan E. Meyer
2010-01-01
Bromus tectorum L. (cheatgrass, downy brome) is a highly invasive inbreeding annual grass that dominates millions of hectares of former shrubland in interior western North America. Factors contributing to its success include strong genetic regulation of key adaptive traits coupled with high phenotypic plasticity in response to resource availability (Meyer and Allen...
Aira (Poaceae: a new generic record for Nicobar Islands, India
Directory of Open Access Journals (Sweden)
Kumar Vinod Chhotupuri Gosavi
2016-06-01
Full Text Available During plant exploration of Andaman and Nicobar in 2014, we were collected some interesting grass specimens from Kamorta Islands of Nicobar. After critical study and taxonomic analysis the unidentified grass species has identified as an Aira caryophyllea L. Perusals of relevant literature were revealed that, the genus Aira L. has so far not reported from Andaman and Nicobar islands. Hence, it is reported in present communication for new record to the Andaman and Nicobar Islands.
Nature of ergastic substances in some Poaceae seeds
African Journals Online (AJOL)
ajl yemi
2011-08-29
Aug 29, 2011 ... 1Department of Botany, University of Benin, PMB 1154, Benin City, Edo State, Nigeria. 2Department of Botany, Ambrose Alli University, PMB. 14, Ekpoma, Edo State, Nigeria. Accepted 6 May, 2011 ... grasses) contribute more food seeds than any other plant family; it contributes about 50% per capita energy ...
Chloroplasts in anther endothecium of Zea mays (Poaceae).
Murphy, Katherine M; Egger, Rachel L; Walbot, Virginia
2015-11-01
Although anthers of Zea mays, Oryza sativa, and Arabidopsis thaliana have been studied intensively using genetic and biochemical analyses in the past 20 years, few updates to anther anatomical and ultrastructural descriptions have been reported. For example, no transmission electron microscopy (TEM) images of the premeiotic maize anther have been published. Here we report the presence of chloroplasts in maize anthers. TEM imaging, electron acceptor photosynthesis assay, in planta photon detection, microarray analysis, and light and fluorescence microscopy were used to investigate the presence of chloroplasts in the maize anther. Most cells of the maize subepidermal endothecium have starch-containing chloroplasts that do not conduct measurable photosynthesis in vitro. The maize anther contains chloroplasts in most subepidermal, endothecial cells. Although maize anthers receive sufficient light to photosynthesize in vivo and the maize anther transcribes >96% of photosynthesis-associated genes found in the maize leaf, no photosynthetic light reaction activity was detected in vitro. The endothecial cell layer should no longer be defined as a complete circle viewed transversely in anther lobes, because chloroplasts are observed only in cells directly beneath the epidermis and not those adjacent to the connective tissue. We propose that chloroplasts be a defining characteristic of differentiated endothecial cells and that nonsubepidermal endothecial cells that lack chloroplasts be defined as a separate cell type, the interendothecium. © 2015 Botanical Society of America.
Micropropagation of Guadua angustifolia Kunth (Poaceae) using a ...
African Journals Online (AJOL)
Universidad del Quindio
2016-07-13
Jul 13, 2016 ... develop an application for RITA® for use in the commercial production of G. angustifolia. Key words: Giant .... Data were analyzed using a random block design with 20 replicates ..... Gray D (eds) Plant Tissue Culture Concepts and Laboratory ... A (eds) Current Issues in Plant Molecular and Cellular Biology,.
7 CFR 201.56-5 - Grass family, Poaceae (Gramineae).
2010-01-01
... ACT FEDERAL SEED ACT REGULATIONS Germination Tests in the Administration of the Act § 201.56-5 Grass.... During germination the scutellum remains inside the seed to absorb nutrients from the endosperm and... with the endosperm. During germination the scutellum remains inside the seed to absorb nutrients from...
Nature of ergastic substances in some Poaceae seeds
African Journals Online (AJOL)
ajl yemi
2011-08-29
Aug 29, 2011 ... 1Department of Botany, University of Benin, PMB 1154, Benin City, Edo State, Nigeria. ... Since seed is the storage organs of ergastic materials such as .... Ultrastructure and Development of Silica Bodies in Monocotyledons.
Palynological studies in tribe Chlorideae (Poaceae) from salt range ...
African Journals Online (AJOL)
Jane
2011-08-15
Aug 15, 2011 ... To determine pollen fertility, acetocarmine and glycerin jelly was used by the modified techniques used by Khan and Stace (1999). Anthers were squashed .... World. Kew bulletin additional series 13, Royal Botanic gardens,. Kew. p. 389. Edeoga HO, Okoli BE (1996). Apomictic behaviour in Costus after C.
LAS ESPECIES DE MUHLENBERGIA (POACEAE: CHLORIDOIDEAE DE ARGENTINA
Directory of Open Access Journals (Sweden)
Peterson Paul
2011-06-01
Full Text Available Se presenta un estudio taxonómico de las especies nativas argentinas del géneroMuhlenbergia, basado en el análisis de los especímenes depositados en 48 herbarios.Se analizan diversos aspectos relativos a la clasifi cación, la nomenclatura y lavariación morfológica de los caracteres. Muhlenbergia está representado enArgentina por 18 especies nativas. Se proporcionan claves para reconocer lasespecies presentes en el país, así como también descripciones de éstas, sinónimos,ilustraciones, distribución geográfica y algunos comentarios morfológicos yecológicos. Muhlenbergia breviaristata (Hack. Parodi y Muhlenbergia holwayorumHitchc., se reducen como sinónimos del híbrido Muhlenbergia angustata (J. PreslKunth × M. rigida (Kunth Kunth. Muhlenbergia diversiglumis Trin. se cita porprimera vez para la Argentina. Por otra parte, las especies Muhlenbergia tenella(Kunth Trin. y Muhlenbergia tenuissima (J. Presl Kunth se excluyen de la fl orade Argentina.
Novedades nomenclaturales en Cenchrus s.l. (Poaceae: Panicoideae: Paniceae)
Gutiérrez, Hugo F; Morrone, Osvaldo
2012-01-01
Recientes estudios filogenéticos con datos morfológicos y moleculares aportaron evidencia sobre la monofilia de los géneros Cenchrus, Pennisetum y Odontelytrum y, por ello, se propuso su unificación y transferencia a Cenchrus, el cual tiene prioridad. Resultados preliminares de la revisión taxonómica del género Cenchrus s.l. para América (Gutiérrez, en preparación) permitieron detectar problemas nomenclaturales. Para resolver dichos inconvenientes, en el presente trabajo se presentan nueve le...
What is Cynodon radiatus Roth ex R. & S. (Poaceae)?
Nowack, R.
1992-01-01
Roemer and Schultes (1817) described Cynodon radiatus, basing themselves on a manuscript by A.W. Roth, copying Roth's brief diagnosis and comment. It was compared to Cynodon dactylon, differing by its larger habit, the number and direction of the spikes, and the glabrous blades and sheaths. This was
Micropropagation of Guadua angustifolia Kunth (Poaceae) using a ...
African Journals Online (AJOL)
The micropropagation of Guadua angustifolia Kunth, commonly known as giant bamboo, using semisolid culture medium, is reported to have low multiplication rates. This study evaluated the multiplication index of G. angustifolia in a temporary immersion system (RITA®), comparing results with those obtained using a ...
Morphophysiological and chemical aspects of torpedograss (Panicum repens L., Poaceae
Directory of Open Access Journals (Sweden)
Simone Meredith Scheffer-Basso
2007-09-01
Full Text Available This work evaluated some of the morphophysiological and bromatological aspects of torpedograss (Panicum repens L. through the quantification of accumulation, allocation and chemical composition of dry matter (DM during spring-summer. Four destructive harvests of aerial and underground parts were carried out on 23 October 2003, 3 December 2003, 22 January 2004 and 20 February 2004, corresponding to 31, 73, 123 and 152 days after the start of the spring. In these harvests, the DM accumulation was respectively 1,650; 4,470; 10,900 and 14,540 kg/ha in the aerial part, with leaf percentages between 45% (first harvest and 35% (last harvest. The crude protein (CP, neutral detergent fiber (NDF and acid detergent fiber (ADF changed between the first and the last harvest, from 9.9 to 7% (CP, 63.9% to 70.3% (FDN, and 37% to 40.8% (FDA, in samples composed by leaves, culms, inflorescences and stolons. The DM allocation to rhizomes (Rh, roots (R, leaves (L, culms+stolons (C and inflorescences (I changed, between the first and the last harvest, from 42 to 19% (Rh, 10 to 7% (R, 22 to 27% (L, 25 to 44% (C, and 0 to 2% (I.
The Mediterranean: the cradle of Anthoxanthum (Poaceae) diploid diversity
Czech Academy of Sciences Publication Activity Database
Chumová, Zuzana; Záveská, E.; Mandáková, T.; Krak, Karol; Trávníček, Pavel
2017-01-01
Roč. 120, č. 2 (2017), s. 285-302 ISSN 0305-7364 Institutional support: RVO:67985939 Keywords : Antoxanthum * rDNA FISH * incomplete lineage sorting Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 4.041, year: 2016
Directory of Open Access Journals (Sweden)
Vânia Helena Techio
2008-07-01
Full Text Available Avaliou-se o complemento cromossômico de 16 acessos de Pennisetum disponíveis na Coleção de Germoplasma da Embrapa Gado de Leite – Juiz de Fora, Estado de Minas Gerais. Para a avaliação citogenética, utilizou-se a técnica de esmagamento e coloração com Feulgen. Paraquatro acessos foram obtidas metáfases com 2n = 28 cromossomos, confirmando sua classificação como P. purpureum. A origem híbrida P. purpureum x P. glaucum foi constatada em oito acessos, os quais apresentaram 2n = 21. Em um acesso identificado como híbrido entre P.purpureum x P. glaucum, foram observadas metáfases com 2n = 54, permitindo inferir que não se trata de um híbrido interespecífico triplóide. Para outros três acessos avaliados, também foramobservadas células com 2n = 54, embora estivessem identificados como híbridos entre P. purpureum x espécie selvagem; P. glaucum policross x hexaplóide 200 e P. glaucum x [F92-161-01 (P. purpureum x P. glaucum].The chromosome complement of 16 Pennisetum accessions belonging to the Germplasm Collection of Embrapa Gado de Leite - Juiz de Fora, Minas Gerais State was evaluated. The cytogenetic analysis employed the smear technique and staining with Feulgen. In four accessions,metaphases with 2n = 28 chromosomes were obtained, confirming their classification as P. purpureum. The hybrid origin P. purpureum x P. glaucum was observed in eight accessions, which presented 2n = 21. In an accession identified as P. purpureum x P. glaucum hybrid, metaphases with 2n = 54 were observed, suggesting that it is not a triploid interspecific hybrid. For three other evaluated accessions, cells with 2n=54 were also observed, although they were identified ashybrids between P. purpureum x wild species; P. glaucum polycross x hexaploid 200 and P. glaucum x [F92-161-01 (P. purpureum x P. glaucum].
Directory of Open Access Journals (Sweden)
J. Escarião da Nóbrega Jr
2006-12-01
Full Text Available Descreve-se um surto de intoxicação por Sorghum halepense (L. Pers. no município de Santa Luzia, semi-árido da Paraíba. Nove bovinos foram colocados numa pastagem com S. halepense em fase de rebrota, com 25-30cm de altura, 15 dias após as primeiras chuvas. Sinais clínicos de dispnéia, ansiedade, tremores musculares e incoordenação apareceram 10-15 minutos após a ingestão. Dois animais morreram em um período aproximado de 3 horas. Na necropsia observaram-se congestão e cianose das mucosas, musculatura escura, pulmão com pontos hemorrágicos e edema, além de folhas da planta no rúmen. A planta foi positiva no teste do papel picrosódico. Mudas de S. halepense coletadas no Município de Currais Novos, Rio Grande do Norte, onde havia históricos de uma intoxicação semelhante, foram plantadas em vasos e realizado o teste de papel picrosódico a cada 15 dias. A planta foi positiva para HCN durante todos os estágios, sendo que nos primeiros 45 dias a reação ocorreu dentro de 1 minuto e, posteriormente, em até 3 minutos. Trinta dias após ter sido plantada, a planta de um dos vasos foi administrada a um caprino causando sinais característicos de intoxicação cianídrica na dose de 11,8g/kg de peso do animal. O caprino se recuperou após tratamento com uma solução de tiossulfato de sódio a 20% na dose de 5mL/10kg. No semi-árido, S. halepense é freqüentemente encontrado como invasora em beiras de açudes e culturas irrigadas, sendo utilizado como forrageira, na época seca, em áreas de vazante.An outbreak of poisoning by Sorghum halepense (L. Pers. in cattle in the Brazilian semiarid is reported. Nine cattle were introduced 15 days after the first rains into a paddock where the plant was sprouting and had 25-30cm high. Clinical signs of dyspnea, anxiety, muscular tremors and incoordination appeared 15 minutes after the animals began to graze. Two of them died within about 3 hours. The others recovered. Cyanotic mucosa, dark muscles, lung edema and hemorrhages, and leaves of the plant in the rumen were observed at necropsy. The plant was positive for the picrosodic paper test. S. halepense from another farm of occurrence of the poisoning was transplanted into two pots. The picrosodic paper test was performed fortnightly in the plants growing in one of them. The plant was positive for cyanide in all growth stages; during the first 45 days the test was positive within 1 minute, but after day 60 within 3 minutes. Thirty days after the plant had been transplanted into one of the pots, it was administered to a goat at a dose of 11.8g/kg, causing clinical signs of HCN poisoning. The animal recovered after the intravenous administration of 5mL/10kg body weight of a 20% sodium thiosulfate solution. In the Brazilian semiarid S. halepense is frequently found invading the border of ponds and irrigated crops, and is used as forage during the dry season.
Directory of Open Access Journals (Sweden)
E. A. Bondarevich
2015-03-01
Full Text Available В работе рассмотрены особенности видового состава редких растительных сообществ с участием Melica virgata Turcz. ex Trin. (Poaceae. При сравнении с ранее известными данными по фитоценозам Монголии с участием этого вида выяснилось, что состав их значительно отличается. Также для фитоценозов из Восточного Забайкалья характерен уникальный видовой состав (заросли трех видов рода Rhamnus: R. davurica, R. erythroxylon, R. pissjaukovae + Ulmus pumila, с высоким проективным покрытием Melica virgata и участием крайне редкого вида для региона – Artemisia rutifolia, представленный на крайне ограниченной территории в бассейне реки Чикой (у с. Усть-Урлук. Сохранение комплекса видов требует создание охраняемой территории и включение в её состав нескольких наиболее ценных участков.
Butterfield, Bradley J.; Wood, Troy E.
2015-01-01
Efforts to improve the diversity of seed 18 resources for important restoration species has become a high priority for land managers in many parts of the world. Relationships between functional trait values and the environment from which seed sources are collected can provide important insights into patterns of local adaptation and guidelines for seed transfer. However, little is known about which functional traits exhibit genetic differentiation across populations of restoration species and thus may contribute to local adaptation. Here, we report the results of a common garden experiment aimed at assessing genetic (including ploidy level) and environmental regulation of several functional traits among populations of Bouteloua gracilis, a dominant C4 grass and the most highly utilized restoration species across much of the Colorado Plateau. We found that leaf size and specific leaf area (SLA) varied significantly among populations, and were strongly correlated with the source population environment from which seeds were collected. However, variation in ploidy level had no significant effect on functional traits. Leaves of plants grown from commercial seed releases were significantly larger and had lower SLA than those from natural populations, a result that is concordant with the overall relation between climate and these two functional traits. We suggest that the patterns of functional trait variation shown here may extend to other grass species in the western USA, and may serve as useful proxies for more extensive genecology research. Furthermore, we argue that care should be taken to develop commercial seed lines with functional trait values that match those of natural populations occupying climates similar to target restoration sites.
Huang, Chao-Li; Ho, Chuan-Wen; Chiang, Yu-Chung; Shigemoto, Yasumasa; Hsu, Tsai-Wen; Hwang, Chi-Chuan; Ge, Xue-Jun; Chen, Charles; Wu, Tai-Han; Chou, Chang-Hung; Huang, Hao-Jen; Gojobori, Takashi; Osada, Naoki; Chiang, Tzen-Yuh
2014-01-01
Young incipient species provide ideal materials for untangling the process of ecological speciation in the presence of gene flow. The Miscanthus floridulus/sinensis complex exhibits diverse phenotypic and ecological differences despite recent divergence (approximately 1.59million years ago). To elucidate the process of genetic differentiation during early stages of ecological speciation, we analyzed genomic divergence in the Miscanthus complex using 72 randomly selected genes from a newly assembled transcriptome. In this study, rampant gene flow was detected between species, estimated as M=3.36x10(-9) to 1.20x10(-6), resulting in contradicting phylogenies across loci. Nevertheless, beast analyses revealed the species identity and the effects of extrinsic cohesive forces that counteracted the non-stop introgression. As expected, early in speciation with gene flow, only 3-13 loci were highly diverged; two to five outliers (approximately 2.78-6.94% of the genome) were characterized by strong linkage disequilibrium, and asymmetrically distributed among ecotypes, indicating footprints of diversifying selection. In conclusion, ecological speciation of incipient species of Miscanthus probably followed the parapatric model, whereas allopatric speciation cannot be completely ruled out, especially between the geographically isolated northern and southern M.sinensis, for which no significant gene flow across oceanic barriers was detected. Divergence between local ecotypes in early-stage speciation began at a few genomic regions under the influence of natural selection and divergence hitchhiking that overcame gene flow.
DEFF Research Database (Denmark)
Tristan Djajadi, Demi; Hansen, Aleksander R.; Jensen, Anders
2017-01-01
physical and chemical features of the biomass surfaces, specifically contact angle measurements (wettability) and attenuated total reflectance-Fourier transform infrared (ATR-FTIR) spectroscopy (surfacebiopolymer composition) produced data correlating pretreatment severity and enzymatic digestibility......, and they also revealed differences that correlated to enzymatic glucose yield responses among the three different biomass types. Conclusion: The study revealed that to a large extent, factors related to physico-chemical surface properties, namely surface wettability as assessed by contact angle measurements...
Directory of Open Access Journals (Sweden)
R. P. Ellis
1984-12-01
Full Text Available The leaf blade anatomy of Peniameris macrocalycina (Steud. Schweick. and P. obtusifolia (Hochst, Schweick. is described and illustrated. The leaf anatomy of these two species shows many similarities suggesting a close relationship between them. A slight problem appears to exist with the circumscription of P. obtusifolia and a minor taxonomic adjustment may result in a classification which agrees totally with that based on leaf anatomy. This would result in details of the leaf outline being diagnostic for these two taxa. The nomenclature of P. obtusifolia is also very confusing and clarification is needed by reference to the relevant type specimens. P. macrocalycina and P. obtusifolia together with P. longiglumis (Nees Stapf, appear to form a distinct genus and do not bear close anatomical resemblances to either P. thuarri Beauv. or P. dregeana Stapf.
Additions to the grasses (Poaceae of Telangana from Kawal Tiger Reserve, Adilabad District, India
Directory of Open Access Journals (Sweden)
Alok Chorghe
2015-07-01
Full Text Available Three species of grasses viz., Dimeria orissae, Iseilema holei and Spodiopogon rhizophorus are being reported for the first time as new distributional records to Telangana from the Kawal Tiger Reserve. Detailed description and illustrations are provided here.
Czech Academy of Sciences Publication Activity Database
Nie, X.; Li, B.; Wang, L.; Liu, P.; Biradar, S. S.; Li, T.; Doležel, Jaroslav; Edwards, D.; Luo, M.; Weining, S.
2012-01-01
Roč. 99, č. 9 (2012), e369-e371 ISSN 0002-9122 Institutional research plan: CEZ:AV0Z50380511 Keywords : chromosome-arm-specific DNA * flow-sorted chromosomes * next-generation sequencing Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.586, year: 2012
Bibb, Jenny L; Cook, Donald; Catchot, Angus; Musser, Fred; Stewart, Scott D; Leonard, Billy Rogers; Buntin, G David; Kerns, David; Allen, Tom W; Gore, Jeffrey
2018-05-28
Corn earworm, Helicoverpa zea (Boddie), commonly infests field corn, Zea mays (L.). The combination of corn plant biology, corn earworm behavior in corn ecosystems, and field corn value renders corn earworm management with foliar insecticides noneconomical. Corn technologies containing Bacillus thuringiensis (Bt) Berliner (Bacillales: Bacillaceae) were introduced that exhibit substantial efficacy against corn earworm and may reduce mycotoxin contamination in grain. The first generation Bt traits in field corn demonstrated limited activity on corn earworm feeding on grain. The pyramided corn technologies have greater cumulative protein concentrations and higher expression throughout the plant, so these corn traits should provide effective management of this pest. Additionally, reduced kernel injury may affect physical grain quality. Experiments were conducted during 2011-2012 to investigate corn earworm impact on field corn yield and grain quality. Treatments included field corn hybrids expressing the Herculex, YieldGard, and Genuity VT Triple Pro technologies. Supplemental insecticide treatments were applied every 1-2 d from silk emergence until silk senescence to create a range of injured kernels for each technology. No significant relationship between the number of corn earworm damaged kernels and yield was observed for any technology/hybrid. In these studies, corn earworm larvae did not cause enough damage to impact yield. Additionally, no consistent relationship between corn earworm damage and aflatoxin contamination was observed. Based on these data, the economic value of pyramided Bt corn traits to corn producers, in the southern United States, appears to be from management of other lepidopteran insect pests including European and southwestern corn borer.
Ultraestructura del bambú Guadua macclurei (Poaceae: Bambusoideae de Costa Rica
Directory of Open Access Journals (Sweden)
Mayra Montiel
2006-06-01
Full Text Available Se evaluaron ultraestructuralmente secciones de la lámina de la hoja, vaina de la hoja y rama, de una planta adulta de Guadua macclurei. Las brácteas del culmo carecen de setas orales. En la superficie adaxial de la lámina foliar se observó un patrón celular diferente al de otras especies de este género. Además, hay tricomas tricelulares y bandas de estomas de alto domo muy ordenadas y evidentes, característica que la podría diferenciar de otras especies en el género. Esta es la primera descripción microscópica de esta especie.We studied the ultrastructure of sections of leaf lamina, leaf sheath and branches of an adult plant of Guadua macclurei. Culm sheaths lack fimbriae (oral setae. The adaxial section of the leaf lamina has a particular cellular pattern, previously unreported in this genus. The tricellular trichomes, and the evident and ordered bands of high dome stomata may be useful for taxonomic purposes. To the best of our knowledge, this is the first microscopic description of this species. Rev. Biol. Trop. 54(Suppl. 2: 35-42. Epub 2006 Dec. 01.
Leaf anatomy of the genus Ehrharta (Poaceae in southern Africa: the Setacea group
Directory of Open Access Journals (Sweden)
R. P. Ellis
1987-10-01
Full Text Available The leaf blade anatomy of the taxa of the Setacea group of species of the genus Ehrharta is described and illustrated. This group includes E. rupestris Nees ex Trin. subsp. rupestris, subsp. tricostata (Stapf Gibbs Russell and subsp. dodii (Stapf Gibbs Russell, as well as E. setacea Nees subsp. setacea, subsp. scabra (Stapf Gibbs Russell, subsp. uniflora (Burch, ex Stapf Gibbs Russell and subsp. disticha Gibbs Russell. All these taxa share a very characteristic leaf anatomy with inrolled or infolded leaves without keels and have adaxial ribs with interlocking prickles. The chlorenchyma is dense and compact with inwardly projecting invaginations visible in all taxa except E. setacea subsp. setacea. In E . setacea subsp. scabra typical arm cells are present. Abaxial costal and intercostal zones are not differentiated and stomata are absent. The long cells are hexagonal or inflated with sinuous walls. Silica bodies are single or paired and rounded in shape. Small hook-like prickles with short barbs are common. Microhairs with a short, truncated distal cell occur. This leaf anatomical structure differs considerably from that of the other species groups recognized in African Ehrharta and the Setacea group appears to be more distinct from the other groups than they are from each other.
A new species of Otatea (Poaceae: Bambusoideae: Bambuseae) from Querétaro, Mexico
Ruiz-Sánchez, Eduardo
2012-01-01
Based on recent systematic studies of the genus Otatea, that included an extensive taxonomic investigation of herbaria specimens, and recent fieldwork in the Mexican state of Querétaro, a new Otatea species, O. ramirezii, is here described and illustrated. The new species is endemic to the Sierra Gorda in Querétaro, Mexico. It is compared with Otatea acuminata, O. carrilloi and O. glauca, from which it can be separated by the presence of only one (rarely two) branches per node, erect culm lea...
Directory of Open Access Journals (Sweden)
Vânia Helena Techio
2006-01-01
Full Text Available The cultivated and sexually compatible species Pennisetum purpureum (elephant grass, 2n = 4x = 28 and Pennisetum glaucum (pearl millet, 2n = 2x = 14 can undergo hybridization which favors the amplification of their genetic background and the introgression of favorable alleles into breeding programs. The main problem with interspecific hybrids of these species is infertility due to triploidy (2n = 3x = 21. This study describes meiosis in elephant grass x pearl millet hybrids and their progenitors. Panicles were prepared according to the conventional protocol for meiotic studies and Alexander’s stain was used for assessing pollen viability. Pearl millet accessions presented regular meiosis with seven bivalents and high pollen viability. For elephant grass, 14 bivalents in diakinesis and metaphase I were observed. The BAG 63 elephant grass accession, derived from tissue culture, presented a high frequency of meiotic abnormalities. The three hybrid accessions presented a high frequency of abnormalities characterized by irregular chromosomal segregation which resulted in the formation of sterile pollen.
Nota sobre el género Imperata (Poaceae, Panicoideae, Sacchareae) en Argentina
Peichoto, Myriam Carolina
2017-01-01
En este trabajo se confirma la presencia de Imperata tenuis en Argentina. Se presenta una ilustración, material de referencia y un mapa de su distribución geográfica en el sur de Sudamérica. Se incluye una clave para identificar las especies del género Imperata presentes en la Argentina. This work confirms the presence of Imperata tenuis in Argentina, and includes an illustration, reference material, a map showing its geographic distribution in southern South America, and a key to identi...
Phylogeny and biogeography of North-American wild rice (Zizania L.Poaceae)
The wild-rice genus Zizania includes four species disjunctly distributed in eastern Asia and North America, with three species (Z. aquatica, Z. palustris, and Z. texana) in North America and one (Z. latifolia) in eastern Asia. The phylogeny and biogeography of Zizania were explored using sequences o...
DNA barcoding of western North American taxa: Leymus (Poaceae) and Lepidium (Brassicaceae)
Catherine Mae Culumber
2007-01-01
My objective was to determine if polymorphic information from the 18S-5.8S-26S nuclear ribosomal DNA internal transcribed spacer regions and the trnK-psbA, trnK-rps16 chloroplast DNA spacer regions is sufficient 1) to identify a plant specimen to the species level, and 2) to establish the phylogenetic relationship between species. The first study examined the...
Geographical distribution of present day Poaceae as evidence for the origin of African floras
Directory of Open Access Journals (Sweden)
W. D. Clayton
1983-11-01
Full Text Available The major tribes and sub-families of grasses occupy worldwide latitudinal belts, which can be related to an evolutionary sequence of climatic adaptations. However, genera tend to be confined to individual continents, suggesting that grasses do not easily cross the oceans, and that the worldwide distribution of the family may have been achieved when the continents were closer together. Species distributions are likewise strongly influenced by the effect of climatic adaptation and continental isolation, but they show a number of aberrations. These are probably a legacy of climatic disturbance during the Pleistocene.
Directory of Open Access Journals (Sweden)
Yajuan Cheng
2016-07-01
Full Text Available The species within the Lolium/Festuca grass complex have dispersed and colonized large areas of temperate global grasslands both naturally and by human intervention. The species within this grass complex represent some of the most important grass species both for amenity and agricultural use worldwide. There has been renewed interest by grass breeders in producing hybrid combinations between these species and several countries now market Festulolium varieties as a combination of genes from both genera. The two genera have been differentiated by their inflorescence structure, but controversy has surrounded the taxonomic classification of the Lolium-Festuca complex species for several decades. In order to better understand the complexities within the Lolium/Festuca complex and their genetic background, the phylogeny of important examplers from the Lolium-Festuca complex were reconstructed. In total 40 taxa representing the Festuca and Lolium species with Vulpia myuros and Brachypodium distachyon as outgroups were sampled, using two noncoding intergenic spacers (trnQ-rps16, trnH-psbA and one coding gene (rbcL. Maximum parsimony (MP, Bayesian inference (BI analyses based on each partition and combined plastid DNA dataset, and median-jointing network analysis were employed. The outcomes strongly suggested that the subgen. Schedonorus has a close relationship to Lolium, and it is also proposed to move the sect. Leucopoa from subgen. Leucopoa to Subgen. Schedonorus and to separate sect. Breviaristatae from the subgen. Leucopoa. We found that F. californica could be a lineage of hybrid origin because of its intermediate placement between the broad-leaved and fine-leaved clade.
Arias-Trinidad, Alfredo; Rivera-Cruz, María del Carmen; Roldán-Garrigós, Antonio; Aceves-Navarro, Lorenzo Armando; Quintero-Lizaola, Roberto; Hernández-Guzmán, Javier
2017-03-01
The oil industry has generated chronic oil spills and their accumulation in wetlands of the state of Tabasco, in Southeastern Mexico. Waterlogging is a factor that limits the use of remediation technologies because of its high cost and low levels of oil degradation. However, Leersia hexandra is a grass that grows in these contaminated areas with weathered oil. The aim of the study was to evaluate the bacteria density, plant biomass production and phytoremediation of L. hexandra in contaminated soil. For this, two experiments in plastic tunnel were performed with fresh (E1) and weathered petroleum (E2) under waterlogging experimental conditions. The E1 was based on eight doses: 6 000, 10 000, 30 000, 60 000, 90 000, 120 000, 150 000 and 180 000 mg.kg-1 dry basis (d. b.) of total petroleum hydrocarbons fresh (TPH-F), and the E2, that evaluated five doses: 14 173, 28 400, 50 598, 75 492 and 112 142 mg. kg-1 d. b. of total petroleum hydrocarbons weathered (TPH-W); a control treatment with 2 607 mg.kg-1 d. b. was used. Each experiment, with eight replicates per treatment, evaluated after three and six months: a) microbial density of total free-living nitrogen-fixing bacteria (NFB) of Azospirillum (AZP) and Azotobacter group (AZT), for viable count in serial plate; b) dry matter production (DMP), quantified gravimetrically as dry weight of L. hexandra; and c) the decontamination percentage of hydrocarbons (PDH) by Soxhlet extraction. In soil with TPH-F, the NFB, AZP y AZT populations were stimulated five times more than the control both at the three and six months; however, concentrations of 150 000 and 180 000 mg.kg-1 d. b. inhibited the bacterial density between 70 and 89 %. Likewise, in soil with TPH-W, the FNB, AZP and AZT inhibitions were 90 %, with the exception of the 14 173 mg.kg-1 d. b. treatment, which stimulated the NFB and AZT in 2 and 0.10 times more than the control, respectively. The DMP was continued at the six months in the experiments, with values of 63 and 89 g in fresh and weathered petroleum, respectively; had no significant differences with the control (p≤0.05). The PDH reached values of 66 to 87 % both TPH-F and TPH-W at six months, respectively. These results demonstrated the ability the L. hexandra rhizosphere to stimulate the high NFB density, vegetal biomass production and phytoremediation of contaminated soils (with fresh and weathered petroleum), in a tropical waterlogging environment.
From schedonorus and micropyropsis to lolium (Poaceae: Loliinae): New combinations and typifications
Czech Academy of Sciences Publication Activity Database
Banfi, E.; Galasso, G.; Foggi, B.; Kopecký, David; Ardenghi, N.M.G.
2017-01-01
Roč. 66, č. 3 (2017), s. 708-717 ISSN 0040-0262 Institutional support: RVO:61389030 Keywords : Epitypification * Fescues * Grasses * Lectotypification * Nomenclature * Nothospecies * Taxonomy Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 2.447, year: 2016
Seasonal responses of six Poaceae to differential levels of solar UV-B radiation
International Nuclear Information System (INIS)
Deckmyn, G.; Impens, I.
1999-01-01
The effects of changes in solar UV-B on the growth and pigmentation of six grass species from cold-temperate grasslands (Lolium perenne, Lolium multiflorum, Festuca arundinacea, Festuca rubra, Phleum pratense and Dactylis glomerata) in spring and summer were studied. The grasses were grown in greenhouses with different foils, resulting in three treatments: no UV-B, 80% of ambient and 90% of ambient UV-BBE (biologically effective UV-B). The results indicated important effects of ambient UV-B levels on grass, but the different species reacted in very different ways. Both morphology and biomass production were influenced by UV-B in some species. However, changes in biomass production did not necessarily occur within the same species as changes in morphology. The grasses were more sensitive in summer. Overall, only F. rubra was positively influenced by UV-B under all circumstances. The biomass of D. glomerata and L. perenne was reduced by UV-B in spring and summer. Morphological changes included reduced height and increased tillering. The sensitivity of the different species was partially explained by their ability to reduce their specific leaf area in response to UV-B. Only the more sensitive species showed increased production of protective pigments. Overall, there were important differences between the effect of a low level of UV-B, and the further increase in UV-B, indicating that several mechanisms are operating at different light levels. (author)
Directory of Open Access Journals (Sweden)
Mason-Gamer Roberta J
2007-06-01
Full Text Available Abstract Background Stowaway elements are short, non-autonomous DNA transposons categorized as miniature inverted-repeat transposable elements (MITEs. The high MITE copy number in grass genomes suggests an active history of amplification and insertion, but ongoing MITE activity has only rarely been seen, and ongoing Stowaway activity has never been observed. Thus, a phylogenetic perspective on presence vs. absence of elements in an aligned data set can provide valuable historical insights into the dynamics of MITE acquisition and loss. Results A Stowaway-like element resides within the fourth intron of a β-amylase gene in representatives of five genera in the wheat tribe, Triticeae. Its presence vs. absence was examined with reference to the β-amylase gene tree topology, and in light of sequence comparisons of the β-amylase elements to Triticeae Stowaway elements in the Entrez nucleotide database. Among the sequences lacking the element, there are five distinct putative excision footprints (one widespread and four restricted to unrelated lineages and two flanking deletions. The sequences that do contain elements are polyphyletic on the β-amylase tree, and their elements are divergent at the sequence level. The β-amylase elements do not form a monophyletic group relative to other Stowaway elements in Entrez; most are more similar to elements from other loci in other Triticeae genomes than they are to one another. Conclusion Combined, the phylogenetic distribution, sequence variation, and Entrez database comparisons indicate that a Stowaway-like element has undergone multiple deletions from and insertions into the same site in β-amylase intron 4 during the history of the tribe. The elements currently at the site represent multiple, distinct lineages that transcend generic boundaries. While patterns of Stowaway polymorphism across a phylogenetic data set do not allow evolutionary mechanisms to be inferred with certainty, they do provide insights into the dynamics of element evolution over an extended time scale. The historical perspective provided by a phylogenetic approach is complementary to the few studies in which ongoing MITE activity has been documented.
Directory of Open Access Journals (Sweden)
Alex González
2012-03-01
Full Text Available Tagosodes orizicolus is one of the main plagues of rice in tropical America causing two types of damages, the direct one, feeding and oviposition effect, and an indirect one, by the transmission of the “Rice hoja blanca virus”. During 2006-2007 we carried out research under greenhouse conditions at Fundación Danac, Venezuela, in order to determine the mechanisms of antixenosis, antibiosis and tolerance to T. orizicolus, which could be acting in commercial varieties and advanced lines of the rice genetic breeding programs of INIA and Fundación Danac. The method of free feeding was used for the antixenosis evaluation, whereas the method of forced feeding was used for antibiosis evaluation (effect on survival and oviposition. Additionally, we used the indirect method based on biomass depression to estimate the tolerance. Some of the evaluated traits included: grade of damage, number of insects settling on rice plants, percentage of sogata mortality at the mature state, number of eggs in the leaf midrib and an index of tolerance. The results showed that rice genotypes possess different combinations of resistance mechanisms, as well as different grades of reactions. The susceptible control ‘Bluebonnet 50’ was consistently susceptible across experiments and the resistant control ‘Makalioka’ had high antixenosis and high antibiosis based on survival and oviposition. The rest of the genotypes presented lower or higher degrees of antixenosis and antibiosis for survival and viposition. The genotype ‘FD0241-M-17-6-1-1-1-1’ was identified with possible tolerance to the direct damage of sogata.Tagosodes orizicolus es una de las principales plagas del cultivo del arroz en América tropical causando dos tipos de daños a la planta, el directo, por efecto de la alimentación y oviposición; el indirecto, por la transmisión del virus de la hoja blanca del arroz. Durante el período 2006-2007 se llevó a cabo una investigación bajo condiciones de umbráculo en la Fundación Danac, Venezuela, con el objeto de determinar los mecanismos de resistencia de antixenosis, antibiosis y tolerancia a T. orizicolus que pudieran estar actuando en líneas avanzadas y cultivares del programa de mejoramiento enético de arroz de las instituciones INIA y Fundación Danac. Para la evaluación de antixenosis se utilizó el método de libre elección, para antibiosis (efecto sobre sobrevivencia y oviposición de los insectos el de alimentación forzada, adicionalmente se usó un método indirecto para estimar la tolerancia. Dentro de los principales parámetros determinados se encontraban: grado de daño, número de insectos posados sobre plantas de arroz, porcentaje de mortalidad de sogata en estado adulto, número de huevos y se calculó un índice de tolerancia con base en la biomasa. Los resultados mostraron que los genotipos de arroz evaluados poseen diferentes combinaciones en cuanto a los mecanismos de resistencia, así como el grado de su efecto. El testigo ‘Bluebonnet 50’ se mantuvo consistentemente susceptible en las evaluaciones y el testigo resistente ‘Makalioka’ fue el único genotipo que presentó alta antixenosis y alta antibiosis para sobrevivencia y oviposición. El resto de los genotipos presentaron un menor o mayor grado de resistencia de tipo antixenosis y antibiosis para sobrevivencia y oviposición. Se identificó el genotipo ‘FD0241-M-17-6-1-1-1-1’ con posible tolerancia al daño directo de sogata.
Directory of Open Access Journals (Sweden)
Mohammad Mehdizadeh
2015-02-01
Full Text Available Nowadays environmental pollution by pesticides application is a major concern for health. Efficiency of many herbicides can be increased by adding adjuvants to the spray solution. Therefore greenhouse study was conducted during 2014 to determine the efficacy of three adjuvants (Citogate, Castor oil and Canola oil at concentrations of 0.1 and 0.2 (%v/v with 5, 10, 20, 30 and 40 g a.i\\ha of sulfosulfuron herbicide on littleseed canary grass. Results showed that the adjuvants enhanced the efficacy of sulfosulfuron in decreasing the dry weights of littleseed canary grass. Performance of herbicide was increased with enhancing its concentrations. Measured ED50 and ED90 concentrations of sulfosulfuron in control were 16.74 and 32.22 g a.i\\ha, respectively. Whereas the values for Citogate 0.2 (%v\\v, was 5.86 and 13.34 g a.i\\ha, respectively. The addition of Citogate and Castor oil had the highest and lowest effect on sulfosulfuron efficacy against Littleseed canary grass. In conclusion, the study revealed that Citogate concentrations had powerful effects on herbicide efficacy followed by Canola oil.
Taxonomy and leaf anatomy of the genus Ehrharta (Poaceae in southern Africa: the Dura group
Directory of Open Access Journals (Sweden)
G. E. Gibbs Russel
1988-10-01
Full Text Available The Dura species group in the genus Ehrharta Thunb. is differentiated morphologically by the perennial habit and the very large, awned, subglabrous spikelets and anatomically by the occurrence of tanniniferous cells and wax platelets obscuring the stomatal pores. The Dura group consists of two species, E. dura Nees ex Trin. and E. microlaena Nees ex Trin., which occur only in Mountain Fynbos. The group shows no clear morphological or anatomical relationship with other species groups in the genus in southern Africa.
Czech Academy of Sciences Publication Activity Database
Mahelka, Václav; Fehrer, Judith; Krahulec, František; Jarolímová, Vlasta
2007-01-01
Roč. 100, - (2007), s. 249-260 ISSN 0305-7364 R&D Projects: GA ČR GA206/05/0778; GA ČR(CZ) GD206/03/H137 Institutional research plan: CEZ:AV0Z60050516 Keywords : Triticeae * polyploidy * gene flow Subject RIV: EF - Botanics Impact factor: 2.939, year: 2007
Diversification of C(4) grasses (Poaceae) does not coincide with their ecological dominance.
Bouchenak-Khelladi, Yanis; Slingsby, Jasper A; Verboom, G Anthony; Bond, William J
2014-02-01
The radiation of a lineage and its rise to ecological dominance are distinct phenomena and driven by different processes. For example, paleoecological data has been used to show that the Cretaceous angiosperm radiation did not coincide with their rise to dominance. Using a phylogenetic approach, we here explored the evolution of C4 grasses and evaluated whether the diversification of this group and its rise to ecological dominance in the late Miocene were decoupled. We assembled a matrix including 675 grass species of the PACMAD clade and 2784 characters (ITS and ndhF) to run a molecular dating analysis using three fossils as reference calibrations. We coded species as C3 vs. C4 and reconstructed ancestral states under maximum likelihood. We used the program BiSSE to test whether rates of diversification are correlated with photosynthetic pathway and whether the radiation of C4 lineages preceded or coincided with their rise to ecological dominance from ∼10 Ma. C4 grass lineages first originated around 35 Ma at the time of the Eocene-Oligocene transition. Accelerated diversification of C4 lineages did not coincide with their rise to ecological dominance. C4-dominated grasslands have expanded only since the Late Miocene and Pliocene. The initial diversification of their biotic elements can be tracked back as far as the Eocene-Oligocene transition. We suggest that shifts in taxonomic diversification and ecological dominance were stimulated by different factors, as in the case of the early angiosperms in the Cretaceous.
With the increased emphasis to use native plant materials in range revegetation programs in the western US, it is critical to develop native grasses that are competitive with invasive weeds, easy to establish, persistent, and produce high seed yield. One such native grass species with appreciable d...
Directory of Open Access Journals (Sweden)
Leonardo Luís Artico
2017-04-01
Full Text Available Chromosome morphometry and nuclear DNA content are useful data for cytotaxonomy and to understand the evolutionary history of different taxa. For the genus Bromus Linnaeus, 1753, distinct ploidy levels have been reported, occurring from diploid to duodecaploid species. The geographic distribution of Bromus species has been correlated with chromosome number and ploidy level. In this study, the aims were to determine the nuclear genome size and characterize the karyotype of the South American Bromus species: Bromus auleticus Trinius ex Nees, 1829, Bromus brachyanthera Döll, 1878 and Bromus catharticus Vahl, 1791. The mean nuclear 2C value ranged from 2C = 12.64 pg for B. catharticus to 2C = 17.92 pg for B. auleticus, meaning a maximum variation of 2C = 5.28 pg, equivalent to 41.70%. Despite this significant difference in 2C value, the three species exhibit the same chromosome number, 2n = 6x = 42, which confirms their hexaploid origin. Corroborating the genome size, the chromosome morphometry (total, short- and long-arm length and, consequently, the class differed among the karyotypes of the species. Based on the first karyograms for these Bromus species, some morphologically similar and several distinct chromosome pairs were found. Therefore, the karyotype characterization confirmed the hexaploid origin of the studied Bromus species, which differ in relation to the karyogram and the nuclear 2C value. Considering this, cytogenetics and flow cytometry can be used to discriminate Bromus species, contributing to taxonomy and systematic studies and providing information on the evolutionary history of this taxa.
Artico, Leonardo Luís; Mazzocato, Ana Cristina; Ferreira, Juliano Lino; Carvalho, Carlos Roberto; Clarindo, Wellington Ronildo
2017-01-01
Chromosome morphometry and nuclear DNA content are useful data for cytotaxonomy and to understand the evolutionary history of different taxa. For the genus Bromus Linnaeus, 1753, distinct ploidy levels have been reported, occurring from diploid to duodecaploid species. The geographic distribution of Bromus species has been correlated with chromosome number and ploidy level. In this study, the aims were to determine the nuclear genome size and characterize the karyotype of the South American Bromus species: Bromus auleticus Trinius ex Nees, 1829, Bromus brachyanthera Döll, 1878 and Bromus catharticus Vahl, 1791. The mean nuclear 2C value ranged from 2C = 12.64 pg for B. catharticus to 2C = 17.92 pg for B. auleticus , meaning a maximum variation of 2C = 5.28 pg, equivalent to 41.70%. Despite this significant difference in 2C value, the three species exhibit the same chromosome number, 2n = 6x = 42, which confirms their hexaploid origin. Corroborating the genome size, the chromosome morphometry (total, short- and long-arm length) and, consequently, the class differed among the karyotypes of the species. Based on the first karyograms for these Bromus species, some morphologically similar and several distinct chromosome pairs were found. Therefore, the karyotype characterization confirmed the hexaploid origin of the studied Bromus species, which differ in relation to the karyogram and the nuclear 2C value. Considering this, cytogenetics and flow cytometry can be used to discriminate Bromus species, contributing to taxonomy and systematic studies and providing information on the evolutionary history of this taxa.
Grass pollen (Poaceae in the air of Sosnowiec (Poland, 1997 - 2006
Directory of Open Access Journals (Sweden)
Kazimiera Chłopek
2012-12-01
Full Text Available The article presents the analysis results of the grass pollen seasons from 1997 to 2006 in Sosnowiec. The research was carried out by means of the volumetric method with the use of a Burkard device. The duration of the pollen seasons was determined by means of the 98% method. The influence of meteorological conditions on the starting date and duration of the grass pollen seasons has been estimated in the article. The beginning of the pollen seasons was recorded between 23 April and 23 May. It has been demonstrated that the average duration of the pollen season amounted to 138 days. The period of maximum concentrations was recorded in June and the first half of July. The highest daily concentration was found in 2000 (495 grains in m3 and the highest annual sums in 2002 and 2000. The daily concentration distribution curve has shown three peaks. The highest values were recorded from 7 am until 11 am, from 13 pm until 17 pm and from 19 pm until 21 pm. It has been found that there is a significant influence of weather conditions (temperature, precipitation and relative humidity on the beginning and duration of the pollen seasons and the period of maximum concentrations.
Chromosomal organization of repetitive DNAs in Hordeum bogdanii and H. brevisubulatum (Poaceae
Directory of Open Access Journals (Sweden)
Quanwen Dou
2016-10-01
Full Text Available Molecular karyotypes of H. bogdanii Wilensky, 1918 (2n = 14, and H. brevisubulatum Link, 1844 ssp. brevisubulatum (2n = 28, were characterized by physical mapping of several repetitive sequences. A total of 18 repeats, including all possible di- or trinucleotide SSR (simple sequence repeat motifs and satellite DNAs, such as pAs1, 5S rDNA, 45S rDNA, and pSc119.2, were used as probes for fluorescence in situ hybridization on root-tip metaphase chromosomes. Except for the SSR motifs AG, AT and GC, all the repeats we examined produced detectable hybridization signals on chromosomes of both species. A detailed molecular karyotype of the I genome of H. bogdanii is described for the first time, and each repetitive sequence is physically mapped. A high degree of chromosome variation, including aneuploidy and structural changes, was observed in H. brevisubulatum. Although the distribution of repeats in the chromosomes of H. brevisubulatum is different from that of H. bogdanii, similar patterns between the two species imply that the autopolyploid origin of H. brevisubulatum is from a Hordeum species with an I genome. A comparison of the I genome and the other Hordeum genomes, H, Xa and Xu, shows that colocalization of motifs AAC, ACT and CAT and colocalization of motifs AAG and AGG are characteristic of the I genome. In addition, we discuss the evolutionary significance of repeats in the genome during genome differentiation.
Muhlenbergia monandra (Poaceae: Eragrostideae, nueva especie anual endémica del Perú
Directory of Open Access Journals (Sweden)
J. José Alegría Olivera
2001-01-01
Full Text Available Se describe e ilustra Muhlenbergia monandra, endémica de Perú. La nueva especie se caracteriza por sus glumas mayores que el antecio, por tener inflorescencias espiciformes y las flores cleistógamas con un estambre. La anatomía foliar se describe e ilustra y se detallan sus caracteres diferenciales. Se incluyen observaciones sobre la epidermis de la lemma y las glumas realizadas con el Microscopio Electrónico de Barrido. Se discute la posición taxonómica de la nueva entidad y las diferencias con las especies anuales relacionadas que habitan en América del Sur
Una nueva especie de Axonopus (Poaceae: Panicoideae: Paniceae de la Guyana de Colombia y Venezuela
Directory of Open Access Journals (Sweden)
Giraldo Cañas Diego
1999-11-01
Full Text Available Axonopus piccae, a new species of the series Barbigeri G. A. Black, is described and illustrated. The new species is known only from two areas of Guayana Region: Guainía (Colombia and Bolívar (Venezuela. Its inflorescence is polytelic and truncate.Based on SEM microphotographs, the characters of its upper anthecium are presented. Its morphological and anatomical relationships are discussed, and a key to the nearest species is provided.Se describe e ilustra Axonopus piccae, una nueva especie perteneciente a la serie Barbigeri G. A. Black, conocida únicamente de dos áreas de la región Guayana en Guainía (Colombia y Bolívar (Venezuela. Su inflorescencia es politélica y truncada. Se comentan las características de su antecio superior sobre la base de microfotografías al microscopio electrónico de barrido. Se discuten sus relaciones morfológicas y anatómicas. Se presenta una clave para separar las especies afines.
Kelchner, Scot A
2013-05-01
Bamboos are large perennial grasses of temperate and tropical forests worldwide. Two general growth forms exist: the economically and ecologically important woody bamboos (tribes Arundinarieae and Bambuseae), and the understory herbaceous bamboos (tribe Olyreae). Evolutionary relationships among the 1400+described species have been difficult to resolve with confidence. Comparative analysis of bamboo plastid (chloroplast) DNA has revealed three to five major lineages that show distinct biogeographic distributions. Taxon sampling across tribes and subtribes has been incomplete and most published data sets include a relatively small number of nucleotide characters. Branching order among lineages is often poorly supported, and in more than one study herbaceous bamboos form a clade within the woody bamboos. In this paper, the Bamboo Phylogeny Group presents the most complete phylogeny estimation to date of bamboo tribes and subtribes using 6.7 kb of coding and noncoding sequence data and 37 microstructural characters from the chloroplast genome. Quality of data is assessed, as is the possibility of long branch attraction, the degree of character conflict at key nodes in the tree, and the legitimacy of three alternative hypotheses of relationship. Four major plastid lineages are recognized: temperate woody, paleotropical woody, neotropical woody, and herbaceous bamboos. Woody bamboos are resolved as paraphyletic with respect to Olyreae but SH tests cannot reject monophyly of woody species (Arundinarieae+Bambuseae). Published by Elsevier Inc.
Airborne grass (Poaceae) pollen in southern Spain. Results of a 10-year study (1987-96).
González Minero, F J; Candau, P; Tomás, C; Morales, J
1998-03-01
This work reports an exhaustive study of the aerobiology of the Gramineae in Seville, Spain, which is typical of coastal Mediterranean areas. Sampling was done with a Cour trap installed on the roof terrace of the School of Pharmacy, Seville, from 1987 to 1996, both inclusive. The climatic pattern of that period was characterized by two exceptionally wet years (1989 and 1996), between which were 5 consecutive years of drought (1990-5). This typically Mediterranean climate affects grass aerobiology. The annual amounts of total grass pollen are low, never exceeding 2500 grains/m3. The start, length, and intensity of the pollen season are significantly correlated with preseasonal meteorologic factors (precipitation and temperature), but intraseasonal meteorologic conditions have no effect on the three variables. The relationships are stated by three equations that, while further years of observations are anticipated, can be considered models to forecast the characteristics of the pollen season: the starting date depends on the mean temperatures of January and February, and the length and intensity of the season depend on the rainfall between the beginning of January and the starting date of the season. For the study period, the weekly concentrations (pollen curves) throughout the year showed no typical pattern of variation over the years, so that it was impossible to make mid- and long-term forecasts of the variation in weekly concentration. The most noteworthy aspects of grass pollen curves are a long pollen season, which starts in February or March and lasts until September or October; peaks of higher concentration (> 100 grains/m3) in May and June, associated with increases in temperature and absence of precipitation; and other peaks in the summer months that may be as high as the spring peaks.
Genetic analysis and gene fine mapping of aroma in rice (Oryza sativa L. Cyperales, Poaceae
Directory of Open Access Journals (Sweden)
Shu Xia Sun
2008-01-01
Full Text Available We investigated inheritance and carried out gene fine mapping of aroma in crosses between the aromatic elite hybrid rice Oryza sativa indica variety Chuanxiang-29B (Ch-29B and the non-aromatic rice O. sativa indica variety R2 and O. sativa japonica Lemont (Le. The F1 grains and leaves were non-aromatic while the F2 non-aroma to aroma segregation pattern was 3:1. The F3 segregation ratio was consistent with the expected 1:2:1 for a single recessive aroma gene in Ch-29B. Linkage analysis between simple sequence repeat (SSR markers and the aroma locus for the aromatic F2 plants mapped the Ch-29B aroma gene to a chromosome 8 region flanked by SSR markers RM23120 at 0.52 cM and RM3459 at 1.23 cM, a replicate F2 population confirming these results. Three bacterial artificial chromosome (BAC clones cover chromosome 8 markers RM23120 and RM3459. Our molecular mapping data from the two populations indicated that the aroma locus occurs in a 142.85 kb interval on BAC clones AP005301 or AP005537, implying that it might be the same gene reported by Bradbury et al (2005a; Plant Biotec J. 3:363-370. The flanking markers Aro7, RM23120 and RM3459 identified by us could greatly accelerate the efficiency and precision of aromatic rice breeding programs.
Intergeneric hybridization and C-banding patterns in Hordelymus (Triticeae, Poaceae)
DEFF Research Database (Denmark)
Bothmer, R. von; Lu, B.-R.; Linde-Laursen, I.
1994-01-01
Crosses of Hordelymus europaeus (2n = 4x = 28) with four genera in the Triticeae were attempted. Adult hybrids were obtained in combinations with Hordeum bogdanii (2x), Hordeum depressum (4x), and Secale cereale (2x). The meiotic pairing was very low in the hybrids with H. bogdanii and Secale...... cereale (0.12 and 0.30 chiasmata/cell, respectively), whereas high pairing (9.90 chiasmata/cell) was found in hybrids with H. depressum due to autosyndetic pairing of H. depressum chromosomes. The chromosome complement of Hordelymus europaeus comprised 16 metacentrics, 8 submetacentrics, and 4 SAT...
Rapid evolution in contemporary time can result when related species, brought together through human-aided introduction, hybridize. The evolutionary consequences of post introduction hybridization range from allopolyploid speciation to extinction of species through genetic amalg...
Inda, Luis A; Segarra-Moragues, José Gabriel; Müller, Jochen; Peterson, Paul M; Catalán, Pilar
2008-03-01
Divergence times and biogeographical analyses have been conducted within the Loliinae, one of the largest subtribes of temperate grasses. New sequence data from representatives of the almost unexplored New World, New Zealand, and Eastern Asian centres were added to those of the panMediterranean region and used to reconstruct the phylogeny of the group and to calculate the times of lineage-splitting using Bayesian approaches. The traditional separation between broad-leaved and fine-leaved Festuca species was still maintained, though several new broad-leaved lineages fell within the fine-leaved clade or were placed in an unsupported intermediate position. A strong biogeographical signal was detected for several Asian-American, American, Neozeylandic, and Macaronesian clades with different affinities to both the broad and the fine-leaved Festuca. Bayesian estimates of divergence and dispersal-vicariance analyses indicate that the broad-leaved and fine-leaved Loliinae likely originated in the Miocene (13My) in the panMediterranean-SW Asian region and then expanded towards C and E Asia from where they colonized the New World. Further expansions in America (10-3.8My) showed a predominant migratory route from North to South (N Americathe AndesPatagonia). This late Tertiary scenario of successive colonizations and secondary polyploid radiations in the southern hemisphere from the northern hemisphere was accompanied by occasional transcontinental long-distance dispersal events between South America and New Zealand. Multiple Pliocene dispersal events (3.6-2.5My) from the near SW European and NW African continents gave rise to the Macaronesian Loliinae flora, while a more recent Pleistocene origin (2-1My) is hypothesized for the high polyploid lineages that successfully colonized newly deglaciated areas in both hemispheres.
