2002-01-01
Heron Island is located at the sourthern end of Australia's 2,050 km-long Great Barrier Reef. Surrounded by coral reef and home to over 1000 species of fish, scuba divers and scientists alike are drawn to the island's resort and research station. The true-color image above was taken by Space Imaging's Ikonos satellite with a resolution of 4 meters per pixel-high enough to see individual boats tied up at the small marina. The narrow channel leading from the marina to the ocean was blasted and dredged decades ago, before the island became a national park. Since then the Australian government has implemented conservation measures, such as limiting the number of tourists and removing or recycling, instead of incinerating, all trash. One of the applications of remote sensing data from Ikonos is environmental monitoring, including studies of coral reef health. For more information about the island, read Heron Island. Image by Robert Simmon, based on data copyright Space Imaging
Díez, Beatriz; Bauer, Karolina; Bergman, Birgitta
2007-01-01
The diversity and nitrogenase activity of epilithic marine microbes in a Holocene beach rock (Heron Island, Great Barrier Reef, Australia) with a proposed biological calcification “microbialite” origin were examined. Partial 16S rRNA gene sequences from the dominant mat (a coherent and layered pink-pigmented community spread over the beach rock) and biofilms (nonstratified, differently pigmented microbial communities of small shallow depressions) were retrieved using denaturing gradient gel electrophoresis (DGGE), and a clone library was retrieved from the dominant mat. The 16S rRNA gene sequences and morphological analyses revealed heterogeneity in the cyanobacterial distribution patterns. The nonheterocystous filamentous genus Blennothrix sp., phylogenetically related to Lyngbya, dominated the mat together with unidentified nonheterocystous filaments of members of the Pseudanabaenaceae and the unicellular genus Chroococcidiopsis. The dominance and three-dimensional intertwined distribution of these organisms were confirmed by nonintrusive scanning microscopy. In contrast, the less pronounced biofilms were dominated by the heterocystous cyanobacterial genus Calothrix, two unicellular Entophysalis morphotypes, Lyngbya spp., and members of the Pseudanabaenaceae family. Cytophaga-Flavobacterium-Bacteroides and Alphaproteobacteria phylotypes were also retrieved from the beach rock. The microbial diversity of the dominant mat was accompanied by high nocturnal nitrogenase activities (as determined by in situ acetylene reduction assays). A new DGGE nifH gene optimization approach for cyanobacterial nitrogen fixers showed that the sequences retrieved from the dominant mat were related to nonheterocystous uncultured cyanobacterial phylotypes, only distantly related to sequences of nitrogen-fixing cultured cyanobacteria. These data stress the occurrence and importance of nonheterocystous epilithic cyanobacteria, and it is hypothesized that such epilithic cyanobacteria
Energy Technology Data Exchange (ETDEWEB)
Thomas, C.M.; Anthony, R.G.
1999-12-01
Great blue heron (Ardea herodias) eggs and prey items were collected from six colonies in Oregon and Washington, USA, during 1994 to 1995. Contaminant concentrations, reproductive success, and biomagnification factors were determined and effects of residue levels were measured by H4IIE rat hepatoma bioassays. Mean residue concentrations in heron eggs and prey items were generally low. However, elevated concentrations of polychlorinated biphenyls (PCBs) were detected in eggs and prey from Ross Island on the Willamette River. Biomagnification factors varied among sites. Sites were not significantly different in H4IIE tetrachlorodibenzo-p-dioxin equivalents (TCDD-EQs), although the TCDD-EQ for Karlson Island was 9 to 20 times greater than that of any other site. Large differences existed between toxic equivalents calculated from egg residue concentrations and TCDD-EQs, which indicated nonadditive interactions among the compounds. Tetrachlorodibenzo-p-dioxin equivalents and nest failure were positively correlated with TCDD concentration. Fledging and reproductive rates were similar to those determined for healthy heron populations, however, indicating that any adverse effects were occurring at the individual level and not at the colony level. Their results support the use of great blue herons as a biomonitor for contamination in aquatic ecosystems. Their relatively low sensitivity to organochlorine contaminants and high trophic position allows contaminant accumulation and biomagnification without immediate adverse effects that are often seen in other, more sensitive species.
Spatiotemporal patterns of coral disease prevalence on Heron Island, Great Barrier Reef, Australia
Haapkylä, J.; Melbourne-Thomas, J.; Flavell, M.; Willis, B. L.