Czech Academy of Sciences Publication Activity Database
Ezquerro-López, D.; Kopecký, David; Inda, L. A.
2017-01-01
Roč. 74, č. 1 (2017), č. článku e052. ISSN 0211-1322 Institutional support: RVO:61389030 Keywords : Broad-leaved fescues * Festuca subgen. Schedonorus * fish * Genome size * rdna Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Plant sciences, botany Impact factor: 0.385, year: 2016
Ultrastructure and histology of organogenesis induced from shoot tips of maize (Zea mays, Poaceae
Directory of Open Access Journals (Sweden)
Walter Marín-Méndez
2009-11-01
Full Text Available Shoot tips of maize (Zea mays L. were cultured on Murashige and Skoog medium supplemented with 2 mg/l BA +1 mg/l 2,4-D +40 mg/l, to investigate phases of ontogenetic development. The study used light microscopy as well as scanning and transmission electronic microscopy techniques. Shoot tips of maize are composed of small cells with a dense cytoplasm and a prominent nucleus. The process of organogenesis began with swelling of the shoot tip, as the first evidence of organogenic calli formation observed three weeks after culture get started. There were two morphologically different types of cells within the organogenic calli. The layer consisted of large cells with small nucleus, free-organelle cytosol, irregular plasmatic membrane, trichome-like structures, and thick cell walls. In the inner cell layer, small and isodiametric cells with a prominent nucleus, small vacuoles, endoplasmatic reticulum, Golgi, mitochondrias and chloroplasts were observed. The presence of trichomes in the more active morphogenic zones could indicate an organogenic potential. Rev. Biol. Trop. 57 (Suppl. 1: 129-139. Epub 2009 November 30.Los ápices de vástagos de maíz (Zea mays L. fueron cultivados con el medio Murashige y Skoog, utilizando como suplemento 2 mg/l BA +1 mg/l 2,4-D +40 mg/l, con el fin de investigar el proceso organogénico durante las diferentes fases del desarrollo ontogenético. El estudio utilizó tanto microscopía de luz, como técnicas de microscopía electrónica. Los análisis histológicos revelaron que los vástagos de maíz están compuestos de pequeñas células con citoplasma denso y núcleo prominente. El proceso de organogénesis inicia con el engrosamiento del ápice del vástago, como primera evidencia de la formación organogénica del calli observada tres semanas después del inicio del cultivo. El estudio ultraestructural muestra dos tipos de células morfológicamente diferentes en el calli organogénico. La capa externa consiste de células grandes con núcleo pequeño, citosol sin organelas, membrana plamática irregular, estructuras similares a tricomas y paredes celulares delgadas. Mientras que en la capa interna se observaron células pequeñas e isodiamétricas con un núcleo prominente, vacuolas pequeñas, retículo endoplasmático, Golgi, mitocondrias y cloroplastos. Observaciones de microscopía electrónica revelan la organización externa de la organogénesis del calli del maíz. Los resultados obtenidos en el presente estudio contribuyen con la comprensión del proceso de organogénesis en los ápices de los vástagos del maíz. Este estudio mejorará nuestro conocimiento acerca de los estados anatómicos óptimos para la integración estable de genes externos. Además, provee información de las condiciones apropiadas en el cultivo in vitro para la regeneración de plantas transgénicas. Este estudio sugiere que la presencia de tricomas en las zonas morfogénicas más activas podría indicar su potencial organogénico.
A phylogenetic analysis of the monogenomic Triticeae (Poaceae) based on morphology
DEFF Research Database (Denmark)
Seberg, Ole; Frederiksen, Signe Elisabeth
2001-01-01
not traditionally included in Aegilops s.J. Most of the 33 characters used in the analysis are coded as binary. The only four multistate characters in the matrix are treated as unordered. Three diploid species of Bromus are used as outgroup. The number of equally parsimonious trees found is very large (approx....... 170000; length = 107, ci = 0.36, ri = 0.75) and the strict consensus tree has an expectedly low level of resolution. However, most of the equally parsimonious trees owe their existence to an unresolved Aegilops clade. If this clade is replaced by its hypothetical ancestor, the number of equally...... parsimonious trees drops dramatically (48; length = 78, ci = 0.45, ri = 0.76). When trees for which more highly resolved compatible trees exist are excluded, only two trees remain. Bremer support is used as a measure of branch support. The trees based on morphology and on molecular data are largely incongruent....
González, Alex; Labrín, Natalia; Alvarez, Rosa M; Jayaro, Yorman; Gamboa, Carlos; Reyes, Edicta; Barrientos, Venancio
2012-03-01
Tagosodes orizicolus is one of the main plagues of rice in tropical America causing two types of damages, the direct one, feeding and oviposition effect, and an indirect one, by the transmission of the "Rice hoja blanca virus". During 2006-2007 we carried out research under greenhouse conditions at Fundaci6n Danac, Venezuela, in order to determine the mechanisms of antixenosis, antibiosis and tolerance to T. orizicolus, which could be acting in commercial varieties and advanced lines of the rice genetic breeding programs of INIA and Fundaci6n Danac. The method of free feeding was used for the antixenosis evaluation, whereas the method of forced feeding was used for antibiosis evaluation (effect on survival and oviposition). Additionally, we used the indirect method based on biomass depression to estimate the tolerance. Some of the evaluated traits included: grade of damage, number of insects settling on rice plants, percentage of sogata mortality at the mature state, number of eggs in the leaf midrib and an index of tolerance. The results showed that rice genotypes possess different combinations of resistance mechanisms, as well as different grades of reactions. The susceptible control 'Bluebonnet 50' was consistently susceptible across experiments and the resistant control 'Makalioka' had high antixenosis and high antibiosis based on survival and oviposition. The rest of the genotypes presented lower or higher degrees of antixenosis and antibiosis for survival and oviposition. The genotype 'FD0241-M-17-6-1-1-1-1' was identified with possible tolerance to the direct damage of sogata.
Silva, L A C; Pagliarini, M S; Santos, S A; Silva, N; Souza, V F
2012-11-28
The genus Mesosetum is a primarily South American genus with 42 species. Mesosetum chaseae, regionally known as 'grama-do-cerrado', is abundant in the Pantanal Matogrossense (Brazil); it is a valuable resource for livestock and for environmental conservation. We collected specimens from the Nhecolandia sub-region of the Brazilian Pantanal, located in Corumbá, Mato Grosso do Sul, Brazil. We examined chromosome number, ploidy level, meiotic behavior, microgametogenesis, and pollen viability of 10 accessions. All the accessions were diploid, derived from x = 8, presenting 2n = 2x = 16 chromosomes. Chromosomes paired as bivalents showing, predominantly, two terminal chiasmata. Interstitial chiasmata were rare. Meiosis was quite normal producing only a few abnormal tetrads in some accessions. Microgametogenesis, after two mitotic divisions, produced three-celled pollen grains. Pollen viability was variable among plant and accessions and was not correlated with meiotic abnormalities.
Techio, Vânia Helena; Davide, Lisete Chamma; Pereira, Antônio Vander
2006-01-01
The cultivated and sexually compatible species Pennisetum purpureum (elephant grass, 2n = 4x = 28) and Pennisetum glaucum (pearl millet, 2n = 2x = 14) can undergo hybridization which favors the amplification of their genetic background and the introgression of favorable alleles into breeding programs. The main problem with interspecific hybrids of these species is infertility due to triploidy (2n = 3x = 21). This study describes meiosis in elephant grass x pearl millet hybrids and their proge...
Barth, Susanne; Jankowska, Marta Jolanta; Hodkinson, Trevor Roland; Vellani, Tia; Klaas, Manfred
2016-03-22
Forty three microsatellite markers were developed for further genetic characterisation of a forage and biomass grass crop, for which genomic resources are currently scarce. The microsatellite markers were developed from a normalized EST-SSR library. All of the 43 markers gave a clear banding pattern on 3% Metaphor agarose gels. Eight selected SSR markers were tested in detail for polymorphism across eleven DNA samples of large geographic distribution across Europe. The new set of 43 SSR markers will help future research to characterise the genetic structure and diversity of Phalaris arundinacea, with a potential to further understand its invasive character in North American wetlands, as well as aid in breeding work for desired biomass and forage traits. P. arundinacea is particularly valued in the northern latitude as a crop with high biomass potential, even more so on marginal lands.
Development of 12 genic microsatellite loci for a biofuel grass, Miscanthus sinensis (Poaceae).
Ho, Chuan-Wen; Wu, Tai-Han; Hsu, Tsai-Wen; Huang, Jao-Ching; Huang, Chi-Chun; Chiang, Tzen-Yuh
2011-08-01
Miscanthus, a nonfood plant with high potential as a biofuel, has been used in Europe and the United States. The selection of a cultivar with high biomass, photosynthetic efficiency, and stress resistance from wild populations has become an important issue. New genic microsatellite markers will aid the assessment of genetic diversity for different strains. Twelve polymorphic microsatellite markers derived from the transcriptome of Miscanthus sinensis fo. glaber were identified and screened on 80 individuals of M. sinensis. The number of alleles per locus ranged from 6 to 12, and the mean expected heterozygosity was 0.75. Cross-taxa transferability revealed that all loci can be applied to all varieties of M. sinensis, as well as the closely related species M. floridulus. These new genic microsatellite markers are useful for characterizing different traits in breeding programs or to select genes useful for biofuel.
Reproductive biology of the native forage grass Trichloris crinita (Poaceae, Chloridoideae).
Kozub, P C; Barboza, K; Galdeano, F; Quarin, C L; Cavagnaro, J B; Cavagnaro, P F
2017-05-01
Trichloris crinita is a perennial forage grass species native to arid regions of the American continent. Due to its extensive area of distribution, good forage quality and resistance to drought and grazing, this species is widely utilised as forage and for revegetation purposes in environments with low water availability. Despite its importance, genetic improvement of T. crinita has been very limited, partly as consequence of the lack of knowledge on its mode of reproduction. In the present work, we studied the reproductive biology of T. crinita by means of embryological analyses, flow cytometric seed screen (FCSS), self-compatibility tests and progeny testing with morphological and molecular markers. Cytological analyses revealed embryo sacs with eight nuclei and of Polygonum type for all T. crinita accessions analysed. FCSS histograms exhibited two clear peaks corresponding to 2C and 3C DNA content, indicating embryo sacs of sexual origin. Controlled pollination experiments designed to evaluate seed set (%) demonstrated that T. crinita is self-compatible, whereas results from morphological and simple sequence repeat (SSR) marker analysis of progeny revealed lack of outcrossing. Together, these results indicate that T. crinita reproduces sexually. It is a self-compatible and autogamous species. It is expected that these data will have a positive impact in the genetics and breeding of this species, and therefore contribute to its proper utilisation in arid regions. © 2017 German Botanical Society and The Royal Botanical Society of the Netherlands.
Microsatellite markers for the native Texas perennial grass, Panicum hallii (Poaceae).
Lowry, David B; Purmal, Colin T; Meyer, Eli; Juenger, Thomas E
2012-03-01
We developed microsatellites for Panicum hallii for studies of gene flow, population structure, breeding experiments, and genetic mapping. Next-generation (454) genomic sequence data were used to design markers. Eighteen robust markers were discovered, 15 of which were polymorphic across six accessions of P. hallii var. hallii. Fourteen of the markers cross-amplified in a P. capillare accession. For the 15 polymorphic markers, the total number of alleles per locus ranged from two to 26 (mean: 11.0) across six populations (11-19 individuals per population). Observed heterozygosity (mean: 0.031) was 13.7 times lower than the expected heterozygosity (mean: 0.426). The deficit of heterozygous individuals is consistent with P. hallii having a high rate of self-fertilization. These markers will be useful for studies in P. hallii and related species.
Susan E. Meyer; David L. Nelson; Suzette Clement; Alisa Ramakrishnan
2010-01-01
Evolutionary processes that maintain genetic diversity in plants are likely to include selection imposed by pathogens. Negative frequency-dependent selection is a mechanism for maintenance of resistance polymorphism in plant - pathogen interactions. We explored whether such selection operates in the Bromus tectorum - Ustilago bullata pathosystem. Gene-for-gene...
Braun, Uwe; Crous, Pedro W.; Nakashima, Chiharu
2014-01-01
Cercosporoid fungi (formerly Cercospora s. lat.) represent one of the largest groups of hyphomycetes belonging to the Mycosphaerellaceae (Ascomycota). They include asexual morphs, asexual holomorphs, or species with mycosphaerella-like sexual morphs. Most of them are leaf-spotting plant pathogens with special phytopathological relevance. In the first part of a new monographic work, cercosporoid hyphomycetes occurring on other fungi (fungicolous species), on ferns (pteridophytes) and gymnosper...
Huang, Chao-Li
2014-11-11
Young incipient species provide ideal materials for untangling the process of ecological speciation in the presence of gene flow. The Miscanthus floridulus/sinensis complex exhibits diverse phenotypic and ecological differences despite recent divergence (approximately 1.59million years ago). To elucidate the process of genetic differentiation during early stages of ecological speciation, we analyzed genomic divergence in the Miscanthus complex using 72 randomly selected genes from a newly assembled transcriptome. In this study, rampant gene flow was detected between species, estimated as M=3.36x10(-9) to 1.20x10(-6), resulting in contradicting phylogenies across loci. Nevertheless, beast analyses revealed the species identity and the effects of extrinsic cohesive forces that counteracted the non-stop introgression. As expected, early in speciation with gene flow, only 3-13 loci were highly diverged; two to five outliers (approximately 2.78-6.94% of the genome) were characterized by strong linkage disequilibrium, and asymmetrically distributed among ecotypes, indicating footprints of diversifying selection. In conclusion, ecological speciation of incipient species of Miscanthus probably followed the parapatric model, whereas allopatric speciation cannot be completely ruled out, especially between the geographically isolated northern and southern M.sinensis, for which no significant gene flow across oceanic barriers was detected. Divergence between local ecotypes in early-stage speciation began at a few genomic regions under the influence of natural selection and divergence hitchhiking that overcame gene flow.
Nuevas especies de Axonopus (Poaceae: Panicoideae: Paniceae de la Amazonia Colombiana
Directory of Open Access Journals (Sweden)
Giraldo Cañas Diego
1998-11-01
Full Text Available Two new species of Axonopus, A. morronei (series Axonopus and A. zuloagae (series Barbigen are described. The new species are known only from the savannas and sandstone plateau of Colombian northwest Amazonia.Se describen dos nuevas especies de Axonopus, A. morronei y A. zuloagae, de las series Axonopus y Barbigeri, respectivamente. Las nuevas especies son conocidas únicamente de las sabanas y afloramientos rocosos de la Amazonia noroccidental colombiana.
The phytoremediation potential of heavy metals from soil using Poaceae energy crops: A review
Directory of Open Access Journals (Sweden)
Melissa PRELAC
2016-09-01
Full Text Available Phytoremediation is a method that use plants which can remove or stabilize pollutants in the environment. The aim of the polluted area remediation is to return ecosystems into original condition. Phytoremediation is a green technology used for a wide range of pollutants as well as on various lands, low costs and reduced environment impacts. Energy crops are relatively new in this field of researches and insufficiently explored. However, the results so far show their potential in heavy metal removal. The aim of this research was to examine the available literature and determine the phytoremediation potential of cadmium, chromium, copper, lead, mercury, nickel and zinc from the soil using Arundo donax, Miscanthus x giganteus, Panicum virgatum, Pennisetum purpureum, Sida hermaphrodita and Sorghum x drummondii. According to the researches conditions, studied energy crops are reccomended in heavy metals phytoextraction, rhizofiltration, stabilization and accumulation. Still, those plants accumulate higher concentrations of heavy metals in the rhizosphere which makes them heavy metals excluders since heavy metals are not translocated into the plants' shoot system and favorable in the implementation of rhizofiltration as well.
Directory of Open Access Journals (Sweden)
Rose A. Monteiro
2008-12-01
Full Text Available The bacterium Herbaspirillum seropedicae is an endophytic diazotroph found in several plants, including economically important poaceous species. However, the mechanisms involved in the interaction between H. seropedicae and these plants are not completely characterized. We investigated the attachment of Herbaspirillum to maize roots and the invasion of the roots by this bacterium using H. seropedicae strain SMR1 transformed with the suicide plasmid pUTKandsRed, which carries a mini-Tn5 transposon containing the gene for the Discosoma red fluorescent protein (Dsred constitutively expressed together with the kanamycin resistance gene. Integration of the mini-Tn5 into the bacterial chromosome yielded the mutant H. seropedicae strain RAM4 which was capable of expressing Dsred and could be observed on and inside fresh maize root samples. Confocal microscopy of maize roots inoculated with H. seropedicae three days after germination showed that H. seropedicae cell were attached to the root surface 30 min after inoculation, were visible in the internal tissues after twenty-four hours and in the endodermis, the central cylinder and xylem after three days.
The utility of Bambusoideae (Poaceae, Poales leaf blade anatomy for identification and systematics
Directory of Open Access Journals (Sweden)
T. D. Leandro
Full Text Available Abstract Bambusoideae is a diverse subfamily that includes herbaceous (Olyreae and woody (Arundinarieae and Bambuseae bamboos. Species within Bambusae are particularly difficult to identify due to their monocarpic lifecycle and the often long durations between mass flowering events; whereas the herbaceous bamboos are pluricarpic, but often are found with no reproductive structures. The leaf blade anatomy of 16 sympatric species of native Brazilian bamboos (Olyreae and Bambuseae from the Atlantic Rainforest was studied in order to detect useful features for their identification. All the studied species share the following features: epidermis with a single stratum of cells; adaxial bulliform cells; mesophyll with arm cells, rosette cells, and fusoid cells; and collateral vascular bundles. Herbaceous bamboos share two features: papillae scattered on the abaxial surface and parallel-sided arrays of bulliform cells; whereas woody bamboos share: centrally organized papillae and fan-shaped arrays of bulliform cells. Also within the woody bamboos, intercostal fibers and a midrib with only one vascular bundle (simple midrib characterize the subtribe Arthrostylidiinae; whereas a midrib with more than one vascular bundle (complex midrib and a stomatal apparatus with two pappilae per subsidiary cell characterize the subtribe Chusqueinae. There are also diagnostic features for the sampled species, such as: papillae shape, and the outline and structure of the midrib. An identification key for all the studied species is provided based on the anatomical features.
Cytotaxonomy of some species and of interspecific hybrids of Pennisetum (Poaceae, Poales
Directory of Open Access Journals (Sweden)
Vânia Helena Techio
2002-01-01
Full Text Available Cytotaxonomic studies were carried out on 26 accessions of Pennisetum spp. originating from the Active Germplasm Bank of Embrapa Gado de Leite-Juiz de Fora, Minas Gerais, Brazil.This study presents cytogenetics and reproductive morphological data for each one of these accessions, which allowed groupings and suggest botanical identifications to be established. The metaphases of the accessions characterized as P. purpureum confirmed the presence of 2n = 28 chromosomes that have already been described for this species. For the hybrids between P. purpureum and P. glaucum and for the hexaploids, resulting from the chromosome duplication of these hybrids, 2n = 21 and 2n = 42 chromosomes were confirmed, respectively. The wild accession identified as P. setosum showed metaphases with 2n = 54 chromosomes, while those characterized as P. nervosum had cells with 2n = 36 chromosomes. The wild accession 15 was different from the others for the morphological characters, with 2n = 36 chromosomes, and was classified as P. orientale. Two statistical procedures were used (canonical variables and cluster analysis on the basis of the Mahalanobis distance, and the results confirmed the conclusions obtained from the cytogenetic and morphologic analysis.
Thresholds, injury, and loss relationships for thrips in Phleum pratense (Poales: Poaceae).
Reisig, Dominic D; Godfrey, Larry D; Marcum, Daniel B
2009-12-01
Timothy (Phleum pratense L.) is an important forage crop in many Western U.S. states. Marketing of timothy hay is primarily based on esthetics, and green color is an important attribute. The objective of these studies was to determine a relationship between arthropod populations, yield, and esthetic injury in timothy. Economic injury levels (EILs) and economic thresholds were calculated based on these relationships. Thrips (Thripidae) numbers were manipulated with insecticides in small plot studies in 2006, 2007, and 2008, although tetranychid mite levels were incidentally flared by cyfluthrin in some experiments. Arthropod population densities were determined weekly, and yield and esthetic injury were measured at each harvest. Effects of arthropods on timothy were assessed using multilinear regression. Producers were also surveyed to relate economic loss from leaf color to the injury ratings for use in establishing EILs. Thrips population levels were significantly related to yield loss in only one of nine experiments. Thrips population levels were significantly related to injury once before the first annual harvest and twice before the second. Thrips were the most important pest in these experiments, and they were more often related to esthetic injury rather than yield loss. EILs and economic thresholds for thrips population levels were established using esthetic injury data. These results document the first example of a significant relationship between arthropod pest population levels and economic yield and quality losses in timothy.
Czech Academy of Sciences Publication Activity Database
Mahelka, Václav
2006-01-01
Roč. 46, - (2006), s. 82-90 ISSN 0043-1737 R&D Projects: GA ČR GA206/05/0778; GA ČR GD206/03/H137; GA MZe QC1362 Institutional research plan: CEZ:AV0Z60050516 Keywords : phenotypic plasticity * flooding * weed Subject RIV: EF - Botanics Impact factor: 1.705, year: 2006
Ribosomal DNA in diploid and polyploid Setaria (Poaceae) species: number and distribution
Nani, Thaís Furtado; Cenzi, Gisele; Pereira, Daniele Lais; Davide, Lisete Chamma; Techio, Vania Helena
2015-01-01
Abstract Setaria Beauvois, 1812 is a genus of economically important forage species, including Setaria italica (Linnaeus, 1753) Beauvois, 1812 and Setaria viridis (Linnaeus, 1753) Beauvois, 1812, closely related species and considered as model systems for studies of C4 plants. However, complications and uncertainties related to taxonomy of other species of the genus are frequent due to the existence of numerous synonyms for the same species or multiple species with the same name, and overlapp...
Ribosomal DNA in diploid and polyploid Setaria (Poaceae) species: number and distribution
Nani, Thaís Furtado; Cenzi, Gisele; Pereira, Daniele Lais; Davide, Lisete Chamma; Techio, Vânia Helena
2015-01-01
Abstract Setaria Beauvois, 1812 is a genus of economically important forage species, including Setaria italica (Linnaeus, 1753) Beauvois, 1812 and Setaria viridis (Linnaeus, 1753) Beauvois, 1812, closely related species and considered as model systems for studies of C4 plants. However, complications and uncertainties related to taxonomy of other species of the genus are frequent due to the existence of numerous synonyms for the same species or multiple species with the same name, and overlapping of morphological characteristics. Cytogenetic studies in Setaria can be useful for taxonomic and evolutionary studies as well as for applications in breeding. Thus, this study is aimed at locating 45S and 5S rDNA sites through fluorescent in situ hybridization (FISH) in Setaria italica, Setaria viridis and Setaria sphacelata (Schumacher, 1827) Stapf, Hubbard, Moss, 1929 cultivars (cvs.) Narok and Nandi. Setaria italica and Setaria viridis have 18 chromosomes with karyotype formulas 6m + 3sm and 9m, respectively. The location of 45S and 5S rDNA for these species was in different chromosome pairs among the evaluated species. Setaria viridis presented a more symmetrical karyotype, strengthening the ancestral relationship with Setaria italica. Setaria sphacelata cvs. Narok and Nandi have 36 chromosomes, and karyotype formulas 11m+7sm and 16m+2sm, respectively. The 45S rDNA signals for both cultivars were also observed in distinct chromosome pairs; however chromosomes bearing 5S rDNA are conserved. Karyotypic variations found among the studied species are evidence of chromosomal rearrangements. PMID:26753080
Genetic control and comparative genomic analysis of flowering time in Setaria (Poaceae).
Mauro-Herrera, Margarita; Wang, Xuewen; Barbier, Hugues; Brutnell, Thomas P; Devos, Katrien M; Doust, Andrew N
2013-02-01
We report the first study on the genetic control of flowering in Setaria, a panicoid grass closely related to switchgrass, and in the same subfamily as maize and sorghum. A recombinant inbred line mapping population derived from a cross between domesticated Setaria italica (foxtail millet) and its wild relative Setaria viridis (green millet), was grown in eight trials with varying environmental conditions to identify a small number of quantitative trait loci (QTL) that control differences in flowering time. Many of the QTL across trials colocalize, suggesting that the genetic control of flowering in Setaria is robust across a range of photoperiod and other environmental factors. A detailed comparison of QTL for flowering in Setaria, sorghum, and maize indicates that several of the major QTL regions identified in maize and sorghum are syntenic orthologs with Setaria QTL, although the maize large effect QTL on chromosome 10 is not. Several Setaria QTL intervals had multiple LOD peaks and were composed of multiple syntenic blocks, suggesting that observed QTL represent multiple tightly linked loci. Candidate genes from flowering time pathways identified in rice and Arabidopsis were identified in Setaria QTL intervals, including those involved in the CONSTANS photoperiod pathway. However, only three of the approximately seven genes cloned for flowering time in maize colocalized with Setaria QTL. This suggests that variation in flowering time in separate grass lineages is controlled by a combination of conserved and lineage specific genes.
Diazotrophic bacteria isolated from wild rice Oryza glumaepatula (Poaceae in the Brazilian Amazon
Directory of Open Access Journals (Sweden)
Paulo Ivan Fernandes Júnior
2013-06-01
Full Text Available The association of wild grasses with diazotrophic bacteria in Brazilian biomes is poorly understood. The isolation and characterization of bacteria associated with wild grasses can contribute to understand the diazotrophic ecology as well as to identify bacteria with biotechnological applications. In this study, we isolated and characterized diazotrophic bacterial isolates from Oryza glumaepatula collected in Cerrado and Forest areas of the Amazon in Roraima State, Brazil. Healthy O. glumepatula plants were collected at five sampling sites at Forest and seven at Cerrado, respectively. The plants were collected at the Cerrado areas in September 2008 while the Forest plants were collected in June/2008 and April/2009. The plants and the soil adhering to the roots were transferred to pots and grown for 35 days in greenhouse conditions. During the harvest, the shoots and the roots were crushed separately in a saline solution; the suspension was diluted serially and inoculated in Petri dishes containing Dyg’s medium. All distinct bacterial colonies were purified in the same medium. The diazotrophic capacity of each bacterium in microaerophilic conditions was assessed in semisolid BMGM medium. In addition, the pellicles forming bacterial isolates were also evaluated by PCR amplification for nifH gene. The diversity of nifH+ bacteria was analyzed by Box-PCR fingerprinting. For selected strains, the growth promoting capacity of O. sativa as a model plant was also evaluated. A total of 992 bacterial isolates were obtained. Fifty- one bacteria were able to form pellicles in the semisolid medium and 38 also positively amplified the 360bp nifH gene fragment. Among the 38 nifH+ isolates, 24 were obtained from the shoots, while 14 originated from the roots. The Box-PCR profiles showed that the bacterial isolates obtained in this study presented a low similarity with the reference strains belonging to the Herbaspirillum, Azospirillum and Burkholderia genus. The growth- promoting ability was confirmed for at least five isolates. For these bacteria, the root and shoot growing results showed higher increases when compared to those observed in plants inoculated with the evaluated reference strains. These results indicate that O. glumaepatula is colonized by a high diverse diazotrophic community in the Brazilian Amazon. Further investigations are now being carried out to determine the taxonomic positions of these isolates and their growth promoting mechanisms.
Diazotrophic bacteria isolated from wild rice Oryza glumaepatula (Poaceae) in the Brazilian Amazon.
Júnior, Paulo Ivan Fernandes; Pereira, Gilmara Maria Duarte; Perin, Liamara; da Silva, Luana Mesquita; Baraúna, Alexandre Cardoso; Alvess, Francilene Muniz; Passos, Samuel Ribeiro; Zilli, Jerri Edson
2013-06-01
The association of wild grasses with diazotrophic bacteria in Brazilian biomes is poorly understood. The isolation and characterization of bacteria associated with wild grasses can contribute to understand the diazotrophic ecology as well as to identify bacteria with biotechnological applications. In this study, we isolated and characterized diazotrophic bacterial isolates from Oryza glumaepatula collected in Cerrado and Forest areas of the Amazon in Roraima State, Brazil. Healthy O. glumepatula plants were collected at five sampling sites at Forest and seven at Cerrado, respectively. The plants were collected at the Cerrado areas in September 2008 while the Forest plants were collected in June/2008 and April/2009. The plants and the soil adhering to the roots were transferred to pots and grown for 35 days in greenhouse conditions. During the harvest, the shoots and the roots were crushed separately in a saline solution; the suspension was diluted serially and inoculated in Petri dishes containing Dyg's medium. All distinct bacterial colonies were purified in the same medium. The diazotrophic capacity of each bacterium in microaerophilic conditions was assessed in semisolid BMGM medium. In addition, the pellicles forming bacterial isolates were also evaluated by PCR amplification for nifH gene. The diversity of nifH bacteria was analyzed by Box-PCR fingerprinting. For selected strains, the growth promoting capacity of O. sativa as a model plant was also evaluated. A total of 992 bacterial isolates were obtained. Fifty-one bacteria were able to form pellicles in the semisolid medium and 38 also positively amplified the 360 bp nifH gene fragment. Among the 38 nifH+ isolates, 24 were obtained from the shoots, while 14 originated from the roots. The Box-PCR profiles showed that the bacterial isolates obtained in this study presented a low similarity with the reference strains belonging to the Herbaspirillum, Azospirillum and Burkholderia genus. The growth-promoting ability was confirmed for at least five isolates. For these bacteria, the root and shoot growing results showed higher increases when compared to those observed in plants inoculated with the evaluated reference strains. These results indicate that O. glumaepatula is colonized by a high diverse diazotrophic community in the Brazilian Amazon. Further investigations are now being carried out to determine the taxonomic positions of these isolates and their growth promoting mechanisms.
Ribosomal DNA variation in finger millet and wild species of Eleusine (Poaceae).
Hilu, K W; Johnson, J L
1992-04-01
Finger millet is an important cereal crop in the semi-arid regions of Africa and India. The crop belongs to the grass genus Eleusine, which includes nine annual and perennial species native to Africa except for the New World species E. tristachya. Ribosomal DNA (rDNA) variation in finger millet and related wild species was used to provide information on the origin of the genomes of this tetraploid crop and point out genetic relationships of the crop to other species in the genus. The restriction endonucleases used revealed a lack of variability in the rDNA spacer region in domesticated finger millet. All the rDNA variants of the crop were found in the proposed direct tetraploid ancestor, E. coracana subsp. africana. Wild and domesticated finger millet displayed the phenotypes found in diploid E. indica. Diploid Eleusine tristachya showed some similarity to the crop in some restriction sites. The remaining species were quite distinct in rDNA fragment patterns. The study supports the direct origin of finger millet from subspecies africana shows E. indica to be one of the genome donors of the crop, and demonstrates that none of the other species examined could have donated the second genome of the crop. The rDNA data raise the possibility that wild and domesticated finger millet could have originated as infraspecific polyploid hybrids from different varieties of E. indica.
Basic chromosome numbers and polyploid levels in some South African and Australian grasses (Poaceae
Directory of Open Access Journals (Sweden)
J. J. Spies
1991-10-01
Full Text Available Chromosome numbers of 46 specimens of grasses, involving 24 taxa from South Africa and Australia, have been determined during the present study. For the first time chromosome numbers are given for Eragrostis sarmentosa (Thunb. Trin. (n = 20. Panicum aequinerve Nees (n = 18, Digitaria argyrograpta (Nees Stapf (n = 9 and D. maitlandii Stapf & C.E. Hubb. (n = 9. Additional polyploid levels are described for Diplachne fusca (L. Beauv. ex Roem. & Schult. (n = 10 and Digitaria diagonalis (Nees Stapf var. diagonalis (n = 9. B-chromosomes were observed in several different specimens. The presence of B-chromosomes often results in abnormal chromosomal behaviour during meiosis.
Zhang, Li-Na; Zhang, Xian-Zhi; Zhang, Yu-Xiao; Zeng, Chun-Xia; Ma, Peng-Fei; Zhao, Lei; Guo, Zhen-Hua; Li, De-Zhu
2014-09-01
The temperate woody bamboos (Arundinarieae) are highly diverse in morphology but lack a substantial amount of genetic variation. The taxonomy of this lineage is intractable, and the relationships within the tribe have not been well resolved. Recent studies indicated that this tribe could have a complex evolutionary history. Although phylogenetic studies of the tribe have been carried out, most of these phylogenetic reconstructions were based on plastid data, which provide lower phylogenetic resolution compared with nuclear data. In this study, we intended to identify a set of desirable nuclear genes for resolving the phylogeny of the temperate woody bamboos. Using two different methodologies, we identified 209 and 916 genes, respectively, as putative single copy orthologous genes. A total of 112 genes was successfully amplified and sequenced by next-generation sequencing technologies in five species sampled from the tribe. As most of the genes exhibited intra-individual allele heterozygotes, we investigated phylogenetic utility by reconstructing the phylogeny based on individual genes. Discordance among gene trees was observed and, to resolve the conflict, we performed a range of analyses using BUCKy and HybTree. While caution should be taken when inferring a phylogeny from multiple conflicting genes, our analysis indicated that 74 of the 112 investigated genes are potential markers for resolving the phylogeny of the temperate woody bamboos. © 2014 John Wiley & Sons Ltd.
Directory of Open Access Journals (Sweden)
Arturi, Miguel J.
2008-06-01
Full Text Available Thirty-one populations of Bromus catharticus Vahl., collected from the Pampean Dominion (Argentina, were classified using twenty four highly heritable traits by numerical taxonomic methods. After implementing a stepwise discriminant analysis, 18 traits were chosen as classificatory variables. Eight population groups were classified in two main clusters. Different morphotypes, primarily associated with panicle architecture and micro floral traits, were found. The patterns in the morphological variation seem to correspond to a gradient of humidity and temperature that diminishes from the NE to the SW. This pattern of classification reflects the geographical origin for most of the sampled populations, although there was some noise. Our results fit the patchy variation model, where populations are genetically selected for macro and micro environmental conditions.Treinta y una poblaciones de Bromus catharticus Vahl., recolectadas en el dominio Pampeano (Argentina, fueron clasificadas utilizando 24 caracteres altamente heredables por métodos de taxonomía numérica. Tras implementar el análisis discriminante del paso a paso (Stepwise, 18 variables fueron seleccionadas como variables clasificatorias. Ocho grupos de poblaciones fueron clasificadas en dos clusters principales. Diferentes morfotipos, principalmente asociados a la arquitectura de las panojas y a variables microflorales, fueron encontrados. El patrón de variación morfológico parece responder a un gradiente de humedad y temperatura que disminuye desde el NE al SW. Además, dicho patrón de clasificación refleja un origen geográfico para la mayoría de las poblaciones, aunque hubo algo de ruido. Nuestros resultados se ajustan a un modelo de variación en parches, donde las poblaciones están genéticamente seleccionadas por condiciones micro y macro ambientales.
Rapid and recent world-wide diversification of bluegrasses (Poa, Poaceae and related genera.
Directory of Open Access Journals (Sweden)
Matthias H Hoffmann
Full Text Available Rapid species diversifications provide fascinating insight into the development of biodiversity in time and space. Most biological radiations studied to date, for example that of cichlid fishes or Andean lupines, are confined to isolated geographical areas like lakes, islands or island-like regions. Using DNA sequence data of the ribosomal internal transcribed spacer (ITS for many species of the Poa alliance, a group comprising about 775 C3 grass species, revealed rapid and parallel diversifications in various parts of the world. Some of these radiations are restricted to isolated areas like the Andes, whereas others are typical of the lowlands of mainly the northern hemisphere. These radiations thus are not restricted to island-like areas and are seemingly actively ongoing. The ages of the diversifying clades are estimated to be 2.5-0.23 million years (Myr. Conservative diversification rates in the Poa alliance amount to 0.89-3.14 species per Myr, thus are in the order of, or even exceeding, other instances of well-known radiations. The grass radiations of the mainly cold-adapted Poa alliance coincide with the Late Tertiary global cooling, which resulted in the retreat of forests and the subsequent formation of cold-adapted grasslands especially in the northern, but also in parts of the southern hemisphere. The cold tolerance, suggested to be one of the ecological key innovations, may have been acquired during the early diversification of the subfamily Pooideae, but became significant millions of years later during the Pliocene/Pleistocene radiation of the Poa alliance.
Leaf anatomy of the South African Danthonieae (Poaceae. III. Merxmuellera stricta
Directory of Open Access Journals (Sweden)
R. P. Ellis
1980-11-01
Full Text Available The anatomical structure, of the leaf blade as seen in transverse section, and of the abaxial epidermis, of Merxmuellera stricta (Schrad. Conert is described and illustrated. In this variable species four distinct anatomical “forms” are recognized viz. the typical M. stricta form, the Cathedral Peak form, the Drakensberg form and the alpine form. The alpine and Cathedral Peak forms have recently been described as M. guillarmodiae Conert (1975. The degree of anatomical differentiation of these “forms” resembles the situation described in M. disticha (Nees Conert (Ellis, 1980. Populations of both M. stricta and M. disticha from the Drakensberg mountains display extensive anatomical diversification which appears to be correlated with environmental factors. In addition, morphological differences are exhibited as well and the anatomical “forms” of M. stricta probably warrant taxonomic recognition.
Leaf anatomy of the South African Danthonieae (Poaceae. XV. The genus Elytrophorus
Directory of Open Access Journals (Sweden)
R. P. Ellis
1986-10-01
Full Text Available The leaf anatomy of Elytrophorus globularis Hack, and E. spicatus (Willd. A. Camus is described and illustrated from freshly fixed material from SWA/Namibia and Botswana. It is shown that these two species are anatomically indistinguishable. It is suggested that they are conspecific. and that E. spicatus possibly represents juvenile plants with immature inflorescences. The anatomical evidence strongly refutes a chloridoid relationship for Elytrophorus but appears to support arundinoid affinities for the genus. Striking anatomical and ecological similarities exist between Elytrophorus and Sacciolepis huillensis (Rendle Stapf. No significant leaf anatomical differences separate Elytrophorus from S. huillensis and some of the other C3 panicoid taxa and. consequently, Elytrophorus may represent a link between the Arundinoideae and the Panicoideae.
Studies upon morhological and biological traits of Festuca rubra, subsp.fallax (Poaceae
Directory of Open Access Journals (Sweden)
Bogusław Sawicki
2013-12-01
Full Text Available Observation and measurements of some traits of Festuca rubra L., subsp. fallax (Thuill. Hack. ecotypes were made in 1995-1997 using samples selected from natural habitats and collected in Grassland Experimental Station in Sosnowica. High differentiation of traits under study and their correlations were found. Valorized ecotypes are good material for new varieties breeding.
Nota sobre EL GÉNERO Imperata (Poaceae, Panicoideae, Sacchareae en Argentina
Directory of Open Access Journals (Sweden)
Myriam C. Peichoto
2013-01-01
Full Text Available En este trabajo se confirma la presencia de Imperata tenuis en Argentina. Se presenta una ilustración, material de referencia y un mapa de su distribución geográfica en el sur de Sudamérica. Se incluye una clave para identificar las especies del género Imperata presentes en la Argentina.
Chiang, Yu-Chung; Tsai, Chi-Chu; Hsu, Tsai-Wen; Chou, Chang-Hung
2012-11-01
Microsatellite loci were developed from Imperata cylindrica, a traditional medicinal herb in Asia and among the top 10 worst invasive weeds in the world, to aid in the identification of the limits of asexual clonal individuals. A total of 21 microsatellite markers, including 18 polymorphic and three monomorphic loci, were developed from I. cylindrica using a magnetic bead enrichment protocol. The primers amplified dinucleotide, trinucleotide, and complex repeats. The number of alleles ranged from one to 19 per locus, with an observed heterozygosity ranging from 0.09 to 1.00. Several loci deviated significantly from the within-population Hardy-Weinberg equilibrium as a result of asexual clonal reproduction. These polymorphic markers should be useful tools in further studies on the identification of the range of clonal reproduction units and the selection and classification of the medicinal cultivar.
The effect of the external medium on the gravitropic curvature of rice (Oryza sativa, Poaceae) roots
Staves, M. P.; Wayne, R.; Leopold, A. C.
1997-01-01
The roots of rice seedlings, growing in artificial pond water, exhibit robust gravitropic curvature when placed perpendicular to the vector of gravity. To determine whether the statolith theory (in which intracellular sedimenting particles are responsible for gravity sensing) or the gravitational pressure theory (in which the entire protoplast acts as the gravity sensor) best accounts for gravity sensing in rice roots, we changed the physical properties of the external medium with impermeant solutes and examined the effect on gravitropism. As the density of the external medium is increased, the rate of gravitropic curvature decreases. The decrease in the rate of gravicurvature cannot be attributed to an inhibition of growth, since rice roots grown in 100 Osm/m3 (0.248 MPa) solutions of different densities all support the same root growth rate but inhibit gravicurvature increasingly with increasing density. By contrast, the sedimentation rate of amyloplasts in the columella cells is unaffected by the external density. These results are consistent with the gravitational pressure theory of gravity sensing, but cannot be explained by the statolith theory.
Characterization and multiplexing of EST-SSR primers in Cynodon (Poaceae) species1.
Jewell, Margaret C; Frere, Celine H; Prentis, Peter J; Lambrides, Christopher J; Godwin, Ian D
2010-10-01
Cynodon species are multiple-use grasses that display varying levels of adaptation to biotic and abiotic stress. Previously identified EST-SSR primers were characterized and multiplexed to assess the level of genetic diversity present within a collection of almost 1200 Cynodon accessions from across Australia. • Two multiplex reactions were developed comprising a total of 16 EST-SSR markers. All SSR markers amplified across different Cynodon species and different levels of ploidy. The number of alleles ranged from one to eight per locus and the total number of alleles for the germplasm collection was 79. • The 16 markers show sufficient variation for the characterization of Cynodon core collections and analysis of population genetic diversity in Cynodon grasses.
International Nuclear Information System (INIS)
Canas, Diego Giraldo
2010-01-01
The checklist of grasses from Colombian Guayana is presented. In all, 152 species, 69 genera, and six subfamilies were recorded. Thus, in the Colombian Guayana is represented the 18.7 and 43.7% of the species and genera of Colombian grasses, respectively. The subfamilies with the highest number of species were Panicoideae (110 species/46 genera), Chloridoideae (21/9), and Bambusoideae (11/9). The most diverse genera were Paspalum (19 species), Panicum (16), Axonopus (14), Eragrostis (9), and Digitaria (8). Nineteen species are introduced and naturalized in the Colombian Guayana, which represent 12.5% of the agrostological flora for the Colombian Guayana. There were 8 endemic species (5.3% of Colombian Guayanan grasses). In addition, some species are reported for the first time for Colombian flora (belonging to Axonopus, Cyphonanthus, Gymnopogon, and Paspalum), and some species are new to science (belonging to Axonopus, Digitaria, Eragrostis, and Sacciolepis). On the other hand, some preliminary biogeographical aspect are analyzed Flora of Colombia,
International Nuclear Information System (INIS)
Giraldo Canas, Diego
2010-01-01
The checklist of grasses from Colombian Guyana is presented. In all, 152 species, 69 genera, and six subfamilies were recorded. Thus, in the Colombian Guyana is represented the 18.7 and 43.7% of the species and genera of Colombian grasses, respectively. The subfamilies with the highest number of species were Panicoideae (110 species/46 genera), Chloridoideae (21/9), and Bambusoideae (11/9). The most diverse genera were Paspalum (19 species), Panicum (16), Axonopus (14), Eragrostis (9), and Digitaria (8). Nineteen species are introduced and naturalized in the Colombian Guyana, which represent 12.5% of the agrostological flora for the Colombian Guyana. There were 8 endemic species (5.3% of Colombian Guayanan grasses). In addition, some species are reported for the first time for Colombian flora (belonging to Axonopus, Cyphonanthus, Gymnopogon, and Paspalum), and some species are new to science (belonging to Axonopus, Digitaria, Eragrostis, and Sacciolepis). On the other hand, some preliminary biogeographical aspect are analyzed.
Embryo sac development in some representatives of the tribe Cynodonteae (Poaceae
Directory of Open Access Journals (Sweden)
A. Strydom
1994-10-01
Full Text Available Chloris virgata Sw., Cynodon dactylon (L. Pers., Harpochloa falx (L. f. Kuntze, and Tragus berteronianus Schult. have a Polygonum type of embryo sac development. Unreduced embryo sacs were found in Eustachys paspaloides (Vahl Lanza & Mattei, Harpochloa falx, and Rendlia altera (Rendle Chiov. Both facultative and obligate apomixis were observed. The Hieracium type of embryo sac development was observed in the aposporic specimens.
El género Chloris Sw. (Poaceae: Chloridoideae) en México
Cerros-Tlatilpa, Rosa; Siqueiros Delgado, María Elena; Skendzic, Elizabeth M.
2015-01-01
En este estudio se reconocen 12 especies de Chloris para el territorio de la República. Cinco son cosmopolitas, cinco americanas y dos de ellas se restringen a México y E.U.A., una está en América y en Australia, mientras que C. truncata se reporta por primera vez de nuestro país. Chloris barbata, C. gayana y C. virgata son consideradas invasoras para el país. Se incluye una clave para su identificación, descripciones y mapas de distribución. El género ocupa una variedad de hábitats, desde zo...
Embryo sac development in some representatives of the tribe Cynodonteae (Poaceae)
A. Strydom; J. J. Spies
1994-01-01
Chloris virgata Sw., Cynodon dactylon (L.) Pers., Harpochloa falx (L. f.) Kuntze, and Tragus berteronianus Schult. have a Polygonum type of embryo sac development. Unreduced embryo sacs were found in Eustachys paspaloides (Vahl) Lanza & Mattei, Harpochloa falx, and Rendlia altera (Rendle) Chiov. Both facultative and obligate apomixis were observed. The Hieracium type of embryo sac development was observed in the aposporic specimens.
Ultraestructura del bambú Guadua paniculata (Poaceae: Bambusoideae de Costa Rica
Directory of Open Access Journals (Sweden)
Mayra Montiel
2006-06-01
Full Text Available Se evaluaron características ultraestructurales de la lámina y la bráctea de la hoja, así como de las ramas, de plantas adultas de Guadua paniculata recolectadas en Costa Rica. Sus características ultraestructurales diagnósticas incluyen el patrón celular de la zona adaxial de la lámina foliar, los largos tricomas unicelulares de la superficie abaxial, los más numerosos tricomas auriculares, agrupados en número de 17, el patrón de cera cuticular y las bandas de estomas rodeadas de papilas céricas.Sections of leaf lamina, leaf sheath and branches of adult Guadua paniculata collected in Costa Rica, were studied ultrastructurally. Diagnostic ultrastructural characteristics include the cellular pattern of the adaxial zone in the leaf blade; the large unicellular trichomes of the abaxial area, the more numerous auricular trichomes, grouped in number of 17, the pattern of cuticular wax and the bands of stomata surrounded by ceric papillae. Rev. Biol. Trop. 54(Suppl. 2: 29-34. Epub 2006 Dec. 01.
Directory of Open Access Journals (Sweden)
Ethel Sánchez
2003-06-01
Full Text Available The wild rice species Oryza latifolia is endemic to Tropical America, allotetraploid and has a CCDD genome type. It belongs to the officinalis group of the genus Oryza. This species is widely distributed through-out the lowlands of Costa Rica and it is found on different life zones, having great morphologic diversity. The purpose of this research is to perform a morphologic description of O. latifolia samples of three Costa Rican localities (Carara, Liberia and Cañas and to see if the phenotypic diversity of the species is reflected at the ultra-structure level. Structures such as the leaf blade, ligule, auricles and spikelet were analyzed. Leaf blade morphology of the specimens from the three localities is characterized by the presence of diamond-shaped stomata with papillae, zipper-like rows of silica cells; a variety of evenly distributed epicuticular wax papillae and bulky prickle trichomes. The central vein of the leaf blade from the Cañas populations is glabrous, while those from Carara and Liberia have abundant papillae. There are also differences among the borders of the leaf blade between these locations. Cañas and Liberia present alternating large and small prickle trichomes ca. 81 and 150 µm, while Carara exhibits even sized prickle trichomes of ca. 93 µm. Auricles from Cañas are rectangular and present long trichomes along the surface ca. 1.5 mm, while those of Liberia and Carara wrap the culm and exhibit trichomes only in the borders. The ligule from the plants of Carara has an acute distal tip, while that of Cañas and Liberia is blunt. The Liberia spikelet has large lignified spines while Cañas and Carara show flexible trichomes.La especie silvestre Oryza latifolia es endémica de América, tetraploide y de genoma CCDD. Pertenece a las especies del género Oryza del grupo officinalis. Presenta una amplia distribución en las tierras bajas de Costa Rica y se le encuentra en varias zonas de vida, mostrando una gran diversidad morfológica. El propósito de este trabajo fue realizar una descripción ultraestructural de plantas de O. latifolia provenientes de las localidades Carara, Liberia y Cañas con el fin de determinar si hay variación intrapo-blacional. Se analizó la lámina foliar, lígula, aurículas y espiguilla, con énfasis en las estructuras de valor taxonómico. La morfología de la lámina foliar de los especímenes de las tres localidades se caracteriza por la presencia de estomas romboidales con papilas, células de sílice de forma crenada, variedad de papilas de cera, distribuidas en forma regular y tricomas espinosos abultados de ca 53 µm. La vena central de la lámina foliar de O. latifolia, localidad Cañas, es lisa, mientras que en Carara y Liberia presenta papilas. Los bordes de la lámina foliar difieren entre localidades; Cañas y Liberia presentan tricomas ganchudos grandes de ca. 150 µm y pequeños de ca 81 µm que alternan, mientras que Carara tiene tricomas ganchudos pequeños de igual tamaño (ca. 93 µm. Las aurículas de Cañas son rectangulares y presentan tricomas atenuados largos de ca. 1.5mm en toda la superficie, mientras las de Liberia y Carara son envolventes y presentan dichos tricomas solamente en los bordes. La lígula de Carara tiene el extremo distal agudo, mientras que Cañas y Liberia lo tienen truncado. La espiguilla de Liberia presenta tricomas espinosos lignificados grandes, mientras que Cañas y Carara tienen tricomas flexibles.
Directory of Open Access Journals (Sweden)
Mayra Montiel
2006-06-01
Full Text Available Se estudió la ultraestructura anatómica de la lámina y la vaina de la hoja, así como de la bráctea del culmo, de Guadua angustifolia var. bicolor, por medio del microscopio electrónico de barrido. Se encontraron similitudes con otras guaduas: estomas de alto domo, células largas con paredes sinuosas y células de sílice. Son propios de la var. bicolor el patrón estomático en la zona abaxial de la hoja cerca de la vaina, con la presencia de gran cantidad de tricomas ganchudos y sin papilas; las brácteas de color café dorado que cubren los culmos y tienen tricomas papilares que cubren el haz; y el abundante número de tricomas auriculares, en grupos de 12.The anatomy of several parts of Guadua angustifolia var. bicolor was analyzed and characterized under a scanning electron icroscope. any similarities ere observed with other Guadua species, particularly the presence of high dome stomata, of large cells with sinuous walls and of silica cells. Specific bicolor characteristics include (1 a different stomatal pattern in the adaxial zone of the leaf base (close to the sheath; (2 the abundance of hook-sshaped trichomes without papilla; (3 the distinctive golden brown color of the bract that covers the culm (caused by papillar trichomes that cover the adaxial sheath; and (4 the size of the groups of auricular trichomes (formed by 12 trichomes. Rev. Biol. Trop. 54(Suppl. 2: 13-19. Epub 2006 Dec. 01.
LAS ESPECIES COLOMBIANAS DEL GÉNERO DIGITARIA (POACEAE: PANICOIDEAE: PANICEAE
Directory of Open Access Journals (Sweden)
GIRALDO-CAÑAS DIEGO
2005-06-01
Full Text Available Se presenta un estudio sistemático, macro y micromorfológico de las especies colombianas del género Digitaria. Se analizan diversos aspectos relativos a la clasificación, la nomenclatura, las afinidades genéricas y la variación macro y micromorfológica de los caracteres, así como algunos aspectos anatómicos de la espiguilla y el antecio superior. El género Digitaria está representado en Colombia por 18 especies distribuidas en cinco secciones: Digitaria sect. Calvulae (una especie, Digitaria sect. Digitaria (siete especies, Digitaria sect. Ischaemum (tres especies, Digitaria sect. Ternatae (cuatro especies y Digitaria sect. Trichachne (tres especies. Dos especies son endémicas de Colombia (Digitaria cardenasiana y Digitaria andicola. Las especies Digitaria argillacea, Digitaria neesiana y Digitaria fragilis se excluyen de la flora de Colombia. Se presentan las claves para reconocer las secciones y las especies presentes en Colombia, así como también las descripciones de éstas, la iconografía, los usos, los nombres vulgares, la distribución geográfica y se comentan algunas observaciones morfológicas y ecológicas. Se documenta la presencia de espiguillas trifloras en el género Digitaria, situación observada en las especies Digitaria dioica y Digitaria nuda.
Directory of Open Access Journals (Sweden)
Carla Maria Garlet de Pelegrin
2009-09-01
Full Text Available O objetivo deste trabalho foi verificar a importância da anatomia foliar, visando a fornecer subsídios para a taxonomia do Complexo Briza, cuja circunscrição vem sendo objeto de discussão. Porções medianas da segunda folha abaixo da inflorescência de 21 táxons do Complexo Briza e um de Erianthecium Parodi foram coletadas, fixadas e processadas de acordo com a metodologia usual em microscopia óptica. Todas as espécies estudadas apresentam padrão anatômico festucóide, característico de gramíneas C3. Os resultados mostram que os caracteres da face abaxial da epiderme relativos à presença/ausência de células suberosas e à forma dos corpos silicosos são úteis para compreender as relações taxonômicas no Complexo Briza, distinguindo as espécies eurasiáticas das americanas. Da mesma forma, alguns caracteres da secção transversal da lâmina foliar como forma da lâmina, quantidade de esclerênquima e estrutura do mesofilo. Por outro lado, com relação às espécies americanas do Complexo Briza, os três agrupamentos aqui obtidos não correspondem a nenhuma proposta anterior de categorias taxonômicas genéricas ou infragenéricas.The aim of this study was to analyze leaf anatomy of selected taxa of the Briza Complex and also of a related genus, Erianthecium Parodi, to provide data for the taxonomy of the Complex, whose circumscription is being discussed. Middle portions of the second leaf below the inflorescence of 21 taxa of the Briza Complex and of Erianthecium bulbosum were collected, fixed and processed according to conventional methodology for light microscopy. All species present anatomical patterns typical of festucoid and C3 grasses. The results suggest that the characters of the abaxial surface of the epidermis such as presence/absence of cork cells and shape of silica bodies are useful for understanding the taxonomic relationships within the Briza Complex, distinguishing Eurasiatic species from American species. The same applies to several characters of the leaf blade in cross-section, e.g. blade shape, amount of sclerenchyma and structure of the mesophyll. On the other hand, in the American species of the "Briza Complex", the three groups obtained here do not agree with any previous proposal of generic or infrageneric taxonomic categories.
Remarks on the thermopreferendum of palearctic bats in their natural habitats
Gaisler, Jiří
1970-01-01
This contribution comprises two remarks of ecological rather than physiological character. Contrary to Herter (1952), Herreid (1967), and Harmata (1969), I did not examine the temperature preference, or thermopreferendum, of bats under experimental conditions but concluded on it only on grounds of
DEFF Research Database (Denmark)
Petersen, Gitte; Seberg, Ole; Aagesen, Lone
2004-01-01
The ability of the program POY, implementing optimization alignment, to deal with major indels is explored and discussed in connection with a phylogenetic analysis of the genus Secale based on partial Adhl sequences. The Adhl sequences used span exon 2-4. Nearly all variation is found in intron 2...... recovers both genera as monophyletic when knowledge of the duplication is incorporated in the analysis. The phylogenetic relationships within Secale are not clearly resolved. Subspecific taxa of Secale strictum have identical sequences and they are confined to a monophyletic group. However, the two...
DEFF Research Database (Denmark)
Friis, Ib; Phillips, Sylvia M.; Gilbert, Michael G.
2011-01-01
During recent field work by Ib Friis and Sally Bidgood six collections were collected that did not represent taxa accounted for in the Flora of Ethiopia and Eritrea. These were Phyllanthus chevalieri, Indigofer bracteolata, Wahlenbergia paludicola, Clerodendrum triflorum, Tragus mongolorum and Hy...
Autotetraploidia e número cromossómico em uma cultivar de Panicum maximum Jacq. (Gramineae / Poaceae
Directory of Open Access Journals (Sweden)
Caetano Creuci Maria
2006-06-01
Full Text Available
O presente trabalho teve por objetivo avaliar o comportamento citológico e em especial o nível de ploidia de uma cultivar de P. maximum, denominada Tanzânia, que, na realidade, é um ecótipo selvagem de origem africana. Foi empregada a metodologia convencional para estudos meióticos. As inflorescências foram fixadas em álcool acético 3:1 por 24 horas, transferidas para álcool a 70% e conservadas sob refrigeração. A técnica de esmagamento foi usada no preparo das lâminas. O corante foi o carmim propiônico a 1%. Foi considerado um mínimo de 200 células por planta. De forma geral, anormalidades meióticas ocorreram em 20% das células mães de pólen analisadas. Em todas as plantas avaliadas, o número de cromossomos observado nas diacineses foi 36. Entre 109 diacineses onde se realizou a contagem do número de cromossomos e se verificou os tipos de associações cromossômicas, 99 apresentaram multivalentes, com predomínio de tetravalentes. Tal ocorrência indica autotetraploidia, onde 2n=4x=36.
Palavras-chave: associações cromossômicas multivalentes, autotetraplóide, cv. Tanzânia, número cromossômico.
Czech Academy of Sciences Publication Activity Database
Paštová, Ladislava
2017-01-01
Roč. 23, č. 2 (2017), s. 187-198 ISSN 1310-7771 Institutional support: RVO:67985939 Keywords : hybrid * leaf blade selection * micromorphology Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany
Saeidi, Hojjatollah; Rahiminejad, Mohammad Reza; Heslop-Harrison, J S
2008-04-01
The diploid goat grass Aegilops tauschii (2n = 2x = 14) is native to the Middle East and is the D-genome donor to hexaploid bread wheat. The aim of this study was to measure the diversity of different subspecies and varieties of wild Ae. tauschii collected across the major areas where it grows in Iran and to examine patterns of diversity related to the taxa and geography. Inter-retroelement amplified polymorphism (IRAP) markers were used to analyse the biodiversity of DNA from 57 accessions of Ae. tauschii from northern and central Iran, and two hexaploid wheats. Key Results Eight IRAP primer combinations amplified a total of 171 distinct DNA fragments between 180 and 3200 bp long from the accessions, of which 169 were polymorphic. On average, about eight fragments were amplified with each primer combination, with more bands being amplified from accessions from the north-west of the country than from other accessions. The IRAP markers showed high levels of genetic diversity. Analysis of all accessions together did not allow the allocation of individuals to taxa based on morphology, but showed a tendency to put accessions from the north-west apart from others regions. It is speculated that this could be due to different activity of retroelements in the different regions. Within the two taxa with most accessions, there was a range of IRAP genotypes that could be correlated closely with geographical origin. This supports suggestions that the centre of origin of the species is towards the south-east of the Caspian Sea. IRAP is an appropriate marker system to evaluate genetic diversity and evolutionary relationships within the taxa, but it is too variable to define the taxa themselves, where more slowly evolving morphological, DNA sequence or chromosomal makers may be more appropriate.
Directory of Open Access Journals (Sweden)
A.C.C.F.F. De Paula
2005-06-01
Full Text Available ß-Glucans are soluble fibers with physiological functions, such as interference with absorption of sugars and reduction of serum lipid levels. The objective of the present study was to analyze the distribution of ß-glucans in different tissues of the African grass species Rhynchelytrum repens and also to evaluate their hypoglycemic activity. Leaf blades, sheaths, stems, and young leaves of R. repens were submitted to extraction with 4 M KOH. Analysis of the fractions revealed the presence of arabinose, glucose, xylose, and traces of rhamnose and galactose. The presence of ß-glucan in these fractions was confirmed by hydrolyzing the polymers with endo-ß-glucanase from Bacillus subtilis, followed by HPLC analysis of the characteristic oligosaccharides produced. The 4 M KOH fractions from different tissues were subjected to gel permeation chromatography on Sepharose 4B, with separation of polysaccharides with different degrees of polymerization, the highest molecular mass (above 2000 kDa being found in young leaves. The molecular mass of the leaf blade polymers was similar (250 kDa to that of maize coleoptile ß-glucan used for comparison. The 4 M KOH fraction injected into rats with streptozotocin-induced diabetes showed hypoglycemic activity, reducing blood sugar to normal levels for approximately 24 h. This performance was better than that obtained with pure ß-glucan from barley, which decreased blood sugar levels for about 4 h. These results suggest that the activity of ß-glucans from R. repens is responsible for the use of this plant extract as a hypoglycemic drug in folk medicine.
Taxonomy and leaf anatomy of the genus Ehrharta (Poaceae) in southern Africa: the Dura group
G. E. Gibbs Russel; R. P. Ellis
1988-01-01
The Dura species group in the genus Ehrharta Thunb. is differentiated morphologically by the perennial habit and the very large, awned, subglabrous spikelets and anatomically by the occurrence of tanniniferous cells and wax platelets obscuring the stomatal pores. The Dura group consists of two species, E. dura Nees ex Trin. and E. microlaena Nees ex Trin., which occur only in Mountain Fynbos. The group shows no clear morphological or anatomical relationship with other species groups in the ge...
Directory of Open Access Journals (Sweden)
Paszko Beata
2016-07-01
Full Text Available Deyeuxia nyingchiensis is here recombined as Calamagrostis nyingchiensis comb. nov. as a result of recent studies of worldwide Agrostidinae. A new record of C. nyingchiensis is reported from Shangri-la (Zhongdian County in Yunnan Province, SW China. Previously, C. nyingchiensis was noted from eastern Xizang and southern Sichuan, SW China. It is compared with the morphologically similar species C. scabrescens. A map with all known geographic records of C. nyingchiensis is presented.
Directory of Open Access Journals (Sweden)
Mayra Montiel
2006-06-01
Full Text Available Utilizando el microscopio electrónico de barrido, se evaluaron ultraestructuralmente, culmo joven (dos años de edad, brácteas del culmo, yemas, superficie abaxial de la lámina foliar y flores de Dendrocalamus latiflorus, un bambú susceptible a cambios bruscos de temperatura y precipitación, que lo hacen florecer con facilidad. Los rasgos más notables fueron la presencia de dos tipos de células operculadas en las glumas estériles de las flores, la abundancia de cera cuticular, la presencia de puntuaciones reticuladas en el xilema y los granos de polen especializados, por la presencia de discos o ventosas para su acople. Las células operculadas y los discos de acople son caracteres taxonómicos importantes.The bamboo Dendrocalamus latiflorus is easily affected by sudden changes in temperature and humidity, which cause it to bloom. We used a scanning electron microscope to describe the ultrastructure of young culm (2 years old, culm bracts, buds, abaxial surface of the leaf lamina and flowers. The most noticeable ultrastructural features were the presence of two types of operculated cells in the sterile flower glums, the abundant cuticular wax, the presence of reticulated punctuations in the xylem and pollen grains with interlocking disks or cups. The operculated cells and the interlocking disks are taxonomically important features. Rev. Biol. Trop. 54(Suppl. 2: 43-50. Epub 2006 Dec. 01.
Clavet, Christopher; Requintina, Matthew; Hampton, Emily; Cowles, Richard S; Byrne, Frank J; Alm, Steven R
2014-12-01
Competitive enzyme-linked immunosorbent assay was used to quantify the amounts of the neonicotinoids clothianidin and imidacloprid in Poa annua L. clippings from treated golf course fairways. Average clothianidin residues 7 d after application ranged from 674 to 1,550 ng/g tissue in 2012 and 455-2,220 ng/g tissue in 2013. Average clothianidin residues the day of application ranged from 17,100-38,800 ng/g tissue in 2014. Average imidacloprid residues 7 d after treatment ranged from 1,950-3,030 ng/g tissue in 2012 and 7,780-9,230 ng/g tissue in 2013. Average imidacloprid residues the day of application ranged from 31,500-40,400 ng/g tissue in 2014. Neonicotinoid or bifenthrin-neonicotinoid combination products applied in field plots in 2012 did not significantly reduce the numbers of larvae relative to the untreated control. However, in 2013, statistically significant reductions in the numbers of larvae recovered from treated field plots were associated with the presence of bifenthrin alone or when used in combination with neonicotinoid active ingredients. Listronotus maculicollis (Kirby) adults caged on neonicotinoid-, bifenthrin-, and bifenthrin-neonicotinoid-treated P. annua turf plugs fed on P. annua leaves, but mortality was only highly significantly different between treated and untreated foliage when weevils were placed on treated foliage the day after treatment and allowed to feed for 7 d. The modest degree of population suppression with bifenthrin in these experiments may not be adequate to justify the continued use of these products due to the increased risk of insecticide resistance and disruption of biological control. © 2014 Entomological Society of America.
Directory of Open Access Journals (Sweden)
Xing Fan
Full Text Available The level and pattern of nucleotide variation in duplicate gene provide important information on the evolutionary history of polyploids and divergent process between homoeologous loci within lineages. Kengyilia is a group of allohexaploid species with the StYP genomic constitutions in the wheat tribe. To investigate the evolutionary dynamics of the Pgk1 gene in Kengyilia and its diploid relatives, three copies of Pgk1 homoeologues were isolated from all sampled hexaploid Kengyilia species and analyzed with the Pgk1 sequences from 47 diploid taxa representing 18 basic genomes in Triticeae. Sequence diversity patterns and genealogical analysis suggested that (1 Kengyilia species from the Central Asia and the Qinghai-Tibetan plateau have independent origins with geographically differentiated P genome donors and diverged levels of nucleotide diversity at Pgk1 locus; (2 a relatively long-time sweep event has allowed the Pgk1 gene within Agropyron to adapt to cold climate triggered by the recent uplifts of the Qinghai-Tibetan Plateau; (3 sweep event and population expansion might result in the difference in the d(N/d(S value of the Pgk1 gene in allopatric Agropyron populations, and this difference may be genetically transmitted to Kengyilia lineages via independent polyploidization events; (4 an 83 bp MITE element insertion has shaped the Pgk1 loci in the P genome lineage with different geographical regions; (5 the St and P genomes in Kengyilia were donated by Pseudoroegneria and Agropyron, respectively, and the Y genome is closely related to the Xp genome of Peridictyon sanctum. The interplay of evolutionary forces involving diverged natural selection, population expansion, and transposable events in geographically differentiated P genome donors could attribute to geographical differentiation of Kengyilia species via independent origins.
DEFF Research Database (Denmark)
Petersen, Gitte; Seberg, Ole; Baden, Claus
2004-01-01
A phylogenetic analysis of the small, Central Asian genus Psathyrostachys Nevski is presented. The analysis is based on morphological characters and nucleotide sequence data from one nuclear gene, DMC1, and three plastid genes, rbcL, rpoA, and rpoC2. Separate analyses of the three data partitions...... (morphology, nuclear sequences, and plastid sequences) result in mostly congruent trees. The plastid and nuclear sequences produce completely congruent trees, and only the trees based on plastid sequences and morphological characters are incongruent. Combined analysis of all data results in a fairly well......-resolved strict consensus tree: Ps. rupestris is the sister to the remaining species, which are divided into two clades: one including Ps. fragilis and Ps. caduca, the other including Ps. juncea, Ps. huashanica, Ps. lanuginosa, Ps. stoloniformis, and Ps. kronenburgii. Pubescent culms and more than 20 mm long...
Azevedo, A L S; Costa, P P; Machado, M A; de Paula, C M P; Sobrinho, F S
2011-11-17
The grasses of the genus Brachiaria account for 80% of the cultivated pastures in Brazil. Despite its importance for livestock production, little information is available for breeding purposes. Embrapa has a population of B. ruziziensis from different regions of Brazil, representing most of existing variability. This population was used to initiate an improvement program based on recurrent selection. In order to assist the genetic improvement program, we estimated the molecular variability among 93 genotypes of Embrapa's collection using ISSR (inter-simple sequence repeat) markers. DNA was extracted from the leaves. Twelve ISSR primers generated 89 polymorphic bands in the 93 genotypes. The number of bands identified by each primer ranged from two to 13, with a mean of 7.41. Cluster analysis revealed a clearly distinct group, containing most of the B. ruziziensis genotypes apart from the outgroup genotypes. Genetic similarity coefficients ranged from 0.0 to 0.95, with a mean of 0.50 and analysis of molecular variance indicated higher variation within (73.43%) than among species (26.57%). We conclude that there is a high genetic diversity among these B. ruziziensis genotypes, which could be explored by breeding programs.
Huang, L-K; Zhang, X-Q; Xie, W-G; Zhang, J; Cheng, L; Yan, H D
2012-08-16
Hemarthria compressa is one of the most important and widely utilized forage crops in south China, owing to its high forage yield and capability of adaptation to hot and humid conditions. We examined the population structure and genetic variation within and among 12 populations of H. compressa in south China using sequence-related amplified polymorphism (SRAP) markers. High genetic diversity was found in these samples [percentage polymorphic bands (PPB) = 82.21%, Shannon's diversity index (I) = 0.352]. However, there was relatively low level of genetic diversity at the population level (PPB = 29.17%, I = 0.155). A high degree of genetic differentiation among populations was detected based on other measures and molecular markers (Nei's genetic diversity analysis: G(ST) = 54.19%; AMOVA analysis: F(ST) = 53.35%). The SRAP markers were found to be more efficient than ISSR markers for evaluating population diversity. Based on these findings, we propose changes in sampling strategies for appraising and utilizing the genetic resources of this species.
Czech Academy of Sciences Publication Activity Database
Dierking, R.; Azhaguvel, P.; Kallenbach, R.; Saha, M.; Bouton, J.; Chekhovskiy, K.; Kopecký, David; Hopkins, A.
2015-01-01
Roč. 8, č. 1 (2015) ISSN 1940-3372 Institutional support: RVO:61389030 Keywords : FESTUCA-ARUNDINACEA SCHREB. * DIVERSITY ARRAYS TECHNOLOGY * SIMPLE SEQUENCE REPEATS Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.509, year: 2015
Directory of Open Access Journals (Sweden)
M. Stella Colomba
2011-06-01
Full Text Available For the first time, the durum wheat Graziella Ra was compared to four Italian durum wheat varieties (Cappelli,Grazia, Flaminio and Svevo and to Kamut in order to preliminary characterize its genome and to investigategenetic diversity among and within the accessions by Amplified Fragment Length Polymorphisms (AFLPs,Simple Sequence Repeats (SSRs and α-gliadin gene sequence analysis. The main aim of the study was anattempt to determine the relationship between the historic accession Graziella Ra and Kamut which isconsidered an ancient relative of the durum subspecies. In addition, nutritional factors of Graziella Ra werereported. Obtained results showed that (i both AFLP and SSR molecular markers detected highly congruentpatterns of genetic diversity among the accessions showing nearly similar efficiency; (ii for AFLPs,percentage of polymorphic loci within accession ranged from 6.57% to 19.71% (mean 12.77% and, for SSRs,from 0% to 57.14% (mean 28.57%; (iii principal component analysis (PCA of genetic distance amongaccessions showed the first two axes accounting for 58.03% (for AFLPs and 61.60% (for SSRs of the totalvariability; (iv for AFLPs, molecular variance was partitioned into 80% (variance among accessions and 20%(within accession and, for SSRs, into 73% (variance among accessions and 27% (within accession; (vcluster analysis of AFLP and SSR datasets displayed Graziella Ra and Kamut into the same cluster; and (vimolecular comparison of α-gliadin gene sequences showed Graziella Ra and Kamut in separate clusters. Allthese findings indicate that Graziella Ra, although being very similar to Kamut, at least in the little part of thegenome herein investigated by molecular markers, may be considered a distinct accession showing appreciablelevels of genetic diversity and medium-high nutritional qualities.
Directory of Open Access Journals (Sweden)
Dominique C. K. Sohounhloué
2010-12-01
Full Text Available In this paper, the insecticidal activities on Anopheles gambiae spp of the essential oils (EO extracted from the dry leaves of some species collected in Benin were studied. The essential oil yields are 2.8, 1.7 and 1.4�0respectively for Cymbopogon schoanenthus (L. Spreng (CS, Cymbopogon citratus Stapf. (CC and Cymbopogon giganteus (Hochst. Chiov (CG. The GC/MS analysis showed that the EO of CS had a larger proportion in oxygenated monoterpenes (86.3�20whereas those of the sheets of CC and CG are relatively close proportions (85.5�0and 82.7�0respectively with. The piperitone (68.5� 2-carene (11.5� and -eudesmol (4.6�20are the major components of the EO of CS while trans para-mentha-1(7,8-dien-2-ol (31.9� trans para-mentha-2,8-dien-1-ol (19.6� cis para-mentha-2,8-dien-1-ol (7.2� trans piperitol (6.3�20and limonene (6.3�20prevailed in the EO of CG. The EO of CC revealed a rich composition in geranial (41.3� neral (33� myrcene (10.4� and geraniol (6.6� The biological tests have shown that these three EO induced 100�0mortality of Anopheles gambiae to 1.1, 586.58 and 1549 µg•cm-2 respectively for CC, CS and CG. These effects are also illustrated by weak lethal concentration for 50�0anopheles population (CC: 0.306; CS: 152.453 and CG: 568.327 µg•cm-2 in the same order of reactivity. The EO of CC appeared most active on two stocks (sensitive and resistant of Anopheles gambiae.
Doust, Andrew N; Kellogg, Elizabeth A
2006-04-01
Many domesticated crops are derived from species whose life history includes weedy characteristics, such as the ability to vary branching patterns in response to environmental conditions. However, domesticated crop plants are characterized by less variable plant architecture, as well as by a general reduction in vegetative branching compared to their progenitor species. Here we examine weedy green millet and its domesticate foxtail millet that differ in the number of tillers (basal branches) and axillary branches along each tiller. Branch number in F(2:3) progeny of a cross between the two species varies with genotype, planting density, and other environmental variables, with significant genotype-environment interactions (GEI). This is shown by a complex pattern of reaction norms and by variation in the pattern of significant quantitative trait loci (QTL) amongst trials. Individual and joint analyses of high and low density trials indicate that most QTL have significant GEI. Dominance and epistasis also explain some variation in branching. Likely candidate genes underlying the QTL (based on map position and phenotypic effect) include teosinte branched1 and barren stalk1. Phytochrome B, which has been found to affect response to shading in other plants, explains little or no variation. Much variation in branching is explained by QTL that do not have obvious candidate genes from maize or rice.
Directory of Open Access Journals (Sweden)
Andréa Beatriz Mendes-Bonato
2006-01-01
Full Text Available Microsporogenesis was analyzed in an interspecific hybrid between an artificially tetraploidized sexual accession of Brachiaria ruziziensis (R genome and a natural apomictic tetraploid accession of B. brizantha (B genome. Chromosomes associated predominantly as bivalents. From this phase to the end of meiosis, chromosomes presented irregular segregation and abnormal arrangement in the metaphase plate. During metaphase I, in 27.8% of meiocytes, bivalents were distributed in two metaphase plates. In anaphase I, two distinct and typical bipolar spindles were formed. In 29.7% of pollen mother cells, one genome did not divide synchronically, with chromosomes lagging behind or not segregating at all. The second division was very irregular, resulting in polyads. Based on previous results from analysis of a triploid hybrid between these species, where the R genome was eliminated by asynchrony during meiosis, it is suggested that the laggard genome in this hybrid also belongs to B. ruziziensis.
Reinheimer, Renata; Malcomber, Simon T; Kellogg, Elizabeth A
2006-01-01
LEAFY HULL STERILE1 (LHS1) is an MIKC-type MADS-box gene in the SEPALLATA class. Expression patterns of LHS1 homologs vary among species of grasses, and may be involved in determining palea and lemma morphology, specifying the terminal floret of the spikelet, and sex determination. Here we present LHS1 expression data from Eleusine indica (subfamily Chloridoideae) and Megathyrsus maximus (subfamily Panicoideae) to provide further insights into the hypothesized roles of the gene. E. indica has spikelets with three to eight florets that mature acropetally; E. indica LHS1 (EiLHS1) is expressed in the palea and lemma of all florets. In contrast, M. maximus has spikelets with two florets that mature basipetally; M. maximus LHS1 (MmLHS1) is expressed in the palea and lemma of the distal floret only. These data are consistent with the hypothesis that LHS1 plays a role in determining palea and lemma morphology and specifies the terminal floret of basipetally maturing grass spikelets. However, LHS1 expression does not correlate with floret sex expression; MmLHS1 is restricted to the bisexual distal floret, whereas EiLHS1 is expressed in both sterile and bisexual floret meristems. Phylogenetic analyses reconstruct a complex pattern of LHS1 expression evolution in grasses. LHS1 expression within the gynoecium has apparently been lost twice, once before diversification of a major clade within tribe Paniceae, and once in subfamily Chloridoideae. These data suggest that LHS1 has multiple roles during spikelet development and may have played a role in the diversification of spikelet morphology.
Zeng, L; Baird, W V
1999-07-01
Inheritance of resistance to the anti-microtubule dinitroaniline herbicides was investigated in a goosegrass biotype displaying an intermediate level of resistance (I). Reciprocal crosses were made between the I biotype and previously characterized susceptible (S) or resistant (R) biotypes. Eight F(1) hybrids were identified, and F(2) populations were produced by selfing. The dinitroaniline-herbicide response phenotype (DRP) of F(1) plants, and F(2) seedlings was determined using a root-growth bioassay. The DRP of F(1) plants of S × I was "susceptible" (i.e., identical to the S parental plants), and the DRP of F(1) plants of I × R was "intermediate" (i.e., identical to the I parental plants). Nonparental phenotypes were not observed in F(1) plants. Results indicated susceptibility to be dominant over intermediate resistance and intermediate resistance to be dominant over high resistance. Analysis of reciprocal crosses ruled out any role for cytoplasmic inheritance. When treated at the discriminating concentration (e.g., 0.28 ppm oryzalin), F(2) seedlings of S × I were classified as either S or I phenotype, and F(2) seedlings of I × R were classified as either I or R phenotype. Again, nonparental phenotypes were not observed. The 3:1 (S:I or I:R) segregation ratios in F(2) seedlings were consistent across all eight F(2) families. The results show that dinitroaniline herbicide resistance in the I biotype of goosegrass is inherited as a single, nuclear gene. Furthermore, it suggests that dinitroaniline resistance in goosegrass is controlled by three alleles at a single locus (i.e., Drp-S, Drp-i, and Drp-r).
Directory of Open Access Journals (Sweden)
Gang Nie
2014-08-01
Full Text Available The genus Miscanthus has great potential as a biofuel feedstock because of its high biomass, good burning quality, environmental tolerance, and good adaptability to marginal land. In this study, the genetic diversity and the relationship of 24 different natural Miscanthus sinensis populations collected from Southwestern China were analyzed by using 33 pairs of Sequence Related Amplified Polymorphism (SRAP primers. A total of 688 bands were detected with 646 polymorphic bands, an average of 19.58 polymorphic bands per primer pair. The average percentage of polymorphic loci (P, gene diversity (H, and Shannon’s diversity index (I among the 24 populations are 70.59%, 0.2589, and 0.3836, respectively. The mean value of total gene diversity (HT was 0.3373 ± 0.0221, while the allelic diversity within populations (HS was 0.2589 ± 0.0136 and the allelic diversity among populations (DST was 0.0784. The mean genetic differentiation coefficient (Gst = 0.2326 estimated from the detected 688 loci indicated that there was 76.74% genetic differentiation within the populations, which is consistent with the results from Analysis of Molecular Variance (AMOVA analysis. Based upon population structure and phylogenetic analysis, five groups were formed and a special population with mixed ancestry was inferred indicating that human-mediated dispersal may have had a significant effect on population structure of M. sinensis. Evaluating the genetic structure and genetic diversity at morphological and molecular levels of the wild M. sinensis in Southwest China is critical to further utilize the wild M. sinensis germplasm in the breeding program. The results in this study will facilitate the biofuel feedstock breeding program and germplasm conservation.
Koslowsky, S D; Boener, R E
1989-01-01
The effects of Al on Panicum virgatum (switchgrass), a widespread perennial grass, were determined in relation to factors which might interact with Al in the soil. Plants were grown for 8 weeks in sand culture and were treated with 3 Al levels (0.5, 2.0, 5.0 mM), 2 P levels (0.065, 0.161 mM), 2 inoculum types (vesicular-arbuscular mycorrhizal (VAM) inoculum or VAM-free soil inoculum) and 2 inoculum sources (a high Al forest in NY or a low Al forest in Ohio) in a factorial design. Plant growth decreased with increasing Al and increased with increasing P, but the Al effect was less at high P than low P. VAM-inoculated plants outgrew non-VAM plants, especially at low and medium Al levels. Total P and Ca uptake decreased with increasing Al concentration, especially at low P levels. VAM inoculation did not result in increased P uptake at any Al level though VAM plants took up significantly more Ca than non-VAM plants at any Al level. VAM plants had lower tissue Al concentrations and took up less Al than non-VAM plants; Al uptake increased with increasing soil Al in non-VAM plants but not in VAM plants. Plants given inoculum from the high Al site had significantly lower tissue Al than plants given the low Al site inoculum, regardless of VAM status. We conclude that the presence of a VAM infection, moderate levels of soil P, and the source of the inoculum can reduce the effects of soluble Al. We discuss potential physiological and edaphic mechanisms by which Al may be immobilized and Ca availability increased in the presence of VAM fungi and other soil microflora.
DEFF Research Database (Denmark)
Linde-Laursen, I.; Seberg, O.; Frederiksen, S.
1996-01-01
-chromosomes, a metacentric and a submetacentric pair. SAT-chromosomes from one population carried exclusively minute satellites, whereas SAT-chromosomes from another population also carried larger polymorphic satellites, suggesting a geographical differentiation. The existence of four chromosomes with nucleolus forming...
DEFF Research Database (Denmark)
Linde-Laursen, Ib; Bothmer, R. von
1986-01-01
. The patterns of both taxa are polymorphic, supporting that both taxa are outbreeders. The karyotypic characters suggest that P. juncea is more closely related to P. fragilis than either is to P. huashanica. N-banding stains weakly. Silver nitrate staining demonstrates that nucleolus organizers of both species...... have different nucleolus forming capacities. The presence of micronucleoli suggests that both species have an extra unidentified chromosome with nucleolus forming capacity....
Currie, Yaleaka; Moch, John; Underwood, Joshua; Kharabsheh, Hamzah; Quesenberry, Amy; Miyagi, Risa; Thomas, Carolyn; Boney, Melanie; Woods, Samantha; Chen, Ming-Shun; Zhu, Lieceng
2014-02-01
Heat stress exerts a profound impact on the resistance of plants to parasites. In this research, we investigated the impact of an acute transient heat stress on the resistance of the wheat line 'Molly,' which contains the R gene H13, to an avirulent Hessian fly (Mayetiola destructor (Say)) population. We found that a significant portion of Molly seedlings stressed at 40 degrees C for 6 h during or after the initial Hessian fly larval attack became susceptible to otherwise avirulent insects, whereas unstressed control plants remained 100% resistant. Specifically, 77.8, 73.3, 83.3, and 46.7% of plants heat stressed at 0, 6,12, and 24 h, respectively, after the initial larval attack became susceptible. Biochemical analysis revealed that heat stress caused a transient decrease in 12-oxo-phytodienoic acid, but an increase in salicylic acid accumulation in Molly plants. The change in phytohormones after heat stress and Hessian fly infestation was not observed in 'Newton,' a near-isogenic but Hessian fly susceptible wheat line. Instead, heat stress caused a relatively prolonged reduction in palmitoleic acid. The role of phytohormones in heat-induced loss of wheat resistance was discussed.
King, S.E.; Grace, J.B.
2000-01-01
Cogongrass is a nonindigenous species perceived to threaten native communities of the southeastern United States through modification of species composition and alteration of community processes. To examine how gap size and disturbance type influence the invasion of wet pine savannas by cogongrass, we performed three field experiments to evaluate the response of cogongrass seeds and transplanted seedlings to four different gap sizes, four types of site disturbance, and recent burning of savanna vegetation. Cogongrass germinated, survived, and grew in all gap sizes, from 0 to 100 cm in diameter. Similarly, disturbance type had no effect on germination or seedling and transplant survival. Tilling, however, significantly enhanced transplanted seedling growth, resulting in a tenfold increase in biomass over the other disturbance types. Seedling survival to 1 and 2 mo was greater in burned savanna than unburned savanna, although transplant survival and growth were not affected by burning. Results of this study suggest that cogongrass can germinate, survive, and grow in wet pine savanna communities regardless of gap size or type of disturbance, including burning. Burning of savanna vegetation may enhance establishment by improving early seedling survival, and soil disturbance can facilitate invasion of cogongrass by enhancing plant growth.
Directory of Open Access Journals (Sweden)
Paulo Ivan Fernandes-Júnior
2015-08-01
Full Text Available Plant species that naturally occur in the Brazilian Caatinga(xeric shrubland adapt in several ways to these harsh conditions, and that can be exploited to increase crop production. Among the strategic adaptations to confront low water availability, desiccation tolerance stands out. Up to now, the association of those species with beneficial soil microorganisms is not well understood. The aim of this study was to characterize Tripogon spicatusdiazotrophic bacterial isolates from the Caatingabiome and evaluate their ability to promote plant growth in rice. Sixteen bacterial isolates were studied in regard to their taxonomic position by partial sequencing of the 16S rRNA gene, putative diazotrophic capacity, in vitro indole-acetic acid (IAA production and calcium phosphate solubilization, metabolism of nine different C sources in semi-solid media, tolerance to different concentrations of NaCl to pHs and intrinsic resistance to nine antibiotics. Finally, the ability of the bacterial isolates to promote plant growth was evaluated using rice (Oryza sativa as a model plant. Among the 16 isolates evaluated, eight of them were classified as Enterobacteriaceae members, related to Enterobacter andPantoeagenera. Six other bacteria were related toBacillus, and the remaining two were related toRhizobiumand Stenotrophomonas.The evaluation of total N incorporation into the semi-solid medium indicated that all the bacteria studied have putative diazotrophic capacity. Two bacteria were able to produce more IAA than that observed for the strain BR 11175Tof Herbaspirillum seropedicae.Bacterial isolates were also able to form a microaerophilic pellicle in a semi-solid medium supplemented with different NaCl concentrations up to 1.27 mol L-1. Intrinsic resistance to antibiotics and the metabolism of different C sources indicated a great variation in physiological profile. Seven isolates were able to promote rice growth, and two bacteria were more efficient than the reference strainAzospirillum brasilense, Ab-V5. The results indicate the potential of T. spicatus as native plant source of plant growth promoting bacteria.
Mayra Montiel; Ethel Sánchez
2006-01-01
Dendrocalamus giganteus es una de las especies de bambú más grandes y fuertes, y es ampliamente utilizada con propósitos varios. Se llevó a cabo un análisis ultraestructural de una población costarricense, determinando tres formas de acumulación de la cera cuticular en forma de papilas céricas. En la zona abaxial de la lámina foliar se aprecian estructuras cuadradas, constituidas por dos células de sílice en los extremos y en las partes laterales papilas céricas dobles, en el centro hay papil...
Directory of Open Access Journals (Sweden)
Mayra Montiel
2006-06-01
Full Text Available Dendrocalamus giganteus es una de las especies de bambú más grandes y fuertes, y es ampliamente utilizada con propósitos varios. Se llevó a cabo un análisis ultraestructural de una población costarricense, determinando tres formas de acumulación de la cera cuticular en forma de papilas céricas. En la zona abaxial de la lámina foliar se aprecian estructuras cuadradas, constituidas por dos células de sílice en los extremos y en las partes laterales papilas céricas dobles, en el centro hay papilas céricas esféricas. Estas estructuras son únicas para este especie, por lo que tienen alto valor taxonómico.Dendrocalamus giganteus is one of the biggest, strongest and most used bamboos. An ultrastructural analysis of samples from a Costa Rican population showed that there are three forms of cuticular wax accumulations, shaped like ceric papillae. In the abaxial zone of the leaf lamina there are square structures composed by two silica cells in the boundaries and double ceric papillae in the lateral parts; in the center there are spherical papillae. These structures are unique for this species. Rev. Biol. Trop. 54(Suppl. 2: 59-63. Epub 2006 Dec. 01.
Liu, Ruijuan; Wang, Richard R-C; Yu, Feng; Lu, Xingwang; Dou, Quanwen
2017-08-01
Genomes of ten species of Elymus, either presumed or known as tetraploid StY, were characterized using fluorescence in situ hybridization (FISH) and genomic in situ hybridization (GISH). These tetraploid species could be grouped into three categories. Type I included StY genome reported species-Roegneria pendulina, R. nutans, R. glaberrima, R. ciliaris, and Elymus nevskii, and StY genome presumed species-R. sinica, R. breviglumis, and R. dura, whose genome could be separated into two sets based on different GISH intensities. Type I genome constitution was deemed as putative StY. The St genome were mainly characterized with intense hybridization with pAs1, fewer AAG sites, and linked distribution of 5S rDNA and 18S-26S rDNA, while the Y genome with less intense hybridization with pAs1, more varied AAG sites, and isolated distribution of 5S rDNA and 18S-26S rDNA. Nevertheless, further genomic variations were detected among the different StY species. Type II included E. alashanicus, whose genome could be easily separated based on GISH pattern. FISH and GISH patterns suggested that E. alashanicus comprised a modified St genome and an unknown genome. Type III included E. longearistatus, whose genome could not be separated by GISH and was designated as St l Y l . Notably, a close relationship between S l and Y l genomes was observed.
Renno, Jean-François; Schmelzer, G.; De Jong, J.H.
1995-01-01
#Pennisetum$ sect. #Brevivalvula$ is a species complex characterized by polyploidy and apoximis. Ploidy level was assessed by DAPI-flow cytometry for 304 plants of the section, originating from Burkina Faso, Benin and southern Niger. The results were confirmed for 54 plants based on chromosome counts. The samples show four euploidy levels (with x = 9) distributed among five species : #P. hordeoides$ (2n = 36, 54), #P. pedicellatum$ (2n = 36, 45, 54), #P. polystachion$ (2n = 18, 36, 45, 54), #...
Evolution and diversity of PAPhy_a phytase in the genepool of wheat (Triticum aestivum L., Poaceae)
DEFF Research Database (Denmark)
Madsen, Claus Krogh; Petersen, Gitte; Seberg, Ole
2017-01-01
Higher phytase activity in food and feedstuffs is desirable in order to counter the antinutritional effects of phytate. The most promising platform where this might be achieved through plant breeding is wheat and its Triticeae relatives. They already accumulate notable amounts of phytase...
Keith R. Merrill; Susan E. Meyer; Craig E. Coleman
2012-01-01
The mechanisms for range expansion in invasive species depend on how genetic variation is structured in the introduced range. This study examined neutral genetic variation in the invasive annual grass Bromus tectorum in the Intermountain Western United States. Patterns of microsatellite (SSR) genotype distribution in this highly inbreeding species were used to make...
International Nuclear Information System (INIS)
Cuda, J.P.; Dunford, J.C.; Leavengood, J.M. Jr.
2007-01-01
Torpedograss, Panicum repens L., is an adventive, rhizomatous grass species that has become an invasive weed of terrestrial, wetland, and aquatic environments in tropical and subtropical regions worldwide. Until recently, strategies for controlling torpedograss in the USA have focused almost exclusively on mechanical and chemical methods, either alone or in combination, with varied results. A survey of the arthropods and nematodes currently associated with the plant in Lake Okeechobee, Florida, was conducted as part of a feasibility study to determine whether torpedograss is an appropriate target for a classical biological control program. Overall, approximately 4,000 arthropods and 400 nematode specimens were collected. Sweep, clipped vegetation, and soil core samples were dominated by representatives of the arthropod orders Hemiptera, Hymenoptera, Diptera, and Acari. Lesion nematodes of the genus Pratylenchus were commonly associated with the roots of torpedograss. None of the organisms collected were torpedograss specialists. Although classical biological control of torpedograss is feasible based on the extent of the infestation, economic losses, resistance to conventional controls, and the report of a potentially host specific natural enemy in India, the botanical position of this grass weed will require a formal risk assessment before proceeding with a classical biological control program. (author) [es
Smarda, P; Stancík, D
2006-01-01
Ploidy levels and chromosome numbers for 24 species of Festuca L. from 29 sites in Bolivia, Colombia, Ecuador and Venezuela are given. The ploidy level of 22 species is reported for the first time. A higher proportion of tetraploids in northern South America and the high frequency of polyploids in the whole continent are documented. In combination with chromosome counts, ploidy level was determined using flow cytometry in 4- to 5 1/2 -year-old herbarium specimens and mature caryopses. Flow cytometric determination from seeds was more reliable than determination from herbarium specimens. In herbarium specimens, the youngest, fresh green leaves, still hidden in sheaths, seem to be most suitable for cytometric determination. In old, brownish leaves, or poorly preserved herbarium specimens, the degradation of DNA signal in flow histograms was documented. DNA content measured in seeds was always higher than that measured in herbarium specimens, which may be caused by the presence of different cytosolic compounds. Differences of about 15% in relative DNA content of F. sodiroana and F. vaginalis was found in simultaneous measurements in seeds.
DEFF Research Database (Denmark)
Linde-Laursen, I.; Seberg, O.; Salomon, B.
1994-01-01
The karyotypes of Elymus dentatus from Kashmir and E. glaucescens from Tierra del Fuego, both carrying genomes S and H, were investigated by C- and N-banding. Both taxa had 2n = 4x = 28. The karyotype of E. dentatus was symmetrical with large chromosomes. It had 18 metacentric, four submetacentric...
Sabiu, S.; O'Neill, F. H.
2016-01-01
This study evaluated membrane stabilization and detoxification potential of ethyl acetate fraction of Zea mays L., Stigma maydis in acetaminophen-induced oxidative onslaughts in the kidneys of Wistar rats. Nephrotoxic rats were orally pre- and posttreated with the fraction and vitamin C for 14 days. Kidney function, antioxidative and histological analyses were thereafter evaluated. The acetaminophen-mediated significant elevations in the serum concentrations of creatinine, urea, uric acid, sodium, potassium, and tissue levels of oxidized glutathione, protein-oxidized products, lipid peroxidized products, and fragmented DNA were dose-dependently assuaged in the fraction-treated animals. The fraction also markedly improved creatinine clearance rate, glutathione, and calcium concentrations as well as activities of superoxide dismutase, catalase, glutathione reductase, and glutathione peroxidase in the nephrotoxic rats. These improvements may be attributed to the antioxidative and membrane stabilization activities of the fraction. The observed effects compared favorably with that of vitamin C and are informative of the fraction's ability to prevent progression of renal pathological conditions and preserve kidney functions as evidently supported by the histological analysis. Although the effects were prominently exhibited in the fraction-pretreated groups, the overall data from the present findings suggest that the fraction could prevent or extenuate acetaminophen-mediated oxidative renal damage via fortification of antioxidant defense mechanisms. PMID:27579048
Sabiu, S; O'Neill, F H; Ashafa, A O T
2016-05-13
Corn silk (Zea mays L., Stigma maydis) is an important herb used traditionally in many parts of the world to treat array of diseases including diabetes mellitus. Inhibitors of α-amylase and α-glucosidase offer an effective strategy to modulate levels of post prandial hyperglycaemia via control of starch metabolism. This study evaluated α-amylase and α-glucosidase inhibitory potentials of corn silk aqueous extract. Active principles and antioxidant attributes of the extract were also analysed. The α-amylase inhibitory potential of the extract was investigated by reacting its different concentrations with α-amylase and starch solution, while α-glucosidase inhibition was determined by pre-incubating α-glucosidase with different concentrations of the extract followed by addition of p-nitrophenylglucopyranoside. The mode(s) of inhibition of the enzymes were determined using Lineweaver-Burke plot. In vitro analysis of the extract showed that it exhibited potent and moderate inhibitory potential against α-amylase and α-glucosidase, respectively. The inhibition was concentration-dependent with respective half-maximal inhibitory concentration (IC50) values of 5.89 and 0.93mg/mL. Phytochemical analyses revealed the presence of alkaloids, flavonoids, phenols, saponins, tannins and phytosterols as probable inhibitory constituents. Furthermore, the extract remarkably scavenges reactive oxygen species like DPPH and nitric oxide radicals, elicited good reducing power and a significant metal chelating attributes. Overall, the non-competitive and uncompetitive mechanism of action of corn silk extract is due to its inhibitory effects on α-amylase and α-glucosidase, respectively. Consequently, this will reduce the rate of starch hydrolysis, enhance palliated glucose levels, and thus, lending credence to hypoglycaemic candidature of corn silk. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Magdalena Szczepaniak
2011-12-01
Full Text Available A good knowledge of species delimitation is crucial for the biodiversity protection and the conservation of wild species. We studied the efficiency of AFLP markers and morphological characters to assist species determination for Melica ciliata L. and M. transsilvanica Schur within European range of distribution, including isolated and range-limit populations of "M. ciliata" (i.e. M. cf. ciliata from the Polish Sudetes, where it is regarded as critically endangered. AFLP markers were found to be more effective then morphological characters (more or less continuous in distinguishing the both studied species. AMOVA revealed very low genetic diversity within populations and high differentiation among populations of M. ciliata and M. transsilvanica (FST = 0.89 and 0.95, respectively. The species-diagnostic AFLP markers of M. transsilvanica shared with "M. ciliata" from the Sudetes were detected. On the other hand, no species-diagnostic genetic markers of M. ciliata or hybrid-diagnostic markers of M. × thuringiaca were found within "M. ciliata". PCoA and NJ showed an overlapping genetic diversity of "M. ciliata" and M. transsilvanica. Hierarchical AMOVA supported the absence of a significant genotypic distinction between "M. ciliata" and M. transsilvanica. ANOVA showed that the length ratio of lower to upper glumes was the best morphological character to discriminate between M. ciliata and M. transsilvanica. Combined morphological and genetic data show that M. ciliata is not currently present in Poland as its putative Polish populations represent M. transsilvanica. A significant decrease in genetic variability that could influence viability was not observed the in Sudetian populations of M. transsilvanica. However, the population size changes significantly as a result of plant succession. Correction of the northern limit of the continuous distribution of M. ciliata L. in Central Europe is presented.
Directory of Open Access Journals (Sweden)
Shamshad Ul Haq
2016-01-01
Full Text Available Expressed sequence tags (ESTs are important resource for gene discovery, gene expression and its regulation, molecular marker development, and comparative genomics. We procured 10000 ESTs and analyzed 267 EST-SSRs markers through computational approach. The average density was one SSR/10.45 kb or 6.4% frequency, wherein trinucleotide repeats (66.74% were the most abundant followed by di- (26.10%, tetra- (4.67%, penta- (1.5%, and hexanucleotide (1.2% repeats. Functional annotations were done and after-effect newly developed 63 EST-SSRs were used for cross transferability, genetic diversity, and bulk segregation analysis (BSA. Out of 63 EST-SSRs, 42 markers were identified owing to their expansion genetics across 20 different plants which amplified 519 alleles at 180 loci with an average of 2.88 alleles/locus and the polymorphic information content (PIC ranged from 0.51 to 0.93 with an average of 0.83. The cross transferability ranged from 25% for wheat to 97.22% for Schlerostachya, with an average of 55.86%, and genetic relationships were established based on diversification among them. Moreover, 10 EST-SSRs were recognized as important markers between bulks of pooled DNA of sugarcane cultivars through BSA. This study highlights the employability of the markers in transferability, genetic diversity in grass species, and distinguished sugarcane bulks.
DEFF Research Database (Denmark)
Peel, Robert George; Kennedy, Roy; Smith, Matt
2014-01-01
Introduction: In aerobiological studies it is often necessary to compare concentration data recorded with different models of sampling instrument. Sampler efficiency typically varies from device to device, and depends on the target aerosol and local atmospheric conditions. To account for these di...
Directory of Open Access Journals (Sweden)
Xiao Wen Hu
Full Text Available Studying seed dormancy and its consequent effect can provide important information for vegetation restoration and management. The present study investigated seed dormancy, seedling emergence and seed survival in the soil seed bank of Stipa bungeana, a grass species used in restoration of degraded land on the Loess Plateau in northwest China. Dormancy of fresh seeds was determined by incubation of seeds over a range of temperatures in both light and dark. Seed germination was evaluated after mechanical removal of palea and lemma (hulls, chemical scarification and dry storage. Fresh and one-year-stored seeds were sown in the field, and seedling emergence was monitored weekly for 8 weeks. Furthermore, seeds were buried at different soil depths, and then retrieved every 1 or 2 months to determine seed dormancy and seed viability in the laboratory. Fresh seeds (caryopses enclosed by palea and lemma had non-deep physiological dormancy. Removal of palea and lemma, chemical scarification, dry storage (afterripening, gibberellin (GA3 and potassium nitrate (KNO3 significantly improved germination. Dormancy was completely released by removal of the hulls, but seeds on which hulls were put back to their original position germinated to only 46%. Pretreatment of seeds with a 30% NaOH solution for 60 min increased germination from 25% to 82%. Speed of seedling emergence from fresh seeds was significantly lower than that of seeds stored for 1 year. However, final percentage of seedling emergence did not differ significantly for seeds sown at depths of 0 and 1 cm. Most fresh seeds of S. bungeana buried in the field in early July either had germinated or lost viability by September. All seeds buried at a depth of 5 cm had lost viability after 5 months, whereas 12% and 4% seeds of those sown on the soil surface were viable after 5 and 12 months, respectively.
Directory of Open Access Journals (Sweden)
S. Sabiu
2016-01-01
Full Text Available This study evaluated membrane stabilization and detoxification potential of ethyl acetate fraction of Zea mays L., Stigma maydis in acetaminophen-induced oxidative onslaughts in the kidneys of Wistar rats. Nephrotoxic rats were orally pre- and posttreated with the fraction and vitamin C for 14 days. Kidney function, antioxidative and histological analyses were thereafter evaluated. The acetaminophen-mediated significant elevations in the serum concentrations of creatinine, urea, uric acid, sodium, potassium, and tissue levels of oxidized glutathione, protein-oxidized products, lipid peroxidized products, and fragmented DNA were dose-dependently assuaged in the fraction-treated animals. The fraction also markedly improved creatinine clearance rate, glutathione, and calcium concentrations as well as activities of superoxide dismutase, catalase, glutathione reductase, and glutathione peroxidase in the nephrotoxic rats. These improvements may be attributed to the antioxidative and membrane stabilization activities of the fraction. The observed effects compared favorably with that of vitamin C and are informative of the fraction’s ability to prevent progression of renal pathological conditions and preserve kidney functions as evidently supported by the histological analysis. Although the effects were prominently exhibited in the fraction-pretreated groups, the overall data from the present findings suggest that the fraction could prevent or extenuate acetaminophen-mediated oxidative renal damage via fortification of antioxidant defense mechanisms.
López, J Manuel Perilla; Johnson, Paul J; Gagné, Raymond J; Boe, Arvid
2015-12-09
Stenodiplosis spartinae Gagné new species (Diptera: Cecidomyiidae) is described from eastern South Dakota and coastal North Carolina, and compared with other American congeners. The known host plants are Spartina alterniflora and S. pectinata. The larva is a seed predator of the ovule and immature caryopsis of the host plant. Adult activity is from the early emergence of the host inflorescence through anthesis. Oviposition occurs in the floret with eggs laid under the edges of the palea and lemma. The larva apparently overwinters in dehisced spikelets in the soil among rhizomes of S. pectinata, with pupation in late spring. Laboratory emergence and field activity of the adults suggest a potentialsecond or third generation developing on late emerging inflorescences. Larval feeding does not induce external color or shape changes in the spikelet. Apparently all three instars are ectoparasitized by Tetrastichus bromi Kostyukov (Hymenoptera: Eulophidae) that was probably introduced to North America in the late 1800's and is inculcated into parasitoid guilds of several Stenodiplosis species. Resource partitioning appears to occur between the gall midge and early instars of Aethes spartinana Barnes and McDunnough (Lepidoptera: Tortricidae) that feed on maturing caryopses. The feeding of this gall midge and the moth probably account for most of the reduced seed production in both natural and agronomic populations of S. pectinata.
Directory of Open Access Journals (Sweden)
Mandar N. Datar
2014-12-01
Full Text Available Ischaemum travancorense Stapf ex C.E.C. Fisch., an endemic species, earlier known only from the Western Ghats of Kerala, Maharashtra and Goa is reported here for the first time from central India.
Jonathan M. LaMantia; Ambika Chandra; David R. Huff
2018-01-01
Interspecific hybridization has been attempted to combine the heat and drought of Poa arachnifera Torr. with the turf quality characteristics of several Poa species. Confirmation of an F1 hybrid through morphological analysis of vegetative and flowering characteristics is often time consuming and ambiguous. Ent-kaurene oxidase (KO) has been sequenced in rice, barley, and wheat. In rice, each of the five copies of KO gene has unique lengths for the first intron. Conserved intron spanning prime...
Directory of Open Access Journals (Sweden)
Jonathan M. LaMantia
2018-04-01
Full Text Available Interspecific hybridization has been attempted to combine the heat and drought of Poa arachnifera Torr. with the turf quality characteristics of several Poa species. Confirmation of an F1 hybrid through morphological analysis of vegetative and flowering characteristics is often time consuming and ambiguous. Ent-kaurene oxidase (KO has been sequenced in rice, barley, and wheat. In rice, each of the five copies of KO gene has unique lengths for the first intron. Conserved intron spanning primers (CISP can be used as a DNA marker to exploit variations of intron lengths that flank conserved gene sequences. In the present study, we developed CISP to sequence partial genomic fragments of the KO gene from seven Poa species. Through sequence analysis, species-specific primers were also developed to produce co-dominant markers that can be used to identify interspecific hybrids between Texas bluegrass and six other Poa species used in the present study.
Díaz-Pérez, A J; Sharifi-Tehrani, M; Inda, L A; Catalán, P
2014-10-01
The fine-leaved Loliinae is one of the temperate grass lineages that is richest in number of evolutionary switches from perennial to annual life-cycle, and also shows one of the most complex reticulate patterns involving distinct diploid and allopolyploid lineages. Eight distinct annual lineages, that have traditionally been placed in the genus Vulpia and in other fine-leaved ephemeral genera, have apparently emerged from different perennial Festuca ancestors. The phenotypically similar Vulpia taxa have been reconstructed as polyphyletic, with polyploid lineages showing unclear relationships to their purported diploid relatives. Interspecific and intergeneric hybridization is, however, rampant across different lineages. An evolutionary analysis based on cloned nuclear low-copy GBSSI (Granule-Bound Starch Synthase I) and multicopy ITS (Internal Transcribed Spacer) sequences has been conducted on representatives of most Vulpia species and other fine-leaved lineages, using Bayesian consensus and agreement trees, networking split graphs and species tree-based approaches, to disentangle their phylogenetic relationships and to identify the parental genome donors of the allopolyploids. Both data sets were able to reconstruct a congruent phylogeny in which Vulpia was resolved as polyphyletic from at least three main ancestral diploid lineages. These, in turn, participated in the origin of the derived allopolyploid Vulpia lineages together with other Festuca-like, Psilurus-like and some unknown genome donors. Long-distance dispersal events were inferred to explain the polytopic origin of the Mediterranean and American Vulpia lineages. Copyright © 2014 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Ding Cun-Bang
2009-10-01
Full Text Available Abstract Background Single- and low- copy genes are less likely subject to concerted evolution, thus making themselves ideal tools for studying the origin and evolution of polyploid taxa. Leymus is a polyploid genus with a diverse array of morphology, ecology and distribution in Triticeae. The genomic constitution of Leymus was assigned as NsXm, where Ns was presumed to be originated from Psathyrostachys, while Xm represented a genome of unknown origin. In addition, little is known about the evolutionary history of Leymus. Here, we investigate the phylogenetic relationship, genome donor, and evolutionary history of Leymus based on a single-copy nuclear Acc1 gene. Results Two homoeologues of the Acc1 gene were isolated from nearly all the sampled Leymus species using allele-specific primer and were analyzed with those from 35 diploid taxa representing 18 basic genomes in Triticeae. Sequence diversity patterns and genealogical analysis suggested that (1 Leymus is closely related to Psathyrostachys, Agropyron, and Eremopyrum; (2 Psathyrostachys juncea is an ancestral Ns-genome donor of Leymus species; (3 the Xm genome in Leymus may be originated from an ancestral lineage of Agropyron and Eremopyrum triticeum; (4 the Acc1 sequences of Leymus species from the Qinghai-Tibetan plateau are evolutionarily distinct; (5 North America Leymus species might originate from colonization via the Bering land bridge; (6 Leymus originated about 11-12MYA in Eurasia, and adaptive radiation might have occurred in Leymus during the period of 3.7-4.3 MYA and 1.7-2.1 MYA. Conclusion Leymus species have allopolyploid origin. It is hypothesized that the adaptive radiation of Leymus species might have been triggered by the recent upliftings of the Qinghai-Tibetan plateau and subsequent climatic oscillations. Adaptive radiation may have promoted the rapid speciation, as well as the fixation of unique morphological characters in Leymus. Our results shed new light on our understanding of the origin of Xm genome, the polyploidization events and evolutionary history of Leymus that could account for the rich diversity and ecological adaptation of Leymus species.
Vigna, Bianca Baccili Zanotto; de Oliveira, Fernanda Ancelmo; de Toledo-Silva, Guilherme; da Silva, Carla Cristina; do Valle, Cacilda Borges; de Souza, Anete Pereira
2016-11-11
Urochloa humidicola (Koronivia grass) is a polyploid (6x to 9x) species that is used as forage in the tropics. Facultative apospory apomixis is present in most of the genotypes of this species, although one individual has been described as sexual. Molecular studies have been restricted to molecular marker approaches for genetic diversity estimations and linkage map construction. The objectives of the present study were to describe and compare the leaf transcriptome of two important genotypes that are highly divergent in terms of their phenotypes and reproduction modes: the sexual BH031 and the aposporous apomictic cultivar BRS Tupi. We sequenced the leaf transcriptome of Koronivia grass using an Illumina GAIIx system, which produced 13.09 Gb of data that consisted of 163,575,526 paired-end reads between the two libraries. We de novo-assembled 76,196 transcripts with an average length of 1,152 bp and filtered 35,093 non-redundant unigenes. A similarity search against the non-redundant National Center of Biotechnology Information (NCBI) protein database returned 65 % hits. We annotated 24,133 unigenes in the Phytozome database and 14,082 unigenes in the UniProtKB/Swiss-Prot database, assigned 108,334 gene ontology terms to 17,255 unigenes and identified 5,324 unigenes in 327 known metabolic pathways. Comparisons with other grasses via a reciprocal BLAST search revealed a larger number of orthologous genes for the Panicum species. The unigenes were involved in C4 photosynthesis, lignocellulose biosynthesis and flooding stress responses. A search for functional molecular markers revealed 4,489 microsatellites and 560,298 single nucleotide polymorphisms (SNPs). A quantitative real-time PCR analysis validated the RNA-seq expression analysis and allowed for the identification of transcriptomic differences between the two evaluated genotypes. Moreover, 192 unannotated sequences were classified as containing complete open reading frames, suggesting that the new, potentially exclusive genes should be further investigated. The present study represents the first whole-transcriptome sequencing of U. humidicola leaves, providing an important public information source of transcripts and functional molecular markers. The qPCR analysis indicated that the expression of certain transcripts confirmed the differential expression observed in silico, which demonstrated that RNA-seq is useful for identifying differentially expressed and unique genes. These results corroborate the findings from previous studies and suggest a hybrid origin for BH031.
Mahelka, Václav; Kopecký, David
2010-06-01
Four accessions of hexaploid Elymus repens from its native Central European distribution area were analyzed using sequencing of multicopy (internal transcribed spacer, ITS) and single-copy (granule-bound starch synthase I, GBSSI) DNA in concert with genomic and fluorescent in situ hybridization (GISH and FISH) to disentangle its allopolyploid origin. Despite extensive ITS homogenization, nrDNA in E. repens allowed us to identify at least four distinct lineages. Apart from Pseudoroegneria and Hordeum, representing the major genome constituents, the presence of further unexpected alien genetic material, originating from species outside the Triticeae and close to Panicum (Paniceae) and Bromus (Bromeae), was revealed. GBSSI sequences provided information complementary to the ITS. Apart from Pseudoroegneria and Hordeum, two additional gene variants from within the Triticeae were discovered: One was Taeniatherum-like, but the other did not have a close relationship with any of the diploids sampled. GISH results were largely congruent with the sequence-based markers. GISH clearly confirmed Pseudoroegneria and Hordeum as major genome constituents and further showed the presence of a small chromosome segment corresponding to Panicum. It resided in the Hordeum subgenome and probably represents an old acquisition of a Hordeum progenitor. Spotty hybridization signals across all chromosomes after GISH with Taeniatherum and Bromus probes suggested that gene acquisition from these species is more likely due to common ancestry of the grasses or early introgression than to recent hybridization or allopolyploid origin of E. repens. Physical mapping of rDNA loci using FISH revealed that all rDNA loci except one minor were located on Pseudoroegneria-derived chromosomes, which suggests the loss of all Hordeum-derived loci but one. Because homogenization mechanisms seem to operate effectively among Pseudoroegneria-like copies in this species, incomplete ITS homogenization in our samples is probably due to an interstitial position of an individual minor rDNA locus located within the Hordeum-derived subgenome.