2010-12-01
Despite increasing research effort on coral diseases, little is known about factors driving disease dynamics on the Great Barrier Reef (GBR). This is the first study to investigate the temporal patterns of coral disease prevalence and potential drivers of disease around Heron Island, in the southern Capricorn Bunker sector of the GBR. Surveys were conducted in two austral summers and three winters between November 2007 and August 2009 on six sites around the island. Six diseases were detected: brown band syndrome (BrB), growth anomalies (GA), ulcerative white spots (UWS), white syndrome (WS), skeletal eroding band disease (SEB) and black band disease (BBD). The lowest overall mean disease prevalence was 1.87 ± 0.75% (mean ± SE) in November 2007 and the highest 4.22 ± 1.72% in August 2008. There was evidence of seasonality for two diseases: BrB and UWS. This is the first study to report a higher prevalence of BrB in the winter. BrB had a prevalence of 3.29 ± 0.58% in August 2008 and 1.53 ± 0.28% in August 2009, while UWS was the most common syndrome in the summer with a prevalence of 1.12 ± 0.31% in November 2007 and 2.67 ± 0.52% prevalence in January 2008. The prevalence of GAs and SEB did not depend on the season, although the prevalence of GAs increased throughout the study period. WS had a slightly higher prevalence in the summer, but its overall prevalence was low (disease prevalence (12% of Acropora and 3.3% of Montipora species were diseased respectively). These results highlight the correlations between coral disease prevalence, seasonally varying environmental parameters and coral community composition. Given that diseases are likely to reduce the resilience of corals, seasonal patterns in disease prevalence deserve further research.
Chondrosarcoma in a wild great white heron from southern Florida.
Spalding, M G; Woodard, J C
1992-01-01
A typical chondrosarcoma is reported from the nictitating membrane of a great white heron (Ardea herodius occidentalis). This is the first report of a neoplasm in a free flying ciconiiform, and was the only one found in a survey of 957 carcasses from Florida.
DEFF Research Database (Denmark)
Santos, Isaac R.; Glud, Ronnie N.; Maher, Damien
2011-01-01
Little is known about how biogeochemical processes in permeable sediments affect the pH of coastal waters. We demonstrate that seawater recirculation in permeable sands can play a major role in proton (H+) cycling in a coral reef lagoon. The diel pH range (up to 0.75 units) in the Heron Island...... lagoon was the broadest ever reported for reef waters, and the night‐time pH (7.69) was comparable to worst‐case scenario predictions for seawater pH in 2100. The net contribution of coarse carbonate sands to the whole system H+ fluxes was only 9% during the day, but approached 100% at night when small...... scale (i.e., flow and topography‐induced pressure gradients) and large scale (i.e., tidal pumping as traced by radon) seawater recirculation processes were synergistic. Reef lagoon sands were a net sink for H+, and the sink strength was a function of porewater flushing rate. Our observations suggest...
National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0100062 includes chemical, meteorological, physical and time series data collected from HERON ISLAND, KANGAROO ISLAND, MARIA ISLAND, MOORING_HERON...
Results of bald eagle, osprey and great blue heron nest site surveys near Fort MacKay, Alberta
International Nuclear Information System (INIS)
Strom, K.; Balagus, P.
1996-01-01
As part of the environmental impact assessment process, a study was conducted to assess the occurrence of bald eagle, osprey and great blue heron on Syncrude's proposed oil sand leases near Fort MacKay. The objective of the study was to determine the relative abundance, habitat preferences and nesting occurrences of these different birds. Aerial count surveys were conducted to include coverage of the shorelines of four rivers and 22 lakes. Breeding activities of the osprey, bald eagle and great blue heron were observed in the regional study area, but not in the local study area. 14 refs., 1 tab., 4 figs
Swan, Hilton B; Deschaseaux, Elisabeth S M; Jones, Graham B; Eyre, Bradley D
2017-07-01
Dimethylsulfoniopropionate (DMSP) and eleven other target zwitterions were quantified in the branch tips of six Acropora species and Stylophora pistillata hard coral growing on the reef flat surrounding Heron Island in the southern Great Barrier Reef (GBR), Australia. Hydrophilic interaction liquid chromatography mass spectrometry (HILIC-MS) was used for sample analysis with isotope dilution MS applied to quantify DMSP. The concentration of DMSP was ten times greater in A. aspera than A. valida, with this difference being maintained throughout the spring, summer and winter seasons. In contrast, glycine betaine was present in significantly higher concentrations in these species during the summer than the winter. Exposure of branch tips of A. aspera to air and hypo-saline seawater for up to 1 h did not alter the concentrations of DMSP present in the coral when compared with control samples. DMSP was the most abundant target zwitterion in the six Acropora species examined, ranging from 44-78% of all target zwitterions in A. millepora and A. aspera, respectively. In contrast, DMSP only accounted for 7% in S. pistillata, with glycine betaine and stachydrine collectively accounting for 88% of all target zwitterions in this species. The abundance of DMSP in the six Acropora species examined points to Acropora coral being an important source for the biogeochemical cycling of sulfur throughout the GBR, since this reef-building branching coral dominates the coral cover of the GBR. Graphical Abstract HILIC-MS extracted ion chromatogram showing zwitterionic metabolites from the branching coral Acropora isopora.