Histopatología de Ustilaginales (carbones) en Poaceas de los géneros Sorghum, Bromus y Glyceria
Astiz Gassó, Marta Mónica
2017-01-01
Sporisorium cruentum (Kühn.), es el agente causal de enfermedades en el género Sorghum incluyendo Sorghum halepense (L.) Pers.. El presente trabajo tuvo por objeto analizar el desarrollo y la evolución del patógeno en los tejidos del hospedante, y evaluar las implicancias de la enfermedad en el crecimiento vegetativo de los rizomas del sorgo de alepo. Para determinar la presencia del hongo se realizaron cortes histológicos del hospedante que se observaron por medio de microscopía óptica (MO) ...
The southern cattle tick, Rhipicephalus (Boophilus) microplus (Canestrini), is a key vector of protozoa that causes bovine babesiosis. Largely eradicated from most of the U.S., the cattle tick continues to infest the Cattle Fever Tick Quarantine Zone in south Texas. Management areas of the souther...
Sylvester, Steven P.; Soreng, Robert J.; Peterson, Paul M.; Sylvester, Mitsy D.P.V.
2016-01-01
Abstract We provide an updated checklist and key to the 30 Poa species with open panicles from Peru which includes previously circumscribed Dissanthelium and Aphanelytrum species, new taxon records, and three undescribed species. Poa compressa, Poa grisebachii, and Poa leioclada are recorded from Peru for the first time. A number of species are placed in synonymy: Poa carazensis, Poa ferreyrae and Poa tovarii are synonymized under the name Poa fibrifera; Poa adusta (tentatively) and Poa pilgeri are synonymized under Poa candamoana; Poa superata is synonymized under Poa grisebachii; and Poa paramoensis is synonymized under Poa huancavelicae. Included within this treatment are three new species, Poa ramoniana, Poa tayacajaensis and Poa urubambensis, which are described and illustrated. Poa ramoniana, found growing near lakes in high elevation Puna grasslands of Junín, is similar to a small form of Poa glaberrima, but differs in having rhizomes and growing to only 5 cm tall. Poa tayacajaensis, found from shrublands on Andean slopes of Huancavelica and Huánuco, bears similarities to Poa aequatoriensis but differs in having shorter lemmas which are pubescent between the veins, densely scabrous sheaths with smooth, glabrous throats, and shorter ligules. Poa urubambensis, a common element of the undisturbed Polylepis forest understory of the Cordillera Urubamba, Cusco, is distinct from all other members of open-panicled Poa’s by having glabrous lemmas with a smooth and glabrous callus, and notably small anthers. The type material for the name Poa adusta is discussed and a lectotype is selected. PMID:27489489
Directory of Open Access Journals (Sweden)
GIRALDO-CAÑAS DIEGO
2008-12-01
Full Text Available Axonopus P. Beauv. es un género nativo del continente americano, del que se conocen unas 72 especies, principalmente concentradas en el norte de Sudamérica, con algunos representantes aparentemente introducidos en el Viejo Mundo. Se registra el género Axonopus por primera vez en Europa con la especie Axonopus fissifolius (Raddi Kuhlm. Por otra parte, cinco binomios se reducen a la sinonimia de Axonopus compressus (Sw. P. Beauv. y de Axonopus scoparius (Flüggé Kuhlm. Se presentan las descripciones de las tres especies tratadas, sus sinónimos, sus ilustraciones, su distribución geográfica y ecológica, y se comentan algunas particularidades
Directory of Open Access Journals (Sweden)
Agnieszka Sutkowska
2012-10-01
Full Text Available ‘Broma’ is a grass cultivar belonging to the species Bromus carinatus. In the Lists of Agricultural Plant Varieties of the Research Centre for Cultivar Testing (COBORU, it is shown as Bromus willdenowii (= B. catharticus, B. unioloides (List of Agricultural Plant Varieties 1989-2009, whereas already in 1984 Mirek demonstrated on the basis of morphological analysis that this was a different closely related species – B. carinatus. The aim of the present study was to verify the species affiliation of cv. ‘Broma’. The conducted analysis of ISSR molecular markers included representatives of cv. ‘Broma” as well as of B. carinatus and B. willdenowii. The method used allowed the identification of molecular markers of the above-mentioned taxa. The numerical analysis of the obtained results suggests that cv. ‘Broma’ should be classified in the species B. carinatus, not B. willdenowii.
Directory of Open Access Journals (Sweden)
Valeriia Shiposha
2016-09-01
Full Text Available Annual Mediterranean species of the genus Brachypodium are promising model plants for energy crops since their selfing nature and short-life cycles are an advantage in breeding programs. The false brome, B. distachyon, has already been sequenced and new genomic initiatives have triggered the de-novo genome sequencing of its close relatives such as B. stacei, a species that was until recently mistaken for B. distachyon. However, the success of these initiatives hinges on detailed knowledge about the distribution of genetic variation within and among populations for the effective use of germplasm in a breeding program. Understanding population genetic diversity and genetic structure is also an important prerequisite for designing effective experimental populations for genomic wide studies. However, population genetic data are still limited in B. stacei. We therefore selected and amplified 10 nuclear microsatellite markers to depict patterns of population structure and genetic variation among 181 individuals from 19 populations of B. stacei occurring in its predominant range, the western Mediterranean area: mainland Iberian Peninsula, continental Balearic Islands and oceanic Canary Islands. Our genetic results support the occurrence of a predominant selfing system with extremely high levels of homozygosity across the analyzed populations. Despite the low level of genetic variation found, two different genetic clusters were retrieved, one clustering all SE Iberian mainland populations and the island of Minorca and another one grouping all S Iberian mainland populations, the Canary Islands and all Majorcan populations except one that clustered with the former group. These results, together with a high sharing of alleles (89% suggest different colonization routes from the mainland Iberian Peninsula into the islands. A recent colonization scenario could explain the relatively low levels of genetic diversity and low number of alleles found in the Canary Islands populations while older colonization events are hypothesized to explain the high genetic diversity values found in the Majorcan populations. Our study provides widely applicable information about geographical patterns of genetic variation in B. stacei. Among others, the genetic pattern and the existence of local alleles will need to be adequately reflected in the germplasm collection of B. stacei for efficient genome wide association studies.
Shiposha, Valeriia; Catalán, Pilar; Olonova, Marina; Marques, Isabel
2016-01-01
Annual Mediterranean species of the genus Brachypodium are promising model plants for energy crops since their selfing nature and short-life cycles are an advantage in breeding programs. The false brome, B. distachyon, has already been sequenced and new genomic initiatives have triggered the de-novo genome sequencing of its close relatives such as B. stacei, a species that was until recently mistaken for B. distachyon. However, the success of these initiatives hinges on detailed knowledge about the distribution of genetic variation within and among populations for the effective use of germplasm in a breeding program. Understanding population genetic diversity and genetic structure is also an important prerequisite for designing effective experimental populations for genomic wide studies. However, population genetic data are still limited in B. stacei. We therefore selected and amplified 10 nuclear microsatellite markers to depict patterns of population structure and genetic variation among 181 individuals from 19 populations of B. stacei occurring in its predominant range, the western Mediterranean area: mainland Iberian Peninsula, continental Balearic Islands and oceanic Canary Islands. Our genetic results support the occurrence of a predominant selfing system with extremely high levels of homozygosity across the analyzed populations. Despite the low level of genetic variation found, two different genetic clusters were retrieved, one clustering all SE Iberian mainland populations and the island of Minorca and another one grouping all S Iberian mainland populations, the Canary Islands and all Majorcan populations except one that clustered with the former group. These results, together with a high sharing of alleles (89%) suggest different colonization routes from the mainland Iberian Peninsula into the islands. A recent colonization scenario could explain the relatively low levels of genetic diversity and low number of alleles found in the Canary Islands populations while older colonization events are hypothesized to explain the high genetic diversity values found in the Majorcan populations. Our study provides widely applicable information about geographical patterns of genetic variation in B. stacei. Among others, the genetic pattern and the existence of local alleles will need to be adequately reflected in the germplasm collection of B. stacei for efficient genome wide association studies.
Finot, Víctor L; Marticorena, Clodomiro; Barrera, Juan A; Muñoz-Schick, Mélica; Negritto, María A
2009-01-01
La Región del Bío-Bío se encuentra en la zona sur de Chile central, considerado un hotspot de biodiversidad. Aunque es una región fuertemente intervenida por el hombre, principalmente por la agricultura, la forestación, la industrialización y la urbanización, tiene un bajo porcentaje de superficie protegida por el Sistema Nacional de Áreas Silvestres Protegidas del Estado (SNASPE). Por ello, documentar la biodiversidad de la región es una tarea ineludible. Se analizó la diversidad de la famil...
Czech Academy of Sciences Publication Activity Database
Mahelka, Václav; Kopecký, David
2010-01-01
Roč. 27, č. 6 (2010), s. 1370-1390 ISSN 0737-4038 R&D Projects: GA ČR GP206/09/P312; GA ČR GA206/09/1126 Institutional research plan: CEZ:AV0Z60050516; CEZ:AV0Z50380511 Keywords : Elymus repens * hybridization * Triticeae Subject RIV: EF - Botanics Impact factor: 5.510, year: 2010
Directory of Open Access Journals (Sweden)
Leandro do Prado Ribeiro
2016-07-01
Full Text Available Bermudagrass (Cynodon dactylon cv. Jiggs is an important food source for dairy cattle in the semi-intensive milk production systems most often used in southern Brazil. Although many insect pests are associated with feed grasses, we report here the first occurrence of the fly Atherigona (Atherigona reversura Villeneuve, 1936 (Diptera: Muscidae feeding on bermudagrass in Brazil. This potential pest was observed in April 2015 in three localities (Abelardo Luz, Palmitos, and Videira in western Santa Catarina, in southern Brazil. The infested plants had senescent and necrotic terminal leaves that reduced plant growth. New growth had to sprout new tillers from basal nodes, which resulted in a reduced plant growth rate. We also provide a morphological identification key (with figures for A. (Atherigona reversura and A. (Acritochaeta orientalis Schiner, 1868. A molecular identification based on COI is also provided to better differentiate species. Keywords: COI gene, Insect pest, Pastures, Plant–insect interaction
Directory of Open Access Journals (Sweden)
Giraldo-Cañas Diego
2009-06-01
Full Text Available Se presenta un estudio taxonómico de las especies de Sporobolus para el noroeste de Sudamérica. Se reconocen once especies para el área de estudio. Se incluyen las claves para determinar las especies así como las descripciones morfológicas y sus ilustraciones. Se discuten para cada una de las especies sus relaciones morfológicas, su distribución geográfica y sus preferencias ecológicas; adicionalmente, se relacionan sus usos y sus nombres comunes. Asimismo, se propone la lectotipificación para Sporobolus lasiophyllus Pilg. Por otra parte, se registran tres especies por primera vez para Colombia [Sporobolus pilifer (Trin. Kunth, Sporobolus tenuissimus (Mart. ex Schrank Kuntze y Sporobolus virginicus (L. Kunth]. Se excluyen de este tratamiento a Sporobolus brasiliensis (Raddi Hack. (=Eragrostis airoides Nees y Sporobolus domingensis (Trin. Kunth. Adicionalmente, se propone la adopción y la unificación de algunos términos morfológicos en agrostología, tales como caña, panoja, espiguilla, lema, antecio y cariopsis, en lugar de culmo, panícula, espícula, lemma, flósculo y cariopse-cariópside, respectivamente.
Arias-Trinidad, Alfredo; Rivera-Cruz, María del Carmen; Roldán-Garrigós, Antonio; Aceves-Navarro, Lorenzo Armando; Quintero-Lizaola, Roberto; Hernández-Guzmán, Javier
2017-01-01
ResumenLa industria petrolera ha generado derrames crónicos de petróleo y su acumulación en Gleysoles en zonas anegadas en el estado de Tabasco, en el sureste de México. El anegamiento es un factor que limita el uso de tecnologías de remediación por el alto costo y los bajos niveles de degradación del petróleo, sin embargo, Leersia hexandra Sw. es un pasto que crece en estas zonas contaminadas con petróleo intemperizado. El objetivo del estudio fue evaluar la densidad de bacterias, producción...
Directory of Open Access Journals (Sweden)
Mayra Montiel
2006-06-01
Full Text Available Mediante el microscopio electrónico de barrido se analizaron muestras de lámina foliar, culmo y rama, así como las brácteas del culmo y yemas de las ramas de Dendrocalamus latiflorus var. latiflorus. Se determinó la presencia en la epidermis abaxial de la lámina foliar de dos tipos de papilas céricas, esféricas y alargadas; éstas últimas rodeando los estomas de bajo domo. Sólo en la superficie adaxial de la nervadura central de la lámina foliar aparecen grandes tricomas en forma de gancho. En la zona abaxial de las brácteas del culmo, hay tricomas alargados y delgados similares a los de las brácteas de D. giganteus y las yemas de las ramas están cubiertas por tricomas bicelulares.We used a scanning electron microscope to observe leaf laminae, culms, branches, culm bracts and branch buds of Dendrocalamus latiflorus var. latiflorus grown in Costa Rica. In the abaxial epidermis of the leaf lamina we found two types of ceric papillae, rounded and elongated, the latter surrounding the low dome stomata. Only the adaxial surface of the central nervature (leaf lamina has big hook-sshaped trichomes. In the abaxial zone of the culm bract there are thin elongated trichomes, similar to those from the bract of Dendrocalamus giganteus. The branch buds are covered by bicelular trichomes. Rev. Biol. Trop. 54(Suppl. 2: 51-57. Epub 2006 Dec. 01.
Directory of Open Access Journals (Sweden)
Mayra Montiel
2006-06-01
Full Text Available El análisis ultraestructural de los clones taiwanés y tailandés de Dendrocalamus asper, realizado al microscopio electrónico de barrido, mostró que el clon de Taiwán tiene estomas de bajo domo en la lámina foliar, mientras que el de Tailandia tiene estomas de alto domo; las acumulaciones de cera cuticular en el clon de Taiwán son de dos formas (cuatro en el de Tailandia. La distribución de los tejidos vasculares es igual en ambos, así como los tejidos que los rodean. Sería difícil identificar estos clones por la observación macroscópica o microscópica de las brácteas del culmo, pues no presentan diferencias significativas: una identificación fiable requiere considerar la ultraestructura de los estomas y las acumulaciones de cera cuticular.An ultraestructural analysis of the Taiwan and Thailand clones of Dendrocalamus asper made with the scanning electron microscope showed that the Taiwan clone had low dome stomata while the Thailand clone has high dome stomata in the leaf lamina. Cuticular wax accumulations in the Taiwan clone has two shapes, against four in the Thailand clone. Both have the same distribution of vascular and surrounding tissues. Macroscopic or microscopic observation of culm bracts are not recommended to differentiate these clones: a reliable identification requires observation of the ultrastructure of stomata and cuticular wax accumulations. Rev. Biol. Trop. 54(Suppl. 2: 65-75. Epub 2006 Dec. 01.
Directory of Open Access Journals (Sweden)
M. Gabriela Fernández Pepi
2008-01-01
Full Text Available El complejo Poa resinulosa incluye un grupo de especies conformado por P. calchaquiensis, P. pedersenii y P. resinulosa, de difícil delimitación debido a que las entidades son afines en cuanto a su morfología, aunque presentan distribución disyunta. Para evaluar y analizar a las especies del complejo Poa resinulosa y especies afines al mismo complejo, se midieron 40 caracteres morfológicos y anatómicos en ejemplares de Poa calchaquiensis, P. lanigera, P. pilcomayensis y P. resinulosa. Esos datos se incorporaron a la matriz del conjunto de especies de Poa sección Dioicopoa confeccionada por Giussani (2000, incluyendo también a P. nubensis una nueva especie afín a P. calchaquiensis. Mediante el análisis de componentes principales y pruebas estadísticas, se circunscribió a las especies del complejo Poa resinulosa. Se describió a P. resinulosa como una variedad de P. ligularis, de la que se diferencia por poseer lígula corta, hojas y cañas de menor longitud, menor ancho de la lámina y estomas de menor tamaño. Se presenta una clave para la identificación de Poa ligularis var. resinulosa y taxones afines, y un mapa con la distribución geográfica de ambas variedades de P. ligularis.
Brassac, Jonathan; Blattner, Frank R
2015-09-01
Polyploidization is an important speciation mechanism in the barley genus Hordeum. To analyze evolutionary changes after allopolyploidization, knowledge of parental relationships is essential. One chloroplast and 12 nuclear single-copy loci were amplified by polymerase chain reaction (PCR) in all Hordeum plus six out-group species. Amplicons from each of 96 individuals were pooled, sheared, labeled with individual-specific barcodes and sequenced in a single run on a 454 platform. Reference sequences were obtained by cloning and Sanger sequencing of all loci for nine supplementary individuals. The 454 reads were assembled into contigs representing the 13 loci and, for polyploids, also homoeologues. Phylogenetic analyses were conducted for all loci separately and for a concatenated data matrix of all loci. For diploid taxa, a Bayesian concordance analysis and a coalescent-based dated species tree was inferred from all gene trees. Chloroplast matK was used to determine the maternal parent in allopolyploid taxa. The relative performance of different multilocus analyses in the presence of incomplete lineage sorting and hybridization was also assessed. The resulting multilocus phylogeny reveals for the first time species phylogeny and progenitor-derivative relationships of all di- and polyploid Hordeum taxa within a single analysis. Our study proves that it is possible to obtain a multilocus species-level phylogeny for di- and polyploid taxa by combining PCR with next-generation sequencing, without cloning and without creating a heavy load of sequence data. © The Author(s) 2015. Published by Oxford University Press, on behalf of the Society of Systematic Biologists.
Directory of Open Access Journals (Sweden)
GIOVANI HERNÁN PALTA-PRADO
2013-12-01
Full Text Available El asentamiento Brisas de San Isidro del Municipio de Popayán no presenta sistema de colección de aguas servidas, las cuales son vertidas directamente sobre la Quebrada Lame, ocasionando contaminación por la carga orgánica y detergentes provenientes del uso doméstico. El objetivo fue evaluar diferentes especies de gramíneas, buscando una alternativa de manejo de las aguas residuales domésticas con plantas útiles en la alimentación animal. Para tal fin se establecieron humedales artificiales bajo un diseño de muestreo temporal y un arreglo factorial de bloques al azar. Se tomaron las muestras de agua residual (pH, oxígeno disuelto (OD, concentración de CO2, demanda biológica oxigeno (DBO, demanda química oxigeno (DQO, conductividad, amonio (NH4+, nitratos (NO3-, fosfatos (PO4 y nitritos (NO2- y Demanda Bioquímica de Oxigeno (DBO5 cada quince días durante seis meses. El análisis estadístico, se realizó por medio de una ANOVA comparando los tratamientos expuestos y una prueba posthoc de Tuckey. El análisis de varianza, mostro diferencias estadísticas significativas para los parámetros oxígeno disuelto (OD, demanda química oxigeno (DQO, amonio (NH4+, nitratos (NO3-, nitritos (NO2- y coliformes totales; evidenciando que los mejores tratamientos fueron B. mutica y P. maximun
Directory of Open Access Journals (Sweden)
Luiz Felipe Gonçalves Fernandes
2013-06-01
Full Text Available Besides exacerbated exploitation, pollution, flow alteration and habitats degradation, freshwater biodiversity is also threatened by biological invasions. This paper addresses how native aquatic macrophyte communities are affected by the non-native species Urochloa arrecta, a current successful invader in Brazilian freshwater systems. We compared the native macrophytes colonizing patches dominated and non-dominated by this invader species. We surveyed eight streams in Northwest Paraná State (Brazil. In each stream, we recorded native macrophytes' richness and biomass in sites where U. arrecta was dominant and in sites where it was not dominant or absent. No native species were found in seven, out of the eight investigated sites where U. arrecta was dominant. Thus, we found higher native species richness, Shannon index and native biomass values in sites without dominance of U. arrecta than in sites dominated by this invader. Although difficult to conclude about causes of such differences, we infer that the elevated biomass production by this grass might be the primary reason for alterations in invaded environments and for the consequent impacts on macrophytes' native communities. However, biotic resistance offered by native richer sites could be an alternative explanation for our results. To mitigate potential impacts and to prevent future environmental perturbations, we propose mechanical removal of the invasive species and maintenance or restoration of riparian vegetation, for freshwater ecosystems have vital importance for the maintenance of ecological services and biodiversity and should be preserved.
Directory of Open Access Journals (Sweden)
Jonathan Brassac
Full Text Available Polyploidization is a major mechanism of speciation in plants. Within the barley genus Hordeum, approximately half of the taxa are polyploids. While for diploid species a good hypothesis of phylogenetic relationships exists, there is little information available for the polyploids (4×, 6× of Hordeum. Relationships among all 33 diploid and polyploid Hordeum species were analyzed with the low-copy nuclear marker region TOPO6 for 341 Hordeum individuals and eight outgroup species. PCR products were either directly sequenced or cloned and on average 12 clones per individual were included in phylogenetic analyses. In most diploid Hordeum species TOPO6 is probably a single-copy locus. Most sequences found in polyploid individuals phylogenetically cluster together with sequences derived from diploid species and thus allow the identification of parental taxa of polyploids. Four groups of sequences occurring only in polyploid taxa are interpreted as footprints of extinct diploid taxa, which contributed to allopolyploid evolution. Our analysis identifies three key species involved in the evolution of the American polyploids of the genus. (i All but one of the American tetraploids have a TOPO6 copy originating from the Central Asian diploid H. roshevitzii, the second copy clustering with different American diploid species. (ii All hexaploid species from the New World have a copy of an extinct close relative of H. californicum and (iii possess the TOPO6 sequence pattern of tetraploid H. jubatum, each with an additional copy derived from different American diploids. Tetraploid H. bulbosum is an autopolyploid, while the assumed autopolyploid H. brevisubulatum (4×, 6× was identified as allopolyploid throughout most of its distribution area. The use of a proof-reading DNA polymerase in PCR reduced the proportion of chimerical sequences in polyploids in comparison to Taq polymerase.
histone H3 predominantly mark the pericentromeric chromatin
Indian Academy of Sciences (India)
SANTOSH KUMAR SHARMA
pericentromeric chromatin during mitosis in monokinetic plants. J. Genet. .... bigger), cytological preparations (easy to difficult) as well as their habitat ... Poaceae. Monocot. Land. 14. Triticum aestivum. Common wheat. Poaceae. Monocot. Land.
Hawkins, Jennifer S; Ramachandran, Dhanushya; Henderson, Ashley; Freeman, Jasmine; Carlise, Michael; Harris, Alex; Willison-Headley, Zachary
2015-08-01
Sorghum is an essential grain crop whose evolutionary placement within the Andropogoneae has been the subject of scrutiny for decades. Early studies using cytogenetic and morphological data point to a poly- or paraphyletic origin of the genus; however, acceptance of poly- or paraphyly has been met with resistance. This study aimed to address the species relationships within Sorghum, in addition to the placement of Sorghum within the tribe, using a phylogenetic approach and employing broad taxon sampling. From 16 diverse Sorghum species, eight low-copy nuclear loci were sequenced that are known to play a role in morphological diversity and have been previously used to study evolutionary relationships in grasses. Further, the data for four of these loci were combined with those from 57 members of the Andropogoneae in order to determine the placement of Sorghum within the tribe. Both maximum likelihood and Bayesian analyses were performed on multilocus concatenated data matrices. The Sorghum-specific topology provides strong support for two major lineages, in alignment with earlier studies employing chloroplast and internal transcribed spacer (ITS) markers. Clade I is composed of the Eu-, Chaeto- and Heterosorghum, while clade II contains the Stipo- and Parasorghum. When combined with data from the Andropogoneae, Clade II resolves as sister to a clade containing Miscanthus and Saccharum with high posterior probability and bootstrap support, and to the exclusion of Clade I. The results provide compelling evidence for a two-lineage polyphyletic ancestry of Sorghum within the larger Andropogoneae, i.e. the derivation of the two major Sorghum clades from a unique common ancestor. Rejection of monophyly in previous molecular studies is probably due to limited taxon sampling outside of the genus. The clade consisting of Para- and Stiposorghum resolves as sister to Miscanthus and Saccharum with strong node support. © The Author 2015. Published by Oxford University Press on
Directory of Open Access Journals (Sweden)
Marcos Vinicius Bastos Garcia
2012-06-01
Full Text Available Lesmas do gênero Omalonyx d'Orbigny, 1837 são hermafroditas, herbívoras, de distribuição neotropical e vivem em plantas aquáticas, nas demais vegetações adjacentes e em solo úmido próximo a ambientes de água doce. No presente trabalho reporta-se a ocorrência atípica de O. pattersonae Tillier, 1981 e de Omalonyx sp. em área de terra firme, distante de ambiente aquático. Estas espécies aqui reportadas são simpátricas e devido à alta densidade populacional e prejuízos causados às folhas do capim-elefante Pennisetum purpureum Schumach, são caracterizadas como pragas agrícolas. No período da noite as lesmas se alimentavam das folhas do capim elefante e durante o dia permaneciam escondidas na base do caule, próximo a superfície úmida do solo. A aplicação de cal hidratada sobre agregados de indivíduos de Omalonyx spp foi um método efetivo para o controle das populações. As alterações ambientais dos ecossistemas amazônicos para uso agrícola e/ou urbanização tem promovido o aumento populacional de espécies que se adaptam a novos habitats e geralmente se tornam pragas de difícil controle.Slugs of the genus Omalonyx d'Orbigny, 1837 are hermaphrodites, herbivorous, distributed on Neotropical regions, living on aquatic plants, moist soil and terrestrial vegetation close to freshwater systems. The present paper reports the atypical occurrence of O. pattersonae Tillier, 1981 and Omalonyx sp. in an upland area far from any aquatic environment. Both species reported here are sympatric and due to the high populations density and damages caused on leaves of elephant-grass Pennisetum purpureum Schumach, they are recognized as agricultural pests. During the night, the slugs feed on the grass leaves and at the daylight they stayed hidden in the base of stems, near the moist soil surface. The use of hydrated lime distributed over the aggregations of Omalonyx spp. showed to be an effective method to control the populations. The environmental changes in the Amazonian ecosystems for agricultural or urban purposes have promoted the increase of populations of native species that adapt in the new habitat and usually become pests that are difficult to control.
Directory of Open Access Journals (Sweden)
Alice Pita-Barbosa
2009-12-01
Full Text Available Visando avaliar os efeitos do fluoreto sobre capim-braquiária, plantas de Brachiaria brizantha e B. decumbens foram submetidas a nevoeiros simulados com fluoreto (10 µg ml-1. Amostras foliares de porções aparentemente sadias foram coletadas 24 horas após a última exposição para análises microscópicas. Folhas, raízes e rizomas foram submetidos à quantificação do teor de fluoreto. As folhas apresentaram necroses pequenas e esparsas. Somente as folhas acumularam fluoreto, apresentando teores 4,4 e 5,2 vezes maiores que no tratamento controle, em B. brizantha e B. decumbens, respectivamente, não havendo diferença no potencial acumulador das duas espécies. As principais alterações micromorfológicas observadas foram lesões próximas aos tricomas, sugerindo que estes sejam as vias preferenciais de entrada do poluente nas plantas. Porções foliares, visualmente sadias, de ambas as espécies apresentaram danos microscópicos antes do surgimento de sintomas, havendo perda da turgidez das células buliformes em B. brizantha e de todos os tecidos em B. decumbens. Alterações micromorfométricas foram observadas somente em B. decumbens, indicando sua maior sensibilidade ao fluoreto, em comparação com B. brizantha. A realização de experimentos de longa duração será fundamental para elucidar o potencial bioacumulador de B. brizantha.To assess the effects of fluoride on signal grass, plants of Brachiaria brizantha and B. decumbens were submitted to simulated fluoride fog (10 µg ml-1. Leaf fragments from apparently healthy portions were colleted 24 hours after the last exposure and used for microscopic analysis. Roots, leaves and rhizomes were submitted to fluoride content quantification. The leaves presented small, sparse necroses. The accumulation of fluoride was observed on the leaves only. B. brizantha and B. decumbens presented, respectively, 4.4 and 5.2 times more fluoride than the control treatment. No difference was observed concerning the accumulation potential of both species. The main micromorphological alterations observed were injuries near the trichomes, therefore, suggesting that these are the preferential routes by which pollutants enter the plants. Visually healthy leaf portions of the two species showed microscopic damages before symptoms appeared, presenting turgidity loss in the bulliform cells of B. brizantha and in all tissues of B. decumbens. Micromorphometric alterations were observed only in B. decumbens, indicating higher sensibility to fluoride in comparison to B. brizantha. Further studies of long duration will be essential to determine the bioaccumulation potential of B. brizantha.
Directory of Open Access Journals (Sweden)
Antônio Vander Pereira
2008-10-01
Full Text Available Avaliou-se o complemento cromossômico de 16 acessos de Pennisetum disponíveis na Coleção de Germoplasma da Embrapa Gado de Leite – Juiz de Fora, Estado de Minas Gerais. Para a avaliação citogenética, utilizou-se a técnica de esmagamento e coloração com Feulgen. Para quatro acessos foram obtidas metáfases com 2n = 28 cromossomos, confirmando sua classificação como P. purpureum. A origem híbrida P. purpureum x P. glaucum foi constatada em oito acessos, os quais apresentaram 2n = 21. Em um acesso identificado como híbrido entre P. purpureum x P. glaucum, foram observadas metáfases com 2n = 54, permitindo inferir que não se trata de um híbrido interespecífico triplóide. Para outros três acessos avaliados, também foram observadas células com 2n = 54, embora estivessem identificados como híbridos entre P. purpureum x espécie selvagem; P. glaucum policross x hexaplóide 200 e P. glaucum x F92-161-01 ( P. purpureum x P. glaucum .The chromosome complement of 16 Pennisetum accessions belonging to the Germplasm Collection of Embrapa Gado de Leite - Juiz de Fora, Minas Gerais State was evaluated. The cytogenetic analysis employed the smear technique and staining with Feulgen. In four accessions, metaphases with 2n = 28 chromosomes were obtained, confirming their classification as P. purpureum. The hybrid origin P. purpureum x P. glaucum was observed in eight accessions, which presented 2n = 21. In an accession identified as P. purpureum x P. glaucum hybrid, metaphases with 2n = 54 were observed, suggesting that it is not a triploid interspecific hybrid. For three other evaluated accessions, cells with 2n=54 were also observed, although they were identified as hybrids between P. purpureum x wild species; P. glaucum polycross x hexaploid 200 and P. glaucum x [F92-161-01 (P. purpureum x P. glaucum].
Directory of Open Access Journals (Sweden)
Suzana Cyrino dos Santos
2012-03-01
Full Text Available A ocorrência de bambúseas é comum em muitas fisionomias florestais, sendo que a elevada abundância destas espécies pode interagir com a regeneração de espécies arbóreas. Foi avaliada a regeneração de espécies arbóreas e de Merostachys multiramea Hack. em uma área de transição entre Floresta Ombrófila Mista e Floresta Estacional no Sul do Brasil e comparada a estrutura de regeneração da área entre dois e quatro anos após floração, frutificação e morte de M. multiramea. Foram alocadas 25 unidades amostrais de 100 m² dispostas de forma aleatória, onde foram amostrados todos os colmos vivos de M. multiramea e indivíduos regenerantes de espécies arbóreas > 30 cm de altura e com perímetro à altura do peito The occurrence of bamboo species is common in several forest physiognomies, and the high abundance of these species may affect the regeneration of other ones. We evaluated both tree species and Merostachys multiramea Hack. recruitment in a transition area between mixed Araucaria rain forest and seasonal semideciduous forests in southern Brazil. We compared the regeneration structure of the areas evaluated two and four years after flowering, fruiting and death of M. multiramea. We randomly distributed 25 100 m² sampling units, and surveyed all living culms of M. multiramea and tree saplings. We sampled 4,372 living bamboos and 2,918 tree saplings, belonging to 32 plant families and 75 species. Most species were classified as zoochorous and canopy light-demanding. On the other hand, plant abundance revealed a greater contribution of autochorous, understory and shade-tolerant trees. M. multiramea density was higher over the four years after the reproductive event (p<0.05, with taller culms (p<0.01, but with the same mean number of culms (p=0.46. A NPMANOVA revealed significant differences in composition and abundance between surveys, with higher similarity among samplings two years after the reproductive event of M. multiramea. We also detected higher species richness over the study period, which was found to be directly associated with the abundance of M. multiramea (p=0.002, but with lower evenness of abundance among regenerating species.
Directory of Open Access Journals (Sweden)
Chaves Alba Lucilvânia Fonseca
2002-01-01
Full Text Available Panicum maximum e Chloris gayana foram submetidas à chuvas simuladas com soluções de fluoreto de potássio (15mg ml-1 com objetivo de identificar as injúrias causadas pelo flúor (F-, como poluente atmosférico, na estrutura da lâmina foliar e fornecer subsídios para a seleção de características diagnósticas a serem utilizadas na bioindicação. Os principais sintomas foram clorose e necrose, principalmente no ápice e margens das lâminas. Nos cortes transversais, quatro tipos de alterações causadas pelo flúor são relacionadas: redução do número, tamanho e arranjo dos cloroplastos; necrose dos tecidos principalmente nas margens das folhas; erosões na superfície da folha e hipertrofia das células. Em C. gayana, no entanto, não foram observadas as alterações nos cloroplastos e os outros sintomas foram bem mais discretos que em P. maximum. A ocorrência de compostos fenólicos foi registrada pela coloração com fucsina em todas as regiões da lâmina onde foram observadas lesões. Ao microscópio eletrônico de varredura foi observado o achatamento e formação de concavidades nas paredes externas das células. Este experimento confirma a maior sensibilidade de P. maximum ao flúor e revela algumas características anatômicas de C. gayana que, entre outros fatores, podem estar contribuindo para a maior resistência desta espécie a este poluente.
Directory of Open Access Journals (Sweden)
Sandro Dutra Silva
2015-08-01
Full Text Available Este artigo objetiva apresentar uma revisão da bibliografia que informa sobre a introdução de gramíneas exóticas, sobretudo de origem africana, no Cerrado goiano. A pecuária foi a principal atividade econômica de Goiás no século XIX e na primeira metade do século XX. Os campos do Cerrado goiano favoreceram o assentamento de parte da sociedade rancheira com seus currais e boiadas. Neste artigo, pretendemos analisar, por meio da história ambiental das gramíneas e da pecuária, a relação entre sociedade e natureza nas savanas do Planalto Central do Brasil nesse período. Dialogamos com os estudos de botânica e a sua relação com a história ambiental, no que se refere às transformações das paisagens pelas ações antrópicas. O estudo destaca a introdução de gramíneas exóticas, especialmente os registros históricos sobre o capim-gordura na expansão da atividade pastoril em Goiás.
DEFF Research Database (Denmark)
Linde-Laursen, I.; Baden, C.
1994-01-01
. Only the presence of 12 nucleoli in interphases identified 6 SAT-chromosome pairs. In subsp. villosus one or two extra micronucleoli indicated a chromosome pair with very low nucleolus-forming activity, bringing the number of SAT-chromosome pairs to 4. This number may be a characteristic...... of a common genome, N. NORs had different nucleolus-forming activities. Meiotic analysis demonstrated a high level of bivalent pairing in the three taxa. A chromosomal rearrangement was suggested in subsp. villosus. The low multivalent frequency in subsp. secaliformis indicates the presence of a pairing...
Takano, Kohei Takenaka; Hibino, Kenshi; Numata, Ayaka; Oguro, Michio; Aiba, Masahiro; Shiogama, Hideo; Takayabu, Izuru; Nakashizuka, Tohru
2017-12-01
Rapid expansion of exotic bamboos has lowered species diversity in Japan's ecosystems by hampering native plant growth. The invasive potential of bamboo, facilitated by global warming, may also affect other countries with developing bamboo industries. We examined past (1975-1980) and recent (2012) distributions of major exotic bamboos ( Phyllostachys edulis and P. bambusoides ) in areas adjacent to 145 weather stations in central and northern Japan. Bamboo stands have been established at 17 sites along the latitudinal and altitudinal distributional limit during the last three decades. Ecological niche modeling indicated that temperature had a strong influence on bamboo distribution. Using mean annual temperature and sun radiation data, we reproduced bamboo distribution (accuracy = 0.93 and AUC (area under the receiver operating characteristic curve) = 0.92). These results infer that exotic bamboo distribution has shifted northward and upslope, in association with recent climate warming. Then, we simulated future climate data and projected the climate change impact on the potential habitat distribution of invasive bamboos under different temperature increases (i.e., 1.5°C, 2.0°C, 3.0°C, and 4.0°C) relative to the preindustrial period. Potential habitats in central and northern Japan were estimated to increase from 35% under the current climate (1980-2000) to 46%-48%, 51%-54%, 61%-67%, and 77%-83% under 1.5°C, 2.0°C, 3.0°C, and 4.0°C warming levels, respectively. These infer that the risk areas can increase by 1.3 times even under a 1.5°C scenario and expand by 2.3 times under a 4.0°C scenario. For sustainable ecosystem management, both mitigation and adaptation are necessary: bamboo planting must be carefully monitored in predicted potential habitats, which covers most of Japan.
Watts, Alan G
2015-08-01
In November 1955, Geoffrey Harris published a paper based on the Christian A Herter Lecture he had given earlier that year at Johns Hopkins University in Baltimore, MD, USA. The paper reviewed the contemporary research that was starting to explain how the hypothalamus controlled the pituitary gland. In the process of doing so, Harris introduced a set of properties that helped define the neuroendocrine hypothalamus. They included: i) three criteria that putative releasing factors for adenohypophysial hormones would have to fulfill; ii) an analogy between the representation of body parts in the sensory and motor cortices and the spatial localization of neuroendocrine function in the hypothalamus; and iii) the idea that neuroendocrine neurons are motor neurons and the pituitary stalk functions as a Sherringtonian final common pathway through which the impact of sensory and emotional events on neuroendocrine neurons must pass in order to control pituitary hormone release. Were these properties a sign that the major neuroscientific discoveries that were being made in the early 1950s were beginning to influence neuroendocrinology? This Thematic Review discusses two main points: the context and significance of Harris's Herter Lecture for how our understanding of neuroendocrine anatomy (particularly as it relates to the control of the adenohypophysis) has developed since 1955; and, within this framework, how novel and powerful techniques are currently taking our understanding of the structure of the neuroendocrine hypothalamus to new levels. © 2015 Society for Endocrinology.
The influence of land use on soil organic carbon and nitrogen content and redox potential
DEFF Research Database (Denmark)
Kusliene, Gedrime
2010-01-01
different farming systems (conventional and organic) as well as abandoned lands. We choose the plants of two botanical species (Poaceae and Fabaceae) in organic and conventional farming systems as well as abandoned lands. Experimental results show that the best soil organic matter status according...... to the investigated indexes is in the soils of conventional and orgaic farming systems occupied with mixtures of Poaceae and Fabaceae and the worst - in the soils of abandoned Poaceae meadowa. In the abandoned lands, Fabaceae (galega) had better influence on soil organic matter status than Poaceae....
INVENTARISASI HIJAUAN PAKAN KUDA PACUAN DI NUSA TENGGARA BARAT
Directory of Open Access Journals (Sweden)
Sudirman Sudirman
2014-12-01
Full Text Available Pacuan kuda dilaksanakan setiap tahun di Provinsi Nusa Tenggara Barat yang diikuti oleh tidak kurang dari 700 ekor kuda pacuan dalam lima kelas lomba. Kegiatan ini umumnya berlangsung selama 1-2 minggu di Pulau Sumbawa dan senantiasa menjadi agenda hiburan rakyat serangkaian dengan acara perayaan hari-hari besar nasional maupun regional dan/atau lokal. Selama kurun waktu tersebut, semua kuda yang akan dilombakan diberikan pakan berupa hijauan dari jenis tumbuhan tertentu dan/atau spesifik. Tujuan penelitian ini adalah (1 menginventarisisr jenis-jenis tumbuhan yang dijadikan hijauan pakan kuda pacuan selama lomba berlangsung, dan (2 mengkaji komposisi nutrisi jenis hijauan pakan dimaksud. Metode yang digunakan untuk mengumpulkan data pada penelitian ini adalah metode observasi dan wawancara. Semua kuda pacuan yang berasal dari beberapa kabupaten di provinsi Nusa Tenggara Barat yangmengikuti lomba pacuan kuda di kabupaten Sumbawa tahun 2012 diamati pemberian pakannya, kemudian dilakukan identifikasi dan analisis komposisi nutrisi jenis hijauan yang diberikan. Untuk mengetahui jenis pakan yang diberikan, dilakukan pengamatan langsung dan wawancara dengan peternak kuda pacuan. Hasil penelitian menunjukkan bahwa tercatat 9 jenis tumbuhan (2 famili, 8 marga yang diberikan pada kuda pacuan selama lomba berlangsung, yaitu Alysicarpus vaginalis (Fabaceae, Desmodium dichotomum (Fabaceae, Cynodon dactylon (Poaceae, Cynodon sp. (Poaceae, Dactyloctenium aegyptium (Poaceae, Brachiaria sp. (Poaceae, Eleusine indica (Poaceae, Eulalia fimbriata (Poaceae dan Leersia hexandra (Poaceae. Hijauan pakan diberikan pada kuda pacuan dalam bentuk pakan tunggal maupun kombinasi diantara jenis-jenis tumbuhan tersebut dengan komposisi nutrisi yang berbeda.
Final report for ER65039, The Role of Small RNA in Biomass Deposition
Energy Technology Data Exchange (ETDEWEB)
Hudson, Matthew E. [Univ. of Illinois, Urbana, IL (United States)
2015-03-12
Our objective in this project was to discover the role of sRNA in regulating both biomass biosynthesis and perenniality in the Andropogoneae feedstock grasses. Our central hypothesis was that there is a time-and space specific sRNA network playing a crucial role in regulating processes associated with cell wall biosynthesis, flowering time control, overwintering/juvenility, and nutrient sequestration in the feedstock grasses. To address this, we performed a large scale biological project consisting of the growth of material, generation of Illumina libraries, sequencing and analysis for small RNA, mRNA and Degradome / cmRNA. Our subsidiary objectives included analysis of the biology of small RNAs and the cell wall composition of Miscanthus. These objectives have all been completed, one publication is in print, one is submitted and several more are in progress.
Lifescience Database Archive (English)
Full Text Available PD:C01530], Benzoxazinones, Polysaccharide, Protein Coix lacryma-jobi [TAX:714458] Same as: D06798 Poaceae (grass family) Coicis semen Major component: Coixenolide [CPD:C17566] ...
McTaggart, Alistair R; Shivas, Roger G; Boekhout, Teun; Oberwinkler, Franz; Vánky, Kálmán; Pennycook, Shaun R; Begerow, Dominik
2016-01-01
Ustilago is a polyphyletic genus of smut fungi found mainly on Poaceae. The development of a taxonomy that reflects phylogeny requires subdivision of Ustilago into smaller monophyletic genera. Several separate systematic analyses have determined that Macalpinomyces mackinlayi, M. tubiformis,
Population genetic structure analysis in endangered Hordeum ...
African Journals Online (AJOL)
Administrator
2011-09-07
Sep 7, 2011 ... populations are grown by few local farmers in low-input farming systems. Based on 117 random ... Triticeae of the Poaceae (Graminae) family found throughout the ... populations and phylogeography is made easy by the.
Cloning and characterization of cDNA encoding xyloglucan ...
African Journals Online (AJOL)
Jane
2011-08-22
Aug 22, 2011 ... plays important role in growth and development of plants. XETs are a family of enzymes .... cloned into pGEM-T Easy vector (Promega Corporation, WI, USA). The recombinant ..... wall modification in the poaceae. Protein Sci.
2127-IJBCS-Article-Koffi Badou Jérémie
African Journals Online (AJOL)
hp
Determination of critical period for weed control in intensive and non-intensive sugarcane (Saccharum officinarum L., Poaceae) production systems in center Côte d'Ivoire ... and chemical methods for effective and ...... Handbook Series No. 4.
Lifescience Database Archive (English)
Full Text Available ucris; Adlay ... Coix lacryma-jobi [TAX:714458] ... Same as: E00845 ... Poaceae (grass family) Adlay fruit and bract; Standards for non-pharmacopoeial crude drugs ... PubChem: 163312269 ...
Commelinid Monocotyledon Lignins Are Acylated by p-Coumarate1[OPEN
Free, Heather C.A.; Smith, Bronwen G.
2018-01-01
Commelinid monocotyledons are a monophyletic clade differentiated from other monocotyledons by the presence of cell wall-bound ferulate and p-coumarate. The Poaceae, or grass family, is a member of this group, and most of the p-coumarate in the cell walls of this family acylates lignin. Here, we isolated and examined lignified cell wall preparations from 10 species of commelinid monocotyledons from nine families other than Poaceae, including species from all four commelinid monocotyledon orders (Poales, Zingiberales, Commelinales, and Arecales). We showed that, as in the Poaceae, lignin-linked p-coumarate occurs exclusively on the hydroxyl group on the γ-carbon of lignin unit side chains, mostly on syringyl units. Although the mechanism of acylation has not been studied directly in these species, it is likely to be similar to that in the Poaceae and involve BAHD acyl-coenzyme A:monolignol transferases. PMID:29724771
Huis, van A.; Woldewahid, G.; Toleubayev, K.; Werf, van der W.
2008-01-01
The effect of millet, Pennisetum typhoideum Rich. (Poaceae), leaf nitrogen content on fitness parameters of the desert locust, Schistocerca gregaria Forsk. (Orthoptera: Acrididae), was studied under laboratory conditions. Locusts reared on high-nitrogen leaves were larger, developed faster, had
Original Paper Weeds control through tree-crop associations in a ...
African Journals Online (AJOL)
these trees, two crops were grown: a shade tolerant crop (Colocasia esculenta, taro) ... The most represented weeds family in the open field was Poaceae while under both tree species, the ...... provided guide, corrections and supervision to.
Czech Academy of Sciences Publication Activity Database
Boutte, J.; Aliaga, B.; Lima, O.; de Carvalho, J.F.; Ainouche, A.; Macas, Jiří; Rousseau-Gueutin, M.; Coriton, O.; Ainouche, M.; Salmon, A.
2016-01-01
Roč. 6, č. 1 (2016), s. 29-40 ISSN 2160-1836 Institutional support: RVO:60077344 Keywords : poaceae * duplication * paralogy * bioinformatics * polyploidy Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.861, year: 2016
Grass survey of the Itremo Massif records endemic central highland ...
African Journals Online (AJOL)
Grasses are members of the plant family Poaceae, and are primar- ily known for their ... Madagascar Conservation & Development is the journal of. Indian Ocean .... cording to the classification by Kellogg (2015). With 64 ..... Flowering plants.
Airborne study of grass allergen (Lol p 1) in different-sized particles.
De Linares, C; Díaz de la Guardia, C; Nieto Lugilde, D; Alba, F
2010-01-01
The Poaceae family is considered one of the main causes of pollen allergy in industrialized countries. The aim of this study is to establish the dynamics of the Poaceae allergens and determine their distribution in the different-sized particles in the atmosphere. The air of Granada (southern Spain) was sampled during the pollination period of Poaceae using a cascade impactor and a Hirst-type volumetric collector simultaneously. The sampled airborne allergens were analyzed by indirect ELISA and field emission scanning electron microscopy. Airborne pollen was evaluated with the Spanish Aerobiological Network methodology. Poaceae pollen and allergenic activity have parallel dynamics during the period of maximum pollination, which is reflected in the positive correlations between the 2 variables. In addition, the highest Lol p 1 concentrations were recorded in particle sizes lower than 3.3 mum (stage 4-F). The Spearman correlation test showed that airborne allergens are not dependent on meteorological factors, such as humidity, wind direction or sunshine, however, Lol p 1 allergen correlated positively with Poaceae pollen. The results of the present study confirm that the Lol p 1 allergen is detected more frequently with pollutants than with coarse particles with similar dynamics and a positive correlation between airborne pollen and aeroallergens. Moreover, Lol p 1 is released in stable weather conditions without large changes in humidity or temperature. Copyright 2009 S. Karger AG, Basel.
Genetic maps of Saccharum officinarum L. and Saccharum robustum Brandes & Jew. ex grassl
Directory of Open Access Journals (Sweden)
Claudia T. Guimarães
1999-03-01
Full Text Available Genetic analysis was performed in a population composed of 100 F1 individuals derived from a cross between a cultivated sugarcane (S. officinarum `LA Purple' and its proposed progenitor species (S. robustum `Mol 5829'. Various types (arbitrarily primed-PCR, RFLPs, and AFLPs of single-dose DNA markers (SDMs were used to construct genetic linkage maps for both species. The LA Purple map was composed of 341 SDMs, spanning 74 linkage groups and 1,881 cM, while the Mol 5829 map contained 301 SDMs, spanning 65 linkage groups and 1,189 cM. Transmission genetics in these two species showed incomplete polysomy based on the detection of 15% of SDMs linked in repulsion in LA Purple and 13% of these in Mol 5829. Because of this incomplete polysomy, multiple-dose markers could not be mapped for lack of a genetic model for their segregation. Due to inclusion of RFLP anchor probes, conserved in related species, the resulting maps will serve as useful tools for breeding, ecology, evolution, and molecular biology studies within the Andropogoneae.Uma progênie de 100 indivíduos F1 obtidos de um cruzamento entre cana-de-açúcar (S. officinarum `LA Purple' e seu suposto progenitor (S. robustum `Mol 5829' foi analisada utilizando marcadores moleculares em dose única. Marcadores do tipo AP-PCR, RFLP e AFLP, gerando um total de 642 polimorfismos, foram mapeados em ambas espécies. O mapa genético de LA Purple foi composto de 341 marcadores, distribuídos em 74 grupos de ligação e 1.881 cM, enquanto que o mapa de ligação de Mol 5829 continha 301 marcadores ao longo de 65 grupos de ligação e 1.189 cM. A transmissão genética nessas duas espécies apresentou polissomia incompleta devido a detecção de 15% dos marcadores em dose simples ligados em fase de repulsão e 13% desses em Mol 5829. Devido a essa polissomia incompleta, os marcadores em dose múltipla não puderam ser mapeados por falta de um modelo genético para descrever tal segregação. O
Forrestel, Elisabeth J; Donoghue, Michael J; Smith, Melinda D
2014-08-01
The importance of fire in the creation and maintenance of mesic grassland communities is well recognized. Improved understanding of how grasses--the dominant clade in these important ecosystems--will respond to alterations in fire regimes is needed in the face of anthropogenically driven climate and land-use change. Here, we examined how grass communities shift in response to experimentally manipulated fire regimes at multiple levels of community diversity--taxonomic, phylogenetic and functional--in C4-dominanted mesic savanna grassland sites with similar structure and physiognomy, yet disparate biogeographic histories. We found that the grass communities were similar in their phylogenetic response and aspects of their functional response to high fire frequency. Both sites exhibited phylogenetic clustering of highly abundant species in annually burned plots, driven by species of the Andropogoneae, and a narrow range of functional strategies associated with rapid post-fire regeneration in a high-light, nitrogen-limited environment. By examining multiple facets of diversity in a comparative context, we identified convergent phylogenetic and functional responses to altered fire regimes in two mesic savanna grasslands. Our results highlight the importance of a common filtering process associated with fire that is consistent across grasslands of disparate biogeographic histories and taxonomic representation. © 2014 The Authors. New Phytologist © 2014 New Phytologist Trust.
Psárky Alopecurus aequalis a A. geniculatus v České republice: jejich určování a rozšíření
Czech Academy of Sciences Publication Activity Database
Bureš, P.; Danihelka, Jiří; Husáková, M.; Pařil, P.
2008-01-01
Roč. 23, - (2008), s. 3-61 ISSN 0862-2035 R&D Projects: GA MŠk(CZ) LC06073; GA ČR(CZ) GA206/07/0706 Institutional research plan: CEZ:AV0Z60050516 Keywords : phytogeography * Poaceae * Central Europe Subject RIV: EF - Botanics
African Journals Online (AJOL)
Timothy Ademakinwa
Faculty of Science, Senate Building and New Hall respectively. A total of 3,495 palynomorphs belonging to about 22 families were recovered in all. The Poaceae family dominates representing 13.67 % of the total palynomorph count, followed by Cyperaceae (12.72 %) Euphorbiaceae (5.34 %) Mimosaceae (8.89 %), Fern.
DEFF Research Database (Denmark)
de Nascimento, Lea; Nogué, Sandra; Fernández-Lugo, Silvia
2015-01-01
-represented (.Pinus, Morella and Ericaceae trees, Chenopodiaceae, Poaceae, Rumex and Urticaceae herbs and shrubs) or under-represented (Lauraceae trees, Fabaceae and Euphorbia shrubs). Results indicate that pollen composition is a good reflection of vegetation in Canarian ecosystems and can be used effectively...
Hernández-Restrepo, M.; Groenewald, J.Z.; Elliott, M.L.; Canning, G.; McMillan, V.E.; Crous, P.W.
2016-01-01
Take-all disease of Poaceae is caused by Gaeumannomyces graminis (Magnaporthaceae). Four varieties are recognised in G. graminis based on ascospore size, hyphopodial morphology and host preference. The aim of the present study was to clarify boundaries among species and varieties in
Hernández-Restrepo, M.; Groenewald, J.Z.; Elliott, M.L.; Canning, G.; McMillan, V.E.; Crous, P.W.
2016-01-01
Take-all disease of Poaceae is caused by Gaeumannomyces graminis (Magnaporthaceae). Four varieties are recognised in G. graminis based on ascospore size, hyphopodial morphology and host preference. The aim of the present study was to clarify boundaries among species and varieties in Gaeumannomyces
Computational identification of putative cytochrome P450 genes in ...
African Journals Online (AJOL)
Chattha
Economically, legumes represent the second most important family of crop plants after Poacea (grass family), accounting for ... further characterization of P450 genes with both known and unknown functions. MATERIALS AND METHODS ..... Cytochrome P450. In: Somerville CR, Meyerowitz EM (eds) .The Arabidopsis book,.
Study of the chemical composition of essential oils and floral waters ...
African Journals Online (AJOL)
This work aimed to study the chemical composition of essential oils and floral waters of Cymbopogon citratus (DC.) Stapf (Poaceae) from Senegal. The plants were collected in two different localities, Dakar and. Kaolack. The extracts were obtained by steam distillation from both fresh and dried plants and analyses carried.
Study of the chemical composition of essential oils and floral waters ...
African Journals Online (AJOL)
This work aimed to study the chemical composition of essential oils and floral waters of Cymbopogon citratus (DC.) Stapf (Poaceae) from Senegal. The plants were collected in two different localities, Dakar and Kaolack. The extracts were obtained by steam distillation from both fresh and dried plants and analyses carried ...
Chromosome numbers and meiotic analysis in the pre-breeding of ...
Indian Academy of Sciences (India)
2011-08-19
Aug 19, 2011 ... of Brachiaria decumbens (Poaceae). GLÉIA CRISTINA LAVERDE ... widely used grass forage worldwide because it adapts to acid soils, is easy to man- ... individual plants growing in the field, fixed in a mixture of ethanol 95% ...
Contribution of chloroplast DNA in the biodiversity of some Aegilops ...
African Journals Online (AJOL)
user
2011-03-21
Mar 21, 2011 ... caudata) belonging to the family Poaceae were used in this study. Nucleotides of 1651 ... terranean basin and grow well in the high rainy areas. Syria is ... ate and easy identification of Aegilops species is required. Molecular ...
A field key to upload Kenya grasses | Agnew | Journal of East ...
African Journals Online (AJOL)
The species of Gramineae (Poaceae) that have been recorded in a delimited area of central and western Kenya are listed and keys are provided for their identification. The area is bounded by the 1000 m contour except in the southern Rift Valley where the Kenya/Tanzania boundary encorporates lower altitudes. For every ...
Stress tolerant plant species spread in the road-ne
Czech Academy of Sciences Publication Activity Database
Šerá, Božena
2011-01-01
Roč. 14, Vol.14 (2011), s. 45-46 ISSN 1644-7298 R&D Projects: GA MŠk OC10032 Institutional research plan: CEZ:AV0Z60870520 Keywords : weed * invasive * road-ne * salinity * Poaceae Subject RIV: AP - Urban, Regional and Transport Planning
Both sugarcane (Saccharum officinarum) and sweet sorghum (Sorghum bicolor) crops are members of the grass (Poaceae) family, and consist of stalks rich in soluble sugars. The extracted juice from both of these crops contains insoluble starch, with much greater quantities occurring in sweet sorghum. ...
African Journals Online (AJOL)
DR. AMINU
From the data, Euphorbiaceae,. Solanaceae, Rutaceae, Malvaceae, Caesalpiniaceae, Poaceae and Apocynaceae (in order of decreasing number of species) were the most frequent Families. Taxa such as Musa species,. Vernonia amygdalina, Citrus species, Psidium guajava and Terminalia catappa were found to be the.
Contribution of chloroplast DNA in the biodiversity of some Aegilops ...
African Journals Online (AJOL)
Four Aegilops species (Aegilops longissima, Aegilops speltoides, Aegilops searsii and Aegilops caudata) belonging to the family Poaceae were used in this study. Nucleotides of 1651 bp from 5.8 S rRNA gene and the intergenic spacers trnT-trnL and trnL-trnF from the chloroplast DNA were combined together in order to ...
Journal of Genetics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Genetics. Kellen Regina Boldrini. Articles written in Journal of Genetics. Volume 85 Issue 3 December 2006 pp 225-228 Research Note. Abnormal timing of cytokinesis in microsporogenesis in Brachiaria humidicola (Poaceae: Paniceae) · Kellen Regina Boldrini Maria Suely Pagliarini Cacilda ...
cas du cordon littoral Port-Bouët-Grand-Bassam
African Journals Online (AJOL)
Formations végétales. Espèces. Familles. Cocoteraie. Fourré littoral. Jachère. Saccharum officinarum L. Poaceae x. Salacia baumannii Loes. Celastraceae x. Sansevieria liberica Gérôme & Labroy. Agavaceae x. Sauvagesia erecta L. Ochnaceae x. Scoparia dulcis L. Scrophulariaceae x x. Sesamum radiatum Schumacher.
Ecology and management of the Prairie Division
Roger C. Anderson
2012-01-01
Grasslands occurred on all continents, comprised almost 42 percent of the worldâs plant cover, and once covered approximately 46 million km2 of the Earthâs surface. Grasslands contain few trees or shrubs, are dominated by grasses (members of the family Poaceae), and have a mixture of nongraminoid herbaceous species called forbs. Plant families...
Evers, J.B.; Vos, J.; Chelle, M.; Andrieu, B.; Fournier, C.; Struik, P.C.
2007-01-01
The outgrowth of tiller buds in Poaceae is influenced by the ratio of red to far-red light irradiance (R:FR). At each point in the plant canopy, R:FR is affected by light scattered by surrounding plant tissues. This paper presents a three-dimensional virtual plant modelling approach to simulate
New species and records of Bipolaris and Curvularia from Thailand
Marin-Felix, Yasmina; Senwanna, C; Cheewangkoon, Ratchadawan; Crous, P.W.
2017-01-01
Several Bipolaris and Curvularia spp. were collected from different disease symptoms of Poaceae in Thailand. Phylogenetic analyses based on DNA sequence data of the internal transcribed spacer region and intervening 5.8S nrRNA gene, and partial fragments of the glyceraldehyde-3-phosphate
The effects of altered levels of UV-B radiation on an Antarctic grass and lichen
Lud, D.; Huiskes, A.H.L.; Moerdijk-Poortvliet, T.C.W.; Rozema, J.J.
2001-01-01
We report a long-term experiment on the photosynthetic response of natural vegetation of Deschampsia antarctica (Poaceae) and Turgidosculum complicatulum (Lichenes) to altered UV-B levels on Leonie Island, Antarctica. UV-B above the vegetation was reduced by filter screens during two seasons. Half
Phleum exaratum, nově zavlečený druh v České republice
Czech Academy of Sciences Publication Activity Database
Ducháček, M.; Chrtek, Jindřich
2017-01-01
Roč. 36, 1-2 (2017), s. 47-53 ISSN 0231-9616 R&D Projects: GA ČR GB14-36079G Institutional support: RVO:67985939 Keywords : Phleum exaratum * Poaceae * Eastern Bohemia * alien species Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany
A synteny-based draft genome sequence of the forage grass Lolium perenne
DEFF Research Database (Denmark)
Byrne, Stephen; Nagy, Istvan; Pfeifer, Matthias
2015-01-01
-family of the grass family (Poaceae). Transcriptome data was used to identify 28 455 gene models, and we utilized macro-co-linearity between perennial ryegrass and barley, and synteny within the grass family, to establish a synteny-based linear gene order. The gametophytic self-incompatibility mechanism enables...
Jose Jesus Sanchez-Escalante; Manuel Espericueta-Betancourt; Reyna Amanda Castillo-Gamez
2005-01-01
Presently, the flora of the Sierra de Mazatán contains 357 species of vascular plants distributed in 248 genera and 80 families. The families with the most species are Asteraceae (48), Fabaceae (45), Poaceae (28), Euphorbiaceae (18), and Acanthaceae, Cactaceae, Scrophulariaceae, and Solanaceae (11 each). The results show that the flora of the Sierra de Mazat...
DEFF Research Database (Denmark)
Zhang, Gengyun; Liu, Xin; Quan, Zhiwu
2012-01-01
Foxtail millet (Setaria italica), a member of the Poaceae grass family, is an important food and fodder crop in arid regions and has potential for use as a C(4) biofuel. It is a model system for other biofuel grasses, including switchgrass and pearl millet. We produced a draft genome (∼423 Mb) an...
Comparative analysis and relationships of six important crop ...
African Journals Online (AJOL)
Administrator
tools using complete chloroplast genomes. Results obtained depict cases of major genome rearrangements, translocation, duplication, inversion and deletion of genes. Members of the poaceae family indicate a close relationship in the nature of conserved sequences while Oryza sativa and. Chlorella vulgaris, which are not ...
De novo genome assembly of the fungal plant pathogen Pyrenophora semeniperda
Marcus M. Soliai; Susan E. Meyer; Joshua A. Udall; David E. Elzinga; Russell A. Hermansen; Paul M. Bodily; Aaron A. Hart; Craig E. Coleman
2014-01-01
Pyrenophora semeniperda (anamorph Drechslera campulata) is a necrotrophic fungal seed pathogen that has a wide host range within the Poaceae. One of its hosts is cheatgrass (Bromus tectorum), a species exotic to the United States that has invaded natural ecosystems of the Intermountain West. As a natural pathogen of cheatgrass, P. semeniperda has potential as a...
Évaluation de la diversité floristique en herbacées des savanes de ...
African Journals Online (AJOL)
Thus, 37 species, 33 kinds and 10 families were identified in the savannah of Hyparrhenia diplandra (Hack.) Stapf and 27 species, 22 kinds and 8 families in the savannah of Loudetia simplex (Nees) CE Hubbard. Overall, the richest families in species were Poaceae, Fabaceae and the Cyperaceae. The Shannon diversity ...
Genetic variation and population structure in Oryza ...
Indian Academy of Sciences (India)
Oryza malampuzhaensis Krish. et Chand. ( 2 n = 4 x = 48 ; Poaceae, Oryza) is endemic to Western Ghats, South India, and shows a highly localized distribution over a small geographical area in this region. This is the most poorly understood taxon in genus Oryza and is often misidentified as O. officinalis owing to their close ...
Huynh, Bich Tram; Tual, Séverine; Turbelin, Clément; Pelat, Camille; Cecchi, Lorenzo; D'Amato, Gennaro; Blanchon, Thierry; Annesi-Maesano, Isabella
2010-09-01
To investigate for the first time the short-term effects of airborne pollen counts on general practitioner (GP) consultations for asthma attacks in the Greater Paris area between 2003-2007. Counts were available for common pollens (Betula, Cupressa, Fraxinus and Poaceae). Weekly data on GP visits for asthma attacks were obtained from the French GP Sentinel Network. A quasi-Poisson regression with generalised additive models was implemented. Short-term effects of pollen counts were assessed using single and multi-pollen models after adjustment for air pollution and influenza. A mean weekly incidence rate of 25.4 cases of asthma attacks per 100,000 inhabitants was estimated during the study period. The strongest significant association between asthma attacks and pollen counts was registered for grass (Poaceae) in the same week of asthma attacks, with a slight reduction of the effect observed in the multi-pollen model. Adjusted relative risk for Poaceae was 1.54 (95% CI: 1.33-1.79) with an inter-quartile range increase of 17.6 grains/m3 during the pollen season. For the first time, a significant short-term association was observed between Poaceae pollen counts and consultations for asthma attacks as seen by GPs. These findings need to be confirmed by more consistent time-series and investigations on a daily basis.
Ma, Peng-Fei; Guo, Zhen-Hua; Li, De-Zhu
2012-01-01
Compared to their counterparts in animals, the mitochondrial (mt) genomes of angiosperms exhibit a number of unique features. However, unravelling their evolution is hindered by the few completed genomes, of which are essentially Sanger sequenced. While next-generation sequencing technologies have revolutionized chloroplast genome sequencing, they are just beginning to be applied to angiosperm mt genomes. Chloroplast genomes of grasses (Poaceae) have undergone episodic evolution and the evolutionary rate was suggested to be correlated between chloroplast and mt genomes in Poaceae. It is interesting to investigate whether correlated rate change also occurred in grass mt genomes as expected under lineage effects. A time-calibrated phylogenetic tree is needed to examine rate change. We determined a largely completed mt genome from a bamboo, Ferrocalamus rimosivaginus (Poaceae), through Illumina sequencing of total DNA. With combination of de novo and reference-guided assembly, 39.5-fold coverage Illumina reads were finally assembled into scaffolds totalling 432,839 bp. The assembled genome contains nearly the same genes as the completed mt genomes in Poaceae. For examining evolutionary rate in grass mt genomes, we reconstructed a phylogenetic tree including 22 taxa based on 31 mt genes. The topology of the well-resolved tree was almost identical to that inferred from chloroplast genome with only minor difference. The inconsistency possibly derived from long branch attraction in mtDNA tree. By calculating absolute substitution rates, we found significant rate change (∼4-fold) in mt genome before and after the diversification of Poaceae both in synonymous and nonsynonymous terms. Furthermore, the rate change was correlated with that of chloroplast genomes in grasses. Our result demonstrates that it is a rapid and efficient approach to obtain angiosperm mt genome sequences using Illumina sequencing technology. The parallel episodic evolution of mt and chloroplast
Huperzine alkaloids from Australasian and southeast Asian Huperzia.
Lim, Wei-Han; Goodger, Jason Q D; Field, Ashley R; Holtum, Joseph A M; Woodrow, Ian E
2010-09-01
The pharmaceutical alkaloid huperzine A (HupA), currently used in herbal supplements and medicines worldwide, is predominantly sourced from the Chinese lycopod Huperzia serrata (Thunb. ex Murray) Trev. (Lycopodiaceae), which on average contains only 0.08 mg HupA g(-1) dry weight, and is experiencing a rapid decline in China due to over-harvesting. To find a high-yielding, natural source of HupA and/or the related huperzine B (HupB) that could potentially be used as the starting material in a commercial propagation program. We surveyed 17 Huperzia species (15 indigenous to Australia and southeast Asia) for their foliar HupA and HupB concentrations. We also studied intra-specific variation for the huperzines in four species that were available in sufficient numbers, and determined tissue-specific accumulation in larger specimens. HupA was detected in 11 Australasian and southeast Asian species, with eight also containing HupB, albeit at much lower concentrations. A H. elmeri (Herter) Holub plant from the Philippines had one of the highest HupA concentrations recorded (1.01 mg g(-1) dry wt) and it also had the highest HupB content of all plants surveyed (0.34 mg g(-1) dry wt). Intra-specific HupA and HupB concentrations were extremely variable, and at the intra-plant level, reproductive strobili were found to accumulate the highest HupA concentrations. Select Huperzia species from Australia and southeast Asia have potential as the starting material for establishing commercial HupA plantations, but the high intra-specific variability observed suggests that detailed screening is needed to isolate high huperzine-yielding individuals.
A search for markers of sugarcane evolution
Directory of Open Access Journals (Sweden)
M. Bacci Jr.
2001-12-01
Full Text Available To determine the phylogenetic relationship between sugarcane cultivars and other members of the Saccharinae subtribe, we identified the fast evolving ITS1-5.8S-ITS2 (ITS = internal transcribed spacer; 5.8S = 5.8S ribosomal DNA region of the sugarcane genome in the Sugarcane Expressed Sequence Tag (SUCEST genome project database. Parsimony analysis utilizing this region and homologs belonging to the 23 closely related Andropogoneae currently deposited in the GenBank database has shown sugarcane as the sister group of Saccharum sinense. However, because there are few parsimony-informative characters and high homoplasy in the ITS1-5.8S-ITS2 region we were not able to determine with confidence the phylogenetic relationship between sugarcane and some of the remaining members of Saccharine subtribe. To find alternatives for the phylogenetic reconstruction of sugarcane evolutionary history, we selected 17 markers (nuclear, chloroplastic or mitochondrial from the SUCEST database of which apha-tubulin, ribosomal protein L16 (rpl16 and DNA-directed RNA polymerase beta chain (rpoC2 were found to have a low incidence of polymorphism and comparable, or even faster, rates of evolution than the ITS1-5.8S-ITS2 region. We suggest that these markers should be considered as preferential choices for phylogenetic studies of Saccharinae subtribe.Com o propósito de determinar a relação filogenética entre a cana-de-açúcar e membros da subtribo Saccharinae, a região gênica nuclear ITS1-5,8S-ITS2 (ITS: espaçador interno transcrito; 5,8S: DNA ribossomal 5.8S, com alta taxa evolutiva, foi identificada no banco de dados do projeto genoma "Sugarcane Expressed Sequence Tag" (SUCEST. Uma análise através do método de parcimônia, utilizando esta região e seqüências homólogas de 23 Andropogoneae retiradas da base de dados GenBank, indicou que a cana-de-açúcar é o grupo-irmão de Saccharum sinense. No entanto, devido à pequena quantidade de caracteres
Molecular genetic analysis of cereal β-amylase genes using exon-primed intron-crossing (EPIC PCR
Directory of Open Access Journals (Sweden)
Stratula Olga
2014-01-01
Full Text Available The proteins encoded by cereal β-amylase genes Bamy1 and Bamy2 genes play an important role in seedling germination and in the brewing process. Here, we use exon-primed intron-crossing (EPIC to analyse Bamy1 and Bamy2 genetic diversity among 38 accessions belonging to six Poaceae tribes. DNA sequence alignment of multiple Poaceae species β-amylase sequences allowed design of EPIC primers that simultaneously amplify Bamy1 and Bamy2 in all the cereal species investigated. The genetic variation observed in the samples investigated is analysed and discussed, and illustrates the effectiveness of this approach for intra- and interspecific analysis in plant species.
Phytoliths as Emerging Taxonomic Tools for Identification of Plants: An Overview
Directory of Open Access Journals (Sweden)
Sheikh Abdul Shakoor
2014-01-01
Full Text Available In the recent advancements in identification of plant species, phytoliths have found an immense role in the identification of plants at different levels of taxonomic hierarchy. Many plant groups are known to accumulate silica in solid form in and between the cells and tissues and hence create the structures commonly known as phytoliths. These phytoliths create replicas of the structures where they are deposited. The shapes of phytolith replicas, their size dimensions (morphometric parameters, surface features (ornamentation, distribution, and orientation pattern in epidermal layers of vegetative and reproductive structures as well as their frequency are highly important for characterization of species. Monocotyledonous families particularly the family Poaceae (Gramineae are known to produce diverse phytolith types that can serve as diagnostic markers for characterization of different taxa at different levels of taxonomic hierarchy. The present paper highlights the importance of phytoliths in taxonomic analysis of plants particularly in the family Poaceae.
Wang, Shuo; Gao, Li-Zhi
2016-11-01
The complete chloroplast genome sequence of foxtail millet (Setaria italica), an important food and fodder crop in the family Poaceae, is first reported in this study. The genome consists of 1 35 516 bp containing a pair of inverted repeats (IRs) of 21 804 bp separated by a large single-copy (LSC) region and a small single-copy (SSC) region of 79 896 bp and 12 012 bp, respectively. Coding sequences constitute 58.8% of the genome harboring 111 unique genes, 71 of which are protein-coding genes, 4 are rRNA genes, and 36 are tRNA genes. Phylogenetic analysis indicated foxtail millet clustered with Panicum virgatum and Echinochloa crus-galli belonging to the tribe Paniceae of the subfamily Panicoideae. This newly determined chloroplast genome will provide valuable information for the future breeding programs of valuable cereal crops in the family Poaceae.
Silicon in Imperata cylindrica (L.) P. Beauv: content, distribution, and ultrastructure.
Rufo, Lourdes; Franco, Alejandro; de la Fuente, Vicenta
2014-07-01
Silicon concentration, distribution, and ultrastructure of silicon deposits in the Poaceae Imperata cylindrica (L.) P. Beauv. have been studied. This grass, known for its medicinal uses and also for Fe hyperaccumulation and biomineralization capacities, showed a concentration of silicon of 13,705 ± 9,607 mg/kg dry weight. Silicon was found as an important constituent of cell walls of the epidermis of the whole plant. Silica deposits were found in silica bodies, endodermis, and different cells with silicon-collapsed lumen as bulliforms, cortical, and sclerenchyma cells. Transmission electron microscope observations of these deposits revealed an amorphous material of an ultrastructure similar to that previously reported in silica bodies of other Poaceae.
Directory of Open Access Journals (Sweden)
Giuseppina Pellizzari
2011-09-01
Full Text Available Two new species of scale insects collected in Sardinia (Italy are described and illustrated: Spinococcus giuliae sp. n. (Pseudococcidae off the roots of Umbilicus rupestris (Crassulaceae and Micrococcus sardous sp. n. (Micrococcidae off the root of an undetermined grass (Poaceae growing near the sea. A n identification key to Micrococcus species and a revised list of the scales presently known in the island are also provided.
Phytochemical profile of sugarcane and its potential health aspects
Singh, Amandeep; Lal, Uma Ranjan; Mukhtar, Hayat Muhammad; Singh, Prabh Simran; Shah, Gagan; Dhawan, Ravi Kumar
2015-01-01
Sugarcane (Saccharum officinarum Linn.) is an important perennial grass of Poaceae family, indigenous to tropical South Asia and Southeast Asia. It is cultivated worldwide due to the economical and medicinal value of its high yielding products. Sugarcane juice is well known as a raw material for the production of refined sugar and its wax is considered as a potential substitute for the expensive carnauba wax, which is of cosmetic and pharmaceutical interest. Refined sugar is the primary produ...
1984-08-01
species richness and density. Such changes are easy to see if stresses are severe. However, subtle stresses can result in subtle changes in community...1976). This clogging of canals is possible because the channels are relatively narrow and the decumbent stems growing from I each side can- come into...CL.) Grisebach CE) Sacgittaria latifolia Willd. POACEAE CE) Fri,2n t hus giganteus (Walt.) Muhl. CFl-lv) Hydrochloa carotini’nsis Beauvois (E) Leersia
Living life the natural way – Wheatgrass and Health
Jaspreet Kaur Kamboj; Satyavati Rana; Vandana Gandhi
2011-01-01
Abstract:The Human diet is enriched with young parts of plants (so called ―green foods‖), which can improve nutrient balance intake in natural way. Wheatgrass (Triticum aestivum) refers to young grass of the common wheat plant, which belongs to Poaceae family. This is the most commonly found herb in India, although its nativity is currently unknown. This plant is believed to have many nutritional values; it has been shown to have anti-inflammatory, antioxidant, anticarcinogenic, immunomodul...
Test Area C-62 Final Programmatic Environmental Assessment
2002-05-01
grasses, leaves, fruits , seeds, and insects. The foods most frequently found in their diets are grasses (Poaceae spp.) and legume fruits (Fabaceae spp...heavily on grasses, herbs, fruits , and mast. They also feed on carrion and insects (Jonkel, 1978). The key habitat requirements of black bears are...transforming toxic compounds into harmless water, carbon dioxide, and/or methane (U.S. Army Corps of Engineers, 1999). Soil and groundwater microbiota are
Rust fungi on some poaceous weeds of wheat crops in Pakistan
NAJAM-UL-SEHAR AFSHAN*; ABDUL REHMAN NIAZI
2013-01-01
The article enlists common poaceous weeds found in wheat crop sand their specific parasitic rust fungi. In this study, four (04) plant taxa of Poaceae infected with rust fungi are collected from different wheat crops grown in different areas of Pakistan. The rust fungi are isolated, characterized and identified. All these host plants are known weeds of wheat crop in Pakistan. This work would help to identify and enlist the potential rust fungi on weeds of wheat crop that could be utilized to ...
USE OF ELEUSINE INDICA (L. GAERTN. (KECHILA GHAS AS AN ANTIPYRETIC MEDICINE OF HERBIVORES
Directory of Open Access Journals (Sweden)
Shibabrata Pattanayak
2017-06-01
Full Text Available In Murshidabad district of West Bengal state, India, the traditionally animal rearing people feed parts of Kechila ghas as an antipyretic medicine to their herbivorous animals. The plant is identified as Eleusine indica (L. Gaertn. of the family Poaceae. After collection from the soil, the plants are washed and the whole root along with 1-2 centimeter of stems are cut and fed directly at fresh, succulent stage to the ailing animals for that purpose.
Evolutionary modes of emergence of short interspersed nuclear element (SINE) families in grasses.
Kögler, Anja; Schmidt, Thomas; Wenke, Torsten
2017-11-01
Short interspersed nuclear elements (SINEs) are non-autonomous transposable elements which are propagated by retrotransposition and constitute an inherent part of the genome of most eukaryotic species. Knowledge of heterogeneous and highly abundant SINEs is crucial for de novo (or improvement of) annotation of whole genome sequences. We scanned Poaceae genome sequences of six important cereals (Oryza sativa, Triticum aestivum, Hordeum vulgare, Panicum virgatum, Sorghum bicolor, Zea mays) and Brachypodium distachyon to examine the diversity and evolution of SINE populations. We comparatively analyzed the structural features, distribution, evolutionary relation and abundance of 32 SINE families and subfamilies within grasses, comprising 11 052 individual copies. The investigation of activity profiles within the Poaceae provides insights into their species-specific diversification and amplification. We found that Poaceae SINEs (PoaS) fall into two length categories: simple SINEs of up to 180 bp and dimeric SINEs larger than 240 bp. Detailed analysis at the nucleotide level revealed that multimerization of related and unrelated SINE copies is an important evolutionary mechanism of SINE formation. We conclude that PoaS families diversify by massive reshuffling between SINE families, likely caused by insertion of truncated copies, and provide a model for this evolutionary scenario. Twenty-eight of 32 PoaS families and subfamilies show significant conservation, in particular either in the 5' or 3' regions, across Poaceae species and share large sequence stretches with one or more other PoaS families. © 2017 The Authors The Plant Journal © 2017 John Wiley & Sons Ltd.
Stable Isotope Mapping of Alaskan Grasses and Marijuana
Booth, A. L.; Wooller, M. J.
2008-12-01
The spatial variation of isotope signatures in organic material is a useful forensic tool, particularly when applied to the task of tracking the production and distribution of plant-derived illicit drugs. In order to identify the likely grow-locations of drugs such as marijuana from unknown locations (i.e., confiscated during trafficking), base isotope maps are needed that include measurements of plants from known grow-locations. This task is logistically challenging in remote, large regions such as Alaska. We are therefore investigating the potential of supplementing our base (marijuana) isotope maps with data derived from other plants from known locations and with greater spatial coverage in Alaska. These currently include >150 samples of modern C3 grasses (Poaceae) as well as marijuana samples (n = 18) from known grow-locations across the state. We conducted oxygen, carbon and nitrogen stable isotope analyses of marijuana and grasses (Poaceae). Poaceae samples were obtained from the University of Alaska Fairbanks (UAF) Museum of the North herbarium collection, originally collected by field botanists from around Alaska. Results indicate that the oxygen isotopic composition of these grasses range from 10‰ to 30‰, and broadly mirror the spatial pattern of water isotopes in Alaska. Our marijuana samples were confiscated around the state of Alaska and supplied to us by the UAF Police Department. δ13C, δ15N and δ18O values exhibit geographic patterns similar to the modern grasses, but carbon and nitrogen isotopes of some marijuana plants appear to be influenced by additional factors related to indoor growing conditions (supplementary CO2 sources and the application of organic fertilizer). As well as providing a potential forensic resource, our Poaceae isotope maps could serve additional value by providing resources for studying ecosystem nutrient cycling, for tracing natural ecological processes (i.e., animal migration and food web dynamics) and providing
Gnigler, Luciana; Caddah, Mayara
2015-01-01
A floristic survey was carried out in a contact area between Araucaria Forest and Seasonal Forest areas, in the municipality of Guaraciaba, Far West of Santa Catarina state, southern Brazil. We provide a checklist containing 108 species and 42 plant families for the area. Families with the most encountered number of species were Myrtaceae (eight species), Solanaceae (eight), Euphorbiaceae (seven) and Poaceae (six). Two species are classified as endangered of extinction, following IUCN criteri...
Suharno, Suharno; Sufaati, Supeni; Agustini, Verena; Tanjung, Rosye Hefmi Rechnelty
2015-01-01
ABSTRAK Daya dukung lingkungan (habitat) sangat berpengaruh terhadap pemenuhan kebutuhan hidup manusia. Usaha domestikasi tumbuhan pokem (Setaria italica L.) di Pulau Numfor Kabupaten Biak Numfor telah diusahakan sejak lama oleh masyarakat lokal. Tumbuhan yang termasuk kelompok rumput–rumputan (Familia: Poaceae) telah dimanfaatkan sebagai bahan pangan lokal. Tujuan dari kajian ini adalah untuk mengetahui pemanfaatan dan proses budidaya yang dilakukan oleh masyarakat lokal di pulau Numfor ...
Illustrated weed flora of cotton crop of khairpur district, sindh, pakistan
International Nuclear Information System (INIS)
Memon, R.A.; Bhatti, G.R.
2014-01-01
A survey was carried out for the composition of weed flora of cotton crop of Khairpur district, Sindh, Pakistan. Thirty six weed species belonging to 16 families were noted. Poaceae was found to be most dominant family representing seven species followed by Asteraceae and Papilionaceae, each with five species. Botanical descriptions and illustrations/line drawings of all the recorded taxa were prepared in order to identify the weed species. (author)
Directory of Open Access Journals (Sweden)
Flávio França
2003-12-01
Full Text Available Foram selecionados seis açudes que margeiam a Estrada do Feijão (BA 052, nos municípios de Feira de Santana e Angüera, entre as coordenadas 39º30'-39º00'W e 12º00'-12º30'S. Com a finalidade de se conhecer a flora vascular dos mesmos, esses tipos de plantas foram coletadas de agosto/1996 a dezembro/1997. Registraram-se 121 espécies distribuídas em 46 famílias. As famílias mais representativas foram: Cyperaceae, com 18 espécies (14,9%, Poaceae, com 13 (10,7%, Asteraceae, com 10 (8,3%, Scrophulariaceae e Fabaceae, com 6 (5,0%. As espécies que ocorreram em todos os açudes foram Pistia stratiotes L. (Araceae, Echinochloa colona (L. Link (Poaceae, Nymphaea ampla (Salisb. DC. (Nymphaeaceae e Oxycarium cubense (Poepp. & Kunth. Lye (Cyperaceae.Six ponds were studied between August/1996 and December/1997 at the edge of State Highway BA 052, in the municipalities of Feira de Santana and Angüera, 39º30'-39º00'W and 12º00'-12º30'S.With the aim to know their vascular flora, one hundred and twenty-one species of vascular plants were collected, representing 46 families. The most frequent families were: Cyperaceae with 18 species (14.9%, Poaceae with 13 (10.7%, Asteraceae with 10 (8.3%, Scrophulariaceae and Fabaceae with 6 (5.0%. The species which were recorded in all lakes were: Pistia stratiotes L. (Araceae, Echinochloa colona (L. Link (Poaceae, Nymphaea ampla (Salisb. DC. (Nymphaeaceae and Oxycarium cubense (Poepp. & Kunth. Lye (Cyperaceae.
Taravat, Elham; Zebarjadi, Alireza; Kahrizi, Danial; Yari, Kheirollah
2015-05-01
Among the essential amino acids, phenylalanine, tryptophan, and tyrosine are aromatic amino acids which are synthesized by the shikimate pathway in plants and bacteria. Herbicide glyphosate can inhibit the biosynthesis of these amino acids. So, identification of the gene tolerant to glyphosate is very important. It has been shown that the common reed or Phragmites australis Cav. (Poaceae) is relatively tolerant to glyphosate. The aim of the current research is identification, cloning, sequencing, and registering of partial aro A gene of the common reed P. australis. The partial aro A gene of common reed (P. australis) was cloned in Escherichia coli and the amino acid sequence was identified/determined for the first time. This is the first report for isolation, cloning, and sequencing of a part of aro A gene from the common reed. A 670 bp fragment including two introns (86 bp and 289 bp) was obtained. The open reading frame (ORF) region in part of gene was encoded for 98 amino acids. Alignment showed high similarity among this region with Zea mays (L.) (Poaceae) (94.6%), Eleusine indica L. Gaertn (Poaceae) (94.2%), and Zoysia japonica Steud. (Poaceae) (94.2%). The alignment of amino acid sequence of the investigated part of the gene showed a homology with aro A from several other plants. This conserved region forms the enzyme active site. The alignment results of nucleotide and amino acid residues with related sequences showed that there are some differences among them. The relative glyphosate tolerance in the common reed may be related to these differences.
Łopieńska-Biernat Elżbieta; Pastorczyk Marta; Giełwanowska Irena; Żółtowska Krystyna; Stryiński Robert; Zaobidna Ewa
2017-01-01
Plants adapt to extremely low temperatures in polar regions by maximizing their photosynthetic efficiency and accumulating cryoprotective and osmoprotective compounds. Flowering plants of the family Poaceae growing in the Arctic and in the Antarctic were investigated. Their responses to cold stress were analyzed under laboratory conditions. Samples were collected after 24 h and 48 h of cold treatment. Quantitative and qualitative changes of sugars are found among different species, but they c...
Arif, Mohammad; Busot, Grethel Y.; Mann, Rachel; Rodoni, Brendan; Liu, Sanzhen; Stack, James P.
2016-01-01
Rathayibacter toxicus is a gram-positive bacterium that infects the floral parts of several Poaceae species in Australia. Bacterial ooze is often produced on the surface of infected plants and bacterial galls are produced in place of seed. R. toxicus is a regulated plant pathogen in the U.S. yet reliable detection and diagnostic tools are lacking. To better understand this geographically-isolated plant pathogen, genetic variation as a function of geographic location, host species, and date of...
A maize resistance gene functions against bacterial streak disease in rice
Zhao, Bingyu; Lin, Xinghua; Poland, Jesse; Trick, Harold; Leach, Jan; Hulbert, Scot
2005-01-01
Although cereal crops all belong to the grass family (Poacea), most of their diseases are specific to a particular species. Thus, a given cereal species is typically resistant to diseases of other grasses, and this nonhost resistance is generally stable. To determine the feasibility of transferring nonhost resistance genes (R genes) between distantly related grasses to control specific diseases, we identified a maize R gene that recognizes a rice pathogen, Xanthomonas oryzae pv. oryzicola, wh...
Sapkota, Sirjan; Conner, Joann A.; Hanna, Wayne W.; Simon, Bindu; Fengler, Kevin; Deschamps, St?phane; Cigan, Mark; Ozias-Akins, Peggy
2016-01-01
Apomixis, or clonal propagation through seed, is a trait identified within multiple species of the grass family (Poaceae). The genetic locus controlling apomixis in Pennisetum squamulatum (syn Cenchrus squamulatus) and Cenchrus ciliaris (syn Pennisetum ciliare, buffelgrass) is the apospory-specific genomic region (ASGR). Previously, the ASGR was shown to be highly conserved but inverted in marker order between P. squamulatum and C. ciliaris based on fluorescence in situ hybridization (FISH) a...
Two new stilbene trimers from Cynodon dactylon.
Li, Bi-Jun; Liu, Yao; Gu, Ai-Tong; Zhang, Qing; Chen, Lei; Wang, Shu-Mei; Wang, Feng
2017-11-01
Many naturally occurring oligostilbenes have drawn considerable attention because of their intricate structures and diverse bioactivities. Two new stilbene trimers, cystibenetrimerol A (1) and cystibenetrimerol B (2) were isolated from the dried grass of Cynodon dactylon (L.) Pers. The planar structures and stereo configurations of them were elucidated by spectroscopic and spectrometric methods. The isolation and structures elucidation of two new stilbene trimers suggested the ordinary grass belonging to the family Poaceae may be a rich source of stilbene oligomers.
Pushing the boundaries of resistance: insights from Brachypodium-rust interactions
Figueroa, Melania; Castell-Miller, Claudia V.; Li, Feng; Hulbert, Scot H.; Bradeen, James M.
2015-01-01
The implications of global population growth urge transformation of current food and bioenergy production systems to sustainability. Members of the family Poaceae are of particular importance both in food security and for their applications as biofuel substrates. For centuries, rust fungi have threatened the production of valuable crops such as wheat, barley, oat, and other small grains; similarly, biofuel crops can also be susceptible to these pathogens. Emerging rust pathogenic races with i...
2398-IJBCS-Article-Ablaye Ngom
African Journals Online (AJOL)
admin
Révision du genre Digitaria Haller (Poaceae) au Sénégal : proposition d'une ... des espèces endémiques du Sénégal (Bâ et. Noba ..... A. Base de la plante. B. Noeud. C. Ligule. D. Inflorescence. E et F. Epillet en faces ... Figure 8 : Digitaria exilis. .... C2. Lemma inférieure. C3. Lemma supérieure. D. Epillet, vue de côté. D1.
The effect of different nitrogen nutrition on proline and asparagine content in plant
Czech Academy of Sciences Publication Activity Database
Neuberg, M.; Pavlíková, D.; Pavlík, Milan; Balík, J.
2010-01-01
Roč. 56, č. 7 (2010), s. 305-311 ISSN 1214-1178 R&D Projects: GA MZe QH71077 Institutional research plan: CEZ:AV0Z50380511 Keywords : plant metabolism * Fabaceae * Poaceae Subject RIV: GD - Fertilization, Irrigation, Soil Processing Impact factor: 1.076, year: 2010 http://www.agriculturejournals.cz/publishedArticle?journal=PSE&volume=56&firstPage=305
Czech Academy of Sciences Publication Activity Database
Neuberg, M.; Pavlíková, D.; Žižková, Eva; Motyka, Václav; Pavlík, Milan
2011-01-01
Roč. 57, č. 8 (2011), s. 381-387 ISSN 1214-1178 R&D Projects: GA MZe QH71077; GA ČR(CZ) GAP506/11/0774 Institutional research plan: CEZ:AV0Z50380511 Keywords : poaceae * fabaceae * N nutrition Subject RIV: GD - Fertilization, Irrigation, Soil Processing Impact factor: 1.078, year: 2011 http://www.agriculturejournals.cz/publicFiles/44520.pdf
The effect of technogenic emissions on the heavy metals accumulation by herbaceous plants.
Chaplygin, Victor; Minkina, Tatiana; Mandzhieva, Saglara; Burachevskaya, Marina; Sushkova, Svetlana; Poluektov, Evgeniy; Antonenko, Elena; Kumacheva, Valentina
2018-02-07
The effect of technogenic emissions on the input of Pb, Zn, Cd, Cu, Mn, Cr, and Ni into plants from the Poaceae and Asteraceae families has been studied. Soil and plant contamination by anthropogenic emissions from industrial enterprises leads the decreasing of crop quality; therefore, the monitoring investigation of plants and soils acquires special importance. The herbaceous plants may be used as bioindicators for main environmental changes. It was found that the high level of anthropogenic load related to atmospheric emissions from the power plant favors the heavy metal (HM) accumulation in herbaceous plants. Contamination with Pb, Cd, Cr, and Ni was revealed in plants growing near the power plant. Heavy metals arrive to plants from the soil in the form of mobile compounds. Plant family is one of the main factors affecting the HM distribution in the above- and underground parts of plants. Plants from the Poaceae family accumulate less chemical elements in their aboveground parts than the Asteraceae plants. Ambrosia artemisiifolia and Artemisia austriaca are HM accumulators. For assessing the stability of plants under contamination with HMs, metal accumulation by plants from soil (the bioconcentration factor) and metal phytoavailability from plants above- and underground parts (the acropetal coefficient) were calculated. According to the bioconcentration factor and translocation factor values, Poaceae species are most resistant to technogenic contamination with HMs. The translocation factor highest values were found for Tanacetum vulgare; the lowest bioconcentration factor values were typical for Poa pratensis.
Las plantas vasculares de los afloramientos rocosos de Suesca, Cordillera Oriental colombiana
Directory of Open Access Journals (Sweden)
Carolina Avellaneda Cadena
2006-01-01
Full Text Available Se muestrearon las plantas vasculares presentes en tres tipos de afloramientos rocosos del municipio de Suesca, departamento de Cundinamarca (Colombia, ubicados entre 2.800 y 3.000 m de altitud. Estos sitios se denominaron Valle de los Halcones (VH, Farallones de Suesca (FS y Los Monolitos (LM. Cada planta fue recolectada, determinada y se le anotó la superficie en la que crecía (placa, repisa o fisura y el hábito de crecimiento (erecta, colgante o perpendicular a la superficie. Se encontraron 97 especies, correspondientes a 38 familias y 70 géneros. La familia más diversa fue Asteraceae, seguida de Poaceae, Orchidaceae, Bromeliaceae y Polypodiaceae. El género con más especies fue Tillandsia, seguido de Polypodium. Los sitos de muestreo con mayor diversidad fueron VH y FS. En LM las familias con más especies fueron Asteraceae y Poaceae, en FS Poaceae y Asteraceae y en VH Asteraceae y Orchidaceae. En VH las placas fue la superficie con mayor número de especies, mientras que en LM fueron las repisas y en FS las placas y las repisas. La mayoría de las especies encontradas en todos los sitos fueron erectas, seguidas de las perpendiculares a la superficie. Los tres sitios de muestreo mostraron alta similitud florística entre sí.
Diekmann, Kerstin; Hodkinson, Trevor R; Wolfe, Kenneth H; van den Bekerom, Rob; Dix, Philip J; Barth, Susanne
2009-06-01
Lolium perenne L. (perennial ryegrass) is globally one of the most important forage and grassland crops. We sequenced the chloroplast (cp) genome of Lolium perenne cultivar Cashel. The L. perenne cp genome is 135 282 bp with a typical quadripartite structure. It contains genes for 76 unique proteins, 30 tRNAs and four rRNAs. As in other grasses, the genes accD, ycf1 and ycf2 are absent. The genome is of average size within its subfamily Pooideae and of medium size within the Poaceae. Genome size differences are mainly due to length variations in non-coding regions. However, considerable length differences of 1-27 codons in comparison of L. perenne to other Poaceae and 1-68 codons among all Poaceae were also detected. Within the cp genome of this outcrossing cultivar, 10 insertion/deletion polymorphisms and 40 single nucleotide polymorphisms were detected. Two of the polymorphisms involve tiny inversions within hairpin structures. By comparing the genome sequence with RT-PCR products of transcripts for 33 genes, 31 mRNA editing sites were identified, five of them unique to Lolium. The cp genome sequence of L. perenne is available under Accession number AM777385 at the European Molecular Biology Laboratory, National Center for Biotechnology Information and DNA DataBank of Japan.
Parr, L B; Perkins, R G; Mason, C F
2002-04-01
The duckweeds Lemna minor L. and L. minuscula Herter reduced PSII quantum efficiency (F'q/F'm) of the filamentous green alga Cladophora glomerata Kützing by up to 42% over seven days when floating above mats of C. glomerata in containers. Dissolved oxygen (DO) increased by 23% at 30 degrees C in containers with C. glomerata over controls. But when the water surface in the containers was covered with Lemna spp. floating above C. glomerata, DO was 83% lower at 30 degrees C over seven days than in control samples with no duckweed or alga. Dissolved oxygen was lower beneath a thick mat (1 cm) of either Lemna spp. covering the surface than under a thin layer (single-frond canopy). PAM fluorimetry showed that maximum PSII efficiency (Fv/Fm) of C. glomerata in containers was reduced under a canopy of L. minor by 17% over seven days, and under L. minuscula by 22%. F'q/F'm of C. glomerata in containers exposed to 51 micromol m(-2) s(-1) PPFD decreased under a canopy of L. minor by 16% over seven days, and under L. minuscula by 19% compared to controls. When light response curves were compared, F'q/F'm was significantly reduced under canopies of L. minor at the highest temperatures tested (28 degrees C and 30 degrees C). L. minor significantly reduced relative electron transport rate (rel. ETR) of the controls by up to 71% at 30 degrees C. Relative electron transport rate did not reach light saturation point (Esat) except at 28 degrees and 30 degrees C under mats of L. minor. Whereas the highest rate of production (rel. ETRmax) and Esat increased with temperature in controls, under a canopy of Lemna, decreases were observed. It is suggested that, during periods of high summer temperature and irradiance, shading inhibits oxygenic photosynthesis in mats of C. glomerata beneath canopies of Lenma spp. This results in less oxygen being produced by the C. glomerata (oxygen produced by Lemna spp. is not released into the water), and this may further inhibit the C. glomerata by
Source areas and long-range transport of pollen from continental land to Tenerife (Canary Islands).
Izquierdo, Rebeca; Belmonte, Jordina; Avila, Anna; Alarcón, Marta; Cuevas, Emilio; Alonso-Pérez, Silvia
2011-01-01
The Canary Islands, due to their geographical position, constitute an adequate site for the study of long-range pollen transport from the surrounding land masses. In this study, we analyzed airborne pollen counts at two sites: Santa Cruz de Tenerife (SCO), at sea level corresponding to the marine boundary layer (MBL), and Izaña at 2,367 m.a.s.l. corresponding to the free troposphere (FT), for the years 2006 and 2007. We used three approaches to describe pollen transport: (1) a classification of provenances with an ANOVA test to describe pollen count differences between sectors; (2) a study of special events of high pollen concentrations, taking into consideration the corresponding meteorological synoptic pattern responsible for transport and back trajectories; and (3) a source-receptor model applied to a selection of the pollen taxa to show pollen source areas. Our results indicate several extra-regional pollen transport episodes to Tenerife. The main provenances were: (1) the Mediterranean region, especially the southern Iberian Peninsula and Morocco, through the trade winds in the MBL. These episodes were characterized by the presence of pollen from trees (Casuarina, Olea, Quercus perennial and deciduous types) mixed with pollen from herbs (Artemisia, Chenopodiaceae/Amaranthaceae and Poaceae wild type). (2) The Saharan sector, through transport at the MBL level carrying pollen principally from herbs (Chenopodiaceae-Amaranthaceae, Cyperaceae and Poaceae wild type) and, in one case, Casuarina pollen, uplifted to the free troposphere. And (3) the Sahel, characterized by low pollen concentrations of Arecaceae, Chenopodiaceae-Amaranthaceae, Cyperaceae and Poaceae wild type in sporadic episodes. This research shows that sporadic events of long-range pollen transport need to be taken into consideration in Tenerife as possible responsible agents in respiratory allergy episodes. In particular, it is estimated that 89-97% of annual counts of the highly allergenous Olea
INVENTORY OF THE INVASIVE ALIE N PLANT SPECIES IN INDONESIA
Directory of Open Access Journals (Sweden)
SRI S UDARMIYATI T JITROSOEDIRDJO
2005-01-01
Full Text Available An inventory of the alien plant species in Indone sia based on the existing references and herbarium specimens concluded that 1936 alien plant species ar e found in Indonesia which belong to 187 families. Field studies should be done to get the complete figur es of alien plant species in Indonesia. Based on the existing figures of the plant species, the invasive alien plant species can be iden tified, followed by studies on the assessment of losses, biology, management and their possible utilizations. Alien plant species are imported to Indonesia for cultivation, collection of the botanical garden, as experimental plants or other curiosities. Aside from plants purposely imported, there are also introduced plant propagules conta-minating imported agricultural products. These alien plant species can be beneficial or have a potential of being invasive. The alien cultivated species consisted of 67% of the total number. More than half of the cultivated plants are ornamental plants. Some of th e species are naturalized or escaped from cultivation and become wild and invasive. Some other natura lized species, adapted well without any problems of invasion. There are 339 species or 17% of the species r ecorded as weeds. The highest record of weeds is found in the family of Poaceae (57 species, follo wed by Asteraceae (53 species and Cyperaceae (35 species. There are 6 families having more than 10 species of weeds: Amaranthaceae, Asteraceae, Cyperaceae, Euphorbiaceae, Poaceae, and Rubiaceae. Three families have more than 100 species: Asteraceae 162 species, Poaceae 120 species, and Papillionaceae 103 species. Five species of aquatic and 20 species of terrestrial plants considered as important alien plant species in Indonesia were identified and some of their distributions noted
Source areas and long-range transport of pollen from continental land to Tenerife (Canary Islands)
Izquierdo, Rebeca; Belmonte, Jordina; Avila, Anna; Alarcón, Marta; Cuevas, Emilio; Alonso-Pérez, Silvia
2011-01-01
The Canary Islands, due to their geographical position, constitute an adequate site for the study of long-range pollen transport from the surrounding land masses. In this study, we analyzed airborne pollen counts at two sites: Santa Cruz de Tenerife (SCO), at sea level corresponding to the marine boundary layer (MBL), and Izaña at 2,367 m.a.s.l. corresponding to the free troposphere (FT), for the years 2006 and 2007. We used three approaches to describe pollen transport: (1) a classification of provenances with an ANOVA test to describe pollen count differences between sectors; (2) a study of special events of high pollen concentrations, taking into consideration the corresponding meteorological synoptic pattern responsible for transport and back trajectories; and (3) a source-receptor model applied to a selection of the pollen taxa to show pollen source areas. Our results indicate several extra-regional pollen transport episodes to Tenerife. The main provenances were: (1) the Mediterranean region, especially the southern Iberian Peninsula and Morocco, through the trade winds in the MBL. These episodes were characterized by the presence of pollen from trees ( Casuarina, Olea, Quercus perennial and deciduous types) mixed with pollen from herbs ( Artemisia, Chenopodiaceae/Amaranthaceae and Poaceae wild type). (2) The Saharan sector, through transport at the MBL level carrying pollen principally from herbs (Chenopodiaceae-Amaranthaceae, Cyperaceae and Poaceae wild type) and, in one case, Casuarina pollen, uplifted to the free troposphere. And (3) the Sahel, characterized by low pollen concentrations of Arecaceae, Chenopodiaceae-Amaranthaceae, Cyperaceae and Poaceae wild type in sporadic episodes. This research shows that sporadic events of long-range pollen transport need to be taken into consideration in Tenerife as possible responsible agents in respiratory allergy episodes. In particular, it is estimated that 89-97% of annual counts of the highly allergenous Olea
The effect of geographical and climatic properties on grass pollen and Phl p 5 allergen release
Alan, Şenol; Şahin, Aydan Acar; Sarışahin, Tuğba; Şahin, Serap; Kaplan, Ayşe; Pınar, Nur Münevver
2018-04-01
The Poaceae family, including grasses, comprises several cosmopolitan and allergenic species. The aim of this study was to determine the correlations between Poaceae pollen and Phl p 5 allergen concentrations in two cities with different geographical and climatic properties in Turkey. Pollen were collected from Burkard traps in Ankara and Zonguldak. Phl p 5 sampling was carried out between March and October in both 2015 and 2016 using a BGI900 Cascade High Volume Air Sampler (900 L/min.). The concentrations of Phl p 5 were measured by the enzyme-linked immunosorbent assay (ELISA) technique. The annual sum of Poaceae pollen (pollen index) during 2015-2016 was 5454 in Ankara and 4142 in Zonguldak. The total Phl p 5 concentration was 1309 pg/m3 in Zonguldak, whereas it was 8181 pg/m3 in Ankara over 2 years. About 90% of the allergen was found in the fraction with particulate matter (PM) > 10 μm in both cities. It was found that the main meteorological parameter which affected pollen and Phl p 5 was temperature in both stations. Rainfall was also found to be important for Zonguldak, due to its climatic and geographic properties. Lastly, we suggest that the primary wind direction, which is from the south of Zonguldak, could have a `drift effect' for allergens because of the airborne pollen concentrations and the dates on which the allergen is released into the atmosphere. The wind direction may be an important factor in the distribution of allergen and pollen grains in stations, especially those with a hilly topography.
Directory of Open Access Journals (Sweden)
Antonio Rodrigues Neto
2012-04-01
Full Text Available A realização deste trabalho teve como objetivo principal conhecer o processo de adaptação estratégica da empresa Vargem Bela, produtora de cachaça no Brejo paraibano. Primeiro, identificou-se os eventos críticos ocorridos no período de 1961 a 2007 e verificou-se sob quais condições estes eventos ocorreram, para então, analisá-los sob a perspectiva da Teoria Institucional e da Visão Baseada em Recursos. Com essa finalidade, foi feita uma revisão na literatura existente sobre as referidas teorias, com ênfase nos trabalhos de DiMaggio e Powell (2005, no que diz respeito à Teoria Institucional, e Peteraf (1993 e Barney e Herterly (2007 no que se refere à Visão Baseada em Recursos. O trabalho é uma pesquisa qualitativa, descritiva e exploratória, que se deu através de um estudo de caso que teve sua sustentação metodológica baseada no trabalho de Pettigrew (1987, sobre métodos de adaptação estratégica de empresas, onde são investigados três elementos da mudança: o contexto (interno e externo, o conteúdo e o processo. A pesquisa possibilitou concluir que o processo de adaptação estratégica vivido pela empresa, apresenta características diferentes em dois períodos temporais distintos. O primeiro período, que vai de 1961 até 1986, em que a postura organizacional assumida no processo de mudança é mais proativa, foram realizadas aquisições de ativos tangíveis e intangíveis capazes de construir vantagens competitivas sustentáveis tornando a empresa mais competitiva e líder de mercado. Entretanto, no segundo período, que vai de 1986 a 2007, a postura assumida pela empresa passa a ser mais reativa, numa demonstração de inércia organizacional, passando a atuar no sentido de atender às pressões ambientais.The accomplishment of this work had as main goal knowing the process of strategic adaptation of Vargem Bela Company, producer of sugar cane brandy in the swamp of Paraiba. First of all, the critical events
Toma, Yo; Clifton-Brown, John; Sugiyama, Shinji; Nakaboh, Makoto; Hatano, Ryusuke; Fernández, Fabián G; Ryan Stewart, J; Nishiwaki, Aya; Yamada, Toshihiko
2013-06-01
Global soil carbon (C) stocks account for approximately three times that found in the atmosphere. In the Aso mountain region of Southern Japan, seminatural grasslands have been maintained by annual harvests and/or burning for more than 1000 years. Quantification of soil C stocks and C sequestration rates in Aso mountain ecosystem is needed to make well-informed, land-use decisions to maximize C sinks while minimizing C emissions. Soil cores were collected from six sites within 200 km(2) (767-937 m asl.) from the surface down to the k-Ah layer established 7300 years ago by a volcanic eruption. The biological sources of the C stored in the Aso mountain ecosystem were investigated by combining C content at a number of sampling depths with age (using (14) C dating) and δ(13) C isotopic fractionation. Quantification of plant phytoliths at several depths was used to make basic reconstructions of past vegetation and was linked with C-sequestration rates. The mean total C stock of all six sites was 232 Mg C ha(-1) (28-417 Mg C ha(-1) ), which equates to a soil C sequestration rate of 32 kg C ha(-1) yr(-1) over 7300 years. Mean soil C sequestration rates over 34, 50 and 100 years were estimated by an equation regressing soil C sequestration rate against soil C accumulation interval, which was modeled to be 618, 483 and 332 kg C ha(-1) yr(-1) , respectively. Such data allows for a deeper understanding in how much C could be sequestered in Miscanthus grasslands at different time scales. In Aso, tribe Andropogoneae (especially Miscanthus and Schizoachyrium genera) and tribe Paniceae contributed between 64% and 100% of soil C based on δ(13) C abundance. We conclude that the seminatural, C4 -dominated grassland system serves as an important C sink, and worthy of future conservation. © 2013 Blackwell Publishing Ltd.
Checklist of Serengeti Ecosystem Grasses
Ficinski, Paweł; Vorontsova, Maria
2016-01-01
Abstract We present the first taxonomic checklist of the Poaceae species of the Serengeti, Tanzania. A review of the literature and herbarium specimens recorded 200 species of grasses, in line with similar studies in other parts of East Africa. The checklist is supported by a total of 939 herbarium collections. Full georeferenced collection data is made available alongside a summary checklist in pdf format. More than a quarter of the species are known from a single collection highlighting the need for further research, especially concerning the rare species and their distribution. PMID:27226761
FIGUEROA-C., YISELA; GALEANO, GLORIA
2012-01-01
Se presenta el inventario florístico del enclave seco interandino de La Tatacoa (vallede la parte alta del río Magdalena, Huila, Colombia). Se encontraron 223 especies,distribuidas en 170 géneros y 60 familias. A nivel florístico, la familia Leguminosaees la más diversificada con 36 especies y 28 géneros, seguida por Poaceae (20/15),Euphorbiaceae (13/6), Asteraceae (10/10) y Cactaceae (8/7). El hábito de crecimientopredominante en términos de riqueza de especies fue el de las hierbas, seguido...
Zhang, Jiang-Tao; Wu, Bo-Wen; Wu, San-An
2018-01-23
The mealybug genus Saccharicoccus Ferris includes three species: S. isfarensis (Borchsenius, 1949), S. sacchari (Cockerell, 1895) and a new species, S. chinensis Zhang, Wu Wu sp. n. The new species, collected on Miscanthus sp. (Poaceae) and other poaceous weeds in China, is described and illustrated, and molecular analyses based on the mitochondrial gene cytochrome c oxidase subunit I (COI) are provided. Additional data on the distribution and host-plants of each species are given, and a key to the adult females of Saccharicoccus species is provided.
Foieri, Alvaro; Lenicov, Ana M Marino De Remes; Virla, Eduardo G
2016-04-11
Notozulia entreriana (Berg) (Hemiptera: Cercopidae) is one of the most common spittlebugs inhabiting the subtropical region of the America, inflicting important economic damage to grass crops. The immature stages are described and illustrated; the main characteristics that distinguish instars are the body size, color, number of flagellomeres, and number of tibial and metatarsomere spines. A key for identification of nymphs is provided as a tool to develop field studies. Nine host plants, all belonging to Poaceae, are recorded as breeding and feeding host plants from different localities in northern Argentina.
Directory of Open Access Journals (Sweden)
LIDIA S. BURRY
2001-06-01
Full Text Available La aplicación de un análisis de regresión lineal simple a datos de lluvia de polen y de vegetación, en una zona de la Patagonia (Provincia de Chubut, Argentina permitió relacionar cuantitativamente los porcentajes de lluvia polínica y de cobertura de la vegetación para los taxa Poaceae, Papilionoideae, tipo Senecio y Mulinum spinosum. Se obtuvo un buen ajuste de las rectas de regresión para cada uno de los taxa considerados, con coeficientes de correlación r de Pearson altos para M. spinosum (0,82 y tipo Senecio (0,81 y coeficientes algo menores en el caso de Poaceae (0,66 y Papilionoideae (0,61. Estas regresiones permitieron inferir la presencia o ausencia de polen regional y el valor predictivo de la presencia de polen en ausencia de la vegetación que lo produce. Al respecto, la lluvia de polen estudiada incluye el aporte regional (excepto Papilionoideae aun cuando M. spinosum tiene una baja contribución. Esta sobrerrepresentación es atribuible al transporte de larga distancia, a través de los vientos que provienen del oeste. Estas relaciones cuantitativas nos permitirán extrapolar cambios vegetacionales pasados en estos taxa a partir de espectros de polen fósil para el área de estudioThe use of simple linear regression to data of pollen rain and vegetation cover in Patagonia (Province of Chubut, Argentina allowed us to develop quantitative relationships between modern pollen rain perecentages and vegetation cover for the taxa Poaceae, Papilionoideae, Senecio type, and Mulinum spinosum. The analysis revealed a good fit of data to regression lines for all taxa, with high Pearson r coefficient values in the case of M. spinosum (0.82 and Senecio type (0.81, and somewhat lower values in the case of Poaceae (0.66 and Papilionoideae (0.61. These regressions allowed us to infer the presence or absence of regional pollen and predict the quantity of pollen in the absence of the vegetation producing it. In this regard, the studied pollen
Silicone tube micro extraction
DEFF Research Database (Denmark)
Reiss, Antje; Fomsgaard, Inge S.; Mathiassen, Solvejg Kopp
Benzoxazinoids are secondary plant metabolites highly abundant in the Poaceae, including the grain crops wheat, triticale and rye. Benzoxazinoids have been shown to be phytotoxic to a range of weed species and suppress the growth of soil fungi, such as Gaeumannomyces graminis, the cause of the take......-all disease in cereals. Hence, an improved knowledge on the prevalence and temporal distribution of benzoxazinoids in the root zone is of major interest. In this trial, four cultivars of winter rye, winter triticale and winter wheat were sown at the end of September and mid of October 2015 in the presence...