Energy Technology Data Exchange (ETDEWEB)
Tiller, Brett L.; Marco, Jeffrey D.; Rickard, William H.
2005-05-01
Excrement sample and livers of juvenile great blue herons were collected at nests at three widely separated colonies along the Hanford Reach of the Columbia River to test the validity of using excrement samples as indicators of metal concentrations in tissues of juvenile herons fed food collected by parent birds within a few kilometers of nests. There was no positive relation noted between metal concentrations in excrement and liver samples taken from the same nests. Statistically significant differences in metal concentrations were noted in excrement samples collected among the different heron colonies. Arsenic, Cd, Cr, and Pb concentrations (dry wt.) were higher in excrement than in liver samples but the opposite was noted for Cu, Hg, and Zn. Mercury concentrations in heron liver samples were biomagnified to a greater extent than Cd and Cr. Fledging success and eggshell thickness measurements were used as indicators of population health. These values were equivalent to or better than those noted for heron colonies elsewhere in the United States.
Great Blue Herons in Puget Sound
2007-06-01
consolidation of the breeding population into relatively few, large reproductive centers. With the breeding population centralized, these colonies become...During nesting and reproduction , heron eggs and young fall prey to forest- associated raptors and other predators, further linking the complexity of...nests up to a meter wide and one-half meter deep. An adequate supply of nest material is also important; both deciduous and conifer twigs are utilized
Nesting season food habits of 4 species of Herons and Egrets at Lake Okeechobee, Florida
Smith, J.P.
1997-01-01
Based on the composition of nestling regurgitations collected during 3 breeding seasons, fish were the most important prey group for Great Egrets (Ardea alba: N = 200 nest-day samples; aggregate percent biomass [APB] = 73.4%), Snowy Egrets (Egretta thula: N = 115; APB = 91.4%), and Tricolored Herons (E. tricolor. N = 68; APB = 97.3%). For Little Blue Herons (E. caerulerr. N = 57), grass shrimp (Palaemoneles paludosus; APB = 39.7%) ranked higher in overall importance than all fishes combined (APB = 36.5%). Dietary overlap, as measured by Schoener's Similarity Index, was greatest between Snowy Egrets and Tricolored Herons (77%) and lowest between Tricolored Herons and Little Blue Herons (30%). Diet diversity, as measured by Shannon's Index, was highest for Great Egrets (2.04), intermediate for Snowy Egrets (1.71) and Tricolored Herons (1.68), and lowest for Little Blue Herons (1.60). Great Egrets ate a wider variety of fish species and sizes, especially larger fishes, and more crayfish than the other species. Little Blue Herons ate fewer fish and more grass shrimp and insects, and ate smaller forage fishes than Tricolored Herons but similar-sized fish as Snowy Egrets. The coarse-scale trophic composition of Snowy Egret and Tricolored Heron diets did not differ significantly, but Tricolored Herons ate larger forage fishes than Snowy Egrets. Pronounced interannual and intercolony variation in diet composition suggested that Great Egrets and Little Blue Herons switched prey types as hydrologic conditions and habitat availability changed. Conversely, lack of such variation suggested that Snowy Egrets and Tricolored Herons adjusted their foraging tactics to ensure contin-ued encounters with preferred prey despite changing habitat conditions. These results are generally consistent with other published data, help confirm some generalizations about foraging strategies and patterns of niche differentiation among these ecologically similar species, and have implications for
Radiocesium dynamics in herons inhabiting a contaminated reservoir system
International Nuclear Information System (INIS)
Dombey, A.H.; Paine, D.; McFarlane, R.W.