Directory of Open Access Journals (Sweden)
Plamen S. Stoyanov
2016-06-01
Full Text Available The study presents data on the diversity of grass species in the region of the village of Mugla (the Western Rhodopes. One hundred forty-one species of higher plants belonging to 40families were registered. (Apiaceae, Aspleniaceae, Asteraceae, Boraginaceae, Brassicaceae,Campanulaceae, Caryophyllaceae, Cistaceae, Cyperaceae, Dipsacaceae, Equisetaceae, Ericaceae,Euphorbiaceae, Fabaceae, Gentianaceae, Geraniaceae, Gesneriaceae, Hypericaceae, Juncaceae,Lamiaceae, Lemnaceae, Liliaceae, Linaceae, Menyanthaceae, Oleacea, Onagraceae, Orchidaceae,Parnassiaceae, Plantaginaceae, Plumbaginaceae, Poaceae, Polygalaceae, Primulaceae,Ranunculaceae, Rosaceae, Rubiaceae, Saxifragaceae, Scrophulariaceae, Valerianaceae andViolaceae. Their conservation status was presented, as well as medicinal plants.
Checklist of Serengeti Ecosystem Grasses.
Williams, Emma Victoria; Elia Ntandu, John; Ficinski, Paweł; Vorontsova, Maria
2016-01-01
We present the first taxonomic checklist of the Poaceae species of the Serengeti, Tanzania. A review of the literature and herbarium specimens recorded 200 species of grasses, in line with similar studies in other parts of East Africa. The checklist is supported by a total of 939 herbarium collections. Full georeferenced collection data is made available alongside a summary checklist in pdf format. More than a quarter of the species are known from a single collection highlighting the need for further research, especially concerning the rare species and their distribution.
Utami, Rini
2011-01-01
Black sticky rice (Oryza sativa L.) belongs to Poaceae family which is used by people as food stuffs such as tape and porridge. Black sticky rice is red/purple and its dye stuff is strong enough. In cosmetic, dye stuff is one of the causes of irritation and allergy on skin so that the researcher has made the formulation of lipstick component using natural dye stuff made of black sticky rice. The formulation of lipstick component consisted of some components such as cera alba, lanolin,...
Directory of Open Access Journals (Sweden)
Lorelys Valerio González
2018-05-01
Full Text Available With the purpose to make a floristic inventory of El Morro Lagoon, which is a protected area of Margarita Island, three zones were sampled with transects bordering the lagoon, between the months March and May and from October to December 2008. At least, 98 species were recorded, distributed in 43 families. The best represented families were Poaceae, Fabaceae and Euphorbiaceae. Mangrove is the dominating biotope, mainly Avicennia germinans (L. L. and Laguncularia racemosa (L. C. F. Gaertn. The alteration of flora could be related to anthropogenic activities, such as urbanism, informal economy and local tourism.
Vascular Plants of the Chimbote Wetlands, Peru
Arana, César; Salinas, Letty
2013-01-01
Los humedales de Chimbote (09°05’51"S; 78°32’52"O) presentan una flora vascular compuesta por 41 especies en 18 familias. El 61% magnoliópsidas y el 39% liliópsidas. Las familias con mayor número de especies fueron Poaceae, Cyperaceae y Asteraceae. Las formas de crecimiento dominantes fueron las hierbas (85%) seguidas de arbustos (10%). En comparación con los humedales costeros de Lima, en Chimbote se presenta mayor riqueza de especies que en Medio Mundo (16 especies) y El Paraíso (25), aunqu...
Floristic diversity of 'Chinarite' protected area – Rodopi municipality, Bulgaria
Directory of Open Access Journals (Sweden)
L. Dospatliev
2017-06-01
Full Text Available Abstract. Study on the species composition of vascular plants in 'Chinarite' protected area in Belashtitsa village, Rodopi Municipality, Bulgaria was conducted using the floristic analysis method. A total of 147 species of vascular plants were identified, belonging to 124 genera and 51 families. The families Poaceae, Asteraceae, Lamiaceae, Brassicaceae, Apiaceae, Rosaceae and Fabaceae are the most highly represented. The comparative analysis shows that the angiosperm taxa are dominating in the studied area. Dicotyledonous plants are prevailing among them, while monocotyledonous are significantly less in number. Molinia caerulea species, identified in the present study, has not been reported to have been found so far in the Thracian lowland floristic region.
Situmorang, Betty Meilya
2013-01-01
Essential oil is a term used for volatile oil and obtained from part of plant such as leaves, flowers, fruit, bark and roots. Lemongrass oil is a major export commodities among the various types of essential oil. The main content of lemongrass oil are sitronellal and geraniol, and content oil of lemongrass is 0.5 to 1.2%. Andropogon citratus DC. of the family Poaceae is one of plant that contains essential oil and is widely used as a liniment. The objective of this research is to determine th...
De Melo, Giany O; Muzitano, Michelle F; Legora-Machado, Alexandre; Almeida, Thais A; De Oliveira, Daniela B; Kaiser, Carlos R; Koatz, Vera Lucia G; Costa, Sônia S
2005-04-01
The infusion of aerial parts (EI) of Eleusine indica Gaertn (Poaceae) is used in Brazil against airway inflammatory processes like influenza and pneumonia. Pre-treatment with 400 mg/kg of crude extract inhibited 98% of lung neutrophil recruitment in mice exposed to aerosols of lipopolysaccharide (LPS) from Gram-negative bacteria, in a dose-dependent manner. At 400 microg/kg, schaftoside (6-C-beta-glucopyranosyl-8-C-alpha-arabinopyranosylapigenin) and vitexin (8-C-beta-glucopyranosylapigenin), isolated from EI, inhibited 62% and 80% of lung neutrophil influx, respectively. These results may justify the popular use of E. indica against airway inflammatory processes.
Ecosystem Management: Synthesis and Findings
2009-04-29
Imperata cylindrica, in the United States. Weed Technology 7:1005-1009. Faircloth, W.H. M.G. Patterson, J.H. Miller, and D.H. Teem. 2005. Wanted dead or...S.E., and J.B. Grace. 2000. The Effects of Gap Size and Disturbance Type on Invasion of wet pine savanna by Cogongrass, Imperata cylindrica (Poaceae...American Journal of Botany, Vol. 87, No. 9. (Sep., 2000), pp. 1279-1286. Lippincott, C.L. 2000. Effects of Imperata cylindrica (L.) Beauv
Caracterización morfológica y relaciones fenéticas entre especies de los órdenes liliales y poales
Guevara O, Lorena; Benítez de Rojas, Carmen
2004-01-01
Con el fin de realizar la caracterización morfológica, comparar y discutir acerca de las posibles relaciones fenéticas, se estudiaron 19 especies pertenecientes a 8 familias del orden Liliales (Cronquist, 1988) y 2 especies de la familia Poaceae subfamilia Bambusoideae (Judd et al., 1999). Se analizaron especímenes colectados en diferentes regiones del país, y otros depositados en el herbario "Víctor Manuel Badillo" de la Facultad de Agronomía de la Universidad Central de Venezuela (MY). Con ...
Directory of Open Access Journals (Sweden)
Amnon Freidberg
2017-05-01
Full Text Available Ichneumonopsis Hardy,1973, a genus of oriental fruit flies, is revised and two new species, I. hancocki sp. nov. (from Peninsular Malaysia and I. taiwanensis sp. nov. (from Taiwan, are described. A key to the three species of Ichneumonopsis is presented. In northern Thailand larvae of I. burmensis Hardy, 1973 develop in bamboo shoots of Pseudoxytenanthera albociliata (Munro Nguyen and Dendrocalamus strictus (Roxburgh Nees (Poaceae, not Melocalamus compactiflorus as previously reported. The recently discovered association of I. burmensis with bamboo substantiates our previous assumption assigning Ichneumonopsis to the primarily bamboo-inhabiting tribe Gastrozonini. Hence, we synonymize Ichneumonopsidini under Gastrozonini (syn. nov..
Directory of Open Access Journals (Sweden)
D'Apolito
2010-12-01
Full Text Available We present data on the pollen harvest by Apismellifera L. at a central-western Brazil site not yet studied. Corbiculae pollen loads were collected during one year in front of the hive, acetolysed and slides mounted for optical microscopy. Identification followed comparisons with a local pollen collection. Forty-two pollen types were utilized by the bee; the most important families were Myrtaceae, Asteraceae, Euphorbiaceae, Brassicaceae and Poaceae. The genus/species level ranking of relative importance showed Eucalyptus (19%, Raphanus raphanistrum (13%, Poaceae type 2 (7.5%, Jatropha cf. gossypiifolia (7% and Sapium glandulatum (6.5%. Overall, the majority of pollen types (80% were not abundantly harvested, and a minority (4% reached values of 10%. Given that the study area has cultivated plants and not natural vegetation, we indicate most of the identified species as manageable and point out that weedy vegetation can be an important food source for bees since it frequently occurred in the pollen spectra even within a totally cultivated area.Apresentamos dados sobre a coleta de pólen por Apis mellifera L. em uma localidade no centro-oeste do Brasil, ainda não estudada. Cargas corbiculares de pólen foram coletadas durante um ano em frente ao ninho, acetolisadas e montadas em lâminas para microscopia óptica. A identificação foi feita por comparação com uma coleção de referência local. Quarenta e dois tipos polínicos foram utilizados pelas abelhas; as famílias mais importantes foram Myrtaceae, Asteraceae, Euphorbiaceae, Brassicaceae e Poaceae. O ranqueamento de importância relativa para gênero/espécie mostrou Eucalyptus (19%, Raphanus raphanistrum (13%, Poaceae tipo 2 (7,5%, Jatropha cf. gossypiifolia (7% e Sapium glandulatum (6,5%. No geral, a maioria dos recursos (80% não foi utilizada com abundância, e uma minoria (4% alcançou valores de 10%. Dado que a área de estudo não possui uma vegetação natural, mas cultivares, n
Li, Ruilong; Tan, Huadong; Zhu, Yaxian; Zhang, Yong
2017-07-01
The polycyclic aromatic hydrocarbons (PAHs) located on the epidermal tissues showed distinctive toxic effects to root, while the retention and distribution of PAHs on mangrove seedlings poorly understood. Our results confirmed that the partition coefficients (K f ) of the PAHs retained on the epidermal tissue of mangrove roots, such as Kandelia obovata, Avicennia marina and Aegiceras corniculatum, were much higher than the Poaceae plants roots, for example wheat and maize (Wild et al., 2005). Moreover, to the parent and alkyl PAHs, a well negative correlation was observed between the surface polarity of these three species of mangrove root and the K f values (p mangrove root epidermal tissues formed larger clusters than that of on Poaceae plants, such as wheat and maize (Wild et al., 2005) due to the limitation of the suberization of the root exodermis and endodermis. After exposure of 30 d, rhizo- and endophytic bacteria degraded parts of the N/O/S-containing PAHs to medium-lifetime fluorescence substances. To our knowledge, this is the first time to assess the retention of PAHs on the epidermal tissue of mangrove root, which will improve our understanding of the root uptake PAHs process. Copyright © 2017 Elsevier Ltd. All rights reserved.
Nisyawati, Aini, R. N.; Silalahi, M.; Purba, E. C.; Avifah, N.
2017-07-01
Research on the local knowledge of food plants used by Karo ethnic in the Semangat Gunung Village, North Sumatra has been done. The aim of this study is to reveal plant species that used by the people of Karo ethnic as food. We used the ethnobotanical approach which included open-ended, semi-structural interview, and exploration method. One eldervillage, 2 traditional healers, and 30 respondents have been selected as sources of information. Descriptive statistics have been used to analyze the gathered data. A number of 109 species which belong to 83 genus and 45 families known to be used as food sources by Karo people. Four families have the highest number of food plant species, which are Solanaceae (8 species), Poaceae (7 species), Fabaceae (6 species), and Zingiberaceae (6 species). All of those families are found in the village, both wild and Cultivated. Solanaceae is used as source of fruits, vegetables, and spices. Poaceae is used as the source of the staple food, alternative food sources, snacks, spices, and traditional foods. Fabaceae is used as source of vegetables and traditional foods. Zingiberaceae is used as source of spices.
Floristic diversity in bashemsin valley of kackar mountains national park of rize, turkey
International Nuclear Information System (INIS)
Baykal, H.
2016-01-01
The floristical structure of Bashemsin and its environs as a protected and isolated area within Kackar Mountains National Park, situated in Rize, a province in the Blacksea region of Turkey, is studied. 1830 plant specimens were collected and 503 taxa were identified in 234 genera and 75 families. Sixteen Pteridophytes and 487 Spermatophytes were determined. Two of Spermatophytes are Gymnospermae while 485 of them are Angiospermae (98 Monocotyledones and 389 Dicotyledones). The richest families in taxa are Asteraceae, Poaceae, Brassicaceae, and Fabaceae (55 Asteraceae, 49 Poaceae, 28 Brassicaceae, and 27 Fabaceae). Phytogeographic elements are listed in order as: Euro-Siberian 247 (49.1%), Irano-Turanian 17 (3.4%), Mediterranean 6 (1.2%), multiregional-unknown phytogeographic root 233 (46.3%). Hemicryptophytes are the richest with 224 (44.5%) taxa and it is followed by cryptophytes 144 (28.6%), therophytes 53 (10.5%), chamaephytes 59 (11.7%), phanerophytes 19 (3.8%), vasicular parasites 2 (0.4%), nanophanerophytes/chamaephytes 1 (0.2%) and hydrophytes 1 (0.2%). 34 endemic taxa were determined (6.7%). 13 threatened taxa were detected in the research area and we determined that Sorbus caucasica Zinserl. var. yaltirikii Goksin population has fallen into CR endangered category with only 2 individuals in the study area. (author)
Lori, M.
2015-05-22
Plant elicitor peptides (Peps) are potent inducers of pattern-triggered immunity and amplify the immune response against diverse pathogens. Peps have been discovered and studied extensively in Arabidopsis and only recently orthologs in maize were also identified and characterized in more detail. Here, the presence of PROPEPs, the Pep precursors, and PEPRs, the Pep receptors, was investigated within the plant kingdom. PROPEPs and PEPRs were identified in most sequenced species of the angiosperms. The conservation and compatibility of the Pep-PEPR-system was analysed by using plants of two distantly related dicot families, Brassicaceae and Solanaceae, and a representative family of monocot plants, the Poaceae. All three plant families contain important crop plants, including maize, rice, tomato, potato, and canola. Peps were not recognized by species outside of their plant family of origin, apparently because of a divergence of the Pep sequences. Three family-specific Pep motifs were defined and the integration of such a motif into the Pep sequence of an unrelated Pep enabled its perception. Transient transformation of Nicotiana benthamiana with the coding sequences of the AtPEPR1 and ZmPEPR1a led to the recognition of Pep peptides of Brassicaceae or Poaceae origin, respectively, and to the proper activation of downstream signalling. It was concluded that signalling machinery downstream of the PEPRs is highly conserved whereas the leucine-rich repeat domains of the PEPRs co-evolved with the Peps, leading to distinct motifs and, with it, interfamily incompatibility.
Asaf, Sajjad; Khan, Abdul Latif; Khan, Abdur Rahim; Waqas, Muhammad; Kang, Sang-Mo; Khan, Muhammad Aaqil; Shahzad, Raheem; Seo, Chang-Woo; Shin, Jae-Ho; Lee, In-Jung
2016-01-01
Oryza minuta (Poaceae family) is a tetraploid wild relative of cultivated rice with a BBCC genome. O. minuta has the potential to resist against various pathogenic diseases such as bacterial blight (BB), white backed planthopper (WBPH) and brown plant hopper (BPH). Here, we sequenced and annotated the complete mitochondrial genome of O. minuta. The mtDNA genome is 515,022 bp, containing 60 protein coding genes, 31 tRNA genes and two rRNA genes. The mitochondrial genome organization and the gene content at the nucleotide level are highly similar (89%) to that of O. rufipogon. Comparison with other related species revealed that most of the genes with known function are conserved among the Poaceae members. Similarly, O. minuta mt genome shared 24 protein-coding genes, 15 tRNA genes and 1 ribosomal RNA gene with other rice species (indica and japonica). The evolutionary relationship and phylogenetic analysis revealed that O. minuta is more closely related to O. rufipogon than to any other related species. Such studies are essential to understand the evolutionary divergence among species and analyze common gene pools to combat risks in the current scenario of a changing environment.
Directory of Open Access Journals (Sweden)
Łopieńska-Biernat Elżbieta
2017-06-01
Full Text Available Plants adapt to extremely low temperatures in polar regions by maximizing their photosynthetic efficiency and accumulating cryoprotective and osmoprotective compounds. Flowering plants of the family Poaceae growing in the Arctic and in the Antarctic were investigated. Their responses to cold stress were analyzed under laboratory conditions. Samples were collected after 24 h and 48 h of cold treatment. Quantitative and qualitative changes of sugars are found among different species, but they can differ within a genus of the family Poaceae. The values of the investigated parameters in Poa annua differed considerably depending to the biogeographic origin of plants. At the beginning of the experiment, Antarctic plants were acclimatized in greenhouse characterized by significantly higher content of sugars, including storage reserves, sucrose and starch, but lower total protein content. After 24 h of exposure to cold stress, much smaller changes in the examined parameters were noted in Antarctic plants than in locally grown specimens. Total sugar content and sucrose, starch and glucose levels were nearly constant in P. annua, but they varied significantly. Those changes are responsible for the high adaptability of P. annua to survive and develop in highly unsupportive environments and colonize new regions.
Daily variation patterns of airborne allergenic pollen in southwestern Spain.
González Minero, F J; Candau, P; Tomás, C; Morales, J
1998-01-01
The study was carried out using a Burkard sampler installed on the roof terrace of the School of Pharmacy, Seville, for two years (1995 and 1996). Eight pollen types described in the literature as having allergenic activity were chosen. They were Poaceae, Olea europaea, Chenopodiaceae/Amaranthaceae, Plantago, Rumex, Urticaceae (including Parietaria), Cupressaceae, and Platanus hispanica. The types were grouped according to the similarity of their pattern of intradiurnal variation in pollen concentration. The following associations were established by multivariate analysis: Urticaceae and Chenopodiaceae/Amaranthaceae (appearing mainly between 11:00 and 20:00), Olea europaea and Plantago (12:00 to 19:00), Poaceae and Rumex (appearing throughout the day), and Cupressaceae and Platanus hispanica (8:00 to 14:00). The patterns of intradiurnal variation were similar both years for each type, despite the fact that the two years were climatologically different (1995 was dry and 1996 wet). We conclude that these behavior patterns are endogenous to the plants, and are hardly affected by meteorological parameters.
Factors influencing seed germination in Cerrado grasses
Directory of Open Access Journals (Sweden)
Rosana Marta Kolb
2016-03-01
Full Text Available Few studies address the ecology of herbs of Cerrado grasslands, which are ecosystems where the long dry season, high temperatures, insolation, fire and invasive grasses greatly influencing germination and the establishment of plants. We assessed germination of 13 species of Poaceae from Cerrado grasslands under nursery conditions or in germination chambers, the latter with i recently collected seeds and seeds after six months storage, ii under constant and alternating temperatures, and iii in the presence and absence of light. Germinability, mean germination time (MGT and required light were quantified to elucidate factors involved in successful germination. Germinability was low for most grasses, probably because of low seed viability. For most species, germinability and MGT were not altered by seed storage. Germination percentages were higher at alternating temperatures and in the presence of light, factors that are more similar to natural environmental situations compared with constant temperature or the absence of light. Our findings indicate that alternating temperatures and light incidence are key factors for germination of species of Poaceae. The maintenance of these environmental factors, which are crucial for the conservation of Cerrado grasslands, depends on appropriate management interventions, such as fire management and the control of biological invasion.
Directory of Open Access Journals (Sweden)
Jairo Humberto Pinto Zárate
2006-01-01
las familias Asteraceae (siete, Poaceae (seis, Cyperaceae (cinco y Scrophulariaceae (cuatro; los géneros con mayor número de morfoespecies en este tipo de vegetación son Isoetes (ocho, Juncus (siete y Eleocharis (cinco. Las familias con mayor representación de géneros en la vegetación terrestre son Asteraceae y Poaceae (25 y 15 respectivamente, seguidas por Scrophulariaceae (nueve y Cyperaceae (siete; los géneros más ricos en morfoespecies son Carex (12, Campylopus, Hypericum, Monticalia y Lachemilla (cada una con 11 morfoespecies. Especies como Crassula venezuelensis, Werneria pygmaea, Plantago rigida, alamagrostis ligulata, Puya santosii, Blechnum loxense, Aragoa abietina, Chusquea tessellata y varias de los géneros Eleocharis, Isoetes, Carex y Sphagnum cobran gran importancia en el proceso sucesional entre comunidades acuáticas y etapas iniciales de colmatación hasta las fases avanzadas de terrización, transicionales a tipos propios de vegetación zonal.
Floristic and phytosociological analysis of palm swamps in the central part of the Brazilian savanna
Directory of Open Access Journals (Sweden)
Isa Lucia de Morais Resende
2013-03-01
Full Text Available We analyzed the floristics and phytosociology of three palm swamps in the municipality of Bela Vista de Goiás, located in the state of Goiás, Brazil, in the central part of the Brazilian savanna (Cerrado. The floristic surveys were conducted monthly from May 2008 to April 2009, and 310 species were recorded (seven bryophytes, 15 ferns and 288 angiosperms. Bryophytes belonged to five genera and five families; ferns belonged to nine genera and nine families; and angiosperms belonged to 134 genera and 45 families. The angiosperm families with the highest species richness were Poaceae, Cyperaceae, Asteraceae, Eriocaulaceae, Xyridaceae, Lentibulariaceae, Melastomataceae, Rubiaceae and Fabaceae. The palm swamps were divided into three zones of increasing humidity: edge, middle and core. The number of species was higher in the middle than at the edge and the core. The families with the highest cover values were Cyperaceae, Melastomataceae, Arecaceae and Poaceae. Although the palm swamps had been disturbed to varying degrees, those disturbances did not affect the flora in the middle or the core. Floristic similarity was high between these two zones within a given palm swamp and low between the edges of different palm swamps.
Directory of Open Access Journals (Sweden)
Eduardo Chaves
2012-10-01
Full Text Available Flowering species of the herbaceous and shrubby layer were sampled in a gallery forest at Portal da Chapada, Alto Paraíso de Goiás-GO in the Chapada dos Veadeiros during 12 months growing within 4.5 meters on either side of a raised pathway 2.4 Km long. The collections were included to University of Brasilia Herbarium (UB. A total of 138 species (103 genera and 40 families were recorded; the most species-rich families were Asteraceae (22, Poaceae (14, Rubiaceae (12, Fabaceae (11 and Melastomataceae (7. The richest family in number of genera was Asteraceae (19, followed by Poaceae (8, Fabaceae (8 and Rubiaceae (7. The results showed a meaningful increase in the Chapada dos Veadeiros flora, especially considering the herbaceous-shrubby layer of the gallery forests (223.6%. Despite the richness of the flora, the number of endemics species in the Goiás State was only 1.5%.
Devis, Deborah L; Davies, Janet M; Zhang, Dabing
2017-09-01
Allergic diseases are characterized by elevated allergen-specific IgE and excessive inflammatory cell responses. Among the reported plant allergens, grass pollen and grain allergens, derived from agriculturally important members of the Poaceae family such as rice, wheat and barley, are the most dominant and difficult to prevent. Although many allergen homologs have been predicted from species such as wheat and timothy grass, fundamental aspects such as the evolution and function of plant pollen allergens remain largely unclear. With the development of genetic engineering and genomics, more primary sequences, functions and structures of plant allergens have been uncovered, and molecular component-based allergen-specific immunotherapies are being developed. In this review, we aim to provide an update on (i) the distribution and importance of pollen and grain allergens of the Poaceae family, (ii) the origin and evolution, and functional aspects of plant pollen allergens, (iii) developments of allergen-specific immunotherapy for pollen allergy using biotechnology and (iv) development of less allergenic plants using gene engineering techniques. We also discuss future trends in revealing fundamental aspects of grass pollen allergens and possible biotechnological approaches to reduce the amount of pollen allergens in grasses. Copyright © 2017. Published by Elsevier Inc.
Xyloglucans of Monocotyledons Have Diverse Structures
Institute of Scientific and Technical Information of China (English)
Yves S.Y. Hsieh; Philip J. Harris
2009-01-01
Except in the Poaceae, little is known about the structures of the xyloglucans in the primary walls of mono-cotyledons. Xyloglucan structures in a range of monocotyledon species were examined. Wall preparations were isolated, extracted with 6 M sodium hydroxide, and the extracts treated with a xyloglucan-specific endo-(1→4)-β-glucanase prep-aration. The oligosaccharides released were analyzed by high-performance anion-exchange chromatography and by ma-trix-assisted laser-desorption ionization time-of-flight mass spectrometry. Oligosaccharide profiles of the non-commelinid monocotyledons were similar to those of most eudicotyledons, indicating the xyloglucans were fucogalactoxyloglucans, with a XXXG ~a core motif and the fucosylated units XXFG and XLFG. An exception was Lemna minor (Araceae), which yielded no fucosylated oligosaccharides and had both XXXG and XXG_n core motifs. Except for the Arecales (palms) and the Dasypogonaceae, which had fucogalactoxyloglucans, the xyloglucans of the commelinid monocotyledons were structurally different. The Zingiberales and Commelinales had xyloglucans with both XXG_n and XXXG core motifs; small proportions of XXFG units, but no XLFG units, were present. In the Poales, the Poaceae had xyloglucans with a XXG_n core motif and no fucosylated units. In the other Poales families, some had both XXXG and XXG_n core motifs, others had only XXXG; XXFG units were present, but XLFG units were not.
International Nuclear Information System (INIS)
Hussain, F.; Shah, S.M.; Badshahi, L.; Durrani, M.J.
2015-01-01
This study revealed that the floristic diversity consisted of 571 species belonging to 82 families including 65 dicots, 13 monocots, 2 gymnosperms and 2 pteridophyte families. There were 334 genera including 3 Pteridophytes, 2 gymnosperms, 54 monocot and 275 dicot genera. Asteraceae (91 Spp., 15.95 %), Poaceae (58 Spp., 10.16 %), Papilionaceae (38 Spp., 6.65 %), Lamiaceae and Rosaceae (each with 26 Spp., 4.55 %), Polygonaceae (25 spp; 4.38), Caryophyllaceae (23 spp.; 4.03%), Apiaceae (21 Spp., 3.68 %), Boraginaceae and Brassicaceae (20 Spp., each with 3.50 %) were the leading families. There were 45 (13.47%), 32 (9.58%), 19 (5.69%), 18 (5.39%) and 16 (4.79%) genera respectively in Asteraceae, Poaceae, Brassicaceae, Apiaceae and Papilionaceae. Flora consisted of 91.59% wild species, 92.64% deciduous species, 92.12% nonspiny species, 80.04% mesophytes and 94.57% heliophytes. Biological spectrum was dominated by therophytes (234 spp., 40.98%), followed by hemicryptophytes (154 spp., 26.97%), geophytes (82 spp., 14.36%), chamaephytes (44 spp., 7.71%), nanophanerophytes (31 spp, 5.43%) and megaphanerophytes (24 spp., 4.20%). The leaf size spectra was dominated by nanophylls (40.98%), leptophylls (24.87%), mesophylls 18.56%) and microphylls (9.11%). Further plant exploration is suggested in this remote inaccessible valley in the Hindukush Range, Pakistan. (author)
Directory of Open Access Journals (Sweden)
Ernest Stawiarz
2017-11-01
Full Text Available The aim of this study was to determine sources of pollen for the honeybee in the Bojanów forest complex, Nowa Dęba Forest District (southeastern Poland. Sampling of pollen loads from bees extended from the beginning of May until the end of September 2016 and was carried out at 7-day intervals using pollen traps mounted at the entrance of beehives. A total of 73 pollen load samples were collected from the study area. Fifty-nine taxa from 31 plant families were identified in the analyzed material. From 4 to 21 taxa (average 9.5 were recorded in one sample. The pollen of Brassicaceae (“others”, Taraxacum type, Solidago type, and Rumex had the highest frequency in the pollen loads examined. Apart from these four taxa, pollen grains of Rubus type, Poaceae (“others”, Calluna, Fagopyrum, Trifolium repens s. l., Phacelia, Aster type, Melampyrum, Quercus, Cornus, and Veronica were recorded in the dominant pollen group. The forest habitat taxa that provided pollen rewards to honeybees in the Bojanów forest complex were the following: Rubus, Calluna, Prunus, Tilia, Frangula alnus, Pinus, Quercus, Cornus, Robinia pseudoacacia, Salix, and Vaccinium. Apart from forest vegetation, the species from meadows and wastelands adjacent to this forest complex, represented by Taraxacum, Rumex, Plantago, Poaceae, Trifolium repens, and Solidago, proved to be an important source of pollen. The study indicates that forest communities are a valuable source of pollen for pollinating insects from early spring through to late fall.
Velázquez, Nadia Jimena; Burry, Lidia Susana; Fugassa, Martín Horacio; Civalero, María Teresa; Aschero, Carlos Alberto
2014-01-01
Palynological, palaeoparasitological and paleobotanical studies of coprolites found in archaeological sites from Perito Moreno National Park (47°57‧S72°05‧W) yielded information on diet, palaeoenvironment and health. These studies allowed adding evidence to the reconstruction of life history of the hunter-gatherers that inhabited Patagonia during the Holocene. We examined the season of the year when camelid Lama guanicoe coprolites (5400 ± 64 yr 14C BP to 9640 ± 190 yr 14C BP) were deposited at Cerro Casa de Piedra 7 (site CCP7). The study used palynological evidence and comparison with pollen spectra of modern feces collected during summer, fall, winter and spring of 2010. The dominant types were: pollen of Nothofagus, Empetrum rubrum, Asteraceae subfam. Asteroideae, Nassauvia, Caryophyllaceae and Poaceae; fern spores; remains of Eimeria macusaniensis; and plant remains of Poaceae, Festuca pallescens, Stipa speciosa, Armeria maritima, Gaultheria mucronata and E. rubrum. Pollen spectra of modern and fossil feces were used for multivariate analysis. Coprolites associated to fall and winter modern feces. These results and those obtained from pollen concentration values and the presence of pollen types indicators of seasonality, allowed the determination of summer, fall and winter coprolites. However, caution must be taken with the seasonality results of coprolites dated earlier than 9000 years BP since the environmental conditions differed from now. The site was probably a camelid shelter during the unfavorable seasons.
Plant species from coal mine overburden dumping site in Satui, South Kalimantan, Indonesia
Directory of Open Access Journals (Sweden)
Vivi Novianti
2017-07-01
Full Text Available Coal mine overburden (OB materials were nutrient-poor, loosely adhered particles of shale, stones, boulders, and cobbles, also contained elevated concentration of trace metals. This condition cause OB substrate did not support plants growth. However, there were certain species that able to grow on overburden dumping site. This investigation sought to identify plants species that presence on coal mine overburden. The research was conducted on opencast coal mine OB dumping site in Satui, South Kalimantan. Vegetation sampling was carried out on six different ages of coal mine OB dumps (7, 10, 11, 42, 59 and 64 month using line transect. Species identification used information from local people, AMDAL report of PT Arutmin Indonesia-Satui mine project, and website. There were 123 plant species, consisted of 79 herbs (Cyperaceae, Poaceae and Asteraceae, 10 lianes, bryophyte, 9 ferns, 10 shrubs, and 14 trees. A number of Poaceae, i.e., Paspalumconjugatum, Paspalumdilatatum, and Echinochloacolona generally present among the stones, boulders, and cobbles. While Cyperaceae such as Fimbristylis miliaceae, Cyperus javanicus, Rhyncospora corymbosa and Scleria sumatrensis most often foundinand around thebasin/pond with its smooth and humid substrate characteristics. Certain species of shrubs and trees present on the 7 month OB dumping site. They wereChromolaena odorata, Clibadium surinamense, Melastoma malabathricum, Trema micrantha, and Solanum torvum (Shrubs, Ochroma pyramidale and Homalanthus populifolius (trees. This plant species could be used for accelerating primary succession purpose on coal mine overburden dumping site. Nevertheless, species selection was needed to avoid planting invasive species.
International Nuclear Information System (INIS)
Alonso, R.; Bermejo, V.; Sanz, J.; Valls, B.; Elvira, S.; Gimeno, B.S.
2007-01-01
Intra-genus and intra-specific variation and the influence of nitrogen enrichment on net assimilation and stomatal conductance of some annual Trifolium species of Mediterranean dehesa grasslands were assessed under experimental conditions. Also gas exchange rates were compared between some Leguminosae and Poaceae species growing in the field in a dehesa ecosystem in central Spain. The results showed that the previously reported different O 3 sensitivity of some Trifolium species growing in pots does not seem to be related to different maximum g s values. In addition, no clear differences on gas exchange rates could be attributed to Leguminosae and Poaceae families growing in the field, with intra-genus variation being more important than differences found between families. Further studies are needed to increase the database for developing a flux-based approach for setting O 3 critical levels for semi-natural Mediterranean species. - The stomatal conductance model incorporated within the EMEP DO 3 SE deposition module needs to be re-parameterised for Mediterranean semi-natural vegetation
Directory of Open Access Journals (Sweden)
Tchuenguem-Fohouo F.N.
2002-01-01
Full Text Available The gatering activity of wild bees (Hymenoptera Apoidea on flowers of maize at Yaound (Cameroon and further considerations on pollination of the tropical Gramineae. At Nkolbisson (Yaounde, Cameroon, in May 1991, flowers of maize (Zea mays L; Poaceae were observed for the study of pollen gathering by five different species of wild bees: one Apidae Meliponinae (Dactylurina staudingeri and four Halictidae Nomiinae (Lipotriches andrei, Lipotriches langi, Lipotriches notabilis and Leuconomia granulata. Each of these Apoidea is well attracted by pollen of maize. The larger number of bees foraging at the same time on a panicle varies from one with Dactylurina staudingeri to four with Lipotriches andrei and Lipotriches notabilis. Generally, bees forage maize during the whole day and during the full flowering period but visits are more numerous in the morning and during the period of intense flowering. Median duration of a visit on a male spikelet varies from 1 sec with Dactylurina staudingeri to 7 sec with Lipotriches andrei. These Apoidea have an elaborated behaviour when gathering pollen of maize. Dactylurina staudingeri however seems less adapted to the floral morphology of Poaceae comparing with Lipotriches. When foraging maize, all these bees are regular visitors to flowers of this plant, even in the presence of other flower species in the vicinity of the crop. Bees studied have a positive impact on the yield of grains due to a complementary action with the well known one of the wind. The influence is indirect as the bees are seldom visiting the stigmates. The explanation is that when the bees are very common on the panicles they shake the anthers, inducing the release of pollen grains in the atmosphere even in the days without wind. The part of wild bees in the increase of yields is estimated to 3/ while the one of the domestic bees (Apis mellifera is estimated to 21/ in that locality. The authors are reviewing existing literature on grass crop
Kotowaroo, M I; Mahomoodally, M F; Gurib-Fakim, A; Subratty, A H
2006-03-01
In this study, seven exotic/indigenous medicinal plants of Mauritius, namely Coix lacryma-jobi (Poaceae), Aegle marmelos (Rutaceae), Artocarpus heterophyllus (Moraceae), Vangueria madagascariensis (Rubiaceae), Azadirachta indica (Meliaceae), Eriobotrya japonica (Rosaceae) and Syzigium cumini (Myrtaceae) were studied for possible effects on starch breakdown by alpha-amylase in vitro. The results showed that only Artocarpus heterophyllus significantly (p Artocarpus heterophyllus on alpha-amylase activity using rat plasma in vitro. It was found that the aqueous leaf extract significantly (p Artocarpus heterophyllus behaved as a competitive inhibitor. Results from the present study tend to indicate that Artocarpus heterophyllus could act as a 'starch blocker' thereby reducing post-prandial glucose peaks. Copyright 2006 John Wiley & Sons, Ltd.
Biodiversity of medicinal plants by Minangkabau ethnic in Guguak Sarai, West Sumatera, Indonesia
Khairiah, A.; Nisyawati, Silalahi, M.
2017-07-01
The research was carried out in Guguak Sarai, West Sumatera, Indonesia. The purpose of this study was to document the diversity of medicinal plants by Minangkabau ethnic base on local knowledge. Data were collected using ethnobotanical approach through open-ended, semi-structured interview and exploration method. The sample consisted of 3 key informants and 94 respondents with provisions age ≥ 30 years old. Data were analyzed qualitatively using descriptive statistics. Total 158 medicinal plants species which belongs to 124 genera and 54 families were reported to be used in against 52 diseases. Among the diseases, gastrointestinal disorders had the highest number of medicinal plants to be used (37 species), skin diseases (36 species), postpartum cures (29 species), urinary tract disorders (26 species) and rheumatism (19 species). Fabaceae (Leguminosae) was the dominant families that used to treat the illness (12 species) followed by Euphorbiaceae, Lamiaceae, Poaceae (10 species) and Asteraceae (9 species).
The floristic characteristics of plants in gardens and streets in urban areas of adana, turkey
International Nuclear Information System (INIS)
Karakus, H.
2014-01-01
This study was carried out to determine the flora of the gardens and road sides in Adana from March 2008 to April 2012. During the floristic studies, 337 vascular plant taxa belonging to 259 genera and 93 families were determined. Families with the greatest number of taxa are Asteraceae 35 species (10%), Fabaceae 30 species (9%), Poaceae 20 species (6%), Rosaceae 11 species (3%) and Lamiaceae 10 species (3%). According to the life-forms phanerophytes 134 species (40%) and therophytes 118 species (35%) are more than the others (chamaephytes, hemicryptophytes, and geophytes). Forty-eight percent (162 taxa) of total flora in the area is exotic species and the rest (52%) are indigenous. Total flora consists of 62% (209 taxa) ornamental species and 38% (128 taxa) ruderal species. (author)
A preliminaryfloristic checklist of thal desert punjab, pakistan
International Nuclear Information System (INIS)
Shaheen, H.; Qureshi, R.
2014-01-01
The floristic survey of the Thal desert, Punjab, Pakistan was carried out during 2010 to 2013. So far, 248 species distributed across 166 genera and 38 families were identified during the report period. Besides, one species viz., Themeda triandra was recorded for the first time from Pakistan. Of them, one fern, 4 monocots and 33 dicots families were determined. The most dominating family was Poaceae that contributed 52 species (21.49%), followed by Fabaceae (34 spp., 13.05%) and Amaranthaceae and Asteraceae (17 spp., 7.02% each). The largest genera were Euphorbia (6 spp.), Cyperus, Eragrostis and Solanum (5 spp. each), Mollugo, Heliotropium and Cenchrus (4 spp. each), Acacia, Prosopis, Tephrosia, Corchorus, Boerhavia and Ziziphus (3 spp. each). This checklist consists of updated systematic families and plants names that will provide a useful starting point for further ecological and bioprospective research of the area under study. (author)
Hydrocarbon phytoremediation in the family Fabaceae--a review.
Hall, Jessica; Soole, Kathleen; Bentham, Richard
2011-04-01
Currently, studies often focus on the use of Poaceae species (grasses) for phytoremediation of hydrocarbon-contaminated soils. Research into the use of Fabaceae species (legumes) to remediate hydrocarbons in soils has been conducted, but these plants are commonly overlooked due to slower recorded rates of degradation compared with many grass species. Evidence in the literature suggests that in some cases Fabaceae species may increase total degradation of hydrocarbons and stimulate degradative capacity of the soil microbial community, particularly for contaminants which are normally more recalcitrant to degradation. As many recalcitrant hydrocarbons have negative impacts on human and ecosystem health, development of remediation options is crucial. Reconsideration of Fabaceae species for removal of such contaminants may lead to environmentally and economically sustainable technologies for remediation of contaminated sites.
Chorological classification approach for species and ecosystem conservation practice
Rogova, T. V.; Kozevnikova, M. V.; Prokhorov, V. E.; Timofeeva, N. O.
2018-01-01
The habitat type allocation approach based on the EUNIS Habitat Classification and the JUICE version 7 software is used for the conservation of species and ecosystem biodiversity. Using the vegetation plots of the Vegetation Database of Tatarstan, included in the EVA (European Vegetation Archive) and GIVD (Global Index of Vegetation-plots Databases) types of habitats of dry meadows and steppes are distinguished by differing compositions of the leading families composing their flora - Asteraceae, Fabaceae, Poaceae and Rosaceae. E12a - Semi-dry perennial calcareous grassland, and E12b - Perennial calcareous grassland and basic steppes were identified. The selected group of relevés that do not correspond to any of the EUNIS types can be considered specific for ecotone forest-steppe landscapes of the southeast of the Republic of Tatarstan. In all types of studied habitats, rare and protected plant species are noted, most of which are South-East-European-Asian species.
Preliminary description of the diet of Hippopotamus amphibius L. in Loango National Park (Gabon
Directory of Open Access Journals (Sweden)
Michez, A.
2013-01-01
Full Text Available Due to the paucity of suitable habitat, hippos are very rare in the Congo Bassin. Compared to East-African populations, Central African populations of hippos have been less studied. Information found in the literature regarding the animal's basic ecology is limited. This study focuses on the description of the diet of an isolated hippo population in Loango National Park (Gabon, comparing faecal analysis with a reference collection of herbaceous species from the savannas. The effectiveness of using faecal analysis versus using the floristic description of hippos' pastures was demonstrated. The most frequent herbaceous species identified in faeces samples were Paspalum vaginatum, Axonopus compressus, Stenotaphrum secundatum (Poaceae and Desmodium triflorum (Fabaceae. The voluntary consumption of a dicotyledonous species (Desmodium triflorum is novel for this species.
THE FLORA OF HEKIMDAG (BOZDAG, ESKISEHIR
Directory of Open Access Journals (Sweden)
Murat ARDIÇ
2011-02-01
Full Text Available In this study the flora of Eskişehir Hekimdağ (Bozdağ were investigated. According to Davis's grid system, the research area lies in B3 square. The plant samples collected in this region and determined that there are 59 families, as well as 467 species and subspecies taxa belonging to 219 genera. The phytogeographical distribution is as follows: 49 Mediterranean, 31 Euro-Siberian, 19 Irano-Turanian, 6 Euxin and 362 unknown or other-regional elements. The largest families are Asteraceae (50, Fabaceae (38, Lamiaceae (24, Poaceae (21 and Liliaceae (18 in terms of the number of species and subspecies included. Genera represented by the highest number of species are Centaurea (7, Alyssum (6, Silene, Astragalus, Trifolium, Lathyrus ve Campanula (5 . The number of endemic taxa within the study area is 41 (10.86%. 13 taxa are new records for the B3 square.
Polyphenol Oxidases in Crops: Biochemical, Physiological and Genetic Aspects
Directory of Open Access Journals (Sweden)
Francesca Taranto
2017-02-01
Full Text Available Enzymatic browning is a colour reaction occurring in plants, including cereals, fruit and horticultural crops, due to oxidation during postharvest processing and storage. This has a negative impact on the colour, flavour, nutritional properties and shelf life of food products. Browning is usually caused by polyphenol oxidases (PPOs, following cell damage caused by senescence, wounding and the attack of pests and pathogens. Several studies indicated that PPOs play a role in plant immunity, and emerging evidence suggested that PPOs might also be involved in other physiological processes. Genomic investigations ultimately led to the isolation of PPO homologs in several crops, which will be possibly characterized at the functional level in the near future. Here, focusing on the botanic families of Poaceae and Solanaceae, we provide an overview on available scientific literature on PPOs, resulting in useful information on biochemical, physiological and genetic aspects.
Brassinosteroid Mediated Cell Wall Remodeling in Grasses under Abiotic Stress
Directory of Open Access Journals (Sweden)
Xiaolan Rao
2017-05-01
Full Text Available Unlike animals, plants, being sessile, cannot escape from exposure to severe abiotic stresses such as extreme temperature and water deficit. The dynamic structure of plant cell wall enables them to undergo compensatory changes, as well as maintain physical strength, with changing environments. Plant hormones known as brassinosteroids (BRs play a key role in determining cell wall expansion during stress responses. Cell wall deposition differs between grasses (Poaceae and dicots. Grass species include many important food, fiber, and biofuel crops. In this article, we focus on recent advances in BR-regulated cell wall biosynthesis and remodeling in response to stresses, comparing our understanding of the mechanisms in grass species with those in the more studied dicots. A more comprehensive understanding of BR-mediated changes in cell wall integrity in grass species will benefit the development of genetic tools to improve crop productivity, fiber quality and plant biomass recalcitrance.
DEFF Research Database (Denmark)
Rao, R Shyama Prasad; Andersen, Jeppe Reitan; Dionisio, Giuseppe
2011-01-01
Poa pratensis, a type species for the grass family (Poaceae), is an important cool season grass that accumulates fructans as a polysaccharide reserve. We studied fructan contents and expression of candidate fructan metabolism genes during cold acclimation in three varieties of P. pratensis adapted...... to different environments: Northern Norway, Denmark, and the Netherlands. Fructan content increased significantly during cold acclimation and varieties showed significant differences in the level of fructan accumulation. cDNA sequences of putative fructosyltransferase (FT), fructan exohydrolase (FEH), and cold...... acclimation protein (CAP) genes were identified and cloned. In agreement with a function in fructan biosynthesis, transcription of a putative sucrose:fructan 6-fructosyltransferase (Pp6-SFT) gene was induced during cold acclimation and fructan accumulation in all three P. pratensis varieties. Transcription...
Field diet of the grasshopper Abracris dilecta Walker (Orthoptera, Acrididae
Directory of Open Access Journals (Sweden)
Carlos Frankl Sperber
1996-01-01
Full Text Available Abracris dilecta Walker, 1870 (Orthoptera, Acrididae, Ommatolampinae ate leafs of at least 14 plant species, in the families Asteraceae, Lamiaceae, Malvales (Sterculiaceae, Tiliaceae or Malvaceae, Poaceae, Fabaceae, Verbenaceae, Aristolochiaceae, Rubiaceae and Melastomataccae. Elephantopus mollis H.B.K. (Asteraceae and Hyptis suaveolens Poit. (Lamiaceae comprised 50% of the diet. The diet breadth of A. dilecta was compared to that of other 11 grasshopper species of the same sub-family, with rarefaction curves. The number of plant species eaten by A. dilecta was greater than that of nine other grasshopper species of the same sub-family (Rhachicreagra spp. but was lower then two others (Microptylopteryx hebardi Rehn, 1905 and Rhachicreagra astytophallus Jago & Rowell, 1981. This results are discussed in view of the broad geographical range and possession of developed wings by A. dilecta, which contrasts with most Ommatolampinae grasshoppers.
Urinary diseases and ethnobotany among pastoral nomads in the Middle East.
Abu-Rabia, Aref
2005-08-02
This article is derived from a broad, twenty-year study of ethnobotany and folk medicine among pastoral nomads in the Middle East which took place from 1984 to 2004. The article presents examples of different treatments of diseases and disorders of the urinary tract carried out by healer herbalists. The preparation of remedies includes boiling infusions, extraction of dry or fresh leaves, flowers, seeds or whole plants. Some of these plants were used both as food and as medicine, by ingesting different parts of the plants, such as leaves, flowers, fruits, and so on, either while soft, cooked or dried. Data were collected by using unstructured interviews and by observation. These plants were identified by healers, patients, and university botanists. This paper identified eighty-five plant species, which belong to thirty-six families. The most representative families are: Asteraceae (8), Brassicaceae (6), Poaceae (6), Umbelliferae (6).
Directory of Open Access Journals (Sweden)
Héctor Andrés Vargas
2015-12-01
Full Text Available ABSTRACT Elachista synethes was recently recognized as an alien species in northern Chile, where its larvae mine the rescue grass Bromus catharticus (Poaceae. In order to provide the necessary information to allow field detection of E. synethes during early ontogeny, we conducted a morphological reappraisal of the immature stages of this leaf-miner moth, based on light and scanning electron microscopy, including the first descriptions of the egg and the first-instar larva. This is the first report of the existence of an apodal early larva for a species of Elachista Treitschke. The legs and prolegs are absent in the first two instars, but are well developed in the last two. Additional observations on the life history are also provided, including a description of the mine.
Estado de la diversidad de la flora vascular de los Pantanos de Villa (Lima - Perú
Directory of Open Access Journals (Sweden)
Dámaso W. Ramirez
2011-05-01
Full Text Available Se presentan los resultados del estudio de la flora vascular de los Pantanos de Villa realizadas en el 2007 y se analiza los cambios florísticos en los últimos años. Se registraron 47 especies silvestres comprendidas en 43 géneros y 27 familias. Las familias con mayor numero de especies fueron Poaceae (7, Cyperaceae (4 y Asteraceae (4. Se reportan 7 especies silvestres como nuevos registros para el humedal: Alternanthera pubiflora, Alternanthera halimifolia, Limnobium laevigatum, Colocasia esculenta, Rumex obtusifolius, Elodea potamogeton, Plantago major. Se encontraron 11 especies cultivadas en el ecosistema. En comparación con estudios anteriores, los resultados muestran una disminución en la riqueza florística, principalmente de las especies acuáticas. El análisis de similitud con anteriores estudios indica un cambio en la composición de la flora en el tiempo.
Etude des groupements d'adventices dans le Maroc occidental
Directory of Open Access Journals (Sweden)
Douira, A.
2010-01-01
Full Text Available Study of the weeds groupings in western Morocco. An ecological floristic study was carried out in the principal areas of Morocco severely infested by the sterile oats. From 110 readings taken in cereals, the 324 listed species belong to 47 botanical families including 39 dicotyledons. Six families: Asteraceae, Fabaceae, Poaceae, Brassicaceae, Caryophyllaceae and Apiaceae add up 59% of the total staff complement alone. The biological aspect shows a prevalence of the therophytes with 80%, followed by the hemicryptophytes and the geophytes with respectively 11 and 7%. Mediterranean taxa are dominating with 62% of the total staff complement. The taking into account of the index partial of noxiousness made it possible to release 27 problematic species whose Avena sterilis, Phalaris paradoxa, Phalaris brachystachys, Scolymus maculates, Lolium multiflorum, Papaver rhoeas and Lolium rigidum are most harmful by far. The factorial analysis of correspondences (A.F.C., by the means of the edaphic variables, made it possible to highlight six ecological groups.
Simeão, C M G; Silveira, F A; Sampaio, I B M; Bastos, E M A F
2015-11-01
Eucalyptus plantations are frequently used for the establishment of bee yards. This study was carried on at Fazenda Brejão, northwestern region of the State of Minas Gerais, Brazil. This farm is covered both with native Cerrado vegetation (Brazilian savanna) and eucalyptus plantations. This paper reports on the botanic origin of pollen pellets and honey collected from honeybee (Apis mellifera) hives along a thirteen-month period (January 2004 to January 2005). The most frequent pollen types found in the pollen pellets during the rainy season were Trema micrantha (Ulmaceae), Copaifera langsdorffii (Fabaceae), an unidentified Poaceae, unidentified Asteraceae-2, Cecropia sp. 1 (Cecropiaceae) and Eucalyptus spp. (Myrtaceae); during the dry season the most frequent pollen types were Acosmium dasycarpum (Fabaceae), Cecropia sp. 1 (Cecropiaceae) and Eucalyptus spp. (Myrtaceae). Pollen grains of Baccharis sp. (Asteraceae), Cecropia sp. 1 (Cecropiaceae), Copaifera langsdorffii (Fabaceae), Mimosa nuda (Fabaceae), Eucalyptus spp. (Myrtaceae) and Trema micrantha (Ulmaceae) were present in the honey samples throughout the study period.
Directory of Open Access Journals (Sweden)
João Augusto Alves Meira Neto
2007-10-01
Full Text Available O conhecimento da flora herbáceo-subarbustiva, juntamente com o da flora lenhosa, auxilia a determinação dos padrões florísticos e permite descrever o espectro biológico com conseqüentes inferências sobre a atua��ão de fatores ambientais e históricos na vegetação. Considerando que poucos trabalhos se aprofundaram no estudo da flora herbáceo-subarbustiva de Cerrado, embora esta seja mais rica que a lenhosa, objetivou-se estudar a composição e os padrões florísticos das floras herbáceo-subarbustiva e lenhosa da Estação Ecológica de Santa Bárbara (EESB (22º 46' 30'' a 22º 50' 30''S e 49º 10' 30'' a 49º15'30'' W , 600 a 680 m de altitude, Município de Águas de Santa Bárbara, Estado de São Paulo. Visou-se, ainda, determinar o espectro biológico para efetuar análises comparativas das diferentes fitofisionomias de Cerrado dessa Unidade de Conservação. Foram encontradas 314 espécies na EESB, sendo 285 em Cerrado sensu lato. As famílias mais ricas em número de espécies foram Asteraceae, Leguminosae, Myrtaceae e Poaceae. Há uma constante ocorrência de Asteraceae, Leguminosae e Poaceae entre as famílias mais ricas, concordando com o observado nos estudos florísticos de Cerrado que incluíram os estratos lenhoso e herbáceo-subarbustivo. O espectro biológico corroborou os padrões anteriormente descritos para o Cerrado sensu lato, exceto pela maior expressão de caméfitas em relação às hemicriptófitas nas fisionomias campestres da EESB, o que pode ser efeito da proteção ao fogo nessa Unidade de Conservação.Only few surveys were carried out on woody and ground layer floras of the Brazilian Cerrado. The objective of this survey was to investigate richness, floristic patterns and biological spectra of different phytophysiognomies on both strata at Santa Bárbara Ecological Station (EESB. EESB is located in the Municipality of Águas de Santa Bárbara, São Paulo State, Brazil (22º 46' 30'' to 22º 50' 30
Directory of Open Access Journals (Sweden)
Rakotoarimanana, V.
2008-01-01
Full Text Available Effects of Fire and Grazing on Grass Phytomass Evolution in a Heteropogon contortus Savanna (Sakaraha Region, South West Madagascar. An experimental study of the effects of fire and grazing was carried out in the Sakaraha area (S. W. Madagascar. The objectives were to evaluate the combined or separate effects of fire and grazing on the green biomass and total phytomass of a Heteropogon contortus-Poupartia caffra dominated savanna. Three burning treatments (no burning, early burning and late burning and two grazing treatments (grazed, ungrazed were compared. A three-year study showed that (1 both burning treatments led to a delayed vegetation phenophase but a higher standing phytomass at the end of the growth cycle, (2 grazing treatment led to a significant decrease of the standing phytomass and of the contribution of Poaceae.
Directory of Open Access Journals (Sweden)
Somayeh Salimi
2014-12-01
Full Text Available This study focused on Zarabad, Cheraghabad and Nogombecom plants of sub-basin watershed city of Chabahar, Iran. The studied flora included 78 species which belonged to 66 genera and 29 families. Poaceae with 16 genera and 19 species, Asteraceae with 7 genera and 8 species, Chenopodiaceae with 5 genera and 4 species, Papilionaceae, with 5 genera and 6 species, constituted the largest plant families respectively. The largest genera of the region were: Salsola, Heliotropium and Plantago, respectively. 42% of the flora belonged to Nobo-Sindian elements, 35%to Irano-Turanian, 18%were bioregional elements and 5% of the species were cosmopolitan. Flora of the studied area, included therophytes (56%, chamaephytes (15%, phanerophytes (14%, geophytes (12% and hemicryptophytes (3%.
Directory of Open Access Journals (Sweden)
Dorin Rechiţean
2011-10-01
Full Text Available The researches carried out between the altitude levels of 236 and 1300 m, in 13 localities from Banat Mountains, proved the influence exerted by stationary natural conditions on the botanic diversity of the vegetal cover. From one vegetal association to another, the total number of botanic species ranged between 9 and 21; the biggest number of species was recorded between 236 – 630 m altitude, and the smallest one between 462 – 650 m. The mean coverage degree of these species was 42.69% in the species belonging to the Poaceae Family (with a variation of 30-70% and 12.85% in the species belonging to the Fabaceae Family (variation of 25-65%.
Directory of Open Access Journals (Sweden)
Palmer Jeffrey D
2006-07-01
Full Text Available Abstract Background Many mitochondrial genes, especially ribosomal protein genes, have been frequently transferred as functional entities to the nucleus during plant evolution, often by an RNA-mediated process. A notable case of transfer involves the rps14 gene of three grasses (rice, maize, and wheat, which has been relocated to the intron of the nuclear sdh2 gene and which is expressed and targeted to the mitochondrion via alternative splicing and usage of the sdh2 targeting peptide. Although this transfer occurred at least 50 million years ago, i.e., in a common ancestor of these three grasses, it is striking that expressed, nearly intact pseudogenes of rps14 are retained in the mitochondrial genomes of both rice and wheat. To determine how ancient this transfer is, the extent to which mitochondrial rps14 has been retained and is expressed in grasses, and whether other transfers of rps14 have occurred in grasses and their relatives, we investigated the structure, expression, and phylogeny of mitochondrial and nuclear rps14 genes from 32 additional genera of grasses and from 9 other members of the Poales. Results Filter hybridization experiments showed that rps14 sequences are present in the mitochondrial genomes of all examined Poales except for members of the grass subfamily Panicoideae (to which maize belongs. However, PCR amplification and sequencing revealed that the mitochondrial rps14 genes of all examined grasses (Poaceae, Cyperaceae, and Joinvilleaceae are pseudogenes, with all those from the Poaceae sharing two 4-NT frameshift deletions and all those from the Cyperaceae sharing a 5-NT insertion (only one member of the Joinvilleaceae was examined. cDNA analysis showed that all mitochondrial pseudogenes examined (from all three families are transcribed, that most are RNA edited, and that surprisingly many of the edits are reverse (U→C edits. Putatively nuclear copies of rps14 were isolated from one to several members of each of these
Aeropalynologic analysis of Timisoara (Romania during 2006 year
Directory of Open Access Journals (Sweden)
Nicoleta IANOVICI
2007-05-01
Full Text Available This article presents the results of a one year qualitative-quantitative study of airborne pollen. The objective of the investigation was to analyse the daily presence and distribution of pollen and to identify the pollen types that are abundantly represented in the atmosphere of the city of Timisoara. A continuous aeropalynologic survey was accomplished between 1 mai 2006 and 8 octombrie 2006. Plants with anemophilous pollination were the best represented: Pinaceae, Poaceae, Plantago, Rumex, Urtica, Chenopodiaceae/Amaranthaceae, Artemisia, Ambrosia, Fraxinus, Salix, Betula, Carpinus, Quercus, Juglans, Platanus, Morus, Tilia. The total pollen spectrum was represented by 17 pollen types. Ambrosia artemisiifolia pollen types was dominant. The highest level of pollen emission was recorded during August-September.
Vegetation structure in the mountain forest in the Turquino National Park, province of Granma
Directory of Open Access Journals (Sweden)
José Luis Rodríguez Sosa
2013-12-01
Full Text Available The research was conducted in the Jeringa site of the Turquino National Park in order to characterize the vegetation of a mountain forest fragment with Juglans jamaicensis. Floristic composition, vegetation structure, and the index value of importance were evaluated. Diameter at 1.30 m above the ground and height of all trees greater than 5 cm in diameter was measured. Data were analyzed using canonical correspondence analysis. 776 individuals of 43 species and 41 genera belonging to 30 families, reporting the Rubiaceae family as the richest in species, followed by Amigdalaceae, Araliaceae, Cyatheaceae, Euphorbiaceae, Flacourtiaceae, Meliaceae, Moraceae, Sapindaceae and Poaceae. The tree species with more IVI were the Pseudolmedia spuria, Oxandra laurifolia, Trophis racemosa, Ocotea leucoxylon, Guarea guara, Dendropanax arboreus and Juglans jamaicensis, mainly due to its abundance in the vegetation, but it was found that the main contributor to the organic weight parameter species was the relative frequency.
Flora of the city of Podgorica, Montenegro: Taxonomic analysis
Directory of Open Access Journals (Sweden)
Stešević Danijela
2008-01-01
Full Text Available In this paper we present the taxonomic segment of a floristic study undertaken in the city of Podgorica in the period of 2002-2007. The check-list of spontaneously growing vascular plants includes 1227 species and subspecies belonging to 545 genera and 118 families. The dominant families are Poaceae (11.7%, asteraceae (11.2% and Fabaceae (9.2%. The most abundant genera are Trifolium (2.1%, Euphorbia (1.5%, Carex (1.5%, Bromus (1.3% and Vicia (1.2%. Analysis of the flora of Podgorica in comparison with some other european cities showed that the flora of Podgorica is most similar to that of Rome (Q/S= 0,7.
Directory of Open Access Journals (Sweden)
Gil Rodrigues dos Santos
2013-09-01
Full Text Available Leaf spots caused by phyto-pathogenic fungi, can reduce the production of forage plants. The essential oils of medicinal plants have antimicrobial potential. The objective here was to evaluate the fungotoxicity in vitro of the essential oils of lemongrass (Cymbopogon citratus (DC. Stapf (Poaceae, citronella (Cymbopogon nardus (L. Rendle (Poaceae, lemon balm (Lippia alba (Mill. NE Br ex Britton & P. Wilson (Verbenaceae and peppermint (Mentha piperita L. (Lamiaceae on the fungus Helminthosporium sp. and the in vivo effect of these oils and of commercial neem oil (Azadirachta indica A. Juss. (Meliaceae on leaf blotch in Panicum maximum Jacq. cv. Tanzania-1. The mycelial growth of the fungus was evaluated over five periods (2; 4; 6; 8 and 10 days from incubation and with five concentrations of essential oils (C1 = 250 ppm; C2 = 500 ppm; C3 = 750 ppm; C4 = 1,000 ppm e C5 = 1,250 ppm. As an alternative control, the preventative and curative effect on leaf blotch of five oil-based treatments were evaluated: lemongrass, citronella, lemon balm, peppermint and neem in four concentrations (2,500; 5,000; 7,500 and 10,000 ppm. The essential oils of lemongrass and citronella were the most effective in reducing mycelial growth of Helminthosporium sp. With the essential oil of lemongrass, the pathogen presented the highest growth concentration (1.250 ppm. The results obtained showed that all the essential oils and concentrations tested presented a preventive and curative effect, reducing the severity of leaf blotch.Manchas foliares, causadas por fungos fitopatogênicos, podem reduzir a produção de forrageiras. Óleos essenciais de plantas medicinais apresentam potencial antimicrobiano. Objetivou-se avaliar a fungitoxicidade in vitro dos óleos essenciais de capim-limão (Cymbopogon citratus (DC. Stapf (Poaceae, citronela (Cymbopogon nardus (L. Rendle (Poaceae, erva-cidreira (Lippia alba (Mill. N.E. Br. ex Britton & P. Wilson (Verbenaceae e hortel
Zhang, Gengyun; Liu, Xin; Quan, Zhiwu; Cheng, Shifeng; Xu, Xun; Pan, Shengkai; Xie, Min; Zeng, Peng; Yue, Zhen; Wang, Wenliang; Tao, Ye; Bian, Chao; Han, Changlei; Xia, Qiuju; Peng, Xiaohua; Cao, Rui; Yang, Xinhua; Zhan, Dongliang; Hu, Jingchu; Zhang, Yinxin; Li, Henan; Li, Hua; Li, Ning; Wang, Junyi; Wang, Chanchan; Wang, Renyi; Guo, Tao; Cai, Yanjie; Liu, Chengzhang; Xiang, Haitao; Shi, Qiuxiang; Huang, Ping; Chen, Qingchun; Li, Yingrui; Wang, Jun; Zhao, Zhihai; Wang, Jian
2012-05-13
Foxtail millet (Setaria italica), a member of the Poaceae grass family, is an important food and fodder crop in arid regions and has potential for use as a C(4) biofuel. It is a model system for other biofuel grasses, including switchgrass and pearl millet. We produced a draft genome (∼423 Mb) anchored onto nine chromosomes and annotated 38,801 genes. Key chromosome reshuffling events were detected through collinearity identification between foxtail millet, rice and sorghum including two reshuffling events fusing rice chromosomes 7 and 9, 3 and 10 to foxtail millet chromosomes 2 and 9, respectively, that occurred after the divergence of foxtail millet and rice, and a single reshuffling event fusing rice chromosome 5 and 12 to foxtail millet chromosome 3 that occurred after the divergence of millet and sorghum. Rearrangements in the C(4) photosynthesis pathway were also identified.
Wang, Shuo; Gao, Li-Zhi
2016-09-01
The complete chloroplast genome of green foxtail (Setaria viridis), a promising model system for C4 photosynthesis, is first reported in this study. The genome harbors a large single copy (LSC) region of 81 016 bp and a small single copy (SSC) region of 12 456 bp separated by a pair of inverted repeat (IRa and IRb) regions of 22 315 bp. GC content is 38.92%. The proportion of coding sequence is 57.97%, comprising of 111 (19 duplicated in IR regions) unique genes, 71 of which are protein-coding genes, four are rRNA genes, and 36 are tRNA genes. Phylogenetic analysis indicated that S. viridis was clustered with its cultivated species S. italica in the tribe Paniceae of the family Poaceae. This newly determined chloroplast genome will provide valuable genetic resources to assist future studies on C4 photosynthesis in grasses.
Silva, Paula Renata Alves da; Simões-Araújo, Jean Luiz; Vidal, Márcia Soares; Cruz, Leonardo Magalhães; Souza, Emanuel Maltempi de; Baldani, José Ivo
Paraburkholderia tropica (syn Burkholderia tropica) are nitrogen-fixing bacteria commonly found in sugarcane. The Paraburkholderia tropica strain Ppe8 is part of the sugarcane inoculant consortium that has a beneficial effect on yield. Here, we report a draft genome sequence of this strain elucidating the mechanisms involved in its interaction mainly with Poaceae. A genome size of approximately 8.75Mb containing 7844 protein coding genes distributed in 526 subsystems was de novo assembled with ABySS and annotated by RAST. Genes related to the nitrogen fixation process, the secretion systems (I, II, III, IV, and VI), and related to a variety of metabolic traits, such as metabolism of carbohydrates, amino acids, vitamins, and proteins, were detected, suggesting a broad metabolic capacity and possible adaptation to plant association. Copyright © 2017 Sociedade Brasileira de Microbiologia. Published by Elsevier Editora Ltda. All rights reserved.
Flora in abandoned fields and adjacent crop fields on rendzina soils in the Zamość region
Directory of Open Access Journals (Sweden)
Marta Ziemińska-Smyk
2015-10-01
Full Text Available A floristic inventory of segetal flora was carried out in abandoned fields and adjacent crop fields on rendzina soils in the Zamość region in the year 2010. This study found a total of 130 weed species belonging to 30 botanical families. The following families were represented most frequently: Asteraceae, Fabaceae, Poaceae, Lamiaceae, Scrophulariaceae, and Brassicaceae. In the segetal flora, apophytes are dominant (55% of the total flora, with the highest number of meadow and xerothermic grassland species among them. Archeophytes (38% predominate in the group of anthropophytes. The species characterized by the highest constancy classes and reaching the highest cover indices posed the greatest threat to crops in the study area. The following weeds are most frequently found in fallow fields: Consolida regalis, Cichorium intybus, and Sinapis arvensis, while Papaver rhoeas is the greatest threat to cereal crops grown on rendzina soils.
Angiosperms, Hydrophytes of five ephemeral lakes of Thiruvallur District, Tamil Nadu, India
Directory of Open Access Journals (Sweden)
Udayakumar, M.
2010-01-01
Full Text Available The aim of this study was to document the Angiosperm diversity of five ephemeral lakes of ThiruvallurDistrict of Tamil Nadu South India. Qualitative floristic surveys were carried out during 2005-2007. Herbarium specimenswith voucher number, taxonomical and ecological information were deposited to the herbarium, Pachaiyappa’s College(PCH Chennai, Tamilnadu. Forty five species of hydrophytes belonging to 21 families and 34 genera were documented.Most speciose families were Poaceae with 5 species followed by Polygalaceae and Nymphaeaceae (4 Cyperaceae,Hydrocharitaceae, Najadaceae, and Scrophulariaceae (3 species each. Mean depth of all five lakes shrinking gradually dueto severe anthropogenic pressure. Conservation of wetlands is the need of the hour to protect the biota as well as quality ofdrinking water.
Directory of Open Access Journals (Sweden)
Kiril STOYANOV
2013-03-01
Full Text Available New data about the natural parasitism of Phelipanche ramosa (L Pomel, P. mutelii (Shultz Pomel, P. oxyloba, P. arenaria and P. purpurea in Bulgaria are collected. The information for the hosts describes 46 new trophic systems with species from the families: Brassicaceae, Solanaceae, Fabaceae, Asteraceae, Apiaceae, Poaceae, Lamiaceae, Scrophulariaceae, Chenopodiaceae, Caryophyllaceae, Araliaceae, Euphorbiaceae, Geraniaceae, Dioscoreaceae and Verbenaceae. The samples are collected outside the crop fields, far from the known host crops, from different parts of the country. Some of the registered hosts are new for Bulgaria. The voucher specimens with physical connection to the hosts are deposited in the Herbarium of The Agricultural University - Plovdiv (SOA. The collected data suggest that genus Phelipanche is represented by two trophic groups according to the known sections. Sect. Phelipanche unites the polyphags P. ramosa, P. oxyloba and P. mutelii. Sect. Arenariae consist oligophags - P. arenaria and P. purpurea.
A Floristic Study of Hamun Lake Basin, South East of Iran
Directory of Open Access Journals (Sweden)
Maryam Keshavarzi
2017-06-01
Full Text Available Lake Hamun is the largest freshwater resource in Iran with area of about 3820 km2. The present study aims to evaluate the floristic elements of the studied site. Plant samples were gathered from nature, from March to July at the growing season. Life form and chorotype of plants in Lake Hamun basin were investigated. Totally 128 plant species belonging to 80 genera and 30 families were identified. Families as Poaceae, Amaranthaceae and Fabaceae were the most dominant and frequent families. Considering biological types revealed that the most frequent forms were therophytes (61% and hemicryptophytes (17%. Floristic elements of the area were mainly Iranotouranian mixed with Saharo-Arabian and Sindu-Sudanian types, although multi- and bi- regional elements were also frequent. As the lake has recently become an international conserved area, the complete biological and ecological study of the site is a necessity.
A floristic study of Salaheddinkola Forests, Nowshahr, Iran
Directory of Open Access Journals (Sweden)
Omid Esmailzadeh
2014-11-01
Full Text Available This paper reports the floristic survey on the Salaheddinkola forests (Nowshahr. These forests posses high variations in elevation ranges and special physiographic properties, which form the growth platform for most of the typical Hyrcanian forest species. The floristic-physiognomic investigation of the region was performed using field-walk procedure and revealed 237 plant species belonging to 196 genera and 85 families. The important families were Asteraceae, Poaceae, Rosaceae, Lamiaceae and Fabaceae with 23, 20, 14, 13 and 10 species, respectively which represented 33.17 percent of the total species. According to Raunkaiaer method, Cryptophytes (28.7%, Hemicryptophytes (27.5% and Phanerophytes (22.5% were the most important structure groups of the local biological spectrum followed by Therophytes (17.7% and Chamaephytes (3.4% Chorotypes. According to Zohary, most of the identified species belonged to Euro-Siberian and Pluriregional regions with 79 (33.6% and 62 (26% taxa, respectively.
Directory of Open Access Journals (Sweden)
Leyda Rodríguez
2009-03-01
Full Text Available Como una contribución al conocimiento florístico de la cuenca del Río Caroní se realizaron colecciones botánicas en varios ambientes de la cuenca baja del Río Cucurital, que incluyen formaciones boscosas, tanto en penillanura como ribereñas, morichales, sabanas, arbustales y ambientes perturbados; en los bosques se hicieron colecciones en parcelas de 0,1 ha y fuera de ellas. De manera general, las familias con mayor cantidad de especies fueron Melastomataceae (46, Rubiaceae (33, Euphorbiaceae (23, Cyperaceae (19, Myrtaceae (18, Fabaceae (18, Clusiaceae (15, Arecaceae (15, Caesalpiniaceae (14, Chrysobalanaceae (14, Lauraceae (14, Poaceae (13 y Burseraceae (12, siendo las más representativas de la cuenca baja. Los géneros con mayor cantidad de especies fueron Miconia (17, Psychotria (13, Ocotea (10, Myrcia (8, Protium (7, Licania (7 y Rhynchospora (7. Melastomataceae y Rubiaceae predominaron en todos los ambientes con excepción de la sabana; Lauraceae, Burseraceae, Arecaceae, Chrysobalanaceae y Euphorbiaceae fueron las de mayor importancia en los bosques, y Myrtaceae y Cyperaceae en los bosques ribereños, esta última junto con las Poaceae predominaron en morichal y sabana. Se encontraron 19 especies restringidas a la Guayana venezolana, de las cuales 12 se conocen sólo del estado Bolívar, evidenciando que las condiciones ecológicas, topográficas y edáficas determinan la presencia de elementos florísticos particulares. Las actividades humanas son escasas, lo que se ha reflejado en poca alteración de las comunidades vegetales y en el mantenimiento del carácter prístino de los ambientes. Los escasos ambientes intervenidos han sido colonizados por especies herbáceas y arbustivas típicas de la región.As a contribution to the floristic knowledge of the Caroní river basin, botanical collections were made in several environments of the lower Cucurital river basin, including forests, riverine forests, palm swamp forests (morichal
Chemical contents in Lygeum spartum L. using instrumental neutron activation analysis
International Nuclear Information System (INIS)
Nedjimi, Bouzid
2015-01-01
The present investigation was conducted to determine the chemical contents of Lygeum spartum L. (Poaceae). Samples were analyzed in order to determine essential (Ca, K, Na, Fe, Co) and some potentially toxic elements (Eu, Sb, Tb) using instrumental neutron activation analysis (INAA). In general chemical element contents were in substantial amounts to meet adult sheep requirements. Potential intake of Ca, K, Zn, Co and Fe by ruminant weighing 50 kg BW consuming 2.0 kg per day DM was sufficient to satisfy their requirements. However, only Na level was still insufficient to meet the requirements for grazing ruminants. Potential toxic elements in this species were within the safety baseline of all the assayed elements recommended by NRC. Na supplementation would seem to be necessary in this zone, for optimum productivity of grazing animals.
Directory of Open Access Journals (Sweden)
Jesús Bello Pulido
2016-08-01
Full Text Available As a contribution to the floristic knowledge of xeric zones of the country, a list of angiospermae species is presented that are found forming part of a xerophytic shrubland, located around the Bocaripo-Chacopata lagoon complex, in Araya Peninsula, Sucre state. A total of 56 families was identified which comprised 142 genus, 180 species and 3 intraspecific taxa. The most dominant families regarding to the species number were: Fabaceae (24 spp., Poaceae (15 spp., Cactaceae (10 spp., Asteraceae, Euphorbiaceae (9 spp. c/u, Malvaceae (8 spp., Convolvulaceae (7 spp., Cyperaceae, Amaranthaceae (6 spp. c/u, Portulacaceae and Bromeliaceae (5 spp. c/u. Among the most important genera, were: Senna (4 spp., Capparis, Cyperus, Opuntia, Sida and Tillandsia (3 spp. c/u. The more common biotype was herbaceous vegetation, followed by shrubs, trees, climber, epiphytes and hemiparasites. The list includes two endemic species and 8 other included in the Red Book of the Flora of Venezuela.
Directory of Open Access Journals (Sweden)
María I. La-Torre
2013-06-01
Full Text Available Se presenta la segunda parte de un estudio taxonómico de la Familia Poaceae del Parque Nacional Yanachaga-Chemillén y zonas aledañas (Oxapampa, Pasco, Perú. Se presentan 63 especies de Poáceas de las subfamilias Pooideae, Centothecoideae, Arundinoideae, Chloridoideae y Panicoideae, las cuales están incluidas en 37 géneros y 12 tribus. Se incluye una breve descripción de los géneros. Se ha elaborado claves para diferenciar los géneros y especies. Para cada especie se indica su ecología, distribución y el material estudiado.
Urinary diseases and ethnobotany among pastoral nomads in the Middle East
Abu-Rabia, Aref
2005-01-01
This article is derived from a broad, twenty-year study of ethnobotany and folk medicine among pastoral nomads in the Middle East which took place from 1984 to 2004. The article presents examples of different treatments of diseases and disorders of the urinary tract carried out by healer herbalists. The preparation of remedies includes boiling infusions, extraction of dry or fresh leaves, flowers, seeds or whole plants. Some of these plants were used both as food and as medicine, by ingesting different parts of the plants, such as leaves, flowers, fruits, and so on, either while soft, cooked or dried. Data were collected by using unstructured interviews and by observation. These plants were identified by healers, patients, and university botanists. This paper identified eighty-five plant species, which belong to thirty-six families. The most representative families are: Asteraceae (8), Brassicaceae (6), Poaceae (6), Umbelliferae (6). PMID:16270930
Boye, Joyce Irene; Achouri, Allaoua; Raymond, Nancy; Cleroux, Chantal; Weber, Dorcas; Koerner, Terence B; Hucl, Pierre; Patterson, Carol Ann
2013-06-26
Glabrous (hairless) canary seed belongs to the Poaceae (Gramineae) family and could serve as an alternative source of gluten-free cereal grain. In this study, allergenic cross-reactivities between hairless, dehulled canary seeds (Phalaris canariensis) and major allergenic proteins from gluten, soy, peanuts, tree nuts, sesame, and mustard were studied using commercial enzyme-linked immune sorbent assay (ELISA) kits specific for these target allergens. Mass spectrometry (MS) and immunoblotting were further used to assess for the presence of gluten-specific protein fragments. MS results revealed the likely presence of proteins homologous with rice, oat, corn, carrot, tomato, radish, beet, and chickpea. However, no presence of celiac-related gluten fragments from wheat, rye, barley, or their derivatives was found. Immunoblotting studies yielded negative results, further confirming the absence of gluten in the canary seed samples tested. No cross-reactivities were detected between canary seeds and almond, hazelnut, mustard, peanut, sesame, soy, walnut, and gluten using ELISA.
Directory of Open Access Journals (Sweden)
Marco Otávio Pivari
2008-06-01
Full Text Available A associação entre as formas biológicas flutuante e epífita, relacionadas a macrófitas aquáticas, constitui o que se chama genericamente de ilha flutuante. Esta denominação é aplicada ao estabelecimento de uma ou mais epífitas sobre indivíduos vivos de espécies flutuantes, como sinônimo de camalotal ou, ainda, para se referir à vegetação flutuante que se desenvolve sobre um solo orgânico em decomposição (histossolo. Realizou-se o levantamento das espécies presentes em cinco baceiros nas sub-regiões pantaneiras do Abobral e Miranda e o estabelecimento das similaridades florísticas entre estes, a fim de evidenciar aspectos da dinâmica sucessional de ilhas flutuantes. Foram encontradas 66 espécies de macrófitas aquáticas epífitas, distribuídas em 27 famílias, sendo Cyperaceae e Poaceae as mais representativas. O número de espécies por baceiro variou de 7 a 39, sendo os táxons comuns a todos esses Ludwigia leptocarpa (Nutt. H. Hara e Oxycaryum cubense (Poepp. & Kunth Palla, ao nível específico, e Asteraceae, Cyperaceae, Onagraceae, Poaceae e Polygonaceae, com relação às famílias. Outras formas biológicas, além da epífita, foram encontradas associadas aos baceiros, ou ainda, se mostraram adaptadas às condições do histossolo, podendo ser consideradas " epífitas casuais" . Baceiros em estágios sucessionais mais próximos apresentam maior similaridade florística e, no geral, quanto mais avançada a sucessão natural, maior a riqueza específica.The association between floating and epiphytic biological forms, regarding aquatic macrophytes, creates what are called floating mats. This concept refers to the establishment of one or more epiphytes on live individuals of floating species, as a synonym of " camalotal," or applied to floating vegetation that grows on organic soil in decomposition (histosol. A checklist of species was made of five floating mats in the Abobral and Miranda Pantanal Wetlands and
Magnoliophyta species of restinga, state of Pernambuco, Brazil.
Directory of Open Access Journals (Sweden)
Zickel, C. S.
2007-01-01
Full Text Available Restinga vegetation occurs along the entire coast of Brazil. The 187 km of coastline of the state ofPernambuco demonstrates a diversity of habitats, such as beaches, dunes, and restingas. The present study sought toelaborate a checklist of the phanerogamic species found there. The species listed were compiled from surveysundertaken between 1951 and 2007, as well as from herbaria collections in that state. A total of 477 species distributedamong 303 genera and 95 families were encountered. The families with the greatest numbers of species were Poaceae(39 species, Fabaceae (34, Cyperaceae (26, Euphorbiaceae (25, Myrtaceae (24, Rubiaceae (20, Caesalpiniaceae(17, Mimosaceae (16, Asteraceae (14, Orchidaceae (14, Bromeliaceae (9, Boraginaceae (8, Malvaceae (8,Solanaceae (8, and Annonaceae, Araceae, Chrysobalanaceae, Malpighiaceae, and Melastomataceae (7 each.Approximately 60 % of the species were common to other restinga areas in northeastern Brazil, and 39.3 % wererestricted to the coast of Pernambuco.
Energy Technology Data Exchange (ETDEWEB)
Chen, Shuangyan [Chinese Academy of Sciences (CAS), Institute of Botany (IB), Beijing; Huang, Xin [Chinese Academy of Sciences (CAS), Institute of Botany (IB), Beijing; Yang, Xiaohan [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Liu, Gongshe [Chinese Academy of Sciences (CAS), Institute of Botany (IB), Beijing
2013-07-04
BACKGROUND: Sheepgrass [Leymus chinensis (Trin.) Tzvel.] is an important perennial forage grass across the Eurasian Steppe and is known for its adaptability to various environmental conditions. However, insufficient data resources in public databases for sheepgrass limited our understanding of the mechanism of environmental adaptations, gene discovery and molecular marker development. RESULTS: The transcriptome of sheepgrass was sequenced using Roche 454 pyrosequencing technology. We assembled 952,328 high-quality reads into 87,214 unigenes, including 32,416 contigs and 54,798 singletons. There were 15,450 contigs over 500 bp in length. BLAST searches of our database against Swiss-Prot and NCBI non-redundant protein sequences (nr) databases resulted in the annotation of 54,584 (62.6%) of the unigenes. Gene Ontology (GO) analysis assigned 89,129 GO term annotations for 17,463 unigenes. We identified 11,675 core Poaceae-specific and 12,811 putative sheepgrass-specific unigenes by BLAST searches against all plant genome and transcriptome databases. A total of 2,979 specific freezing-responsive unigenes were found from this RNAseq dataset. We identified 3,818 EST-SSRs in 3,597 unigenes, and some SSRs contained unigenes that were also candidates for freezing-response genes. Characterizations of nucleotide repeats and dominant motifs of SSRs in sheepgrass were also performed. Similarity and phylogenetic analysis indicated that sheepgrass is closely related to barley and wheat. CONCLUSIONS: This research has greatly enriched sheepgrass transcriptome resources. The identified stress-related genes will help us to decipher the genetic basis of the environmental and ecological adaptations of this species and will be used to improve wheat and barley crops through hybridization or genetic transformation. The EST-SSRs reported here will be a valuable resource for future gene-phenotype studies and for the molecular breeding of sheepgrass and other Poaceae species.
Directory of Open Access Journals (Sweden)
Lucélia do Valle Borges
2007-05-01
Full Text Available The aim of this study was to determine feeding habitats of capybaras in the ESEC-Taim (RS, Brazil, using microhistological analyses of feces. Data were analyzed seasonally. In 172 samples analyzed, 17 species were identified, with predominance of Poaceae. Zizaniopsis bonariensis was the most frequent species in winter (38%, spring (32% and summer (26.5% and Paspalum disthichum in fall (31.5%. A observed increase in vegetation consumption during summer might be due to the food quality. Capybaras showed an opportunistic behavior in the winter and summer and a more selective behavior in spring and fall. Capybaras from the ESEC-Taim varied diet according to the season and alimentary availability.O principal objetivo deste estudo foi determinar os hábitos alimentares das capivaras na ESEC-Taim baseado na análise microhistologica de suas fezes. Os dados foram analisados sazonalmente. Em 172 amostras analisadas, foram identificadas 17 espécies, com predominância de Poaceae. Zizaniopsis bonariensis foi a espécie mais freqüente no inverno (38%, primavera (32% e verão (26,5% e Paspalum disthichum no outono (31,5%. O aumento no consumo da vegetação durante o verão pode ser explicado devido à qualidade da vegetação. As capivaras mostram um comportamento de oportunismo nas estações de inverno e verão e um comportamento mais seletivo na primavera e outono. Concluindo, as capivaras da ESEC-Taim variam sua dieta de acordo com a estação e a disponibilidade de comida.
Vegetation and climate history during the last millennium derived from Anggertu Lake, Tengger Desert
Duan, F.; An, C.; Zhao, Y.; Wang, W.; Cao, Z.
2017-12-01
Studying the climate changes during the last millennium can help us to understand current relationship between human-social activities and natural environment changes, and improve projections of future climate. Pollen assemblages, loss-on-ignition (LOIorg at 550 °C) and grain size data collected from sediment core (AGE15A) from the center of Anggertu lake (eastern Tengger Desert, Inner Mongolia) are presented to reconstruct regional vegetation and climate history during the last millennium. Results show that: 1) desert or desert steppe dominated by Artemisia and Amaranthaceae expanded around this region during the period of 988 1437 A.D., indicating a generally dry climate condition with two short humid periods (1003 1082 A.D. and 1388 1437 A.D). These two wet periods are characterized by relatively high vegetation cover and bio-productivity, reflected by high pollen concentrations and LOIorg. Increase in the steppe or meadow vegetation communities (Poaceae, Cyperaceae) and vegetation cover during the period of 1437 2015 A.D. suggest a wetting trend, as also indicated by gradually finer grain size. The relatively high LOI indicate a high bio-productivity during this interval. And then unstable lacustrine environment was found with frequent fluctuations in pollen concentration and grain size since 1842 A.D.. 2) This study recorded a relatively dry Medieval Warm Period (MWP; 1082 1388 A.D.) and a wet Little Ice Age (LIA; 1437 1842 A.D.), which is generally consistent with climate characteristics in arid central Asia (ACA). 3) Increased Amaranthaceae and high abundance of Poaceae were related to overgrazing and agricultural activities at that time to some extent. Thus vegetation evolution of the lake region was influenced by human activities and climate changes.
Batiz, M. F. Rossi; Marino de Remes Lenicov, A. M.; Hagedorn, Henry
2014-01-01
Abstract The five immature stages of the planthopper Lacertinella australis (Remes Lenicov and Rossi Batiz) (Hemiptera: Delphacidae: Saccharosydnini) are described and illustrated. The main characters that allowed us to distinguish the various stages were body size, number of tarsomeres and metatibial spines, and number of teeth on the spur. New biological data based on laboratory rearing and field observations showed that L. australis can carry out its biological cycle successfully on the graminaceous pampas grass ( Cortaderia spp. Stapf (Poales: Poaceae)). In addition, the efficient rearing in captivity, the high survivorship registered, and overwintering only on this host plant suggests that L. australis is a potential biocontrol agent of this invasive graminaceous weed. This study provides information about the immature stages , including a key for their identification, based on laboratory reared specimens and field observations. Resumen Se describen e ilustran las cinco etapas inmaduras de la especie de Saccharisydnini Lacertinella australis (Remes Lenicov and Rossi Batiz) (Hemiptera: Delphacidae). Los principales caracteres que permitieron distinguir las diferentes etapas fueron: tamaño corporal, número de espinas en los tarsómeros y metatibia y número de dientes en el espolón tibial. Nuevos datos biológicos, basados en la cría de laboratorio y observaciones de campo, mostraron que L. australis puede realizar su ciclo biológico exitosamente en la graminácea cortadera ( Cortaderia spp. Stapf (Poales: Poaceae)). Además, la eficiente crianza en cautive-rio y la alta supervivencia registrada en esta planta hospedera, sugieren que L. australis podría ser usada como un potencial agente de control biológico de esta maleza invasora. Este estudio proporciona informa-ción sobre las etapas inmaduras, incluyendo una clave para su identificación, basada en individuos provenientes de la cría de laboratorio y de campo. PMID:25199992
Insecticidal Management and Movement of the Brown Stink Bug, Euschistus servus, in Corn
Reisig, Dominic D.
2011-01-01
In eastern North Carolina, some brown stink bugs, Euschistus servus (Say) (Hemiptera: Pentatomidae) are suspected to pass the F1 generation in wheat (Triticum aestivum L.) (Poales: Poaceae) before moving into corn (Zea mays L.) (Poales: Poaceae). These pests can injure corn ears as they develop. To test their effectiveness as a management tactic, pyrethroids were aerially applied to field corn in two experiments, one with 0.77 ha plots and another with 85 ha plots. Euschistus servus population abundance was monitored over time in both experiments and yield was assessed in the larger of the two experiments. In the smaller experiment, the populations were spatially monitored in a 6.3 ha area of corn adjacent to a recently harvested wheat field (352 sampling points of 6.1 row-meters in all but the first sampling event). Overall E. servus abundance decreased throughout the monitoring period in the sampling area of the smaller experiment, but remained unchanged over time in the large-scale experiment. During all sampling periods in both experiments, abundance was the same between treatments. Yield was unaffected by treatment where it was measured in the larger experiment. In the smaller experiment, E. servus were initially aggregated at the field edge of the corn (two, six and 13 days following the wheat harvest). Sixteen days following the wheat harvest they were randomly distributed in the corn. Although it was not directly measured, stink bugs are suspected to move the cornfield edge as a result of the adjacent wheat harvest. More study of the biology of E. servus is needed, specifically in the area of host preference, phenology and movement to explain these phenomena and to produce better management strategies for these pests. PMID:22950984
Chen, Shuangyan; Huang, Xin; Yan, Xueqing; Liang, Ye; Wang, Yuezhu; Li, Xiaofeng; Peng, Xianjun; Ma, Xingyong; Zhang, Lexin; Cai, Yueyue; Ma, Tian; Cheng, Liqin; Qi, Dongmei; Zheng, Huajun; Yang, Xiaohan; Li, Xiaoxia; Liu, Gongshe
2013-01-01
Sheepgrass [Leymus chinensis (Trin.) Tzvel.] is an important perennial forage grass across the Eurasian Steppe and is known for its adaptability to various environmental conditions. However, insufficient data resources in public databases for sheepgrass limited our understanding of the mechanism of environmental adaptations, gene discovery and molecular marker development. The transcriptome of sheepgrass was sequenced using Roche 454 pyrosequencing technology. We assembled 952,328 high-quality reads into 87,214 unigenes, including 32,416 contigs and 54,798 singletons. There were 15,450 contigs over 500 bp in length. BLAST searches of our database against Swiss-Prot and NCBI non-redundant protein sequences (nr) databases resulted in the annotation of 54,584 (62.6%) of the unigenes. Gene Ontology (GO) analysis assigned 89,129 GO term annotations for 17,463 unigenes. We identified 11,675 core Poaceae-specific and 12,811 putative sheepgrass-specific unigenes by BLAST searches against all plant genome and transcriptome databases. A total of 2,979 specific freezing-responsive unigenes were found from this RNAseq dataset. We identified 3,818 EST-SSRs in 3,597 unigenes, and some SSRs contained unigenes that were also candidates for freezing-response genes. Characterizations of nucleotide repeats and dominant motifs of SSRs in sheepgrass were also performed. Similarity and phylogenetic analysis indicated that sheepgrass is closely related to barley and wheat. This research has greatly enriched sheepgrass transcriptome resources. The identified stress-related genes will help us to decipher the genetic basis of the environmental and ecological adaptations of this species and will be used to improve wheat and barley crops through hybridization or genetic transformation. The EST-SSRs reported here will be a valuable resource for future gene-phenotype studies and for the molecular breeding of sheepgrass and other Poaceae species.
Diekmann, Kerstin; Hodkinson, Trevor R; Barth, Susanne
2012-11-01
Lolium perenne (perennial ryegrass) is the most important forage grass species of temperate regions. We have previously released the chloroplast genome sequence of L. perenne 'Cashel'. Here nine chloroplast microsatellite markers are published, which were designed based on knowledge about genetically variable regions within the L. perenne chloroplast genome. These markers were successfully used for characterizing the genetic diversity in Lolium and different grass species. Chloroplast genomes of 14 Poaceae taxa were screened for mononucleotide microsatellite repeat regions and primers designed for their amplification from nine loci. The potential of these markers to assess genetic diversity was evaluated on a set of 16 Irish and 15 European L. perenne ecotypes, nine L. perenne cultivars, other Lolium taxa and other grass species. All analysed Poaceae chloroplast genomes contained more than 200 mononucleotide repeats (chloroplast simple sequence repeats, cpSSRs) of at least 7 bp in length, concentrated mainly in the large single copy region of the genome. Nucleotide composition varied considerably among subfamilies (with Pooideae biased towards poly A repeats). The nine new markers distinguish L. perenne from all non-Lolium taxa. TeaCpSSR28 was able to distinguish between all Lolium species and Lolium multiflorum due to an elongation of an A(8) mononucleotide repeat in L. multiflorum. TeaCpSSR31 detected a considerable degree of microsatellite length variation and single nucleotide polymorphism. TeaCpSSR27 revealed variation within some L. perenne accessions due to a 44-bp indel and was hence readily detected by simple agarose gel electrophoresis. Smaller insertion/deletion events or single nucleotide polymorphisms detected by these new markers could be visualized by polyacrylamide gel electrophoresis or DNA sequencing, respectively. The new markers are a valuable tool for plant breeding companies, seed testing agencies and the wider scientific community due to
Medicinal plants used to treat TB in Ghana.
Nguta, Joseph Mwanzia; Appiah-Opong, Regina; Nyarko, Alexander K; Yeboah-Manu, Dorothy; Addo, Phyllis G A
2015-06-01
The current study was designed to document medicinal plant species that are traditionally used to treat tuberculosis (TB) by Ghanaian communities. The medicinal plants used against TB or its signs and symptoms were selected using library and online published data searches. A guided questionnaire interview was also conducted with a botanist involved in plant collection at the Centre for Scientific Research into Plant Medicine (CSRPM) at Mampong. Data obtained were entered in Excel and summarized into means and frequencies using SPSS 12.0.1 for windows, and expressed as tables and bar graphs. A total of 15 medicinal plant species distributed between 13 genera and 13 families were documented. The following medicinal plant species were found to be used against TB in Greater Accra and Eastern parts of Ghana: Azadirachta indica A. Juss. Stem bark (Meliaceae), Hygrophila auriculata Heine, whole plant (Acanthaceae), Chenopodium ambrosioides L. leaves (Amaranthaceae), Coix lacryma-jobi L. glumes (Poaceae), Solanum torvum Sw. unripe fruits (Solanaceae), Solanum torvum Sw. leaves (Solanaceae), Bidens pilosa L. whole plant (Asteraceae), Phyllanthus fraternus G.L. Webster leaves (Phyllanthaceae), Dissotis rotundifolia (Sm.) Triana, leaves (Melastomataceae), Cymbopogon giganteus Chiov. Leaves (Poaceae), Cyperus articulatus L. roots (Cyperaceae), Allium sativum L. bulb (Amaryllidaceae), Zingiber officinale Roscoe, rhizomes (Zingiberaceae), Allium cepa L. bulbs (Amaryllidaceae), Allium cepa L. leaves (Amaryllidaceae), Aloe vera var. barbadensis aqueous extract from leaves (Xanthorrhoeaceae), Aloe vera var. barbadensis organic extract from leaves (Xanthorrhoeaceae), Cocos nucifera Linn, water (Arecaceae) and Cocos nucifera Linn. Husk (Arecaceae). The collected plant species could be a source of a new class of drugs against TB. Bioactivity guided fractionation is recommended to identify lead compounds for antimycobacterial activity. The current paper documents for the first time
High altitude artisanal small-scale gold mines are hot spots for Mercury in soils and plants
International Nuclear Information System (INIS)
Terán-Mita, Tania A.; Faz, Angel; Salvador, Flor; Arocena, Joselito M.; Acosta, Jose A.
2013-01-01
Mercury releases from artisanal and small-scale gold mines (ASGM) condense and settle on plants, soils and water bodies. We collected soil and plant samples to add knowledge to the likely transfer of Hg from soils into plants and eventually predict Hg accumulation in livestock around ASGM in Bolivia. Mean contents of Hg in soils range from 0.5 to 48.6 mg Hg kg −1 soil (5× to 60× more compared to control sites) and exceeded the soil Hg threshold levels in some European countries. The Hg contents ranged from 0.6 to 18 and 0.2 to 28.3 mg Hg kg −1 leaf and root, respectively. The high Hg in Poaceae and Rosaceae may elevate Hg accumulation into the food chain because llama and alpaca solely thrive on these plants for food. Erosion of soils around ASGM in Bolivia contributes to the Hg contamination in lower reaches of the Amazon basin. - Highlights: ► Hg in soils ranged from 0.5 to 48.6 mg Hg kg −1 soil, and at least 5× to 60× more than control sites. ► Plants near gold mines exceed the 0.1 mg Hg kg −1 plant material European limit for feed quality. ► Camelids feeding on plants with high Hg may elevate Hg levels in foods (meats) for the miners. ► Soils with high Hg can be significant Hg sources to the contamination of the Amazon basin. - Mean contents of Hg in soils were at least 5× to 60× more compared to Hg in control sites, and the high Hg in Poaceae and Rosaceae may elevate Hg into the food chain.
Young, intact and nested retrotransposons are abundant in the onion and asparagus genomes.
Vitte, C; Estep, M C; Leebens-Mack, J; Bennetzen, J L
2013-09-01
Although monocotyledonous plants comprise one of the two major groups of angiosperms and include >65 000 species, comprehensive genome analysis has been focused mainly on the Poaceae (grass) family. Due to this bias, most of the conclusions that have been drawn for monocot genome evolution are based on grasses. It is not known whether these conclusions apply to many other monocots. To extend our understanding of genome evolution in the monocots, Asparagales genomic sequence data were acquired and the structural properties of asparagus and onion genomes were analysed. Specifically, several available onion and asparagus bacterial artificial chromosomes (BACs) with contig sizes >35 kb were annotated and analysed, with a particular focus on the characterization of long terminal repeat (LTR) retrotransposons. The results reveal that LTR retrotransposons are the major components of the onion and garden asparagus genomes. These elements are mostly intact (i.e. with two LTRs), have mainly inserted within the past 6 million years and are piled up into nested structures. Analysis of shotgun genomic sequence data and the observation of two copies for some transposable elements (TEs) in annotated BACs indicates that some families have become particularly abundant, as high as 4-5 % (asparagus) or 3-4 % (onion) of the genome for the most abundant families, as also seen in large grass genomes such as wheat and maize. Although previous annotations of contiguous genomic sequences have suggested that LTR retrotransposons were highly fragmented in these two Asparagales genomes, the results presented here show that this was largely due to the methodology used. In contrast, this current work indicates an ensemble of genomic features similar to those observed in the Poaceae.
Insights into the Musa genome: Syntenic relationships to rice and between Musa species
Directory of Open Access Journals (Sweden)
Althoff Ryan
2008-01-01
Full Text Available Abstract Background Musa species (Zingiberaceae, Zingiberales including bananas and plantains are collectively the fourth most important crop in developing countries. Knowledge concerning Musa genome structure and the origin of distinct cultivars has greatly increased over the last few years. Until now, however, no large-scale analyses of Musa genomic sequence have been conducted. This study compares genomic sequence in two Musa species with orthologous regions in the rice genome. Results We produced 1.4 Mb of Musa sequence from 13 BAC clones, annotated and analyzed them along with 4 previously sequenced BACs. The 443 predicted genes revealed that Zingiberales genes share GC content and distribution characteristics with eudicot and Poaceae genomes. Comparison with rice revealed microsynteny regions that have persisted since the divergence of the Commelinid orders Poales and Zingiberales at least 117 Mya. The previously hypothesized large-scale duplication event in the common ancestor of major cereal lineages within the Poaceae was verified. The divergence time distributions for Musa-Zingiber (Zingiberaceae, Zingiberales orthologs and paralogs provide strong evidence for a large-scale duplication event in the Musa lineage after its divergence from the Zingiberaceae approximately 61 Mya. Comparisons of genomic regions from M. acuminata and M. balbisiana revealed highly conserved genome structure, and indicated that these genomes diverged circa 4.6 Mya. Conclusion These results point to the utility of comparative analyses between distantly-related monocot species such as rice and Musa for improving our understanding of monocot genome evolution. Sequencing the genome of M. acuminata would provide a strong foundation for comparative genomics in the monocots. In addition a genome sequence would aid genomic and genetic analyses of cultivated Musa polyploid genotypes in research aimed at localizing and cloning genes controlling important agronomic
Modeling pollen time series using seasonal-trend decomposition procedure based on LOESS smoothing.
Rojo, Jesús; Rivero, Rosario; Romero-Morte, Jorge; Fernández-González, Federico; Pérez-Badia, Rosa
2017-02-01
Analysis of airborne pollen concentrations provides valuable information on plant phenology and is thus a useful tool in agriculture-for predicting harvests in crops such as the olive and for deciding when to apply phytosanitary treatments-as well as in medicine and the environmental sciences. Variations in airborne pollen concentrations, moreover, are indicators of changing plant life cycles. By modeling pollen time series, we can not only identify the variables influencing pollen levels but also predict future pollen concentrations. In this study, airborne pollen time series were modeled using a seasonal-trend decomposition procedure based on LOcally wEighted Scatterplot Smoothing (LOESS) smoothing (STL). The data series-daily Poaceae pollen concentrations over the period 2006-2014-was broken up into seasonal and residual (stochastic) components. The seasonal component was compared with data on Poaceae flowering phenology obtained by field sampling. Residuals were fitted to a model generated from daily temperature and rainfall values, and daily pollen concentrations, using partial least squares regression (PLSR). This method was then applied to predict daily pollen concentrations for 2014 (independent validation data) using results for the seasonal component of the time series and estimates of the residual component for the period 2006-2013. Correlation between predicted and observed values was r = 0.79 (correlation coefficient) for the pre-peak period (i.e., the period prior to the peak pollen concentration) and r = 0.63 for the post-peak period. Separate analysis of each of the components of the pollen data series enables the sources of variability to be identified more accurately than by analysis of the original non-decomposed data series, and for this reason, this procedure has proved to be a suitable technique for analyzing the main environmental factors influencing airborne pollen concentrations.
Directory of Open Access Journals (Sweden)
Ron Stauder
2018-03-01
Full Text Available Strigolactones (SLs are apocarotenoid phytohormones synthesized from carotenoid precursors. They are produced most abundantly in roots for exudation into the rhizosphere to cope with mineral nutrient starvation through support of root symbionts. Abscisic acid (ABA is another apocarotenoid phytohormone synthesized in roots, which is involved in responses to abiotic stress. Typically low carotenoid levels in roots raise the issue of precursor supply for the biosynthesis of these two apocarotenoids in this organ. Increased ABA levels upon abiotic stress in Poaceae roots are known to be supported by a particular isoform of phytoene synthase (PSY, catalyzing the rate-limiting step in carotenogenesis. Here we report on novel PSY3 isogenes from Medicago truncatula (MtPSY3 and Solanum lycopersicum (SlPSY3 strongly expressed exclusively upon root interaction with symbiotic arbuscular mycorrhizal (AM fungi and moderately in response to phosphate starvation. They belong to a widespread clade of conserved PSYs restricted to dicots (dPSY3 distinct from the Poaceae-PSY3s involved in ABA formation. An ancient origin of dPSY3s and a potential co-evolution with the AM symbiosis is discussed in the context of PSY evolution. Knockdown of MtPSY3 in hairy roots of M. truncatula strongly reduced SL and AM-induced C13 α-ionol/C14 mycorradicin apocarotenoids. Inhibition of the reaction subsequent to phytoene synthesis revealed strongly elevated levels of phytoene indicating induced flux through the carotenoid pathway in roots upon mycorrhization. dPSY3 isogenes are coregulated with upstream isogenes and downstream carotenoid cleavage steps toward SLs (D27, CCD7, CCD8 suggesting a combined carotenoid/apocarotenoid pathway, which provides “just in time”-delivery of precursors for apocarotenoid formation.
Barima, Yao Sadaiou Sabas; Angaman, Djédoux Maxime; N'gouran, Kobenan Pierre; Koffi, N'guessan Achille; Kardel, Fatemeh; De Cannière, Charles; Samson, Roeland
2014-02-01
Particulate matter (PM) emissions, and the associated human health risks, are likely to continue increasing in urban environments of developing countries like Abidjan (Ivory Cost). This study evaluated the potential of leaves of several herbaceous and tree species as bioindicators of urban particulate matter pollution, and its variation over different land use classes, in a tropical area. Four species well distributed (presence frequencies >90%) over all land use classes, easy to harvest and whose leaves are wide enough to be easily scanned were selected, i.e.: Amaranthus spinosus (Amaranthaceae), Eleusine indica (Poaceae), Panicum maximum (Poaceae) and Ficus benjamina (Moraceae). Leaf sampling of these species was carried out at 3 distances from the road and at 3 height levels. Traffic density was also noted and finally biomagnetic parameters of these leaves were determined. Results showed that Saturation Isothermal Remanent Magnetization (SIRM) of leaves was at least 4 times higher (27.5×10(-6)A) in the vicinity of main roads and industrial areas than in parks and residential areas. The main potential sources of PM pollution were motor vehicles and industries. The slightly hairy leaves of the herbaceous plant A. spinosus and the waxy leaves of the tree F. benjamina showed the highest SIRM (25×10(-6)A). Leaf SIRM increased with distance to road (R(2)>0.40) and declined with sampling height (R(2)=0.17). The distance between 0 and 5m from the road seemed to be the most vulnerable in terms of PM pollution. This study has showed that leaf SIRM of herbaceous and tree species can be used to assess PM exposure in tropical urban environments. © 2013.
Brantley, Steven T; Bissett, Spencer N; Young, Donald R; Wolner, Catherine W V; Moore, Laura J
2014-01-01
Barrier islands are complex and dynamic systems that provide critical ecosystem services to coastal populations. Stability of these systems is threatened by rising sea level and the potential for coastal storms to increase in frequency and intensity. Recovery of dune-building grasses following storms is an important process that promotes topographic heterogeneity and long-term stability of barrier islands, yet factors that drive dune recovery are poorly understood. We examined vegetation recovery in overwash zones on two geomorphically distinct (undisturbed vs. frequently overwashed) barrier islands on the Virginia coast, USA. We hypothesized that vegetation recovery in overwash zones would be driven primarily by environmental characteristics, especially elevation and beach width. We sampled species composition and environmental characteristics along a continuum of disturbance from active overwash zones to relict overwash zones and in adjacent undisturbed environments. We compared species assemblages along the disturbance chronosequence and between islands and we analyzed species composition data and environmental measurements with Canonical Correspondence Analysis to link community composition with environmental characteristics. Recovering and geomorphically stable dunes were dominated by Ammophila breviligulata Fernaud (Poaceae) on both islands while active overwash zones were dominated by Spartina patens (Aiton) Muhl. (Poaceae) on the frequently disturbed island and bare sand on the less disturbed island. Species composition was associated with environmental characteristics only on the frequently disturbed island (p = 0.005) where A. breviligulata was associated with higher elevation and greater beach width. Spartina patens, the second most abundant species, was associated with larger sediment grain size and greater sediment size distribution. On the less frequently disturbed island, time since disturbance was the only factor that affected community
Directory of Open Access Journals (Sweden)
Steven T Brantley
Full Text Available Barrier islands are complex and dynamic systems that provide critical ecosystem services to coastal populations. Stability of these systems is threatened by rising sea level and the potential for coastal storms to increase in frequency and intensity. Recovery of dune-building grasses following storms is an important process that promotes topographic heterogeneity and long-term stability of barrier islands, yet factors that drive dune recovery are poorly understood. We examined vegetation recovery in overwash zones on two geomorphically distinct (undisturbed vs. frequently overwashed barrier islands on the Virginia coast, USA. We hypothesized that vegetation recovery in overwash zones would be driven primarily by environmental characteristics, especially elevation and beach width. We sampled species composition and environmental characteristics along a continuum of disturbance from active overwash zones to relict overwash zones and in adjacent undisturbed environments. We compared species assemblages along the disturbance chronosequence and between islands and we analyzed species composition data and environmental measurements with Canonical Correspondence Analysis to link community composition with environmental characteristics. Recovering and geomorphically stable dunes were dominated by Ammophila breviligulata Fernaud (Poaceae on both islands while active overwash zones were dominated by Spartina patens (Aiton Muhl. (Poaceae on the frequently disturbed island and bare sand on the less disturbed island. Species composition was associated with environmental characteristics only on the frequently disturbed island (p = 0.005 where A. breviligulata was associated with higher elevation and greater beach width. Spartina patens, the second most abundant species, was associated with larger sediment grain size and greater sediment size distribution. On the less frequently disturbed island, time since disturbance was the only factor that affected
Residual value analyses of the medicinal flora of the western himalayas: the Naran valley, Pakistan
International Nuclear Information System (INIS)
Khan, S.M.; Harper, D.; Page, S.; Ahmad, H.
2011-01-01
Statistical analyses of the medicinal flora of the Naran Valley in the Western Himalayas were performed using Moerman's methods and Principal Components Analysis (PCA). The results demonstrate that the valley's indigenous people utilize medicinal plants in a systematic way. Sixty-eight families of plants were identified during the study, of which 52 contained one or more species of medicinal value. The standard deviation for residual values of all the 68 families was 0.993 and the results of the residual analysis revealed that seven of these plant families were overused by the local people, indicated by residual values greater than the standard deviation. Residual values obtained from a regression analysis of plant species with their medicinal uses showed that the families with the highest rank were Polygonaceae, Gentianaceae, Lamiaceae, Rosaceae and Plantaginaceae, indicating their medicinal importance. By comparison, Poaceae, Boraginaceae, Primulaceae, Salicaceae, and Ranunculaceae were the lowest ranking families, containing few species of medicinal value. Although a few of the most species-rich families in the valley contained a high number of medicinal plants and hence displayed high residual values, some other species-rich families contained few or no species of medicinal value. For example, the third largest family, Poaceae, is the lowest in terms of its residual value, while the largest family, Asteraceae, contains only seven species noted as having medicinal uses. Sixteen plant families in the valley contained no species with reported medicinal use, while seven families contained only one species with medicinal value. In contrast, all of the species in several of the least species-rich families were recorded as having a medicinal use. The results of a Principal Components Analysis showed a gradient of medicinal plant use along the valley. Using robust statistical approaches, our study provides a clear indication that the indigenous people of this Western
Camacho, Irene Câmara
2015-01-01
Nowadays, pollen calendars are useful tools for clinical guidance intended for allergy sufferers, because they can be used to prevent and manage allergic respiratory diseases, thus improving the quality of life. An aeropalinological study was performed in the city of Funchal with the purpose of establishing a pollen calendar and determining allergic risk, based on a seven year study (2003-2009). The airborne pollen monitoring was carried out with a Hirst type volumetric spore trap, following well-established guidelines. The mean annual pollen index was 1,635.09 and comprised 42 different pollen types. Airborne pollen levels were higher between March - June, accounting for 57.9% of the annual counts. Arboreal pollen grains (52.72%) prevailed in the atmosphere together with herbs and grasses (44.64%), while fern spores (2.29%) and unidentified pollen (0.35%) were scarce. The main pollen types were Urticaceae (20.64%), Poaceae (16.02%), Cupressaceae (13.61%), Pinaceae (9.07%), Myrtaceae (5.93%) and Ericaceae (5.02%). The pollen calendar comprised a total of 14 taxa and is similar to Mediterranean regions, with the exception of Olea europaea, Quercus sp., Betula sp. and Alnus sp. pollen types which are rare or absent. The main pollen season of major pollen taxa is significantly longer in Funchal (on average 239 days) than other European sites, especially for Urticaceae and Poaceae, but the pollen peaks were substantially lower. The pollen calendar for Funchal is the first ever created for Madeira region. Taking into account the low pollen index and number of allergy-risk days recorded (39 days in 7 years), the air quality of Funchal can be considered good.