1977-01-01
The little blue heron (Florida caerulea) and the green heron (Butorides virescens) nest at a radionuclide-contaminated reservoir on the Savannah River Plant near Aiken, South Carolina. Green herons distributed their nests singly along the periphery of the reservoir but fed their nestlings exclusively upon amphibians collected from adjacent uncontaminated Carolina bays. Radiocesium burdens in green heron nestlings did not exceed 5 pCi/g wet wt. and 12 regurgitated food pellets averaged 0.2 pCi/g. Twelve pairs of little blue herons established a heronry upon a small island and fed their nestlings fish and amphibians foraged from within the differentially radionuclide-contaminated reservoir system. Nestlings within the same nest did not exhibit significant differences in body burdens, and the maximum radiocesium burden determined was 27.4 pCi/g wet wt. Substantial differences were found between nestlings from different nests however. The radiocesium level of 43 regurgitated food pellets had a high correlation with observed levels in the nestlings, and variation in food contamination is believed to be the major contributor in the observed variation in the nestlings. The variable contamination of primary prey species was correlated with the differentially contaminated foraging sites and indicates that adult little blue herons tended to spatially partition the available foraging areas. (author)
Rattner, B.A.; Hatfield, J.S.; Melancon, M.J.; Custer, T.W.; Tillett, D.E.
1993-01-01
Pipping black-crowned night-heron (Nycticorax nycticorax) embryos were collected from undisturbed (Chincoteague National Wildlife Refuge, VA) and industrialized (Cat Island, Green Bay, WI; San Francisco Bay, CA) locations. Hepatic P450 associated monooxygenases (AHH, EROD, BROD, ECOD) and P450 proteins (CYP1A, CYP2B) were induced up to 85-fold, and were associated with burdens of total PCBs and 11 AHH-active PCB congeners. Dioxin equivalents (TCDD-EQs) of sample extracts, derived by bioassay (H4I1E rat hepatoma cell) and mathematically (product of PCB congener concentration and relative TCDD potency), revealed greatest TCDD-EQs in Cat Island samples. TCDD-EQs were associated with P450s, especially BROD, EROD and CYP1A (r2 = 0.35 to 0.66). TCDD-EQs derived by bioassay were highly correlated with TCDD-EQs derived mathematically (r2 = 0.58 to 0.67) . Multiple regressions were also performed to investigate relationships among P450s and PCB congeners. In summary, these data demonstrate that hepatic P450s of heron embryos are biomarkers of exposure to dioxin-like compounds and provide further evidence that this species has considerable value for assessing wetland and estuarine contamination.
Burger, J; Gochfeld, M
1993-09-01
Several species of herons and egrets frequently nest in colonies in areas where humans also concentrate. Since the birds feed on intermediate-sized fish that themselves concentrate pollutants, they can be used not only to assess the levels of contaminants in avian tissues but as indicators of contaminants in the environment. The concentration of heavy metals and selenium in the breast feathers of fledgling black-crowned night herons Nycticorax nycticorax and Chinese pond herons Ardeola bacchus from the Tu Jing Yan heronry outside Chengdu, Szechuan Province in China; and from fledgling black-crowned night heron, little egret Egretta garzetta, great egret Egretta alba and cattle egret Bubulcus ibis from the Mai Po heronry in Hong Kong, were determined. Breast feathers were also collected from adult great egrets in Hong Kong. Adult great egrets had significantly higher levels of all heavy metals than did young great egrets. There were no significant interspecific differences in metal levels among the young at Szechuan China, except for chromium (pond herons had higher levels). There were significant differences among the young nesting at Hong Kong for all metals examined. Great egrets had lower, and night herons had higher, levels of lead than the other young. Night herons also had the highest levels of cadmium, manganese, and selenium compared to the other young. Great egret chicks had the lowest mercury levels, while little egret had the highest levels. Lead levels for all the birds in both Hong Kong and Szechuan were among the highest in the world, and this was attributed to the continued use of leaded gasoline.
International Nuclear Information System (INIS)
MacIntosh, D.L.