Directory of Open Access Journals (Sweden)
Jana Ščevková
2015-09-01
Full Text Available Introduction and objective. The association between airborne pollen counts or duration of pollen season and allergy symptoms is not always distinguished. The purpose of this study was to examine the correlation between pollen exposure (annual total pollen quantity and main pollen season length of selected allergenic plants in the atmosphere of Bratislava, and concentration of allergen-specific immunoglobulin E (sIgE in serum of patients with seasonal allergy during 2002–2003. Materials and methods. The concentration of pollen was monitored by a Burkard volumetric pollen trap. At the same time, 198 pollen allergic patients were testing to determine the values of sIgE antibodies against selected pollen allergens; a panel of 8 purified allergens was used. Results. The highest percentages of sensitization were detected for Poaceae and [i]Ambrosia[/i] pollen allergens. The most abundant airborne pollen types were Urticaceae, [i]Betula[/i], [i]Populus[/i], Fraxinus, Pinus and Poaceae. The length of the pollen season varied. The longest pollen season was that of the [i]Plantago[/i] – 105 days, and the shortest, [i]Corylus[/i] – 20 days. A significant correlation was found between annual total pollen quantity and median sIgE values, especially in 2002. Conclusions. A strong and significant positive correlation was observed between pollen counts, excluding [i]Betula[/i], and sIgE levels in both analysed years. The correlation was weaker and negative in the case of length of pollen season and sIgE values.
Oliveira, R R; Viana, A J C; Reátegui, A C E; Vincentz, M G A
2015-12-29
Determination of gene expression is an important tool to study biological processes and relies on the quality of the extracted RNA. Changes in gene expression profiles may be directly related to mutations in regulatory DNA sequences or alterations in DNA cytosine methylation, which is an epigenetic mark. Correlation of gene expression with DNA sequence or epigenetic mark polymorphism is often desirable; for this, a robust protocol to isolate high-quality RNA and DNA simultaneously from the same sample is required. Although commercial kits and protocols are available, they are mainly optimized for animal tissues and, in general, restricted to RNA or DNA extraction, not both. In the present study, we describe an efficient and accessible method to extract both RNA and DNA simultaneously from the same sample of various plant tissues, using small amounts of starting material. The protocol was efficient in the extraction of high-quality nucleic acids from several Arabidopsis thaliana tissues (e.g., leaf, inflorescence stem, flower, fruit, cotyledon, seedlings, root, and embryo) and from other tissues of non-model plants, such as Avicennia schaueriana (Acanthaceae), Theobroma cacao (Malvaceae), Paspalum notatum (Poaceae), and Sorghum bicolor (Poaceae). The obtained nucleic acids were used as templates for downstream analyses, such as mRNA sequencing, quantitative real time-polymerase chain reaction, bisulfite treatment, and others; the results were comparable to those obtained with commercial kits. We believe that this protocol could be applied to a broad range of plant species, help avoid technical and sampling biases, and facilitate several RNA- and DNA-dependent analyses.
Phenological records as a complement to aerobiological data
Tormo, Rafael; Silva, Inmaculada; Gonzalo, Ángela; Moreno, Alfonsa; Pérez, Remedios; Fernández, Santiago
2011-01-01
Phenological studies in combination with aerobiological studies enable one to observe the relationship between the release of pollen and its presence in the atmosphere. To obtain a suitable comparison between the daily variation of airborne pollen concentrations and flowering, it is necessary for the level of accuracy of both sets of data to be as similar as possible. To analyse the correlation between locally observed flowering data and pollen counts in pollen traps in order to set pollen information forecasts, pollen was sampled using a Burkard volumetric pollen trap working continuously from May 1993. For the phenological study we selected the main pollen sources of the six pollen types most abundant in our area: Cupressaceae, Platanus, Quercus, Plantago, Olea, and Poaceae with a total of 35 species. We selected seven sites to register flowering or pollination, two with semi-natural vegetation, the rest being urban sites. The sites were visited weekly from March to June in 2007, and from January to June in 2008 and 2009. Pollen shedding was checked at each visit, and recorded as the percentage of flowers or microsporangia in that state. There was an association between flowering phenology and airborne pollen records for some of the pollen types ( Platanus, Quercus, Olea and Plantago). Nevertheless, for the other types (Cupressaceae and Poaceae) the flowering and airborne pollen peaks did not coincide, with up to 1 week difference in phase. Some arguments are put forward in explanation of this phenomenon. Phenological studies have shown that airborne pollen results from both local and distant sources, although the pollen peaks usually appear when local sources are shedding the greatest amounts of pollen. Resuspension phenomena are probably more important than long-distance transport in explaining the presence of airborne pollen outside the flowering period. This information could be used to improve pollen forecasts.
Characterisation of bio-aerosols during dust storm period in N-NW India
Yadav, Sudesh; Chauhan, M. S.; Sharma, Anupam
Bio-investigations for pollen and spores were performed on dry free-fall dust and PM 10 aerosol samples, collected from three different locations separated by a distance of 600 km, situated in dust storm hit region of N-NW India. Presence of pollen of trees namely Prosopis ( Prosopis juliflora and Prosopis cinearia), Acacia, Syzygium, Pinus, Cedrus, Holoptelea and shrubs namely Ziziphus, Ricinus, Ephedra and members of Fabaceae, Oleaceae families was recorded but with varying proportions in the samples of different locations. Poaceae, Chenopodiaceae/Amaranthaceae, Caryophyllaceae, Brassicaceae and Cyperaceae (sedges) were some of the herb pollen identified in the samples. Among the fungal spores Nigrospora was seen in almost all samples. Nigrospora is a well known allergen and causes health problems. The concentration of trees and shrubs increases in the windward direction just as the climate changes from hot arid to semiarid. The higher frequency of grasses (Poaceae) or herbs could either be a result of the presence of these herbs in the sampling area and hence the higher production of pollen/spores or due to the resuspension from the exposed surface by the high-intensity winds. But we cannot ascertain the exact process at this stage. The overall similarity in the pollen and spore assemblage in our dust samples indicates a common connection or source(s) to the dust in this region. Presence of the pollen of the species of Himalayan origin in our entire samples strongly point towards a Himalayan connection, could be direct or indirect, to the bioaerosols and hence dust in N-NW India. In order to understand the transport path and processes involved therein, present study needs further extension with more number of samples and with reference to meteorological parameters.
Dresselhaus, Thomas; Lausser, Andreas; Márton, Mihaela L
2011-09-01
In contrast to animals and lower plants such as mosses and ferns, sperm cells of flowering plants (angiosperms) are immobile and require transportation to the female gametes via the vegetative pollen tube cell to achieve double fertilization. The path of the pollen tube towards the female gametophyte (embryo sac) has been intensively studied in many intra- and interspecific crossing experiments with the aim of increasing the gene pool of crop plants for greater yield, improved biotic and abiotic stress resistance, and for introducing new agronomic traits. Many attempts to hybridize different species or genotypes failed due to the difficulty for the pollen tubes in reaching the female gametophyte. Detailed studies showed that these processes are controlled by various self-incompatible (intraspecific) and cross-incompatible (interspecific) hybridization mechanisms. Understanding the molecular mechanisms of crossing barriers is therefore of great interest in plant reproduction, evolution and breeding research. In particular, pre-zygotic hybridization barriers related to pollen tube germination, growth, guidance and sperm delivery, which are considered the major hybridization controls in nature and thus also contribute to species isolation and speciation, have been intensively investigated. Despite this general interest, surprisingly little is known about these processes in the most important agronomic plant family, the Gramineae, Poaceae or grasses. Small polymorphic proteins and their receptors, degradation of sterility locus proteins and general compounds such as calcium, γ-aminobutyric acid or nitric oxide have been shown to be involved in progamic pollen germination, adhesion, tube growth and guidance, as well as sperm release. Most advances have been made in the Brassicaceae, Papaveraceae, Linderniaceae and Solanaceae families including their well-understood self-incompatibility (SI) systems. Grass species evolved similar mechanisms to control the penetration
Directory of Open Access Journals (Sweden)
Itayguara Ribeiro da Costa
2004-12-01
Full Text Available Este trabalho visa conhecer a composição e riqueza florística, os padrões fenológicos reprodutivos, as síndromes de dispersão e as formas de vida das espécies de uma disjunção de cerrado em clima semi-árido, na chapada do Araripe, Estado do Ceará. Foram encontradas 107 espécies e 41 famílias. Fabaceae, Myrtaceae, Poaceae, Apocynaceae, Euphorbiaceae e Malpighiaceae foram as mais ricas em espécies. Foi feita a distribuição geográfica de 47 espécies arbustivas e arbóreas em 27 listagens de cerrados brasileiros. Doze espécies apresentaram ampla distribuição geográfica e 13 foram registradas apenas neste trabalho. Cerca de 76% das espécies floresceram e frutificaram no período chuvoso. As síndromes de dispersão predominantes foram: zoocoria, autocoria e anemocoria. O espectro biológico foi predominantemente constituído por fanerófitos (50,7%, hemicriptófitos (14,9% e caméfitos (13,1%. O cerrado estudado apresentou menor riqueza taxonômica que os cerrados contínuos e comportamento das fenofases reprodutivas, percentagem de síndromes de dispersão e formas de vida similares.This study subject to investigate the floristic composition and richness, the reproductive phenological patterns, the dispersal syndromes and life forms of species of a disjunt cerrado in semiarid climate at Araripe plateau during a one year period. We found 107 species and 41 families. Fabaceae, Myrtaceae, Poaceae, Apocynaceae, Euphorbiaceae and Malpighiaceae showed the largest number of species. For 47 of the woody species found, we studied the geographical distribution based on 27 papers of the Brazilian cerrados. Twelve species are of widespread occurence in the cerrado, and 13 are restricted to the Araripe plateau. Zoocory, autocory, and anemocory are the predominant syndromes of dispersal. The predominant life forms were phanerophytes (50.7%, hemicriptophytes (14.9% and camephytes (13.1%. The cerrado of Araripe have lower species richness
Directory of Open Access Journals (Sweden)
Suharno Suharno
2015-03-01
Full Text Available ABSTRAK Daya dukung lingkungan (habitat sangat berpengaruh terhadap pemenuhan kebutuhan hidup manusia. Usaha domestikasi tumbuhan pokem (Setaria italica L. di Pulau Numfor Kabupaten Biak Numfor telah diusahakan sejak lama oleh masyarakat lokal. Tumbuhan yang termasuk kelompok rumput–rumputan (Familia: Poaceae telah dimanfaatkan sebagai bahan pangan lokal. Tujuan dari kajian ini adalah untuk mengetahui pemanfaatan dan proses budidaya yang dilakukan oleh masyarakat lokal di pulau Numfor sebagai upaya dalam memenuhi bahan pangan lokal. Hasil penelitian menunjukkan bahwa usaha budidaya pokem telah lama berlangsung secara turun–temurun sejak nenek moyang mereka tinggal di Pulau Numfor. Sistem budidaya yang mereka lakukan masih tergolong sederhana (konvensional. Masyarakat memanfaatkan lahan di sekitar kampung masing–masing karena mudah terjangkau. Sistem pertanian yang dilakukan masih dengan pola ladang berpindah. Kondisi sumber daya alam di wilayah pulau ini sangat terbatas. Kondisi tanah berkapur dan ketidaktersediaan tanaman sagu sebagaimana sumber bahan pangan utama orang Papua menyebabkan masyarakat berusaha menyediakan bahan pangan lokal, termasuk pokem. Nilai gizi biji tanaman ini cukup tinggi sehingga berpotensi untuk dikembangkan sebagai salah satu upaya dalam mengatasi ketahanan pangan nasional. ABSTRACT Carrying capacity of the habitat plays important role in the fulfillment of human needs. The effort of pokem plant {Setaria italica (L. Beauv} domestication in Numfor Island, Biak Numfor regency has been started by local communities since long time ago. The Plant grouping as grass (Family: Poaceae have been used as local foodstuff. The aim of the study is to know the usage and cultivation of the plant performed by local communities in Numfor Island in strugling of fulfilling local foodstuff. The result showed cultication of pokem has been done from one to other generation since their ancestors had arrived for the first time in the
Avaliação da Qualidade de Amostras de Plantas Medicinais Comercializadas no Brasil
Directory of Open Access Journals (Sweden)
Renato Pamplona Cardozo Costa
2014-08-01
Full Text Available Drogas vegetais constituem uma das matérias-primas utilizadas na fabricação de fitoterápicos, além de serem largamente utilizadas pela população como recurso terapêutico. O mercado de produtos derivados de matéria-prima vegetal, com isso, se tornou alvo de investimentos de empresas do setor farmacêutico. O presente trabalho objetivou verificar a qualidade de drogas vegetais comercializadas no mercado brasileiro, utilizando-se conjuntamente métodos de análise simples e de baixo custo.Para tanto , foram usadas amostras de “centela”, “chá verde” e “espinheira santa”, obtidas em estabelecimentos comerciais, sendo sua identidade e qualidade avaliadas por meio de análises anatômicas e microquímicas. O estudo anatômico demonstrou que as três amostras de centela continham Centella asiatica, estando algumas em mau estado de conservação. Os contaminantes desta amostra eram principalmente outras partes do corpo vegetativo de C. asiatica, além de folhas de Poaceae e de outras espécies vegetais. Duas amostras de chá verde foram identificadas como Camellia sinensis e apresentavam caules da mesma espécie como contaminantes. A terceira amostra de chá verde era constituída por Ilex paraguariensis, sendo que folhas de Bambusoideae (Poaceae também foram encontradas. Uma das amostras de espinheira santa era constituída de Sorocea bonplandii. As demais continham folhas e fragmentos de caule de Maytenus ilicifolia. As três amostras de centela apresentaram saponinas triterpênicas. Todas as amostras de chá verde possuíam metilxantinas. Dessas, apenas aquelas constituídas por C. sinensis demonstraram a presença de flavonoides. As amostras de espinheira-santa apresentaram taninos condensados. Desse modo, as metodologias propostas forneceram resultados complementares que podem ser empregados no controle de qualidade de drogas vegetais.
Schittek, K.; Forbriger, M.; Mächtle, B.; Schäbitz, F.; Wennrich, V.; Reindel, M.; Eitel, B.
2015-01-01
High-altitude peatlands of the Andes still remain relatively unexploited although they offer an excellent opportunity for well-dated palaeoenvironmental records. To improve knowledge about climatic and environmental changes in the western Andes of southern Peru, we present a high-resolution record of the Cerro Llamoca peatland for the last 8600 years. The 10.5 m long core consists of peat and intercalated sediment layers and was examined for all kinds of microfossils. We chose homogeneous peat sections for pollen analysis at decadal to centennial resolution. The inorganic geochemistry was analysed in 2 mm resolution (corresponding >2 years) using an ITRAX X-ray fluorescence core scanner. We interpret phases of relatively high abundances of Poaceae pollen in our record as an expansion of Andean grasslands during humid phases. Drier conditions are indicated by a significant decrease of Poaceae pollen and higher abundances of Asteraceae pollen. The results are substantiated by changes in arsenic contents and manganese/iron ratios, which turned out to be applicable proxies for in situ palaeoredox conditions. The mid-Holocene period of 8.6-5.6 ka is characterised by a series of episodic dry spells alternating with spells that are more humid. After a pronounced dry period at 4.6-4.2 ka, conditions generally shifted towards a more humid climate. We stress a humid/relatively stable interval between 1.8 and 1.2 ka, which coincides with the florescence of the Nasca culture in the Andean foothills. An abrupt turn to a sustained dry period occurs at 1.2 ka, which is contemporaneous with the demise of the Nasca/Wari society in the Palpa lowlands. Markedly drier conditions prevail until 0.75 ka, providing evidence of the presence of a Medieval Climate Anomaly. Moister but hydrologically highly variable conditions prevailed again after 0.75 ka, which allowed re-expansion of tussock grasses in the highlands, increased discharge into the Andean foreland and resettling of the
Directory of Open Access Journals (Sweden)
Sônia Maria Forti Broglio-Micheletti
2009-12-01
Full Text Available Extratos vegetais foram estudados com o objetivo de avaliar suas eficiências no controle de Rhipicephalus (Boophilus microplus (Canestrini, 1887 em laboratório. Fêmeas ingurgitadas de carrapato foram coletadas de bovinos e mantidas em placas de Petri. Foram utilizados extratos orgânicos alcoólicos 2% (peso/volume de sementes de Annona muricata L. (Annonaceae (graviola; flores de Syzygium malaccensis (L. (Myrtaceae (jambo; folhas de Cymbopogon citratus (DC. Stapf (Poaceae (capim-santo; folhas de Azadirachta indica A. Juss (Meliaceae (nim; e extrato hexânico na mesma concentração de A. indica (sementes. Os grupos-controle foram compostos por fêmeas sem tratamento e fêmeas tratadas com água destilada e esterilizada e dimetilsulfóxido (DMSO a uma concentração de 1%. O extrato de A. muricata apresentou o maior poder acaricida, com eficácia de 100%, seguido dos extratos de S. malaccensis (75 e 59,24% e A. indica (65 e 38,49%. Houve 100% de redução na eclosão das larvas quando se utilizou o extrato de sementes de A. muricata.Plant extracts were studied to evaluate its efficiency in the control of Rhipicephalus (Boophilus microplus (Canestrini, 1887 in laboratory. Engorged female ticks were collected from the cattle, kept in Petri dishes. Organic alcoholic extracts 2% (weight/volume were used: seeds of Annona muricata L. (Annonaceae (soursop; flowers of Syzygium malaccensis (L. (Myrtaceae (iamb, leaves of Cymbopogon citratus (DC. Stapf (Poaceae (holy grass, leaves of Azadirachta indica A. Juss (Meliaceae (neem and hexane extract 2% (weight/volume of A. indica (seeds. The control groups consisted of untreated females and females treated with distilled water and sterile and dimethylsulfoxide (DMSO a concentration of 1%. The extract of A. muricata (seed had the highest mortality with acaricide activity and 100% efficacy followed by extracts of S. malaccensis (75 and 59.24% and A. indica (65 and 38.49%. The seed extract of A. muricata
Directory of Open Access Journals (Sweden)
E.R. Lorenzetti
2012-01-01
Full Text Available Cymbopogon citratus (DC. Stapf é uma planta medicinal pertencente a família Poaceae, perene, importante para a indústria farmacêutica e alimentícia devido ao óleo essencial que produz. Um problema limitante para a produção comercial é a ferrugem, doença cujo agente etiológico é o fungo Puccinia nakanishikii Dietel. O presente trabalho objetivou avaliar a ação de produtos naturais no controle da doença in vitro e in vivo. Para os testes in vitro, empregaram-se os seguintes produtos sobre a germinação de esporos do patógeno: óleos essenciais de eucalipto, palma-rosa, cravo-da-índia, menta, limão, citronela e mil-folhas; extrato pirolenhoso de eucalipto e mentol cristalizado, em diferentes concentrações. Para os testes de campo foram selecionados quatro produtos, o óleo de citronela e de eucalipto, o extrato pirolenhoso, e o mentol. In vitro, todos os agentes mostraram-se promissores no controle do patógeno. Quando em condições in vivo, sob alta severidade da doença no ato da avaliação, os produtos testados foram capazes de reduzir a severidade da doença em comparação com a testemunha. O controle da doença com os agentes naturais variou de 38% (extrato pirolenhoso a 61%(óleo essencial de eucalipto.Cymbopogon citratus (DC. Stapf is a medicinal plant that belongs to the Poaceae family; it is perennial and important for the pharmaceutical and food industry due to the essential oil it produces. A limiting problem for commercial production is rust, a disease that has as etiological agent the fungus Puccinia nakanishikii Dietel. The present study aimed to evaluate the action of natural products on the disease control, in vitro and in vivo. For the in vitro tests, the following products were employed on the germination of the pathogen spores: essential oils from eucalyptus, palmarosa, clove, peppermint, lemon, citronella and yarrow, pyroligneous extract from eucalyptus, and crystallized menthol, at different
Holocene climate variability and oceanographic changes off western South Africa
Zhao, Xueqin; Dupont, Lydie; E Meadows, Michael; Schefuß, Enno; Bouimetarhan, Ilham; Wefer, Gerold
2017-04-01
South Africa is located at a critical transition zone between subtropical and warm-temperate climate zones influenced by the Indian and Atlantic oceans. Presently, the seasonal changes of atmospheric and oceanic systems induce a pronounced rainfall seasonality comprised of two different rainfall zones over South Africa. How did this seasonality develop during the Holocene? To obtain a better understanding of how South African climates have evolved during the Holocene, we conduct a comprehensive spatial-temporal approach including pollen and dinoflagellate cyst records from marine sediment samples retrieved from the Namaqualand mudbelt, a Holocene terrigenous mud deposit on the shelf of western South Africa. The representation of different vegetation communities in western South Africa is assessed through pollen analysis of surface sediments. This approach allows for climate reconstructions of the summer rainfall zone (SRZ) using Group 1 (Poaceae, Cyperaceae, Phragmites-type and Typha) and winter rainfall zone (WRZ) using Group 2 (Restionaceae, Ericaceae, Anthospermum, Stoebe/Elytropappus-type, Cliffortia, Passerina, Artemisia-type and Pentzia-type) from a single marine archive. The fossil pollen data from gravity core GeoB8331-4 indicate contrasting climate patterns in the SRZ and WRZ especially during the early and middle Holocene. The rainfall amount in the SRZ is dominated by insolation forcing, while in the WRZ it is mainly attributed to the latitudinal position of the southern westerlies. Dinoflagellate cyst data show significantly different oceanographic conditions associated with climate changes on land. High percentages of autotrophic taxa like Operculodinium centrocarpum and Spiniferites spp. indicate warm and stratified conditions during the early Holocene, suggesting reduced upwelling. In contrast, the middle Holocene is characterized by a strong increase in heterotrophic taxa in particular Lejeunecysta paratenella and Echinidinium spp., indicating cool
Directory of Open Access Journals (Sweden)
Maria Conceição de Souza
2003-04-01
Full Text Available Foi realizada uma caracterização botânica da lagoa Figueira (planície alagável do alto rio Paraná, Porto Rico, Estado do Paraná, Brasil, a 22o45’36’’S e 53ol5’56’’W, empregando-se levantamentos florísticos e perfis fitofisionômicos em diferentes períodos fluviométricos, além de uma carta batimétrica e análise do solo. O levantamento florístico resultou no reconhecimento de 36 famílias, 75 gêneros e 89 espécies. As famílias de maior riqueza específica foram Poaceae (14 espécies, seguida por Cyperaceae e Euphorbiaceae (oito cada. O porte predominante pertenceu ao herbáceo (79,78% das espécies e, quanto à forma biológica, houve predominância das terrestres (50,56% e das anfíbias (37,08%. A fitofisionomia, com predominância de herbáceas, apresenta diferenciações entre as margens e ao longo da lagoa, havendo uma considerável diminuição da cobertura vegetal no período de águas altas. Essa lagoa foi considerada um corpo de água raso, com solo tipo argilosoA botanical characterization of the Figueira pond (Upper Paraná River floodplain, in Porto Rico, State of Paraná, Brazil, at 22o45’36’’ S and 53ol5’56’’ W has been carried out using floristic surveys and phytophysiognomic profiles, in different water periods, together with a bathymetric chart and a soil analysis. The floristic survey resulted in 36 families, 75 genera and 89 species. The families with more specific richness were Poaceae (14 species, followed by Cyperaceae and Euphorbiaceae (eight each. The highest habit incidence belonged to the herbaceous (79,78% of the species and, concerning the biological form, there was predominance of the terrestrial (50,56% and amphibious ones (37,08%. The phytophysiognomy, with predominance of herbaceous, shows differentiation between the banks and along the pond, with a considerable decrease of the vegetal covering in the high water periods. This pond was considered a shallow body of water, with
Directory of Open Access Journals (Sweden)
Vali Joana Pott
1997-12-01
Full Text Available O Pantanal, por ser alagável, é ambiente favorável ao desenvolvimento de muitas plantas aquáticas. Para atender demandas de levantamentos florísticos regionais, fez-se a listagem das macrófitas aquáticas do Pantanal, com base em coletas depositadas nos Herbários CPAP (EMBRAPA, COR (Universidade Federal de Mato Grosso do Sul, CH (Universidade Federal de Mato Grosso e K (Kew. Até o momento, foram levantadas 242 espécies, distribuídas em 106 gêneros e 54 famílias. As famílias mais numerosas são Poaceae (22 espécies, Cyperaceae(17, Leguminosae e Scrophulariaceae(14, Alismataceae e Onagraceae(13, Pontederiaceae(11, Lentibulariaceae(10, Characeae(9, emnaceae, Malvaceae e Nymphaeaceae(8. A maioria das demais famílias apresentam uma ou duas espécies cada. Quanto à forma biológica, 39% são plantas emergentes, 28% anfíbias, 11,5% flutuantes fixas, 8% flutuantes livres, 8% submersas fixas, 3,8% submersas livres e 1,7% epífítas. Os principais gêneros em número de espécies são Nymphaea, Utricularia, Echinodorus, Ludwigia, Polygonum, Aeschynomene, Cyperus, Eleocharis e Bacopa.The Pantanal, being a wetland, is a favorable environment for the development of many aquatic plants. This list of aquatic macrophytes of the Pantanal was made based on field collections, deposited at Herbarium CPAP (EMBRAPA, COR (Universidade Federal de Mato Grosso do Sul, CH (Universidade Federal de Mato Grosso and K (Kew, to support regional floristic surveys. Until present, 242 species were listed, distributed within 106 genera and 54 families. The most numerous families were Poaceae (22 species Cyperaceae(17, Leguminosae and Scrophulariaceae(14, Alismataceae and Onagraceae(13, Pontederiaceae (11, Lentibulariaceae(10, Characeae(9, Lemnaceae, Malvaceae andNymphaeaceae(8. The majority of other families has one or two species each. The life form spectrum includes 39% emergent plants, 28% amphibious, 11,5% rooted floating, 8% free floating, 8% rooted submerged
Directory of Open Access Journals (Sweden)
Bidyut Jyoti Das
2014-12-01
Full Text Available Aim: The present investigation was carried out to evaluate the nutritive value of fodder in natural habitat, cultivated crops and their preference by wild Asian elephant (Elephas maximus in forest and non-forest areas in four seasons using field observation in Sonitpur District of Assam; since, there were frequent incidences of crop raiding by wild elephant leading to loss of property and human-elephant conflict. Materials and Methods: The study was conducted in four seasons. The study included forest areas of Sonai-Rupai Wildlife Sanctuary, part of Nameri National Park and high human-elephant conflicted areas of non-forest near to the sanctuary and parks. The consumed fodders were identified, collected and evaluated. The proximate composition was determined using AOAC (1990. Results: Total 39 different fodder species of 18 families including herbs, climber, grasses, paddy seeds, paddy saplings, plants and its leaves, bark, fruits, and roots were recorded to be utilized by elephants. The first three family of fodder that elephant relished more were Poaceae (46.15%, Musaceae (7.69% and Zingiberaceae (5.13% respectively. The crude protein content of fodder in all seasons, total ash content only in winter and post monsoon seasons and neutral detergent fiber content of fodder between forest and non-forest were significant (p<0.05. Elephants preferred to forage more on nutritionally rich fodder than poor natural fodder. Incidence of crop raiding was more in post monsoon season could be due to availability of nutritionally rich fodder than the poor natural fodder and generally happened in the night. Conclusions: The study revealed that during post monsoon season, there were abundant nutritionally rich sources of cultivated crops than the fodder of natural habitat that might provoke the wild elephants to raid crops. Poaceae shared a major portion of their diet. The findings will definitely help nutritionist, ecologist and policy makers to understand
Alien flora of Turkey: checklist, taxonomic composition and ecological attributes
Directory of Open Access Journals (Sweden)
Ahmet Uludag
2017-06-01
Full Text Available The paper provides an updated checklist of the alien flora of Turkey with information on its structure. The alien flora of Turkey comprises 340 taxa, among which there are 321 angiosperms, 17 gymnosperms and two ferns. Of the total number of taxa, 228 (68% are naturalized and 112 (32% are casual. There are 275 neophytes (172 naturalized and 103 casual and 61 archaeophytes (52 naturalized and 9 casual; four species could not be classified with respect to the residence time. In addition, 47 frequently planted taxa with a potential to escape are also listed. The richest families are Asteraceae (38 taxa, Poaceae (30, Fabaceae (23 and Solanaceae (22. As for the naturalized alien plants, the highest species richness is found in Asteraceae (31 taxa, Poaceae (22, Amaranthaceae (18 and Solanaceae (15. The majority of alien taxa are perennial (63.8% of the total number of taxa with this life history assigned, including those with multiple life histories, annuals contribute 33.8% and 2.4% are biennial aliens. Among perennials the most common life forms are phanerophytes, of which 20.3% are trees and 12.6% shrubs; woody vines, stem succulents, and aquatic plants are comparatively less represented. Most of the 340 alien taxa introduced to Turkey have their native ranges in Americas (44.7% and Asia (27.6%. Of other regions, 9.1% originated in Africa, 4.4% in Eurasia, 3.8% in Australia and Oceania and 3.5% in the Mediterranean. The majority of taxa (71.9% were introduced intentionally, whereas the remaining (28.1% were introduced accidentally. Among the taxa introduced intentionally, the vast majority are ornamental plants (55.2%, 10.0% taxa were introduced for forestry and 6.7% as crops. Casual alien plants are most commonly found in urban and ruderal habitats (40.1% where naturalized taxa are also often recorded (27.3%. Plants that occur as agricultural weeds are typically naturalized rather than casual (16.0% vs 7.1%, respectively. However, (seminatural
Agbodeka, Kodjovi; Gbekley, Holaly E; Karou, Simplice D; Anani, Kokou; Agbonon, Amegnona; Tchacondo, Tchadjobo; Batawila, Komlan; Simpore, Jacques; Gbeassor, Messanvi
2016-03-01
In Togo, malaria constitutes a major public health problem but, until now, the population still mostly relies on herbal medicine for healing. This study aimed to document medicinal plants used for malaria therapy in the Plateau region of the country. Semi-structured questionnaire interviews were used to gather ethnobotanical and sociodemographic data from traditional healers of the study area. A total of 61 plants species belonging to 33 families were found to be in use for malaria therapy in the Plateau region. Caesalpiniaceae were the most represented family with 7 species, followed by Euphorbiaceae and Poaceae with 4 species each. According to the relative frequency of citation (RFC), Newbouldia laevis Seem. (RFC =0.52), Sarcocephalus latifolius (Sm.) E.A. Bruce (RFC =0.48), Acanthospermum hispidum DC. (RFC =0.43), and Senna siamea (Lam.) H.S. Irwin and Barneby (RFC =0.40) were the most cited in the treatment of malaria in the traditional medicine in the Plateau region. The parts of plants used could either be the barks, roots, leaves, or whole plants. The recipes also could be a combination of various species of plants or plant parts. This study highlights the potential sources for the development of new antimalarial drugs from indigenous medicinal plants found in the Plateau region of Togo. Such results could be a starting point for in vitro antimalarial screenings. 61 plants species from 33 families are use for malaria therapy in the Plateau region of TogoThe main families are Caesalpiniaceae Euphorbiaceae and PoaceaeThe most used species are Newbouldia laevis Seem. (RFC = 0.52), Sarcocephalus latifolius (Sm.) E.A. Bruce (RFC = 0.48), Acanthospermum hispidum DC. (RFC = 0.43), and Senna siamea (Lam.) H.S. Irwin and Barneby (RFC = 0.40) Abbreviations Used: RFC: Relative frequency of citation, FC: Frequency of citation, Dec: Decoction, Orl: Oral route, Mac: Maceration, Jui: Juice, Inf: Infusion, Sau: Sauce, Kne: Kneading, Le: Leaves, Rt: Roots, Wp: Whole plant
Directory of Open Access Journals (Sweden)
Alexandre Magno Brighenti
2003-05-01
Full Text Available O objetivo deste trabalho foi realizar um levantamento das plantas daninhas infestantes na précolheita da cultura de girassol em lavouras dos municípios do sudoeste goiano (Chapadão do Céu, Jataí e Montividiu e em Chapadão do Sul, MS. Foram amostradas, no período de maio a junho de 2002, 51 propriedades dos quatro municípios, totalizando uma área de 583 m². As espécies daninhas foram identificadas e contadas mediante a aplicação de um quadrado de 1,0x1,0 m, colocado ao acaso dentro da área ocupada pelas lavouras. Foram obtidos os valores de freqüência, densidade, abundância e índice de importância relativa. Plantas voluntárias de soja e de milho fazem parte da flora daninha infestante de lavouras de girassol dessa região. As famílias Poaceae, Asteraceae e Euphorbiaceae são as que apresentam maior número de espécies. As principais plantas daninhas infestantes na região são, em ordem decrescente, Ageratum conyzoides, Chamaesyce hirta, Cenchrus echinatus, Bidens sp., Euphorbia heterophylla e Commelina benghalensis.The objective of this work was to survey the weeds in the preharvest of the sunflower crop in growers field of the southwest regions of Goiás State (Chapadão do Céu, Jataí and Montividiu and Chapadão do Sul, Mato Grosso do Sul State, Brazil. Fifty one farms were evaluated, during the period of May to June, 2002, in a total of 583 m² of area. The weeds were identified and counted inside a square (1.0x1.0 m, applied in each area, in order to determine the frequency, density, abundance and relative importance. Volunteer soybean (Glycine max and corn (Zea mays are part of the weed species in sunflower crop in the area. The botanical families Poaceae, Asteraceae and Euphorbiaceae present larger number of species. The main weeds found in the area are, in decreasing order, Ageratum conyzoides, Chamaesyce hirta, Cenchrus echinatus, Bidens sp., Euphorbia heterophylla and Commelina benghalensis.
Directory of Open Access Journals (Sweden)
Eduardo Méndez
2009-07-01
Full Text Available La biodiversidad de la flora de la vertiente oriental del Cordón del Plata, Luján de Cuyo, Mendoza, Argentina se analizó a lo largo de un gradiente altitudinal, entre los 1200 y 4500 m s.n.m. Para ello se utilizó la lista florística de las especies de 89 comunidades vegetales distribuidas en 14 unidades de vegetación, 5 pisos de vegetación y 3 unidades fitogeográficas. Para cada especie se consideró su distribución en los grupos de comunidades vegetales, ubicación fitogeográfica, formas de vida, origen y registro de colección. La flora examinada contiene 667 especies vegetales que se corresponden con 338 géneros y 82 familias. Las familias están representadas por 8 Pteridophyta, 1 Gymnospermae y 73 Angiospermae, con 12 Monocotyledoneae y 61 Dicotyledoneae. Las familias mejor representadas son Asteraceae y Poaceae que tienen en conjunto 110 géneros y 249 especies. Los géneros Senecio, Baccharis y Adesmia son los más ricos en especies. Aproximadamente el 20 % de las especies son endémicas de Argentina. La flora del área se la compara con la del país, la provincia y la de otras áreas.Floristic catalogue. The floristic biodiversity of the eastern slope of the Cordón del Plata, Luján de Cuyo, Mendoza, Argentina, was studied along an altitudinal gradient, between 1200 and 4500 m a.s.l. For this we used a floristic list of 89 plant communities, distributed in 14 vegetation types, 5 vegetation belts and 3 phytogeographic units. For each of the species, its distribution in the groups of plant communities, phytogeographic position, life form, biogeographical origin, and registration of each collection was considered. The studied flora has 667 species, corresponding to 338 genera and 82 families. There are 8 Pteridophyta, 1 Gymnospermae, and 73 Angiospermae, of which 12 are Monocotyledons and 61 Dicotyledons. The most represented families are Asteraceae and Poaceae, which in total have 110 genera and 249 species. The most species
Directory of Open Access Journals (Sweden)
Marco Antônio Batalha
2001-12-01
Full Text Available We studied a 1225 ha area, composed mainly of cerrado, in Santa Rita do Passa Quatro, São Paulo State, southeastern Brazil (21°36-38'S, 47°36-39'W. In three cerrado physiognomies (campo cerrado -- a wooded savanna, cerrado sensu stricto -- a woodland, and cerradão -- a tall woodland, we collected all vascular plants in reproductive stage, and identified them to species level. We found 360 species, representing 236 genera and 69 families. The richest families were: Asteraceae, Fabaceae, Poaceae, and Rubiaceae. The savanna physiognomies were richer than the forest one. The ratio between herbaceous and woody species was approximately 2:1. We analysed the whole flora and its two components separately, woody and herbaceous, comparing them with other disjunct cerrado areas. We obtained similarity values (Sørensen index from 0.47 to 0.81, which showed that the 3 diversity of the cerrado was higher in the herbaceous component than in the woody one.Estudamos uma área de 1225 ha, composta principalmente por cerrado, situada em Santa Rita do Passa Quatro, estado de São Paulo (21°36-38'S, 47°36-39'W. Em três fisionomias de cerrado (campo cerrado, cerrado sensu stricto e cerradão, coletamos, durante 18 meses, em excursões mensais, espécimes em fase fértil e os identificamos em nível específico. Encontramos 360 espécies, pertencentes a 236 gêneros e 69 famílias. As fam��lias mais ricas foram: Fabaceae, Asteraceae, Poaceae e Rubiaceae. As fisionomias savânicas foram mais ricas do que a florestal. A razão entre espécies arbustivo-arbóreas e herbáceo-subarbustivas foi de aproximadamente 2:1. Analisamos a flora como um todo e seus componentes herbáceo-subarbustivo e arbustivo-arbóreo separadamente, comparando-os com outras áreas disjuntas de cerrado. Dessa comparação, obtivemos valores de similaridade (índice de Sørensen de 0,47 a 0,81, que mostraram que a diversidade 3 foi maior no componente herbáceo-subarbustivo do que no
Directory of Open Access Journals (Sweden)
Geraldo Tadeu dos Santos
2001-05-01
Full Text Available O objetivo do trabalho foi avaliar o efeito de diferentes alturas (24; 26; 43; 45; 52; 62; 73 e 78 cm do pasto sobre a qualidade de forragem e estrutura do perfil do capim-Tanzânia, (Panicum maximum Jacq. cv. Tanzânia – 1 (Poaceae. Foram utilizados novilhos da raça Nelore sob pastejo com carga animal variável, por meio da técnica put and take. O delineamento experimental utilizado foi inteiramente casualizado, com duas repetições. A densidade de matéria seca total (DMT aumentou com o avanço no período experimental, enquanto a densidade de matéria seca de lâminas (DML não foi influenciada pelo período e pela altura do pasto. O estrato superior da pastagem foi a porção de maior qualidade, apresentando maior DML e maior teor de PB. Os estratos inferiores apresentaram menor qualidade, devido à maior DMT e menor DML, acarretando em maiores valores de FDA e FDN e menores teores de PB. O conteúdo de minerais das lâminas foi superior aos colmos, mantendo-se inalterado com relação aos estratos da pastagem.The effect of different sward heights (24; 26; 43; 45; 52; 62; 73 and 78 cm on forage quality and profile structure Tanzania grass, Panicum maximum Jacq. cv. Tanzania – 1 (Poaceae is provided. Nelore steers were used in grazing at variable stocking rates with put and take technique. The experimental design was completely randomized, with two replications. Total dry matter bulk densitity (TDMD increased during experimental period, while the leaf blade dry matter bulk density (LDMD was not influenced by period on by sward height. The upper layers had the best quality with higher LDMD and CP levels. Lower layers had the worst quality, due the higher TDMD and lower LDMD. This fact caused higher ADF and NDF levels and lower CP levels. Leaf blade mineral content was higher than that of stem, and remained unaltered in relation to the different layers.
Directory of Open Access Journals (Sweden)
Geane Dias Gonçalves
2001-05-01
Full Text Available O experimento teve por objetivo avaliar a desidratação de cultivares de Cynodon spp. (Poaceae durante o processo de fenação. Foram realizadas amostragens nos tempos zero (momento do corte, 3, 6, 21, 24, 27 e 30 horas após o corte, a fim de se determinar a curva de desidratação e os teores de proteína bruta (PB da planta inteira e das frações folhas e colmos. Determinou-se também a espessura dos colmos de cada cultivar. Utilizou-se o delineamento experimental em blocos completamente casualizados em esquema fatorial 3x7 (cultivares x tempos de amostragens, com três repetições. A velocidade de perda de água foi semelhante para os cultivares avaliados, tanto para a planta como para as frações colmos e folhas. Não houve efeito para os teores de PB com o avanço nos tempos de secagem. Porém, houve diferença para a relação L/C, onde o Tifton 85 apresentou maior valor. Já para o diâmetro do colmo, o Tifton 44 foi superior em relação aos demais cultivares.Dehydration of cultivars of the genus Cynodon (Poaceae and the possible variations of chemical composition of forages during the haymaking process were evaluated. Three cultivars of Cynodon, Tifton 85, Coast cross and Tifton 44 were used, in plots of 15 m2, with three randomized blocks. Samples at 0 (cutting time, 3, 6, 21, 24, 27 and 30 hours after cutting were taken to determine the dehydration curve of whole plant, leaves and stem. Speed in water loss in plant, leaves and stem segments was similar in all cultivars. Drying did not affect CP taxes. There was, however, a difference for the leaves/stem relationship in which Tifton 85 had the highest value. Tifton 44 was higher in the other cultivars with regard to stem diameter.
Directory of Open Access Journals (Sweden)
MC. Souza
2009-06-01
Full Text Available The purpose of this study was to update the floristic inventory found in the Upper Paraná River floodplain. Floristic surveys were performed from February 2000 through March 2008, as part of the Brazilian Long-Term Ecological Research Program (PELD/CNPq -Site 6. The material collected was identified from 774 species, 442 genera, and 116 families. The ten families with high species richness were Leguminosae, Poaceae, Rubiaceae, Asteraceae, Euphorbiaceae, Myrtaceae, Cyperaceae, Solanaceae, Sapindaceae, and Orchidaceae, which contributed to 46.1% of the total number of species. Genera with high richness were Solanum, Cyperus, Panicum, Eugenia, Tillandsia, Serjania, Casearia, and Polygonum, which together contributed to 10.2% of the total number of species. These data, combined with information published in 1997, recorded 955 species, 575 genera, and 128 families. These organisms were from several riparian environments and were distributed as herbs, shrubs, trees, climbers and epiphytes. Panicum maximum, Pennisetum purpureum, Ricinus communis, and Urochloa decumbens are considered weeds due to the wide distributions determined for these species. The results presented herein suggest the need to further investigate the control of these potential weed species.Com o objetivo de ampliar os conhecimentos sobre a flora da planície de inundação do Alto Rio Paraná, foram conduzidos inventários florísticos no período de fevereiro de 2000 a março de 2008, incluídos no Programa Brasileiro de Pesquisas Ecológicas de Longa Duração (PELD/CNPq - Sítio 6. O material coletado foi identificado em 774 espécies, 442 gêneros e 116 famílias. As dez famílias de maior riqueza de espécies foram Leguminosae, Poaceae, Rubiaceae, Asteraceae, Euphorbiaceae, Myrtaceae, Cyperaceae, Solanaceae, Sapindaceae e Orchidaceae, que juntas reuniram 46,1% do total do número de espécies. Os gêneros com maior riqueza de espécies foram Solanum, Cyperus, Panicum, Eugenia
[Sensitization to Castanea sativa pollen and pollinosis in northern Extremadura (Spain)].
Cosmes Martín, P M; Moreno Ancillo, A; Domínguez Noche, C; Gutiérrez Vivas, A; Belmonte Soler, J; Roure Nolla, J M
2005-01-01
Castanea sativa pollen allergy has generally been considered to be uncommon and clinically insignificant. In our geographical area (Plasencia, Cáceres, Spain) Castanea sativa pollen is a major pollen. To determine the atmospheric fluctuations and prevalence of patients sensitized to Castanea pollen in our region and to compare this sensitization with sensitizations to other pollens. Patients with respiratory symptoms attending our outpatient clinic for the first time in 2003 were studied. The patients underwent skin prick tests with commercial extracts of a battery of inhalants including Castanea sativa pollen. Serologic specific IgE to Castanea sativa pollen was determined using the CAP system (Pharmacia and Upjohn, Uppsala, Sweden). Airborne pollen counts in our city were obtained using Cour collection apparatus over a 4-year period (2000 to 2003). The most predominant pollens detected were (mean of the maximal weekly concentrations over 4 years in pollen grains/m3): Quercus 968, Poacea 660, Olea 325, Platanus 229, Pinus 126, Cupresaceae 117, Plantago 109, Alnus 41, Populus 40, Castanea 32. We studied 346 patients (mean age: 24.1 years). In 210 patients with a diagnosis of pollinosis, the percentages of sensitization were: Dactylis glomerata 80.4%, Olea europea 71.9%, Fraxinus excelsior 68%, Plantago lanceolata 62.8%, Chenopodium album 60.9%, Robinia pseudoacacia 49%, Artemisia vulgaris 43.8%, Platanus acerifolia 36.6%, Parietaria judaica 36.1%, Populus nigra 32.3%, Betula alba 27.6%, Quercus ilex 21.4%, Alnus glutinosa 20.9%, Cupressus arizonica 7.6% and Castanea sativa 7.1%. Fifteen patients were sensitized to Castanea sativa and 14 had seasonal rhinoconjunctivitis and asthma. Ten patients had serum specific IgE to Castanea pollen (maximum value: 17.4 Ku/l). Castanea pollen is present in our area in large amounts from the 23rd to the 28th weeks of the year, with a peak pollen count in the 25th week. The most important allergenic pollens in northern Extremadura
Directory of Open Access Journals (Sweden)
Maria Rosangela Malheiros Silva
2009-01-01
Full Text Available Os experimentos foram desenvolvidos nos anos agrícolas 2003/2004 e 2004/2005, em área experimental da Universidade Estadual Paulista, Campus de Jaboticabal (SP, com o objetivo de se determinarem os períodos de interferência das plantas daninhas na cultura do arroz de terras altas, cultivar Caiapó. O delineamento experimental foi em blocos ao acaso com quatro repetições e 16 tratamentos. Os tratamentos foram constituídos por períodos crescentes de controle ou de convivência das plantas daninhas após a emergência da cultura: 0-10, 0-20, 0-30, 0-40, 0-50, 0-60, 0-70 dias e 0-colheita. Nos dois anos, as famílias predominantes eram Poaceae, Asteraceae, Amaranthaceae e Malvaceae e as principais plantas daninhas presentes foram: Cyperus rotundus L., Cenchrus echinatus L., Digitaria spp Heist., Echinochloa crus-galli (L. P. Beauv., Brachiaria decumbens Stapf., Eleusine indica Gaertn e Alternanthera tenella Colla. A cultivar de arroz de terras altas Caiapó deve ser mantida sem plantas daninhas nos 30 dias após a emergência.The experiments were carried out in two growing seasons (2003/04 and 2004/05 in an experimental area at São Paulo State University - UNESP, Jaboticabal Campus, to evaluate the weed interference periods on the upland Caiapó rice variety. The experimental design was randomized blocks with 4 replicates and 16 treatments. The treatments consisted of increasing periods of control or coexistence after emergence of the culture: 0-10; 0-20; 0-30; 0-40; 0-50; 0-60; 0-70 days; 0-harvest. The predominant families were Poaceae, Asteraceae, Amaranthaceae and Malvaceae, and the main weeds present were Cyperus rotundus L., Cenchrus echinatus L., Digitaria spp Heist., Echinochloa crus-galli (L. P. Beauv., Brachiaria decumbens Stapf., Eleusine indica Gaertn e Alternanthera tenella Colla for both years. The upland rice cultivar Caiapó is to be kept free of weeds for 30 days after emergence.
Directory of Open Access Journals (Sweden)
Marta Rodrigues Pacheco
2009-10-01
Full Text Available O pólen de algumas espécies de Stryphnodendron (Mimosoidea, conhecidas popularmente por barbatimão, tem sido apontado como agente causador da mortandade de larvas pré-pupas observada na cria ensacada brasileira (CEB. Neste estudo, objetivou-se identificar os tipos polínicos encontrados em amostras de pólen coletadas em colméias de Apis mellifera L., no Estado do Rio de Janeiro, a fim de elucidar as fontes florais utilizadas por essa espécie de abelhas em períodos sujeitos a CEB, com especial atenção para a presença do pólen de Stryphnodendron spp. Foram coletadas amostras de pólen apícola e pão de abelhas em sete apiários, em três municípios do Estado do Rio de Janeiro. A amostragem foi tomada um mês antes e durante a ocorrência da CEB. As famílias botânicas mais representativas foram: Leguminosae, Euphorbiaceae, Asteraceae, Poaceae e Myrtaceae. O pólen de Stryphnodendron não esteve presente nas amostras analisadas. A ausência de Stryphnodendron no menu floral das colônias africanizadas acometidas pela CEB em condições naturais sugere outro fator causal para a CEB no Estado do Rio de Janeiro.The pollen of some Stryphnodendron species (Mimosoidea, commonly known as barbatimão, has been identified as a causative agent of pre-pulps larvae mortality, observed in Brazilian sac brood disease (BSB. The goal of this study is to identify the pollen types found in samples of pollen collected by Apis mellifera L. to elucidate the floral diet used by this honeybee specie in Rio de Janeiro state during the periods where BSB usually occurs. Particular attention was given to the pollen of Stryphnodendron spp presence. Samples of pollen and bee bread were collected from seven apiaries located in Rio de Janeiro state, Brazil. Sampling procedures were done a month before BSB usual occurrence and also during its occurrence. Leguminosae, Euphorbiaceae, Asteraceae, Poaceae and Myrtaceae were most representative botanical families on
Presencia y distribución de micofilas en gramíneas de Argentina
Directory of Open Access Journals (Sweden)
Lugo, Mónica A.
1998-06-01
Full Text Available The mycophyllas were studied in grasses (Poaceae from natural Argentinian grasslands. Festuca fiebrigii Pilg., F. hieronymi Hack. var. expansa (St. Yves Türpe, F. parodii St. Yves, Melica macra Nees, M. stuckertii Hack., Poa hieronymi Hack.. P. holciformis J. Presl, P. lilloi Hack., P. plicata Hack, and P. stuckertii (Hack. Parodi are reponed as new hosts and the distribution área of the association for Festuca arundinacea Schreb., F. hieronymi Hack, var. hieronymi and F. tucumanica E.B. Alexeev, has been extended. The interaction was a mutualistic symbiosis. Most of the species had both the culm parenchyma and the fruits colonized, except in Melica macra. Poa hieronymi and P. plicata, where the symbiont was only observed in the parenchyma. On the other hand, variation in the association was observed in relation to the host species, location and altitude.Se realiza un estudio de las micofilas encontradas en gramíneas (Poaceae de pastizales naturales de Argentina. La búsqueda del simbionte fúngico se efectuó en plantas vivas y herborizadas. Se dan a conocer como nuevos hospedantes a Festucafiebrigii Pilg., F. hieronymi Hack, var. expanda (St. Yves Türpe, F. parodii St. Yves, Melica macra Nees, M. stuckertii Hack., Poa hieronymi Hack., P. holciformis J. Presl, P. lilloi Hack., P. plicata Hack, y P. stuckertii (Hack. Parodi, y se amplía el área de distribución de la asociación para Festuca arundinacea Schreb., F. hieronymi Hack. var. hieronymi y F. tucumanica E.B. Alexeev. El tipo de interacción observada corresponde a una simbiosis mutualista. En la mayoría de las especies analizadas el endófito colonizó el parenquima de las cañas y los frutos, salvo en Melica macra. Poa hieronymi y P. alicata, en las que solo se observó en el parenquima. Por otro lado, la presencia de micofilas presentó variaciones con relación a la especie del hospedante, altitud y localidad de procedencia.
A late Holocene pollen record from proglacial Oblong Tarn, Mount Kenya.
Directory of Open Access Journals (Sweden)
Colin J Courtney Mustaphi
Full Text Available High-elevation ecosystems, such as those on Mount Kenya are undergoing significant changes, with accelerated glacial ice losses over the twentieth century creating new space for alpine plants to establish. These ecosystems respond rapidly to climatic variability and within decades of glacial retreat, Afroalpine pioneering taxa stabilize barren land and facilitate soil development, promoting complex patches of alpine vegetation. Periglacial lake sediment records can be used to examine centennial and millennial scale variations in alpine and montane vegetation compositions. Here we present a 5300-year composite pollen record from an alpine tarn (4370 m asl in the Hausberg Valley of Mount Kenya. Overall, the record shows little apparent variation in the pollen assemblage through time with abundant montane forest taxa derived and transported from mid elevations, notably high abundances of aerophilous Podocarpus pollen. Afroalpine taxa included Alchemilla, Helichrysum and Dendrosenecio-type, reflecting local vegetation cover. Pollen from the ericaceous zone was present throughout the record and Poaceae percentages were high, similar to other high elevation pollen records from eastern Africa. The Oblong Tarn record pollen assemblage composition and abundances of Podocarpus and Poaceae since the late Holocene (~4000 cal yr BP-present are similar to pollen records from mid-to-high elevation sites of nearby high mountains such as Mount Elgon and Kilimanjaro. These results suggest a significant amount of uphill pollen transport with only minor apparent variation in local taxa. Slight decreasing trends in alpine and ericaceous taxonomic groups show a long-term response to global late Holocene cooling and a step decrease in rate of change estimated from the pollen assemblages at 3100 cal yr BP in response to regional hydroclimatic variability. Changes in the principal component axis scores of the pollen assemblage were coherent with an independent mid
Directory of Open Access Journals (Sweden)
P.F Souza
2011-12-01
Full Text Available Neste trabalho é apresentada a composição florística e estrutural de ilhas de vegetação de um inselberg do Vale do Moxuara, localizado no município de Cariacica-Espírito Santo, onde avaliou-se a riqueza das ilhas de vegetação está relacionada com seu tamanho e com a profundidade do solo. Foram avaliadas 45 ilhas de vegetação para estimativa dos parâmetros fitossociológicos necessários às análises. Foram encontradas 53 espécies de plantas vasculares, pertencentes a 24 famílias e 48 gêneros. As famílias com maior representatividade foram Poaceae, com sete espécies, seguida de Asteraceae, Malvaceae e Fabaceae, com seis espécies cada. Plantas daninhas representaram 39,6% da flora inventariada e 25,5% da cobertura vegetal das ilhas. As espécies com maior frequência e cobertura relativa foram Selaginella convoluta e Anemia tomentosa. A regressão múltipla não se mostrou significativa, o que foi discutido considerando o papel inibidor de espécies daninhas.This study presents the floristic and structural composition of vegetation islands of an inselberg in Vale do Moxuara, in Cariacica-ES, to evaluate whether the islands' richness is related to their size and soil depth. A total of 45 vegetation islands were evaluated by estimating the phytosociological parameters needed for the analysis. Fifty-three vascular plant species of twenty-four families and forty-eight genders were found. The most outstanding families were Poaceae, with seven species, followed by Malvaceae and Fabaceae, with six species each. Weeds represented 39.6% of all flora listed and 25.5% of the islands' vegetation cover. Selaginella convoluta and Anemia tomentosa had the most frequency and relative cover. Multiple regression was not significant, considering the inhibiting role played by the weed species.
Directory of Open Access Journals (Sweden)
Marcelo P. Hernández
2011-07-01
Full Text Available El trabajo da a conocer de manera comparativa, el recurso fitoterapéutico utilizado por los habitantes de dos sectores de la ribera rioplatense, uno continental, ubicado en las localidades de Palo Blanco y Los Talas denominado "Monte" y, otro insular, representado por la isla Paulino, ambos situados al noreste del partido de Berisso, provincia de Buenos Aires, Argentina. El objetivo es analizar comparativamente el comportamiento de los habitantes en el uso de las plantas medicinales en relación con el ambiente en que se encuentran situadas las unidades domésticas. Los resultados demostraron que existen diferencias atribuibles a factores tradicionales, estructurales y ambientales que conducen a un mayor conocimiento y uso de plantas para tratar afecciones de la piel, reumatismo, artritis y asma en la zona insular, mientras que en la zona continental, se destaca el uso de plantas para tratar parasitosis y problemas de las vías respiratorias. De un total de 61 especies, se destaca el uso de Aloe vera (L. Burm f. (Asphodelaceae, Cortaderia selloana (Schult. & Schult. f. Asch. & Graebn. (Poaceae y Equisetum giganteum L. (Equisetaceae, así como el uso del liquen Ramalina celastri (Spreng. Krog & Swinscow en la Isla Paulino.