1992-09-01
This report presents a pair of wildlife exposure models developed for use in investigating the risks to wildlife of releases of mercury and PCBS. The species modeled are the great blue heron and mink The models may be used to estimate the exposure experienced by mink and herons, to help establish remedial action goals and to identify research needs. Because mercury and PCBs bioaccumulate through dietary uptake, the models simulate the food webs supporting the two species. Sources of contaminants include surface water, sediment, sediment pore water, and soil. The model are stochastic equilibrium models. Two types of variance in the input parameters are distinguished: stochastic variance among individual mink and herons and ignorance concerning true parameter values. The variance in the output due to stochastic parameters indicates the expected variance among the receptors. The variance due to ignorance indicates the extent to which the model outputs could be unpaved by additional sampling and measurement. The results of the models were compared to concentrations measured in great blue heron eggs and nestlings from colonies on the Clinch and Tennessee Rivers. The predicted concentrations agreed well with the measured concentrations. In addition, the variances in measured values among individuals was approximately equal to the total stochastic variance predicted by the models
Energy Technology Data Exchange (ETDEWEB)
MacIntosh, D.L. (Indiana Univ., Bloomington, IN (United States). School of Public and Environmental Affairs); Suter, G.W. II; Hoffman, F.O. (Oak Ridge National Lab., TN (United States))
1992-09-01
This report presents a pair of wildlife exposure models developed for use in investigating the risks to wildlife of releases of mercury and PCBS. The species modeled are the great blue heron and mink The models may be used to estimate the exposure experienced by mink and herons, to help establish remedial action goals and to identify research needs. Because mercury and PCBs bioaccumulate through dietary uptake, the models simulate the food webs supporting the two species. Sources of contaminants include surface water, sediment, sediment pore water, and soil. The model are stochastic equilibrium models. Two types of variance in the input parameters are distinguished: stochastic variance among individual mink and herons and ignorance concerning true parameter values. The variance in the output due to stochastic parameters indicates the expected variance among the receptors. The variance due to ignorance indicates the extent to which the model outputs could be unpaved by additional sampling and measurement. The results of the models were compared to concentrations measured in great blue heron eggs and nestlings from colonies on the Clinch and Tennessee Rivers. The predicted concentrations agreed well with the measured concentrations. In addition, the variances in measured values among individuals was approximately equal to the total stochastic variance predicted by the models.
Sensitivity of coral cays to climatic variations, southern Great Barrier Reef, Australia
Energy Technology Data Exchange (ETDEWEB)
Flood, P G
1986-01-01
Analysis of available wind data for the years 1962-80 from Heron Island which is located within the southern Great Barrier Reef indicates that the annual wind energy vector has oscillated within a 45 degree arc from the SSE in the early 1960's to ESE in the late 1970's. Such changes in wind direction influence the direction of propagation of the waves which mold the shape of coral sand cays in this region. Documentation is provided which shows that the variability of the shoreline positions on Erskine Island, an uninhabited vegetated sand cays reflects this change. The implication is that contemporary shoreline erosion on Heron Island is not caused by the development associated with the tourist resort there. It is a symptom of the change in the propagation direction of the wind-induced waves which is related to long-term climatic change.
National Oceanic and Atmospheric Administration, Department of Commerce — This archival package contains carbonate chemistry and environmental parameters data that were collected from a 200-day time series monitoring on the Heron Island...
Energy Technology Data Exchange (ETDEWEB)
MacIntosh, D.L. [Indiana Univ., Bloomington, IN (United States). School of Public and Environmental Affairs; Suter, G.W. II; Hoffman, F.O. [Oak Ridge National Lab., TN (United States)
1992-09-01
This report presents a pair of wildlife exposure models developed for use in investigating the risks to wildlife of releases of mercury and PCBS. The species modeled are the great blue heron and mink The models may be used to estimate the exposure experienced by mink and herons, to help establish remedial action goals and to identify research needs. Because mercury and PCBs bioaccumulate through dietary uptake, the models simulate the food webs supporting the two species. Sources of contaminants include surface water, sediment, sediment pore water, and soil. The model are stochastic equilibrium models. Two types of variance in the input parameters are distinguished: stochastic variance among individual mink and herons and ignorance concerning true parameter values. The variance in the output due to stochastic parameters indicates the expected variance among the receptors. The variance due to ignorance indicates the extent to which the model outputs could be unpaved by additional sampling and measurement. The results of the models were compared to concentrations measured in great blue heron eggs and nestlings from colonies on the Clinch and Tennessee Rivers. The predicted concentrations agreed well with the measured concentrations. In addition, the variances in measured values among individuals was approximately equal to the total stochastic variance predicted by the models.
Kushlan, J.A.; Hancock, J.A.
2005-01-01
Herons and their close relatives, the egrets and bitterns, comprise sixty species in total and are found all over the world except in polar regions, and are a strikingly beautiful part of the wetlands they inhabit. They are particularly abundant and popular in South West USA, especially Florida. Herons are a diverse group, easily recognized by their long legs, necks and bills. Many species are notable for their sociality as they feed, roost, and nest together in single or mixed species assemblages. The authors have extensive experience of research and observation of these birds and this book provides an up to date comprehensive review of the herons of the world. Covering their biology, distribution, description, systematics, breeding, feeding, and conservation, James Hancock and James Kushlan have distilled their lifetimes' research on the heron into one volume. This volume is complemented by beautiful color paintings especially painted for the book, color photographs, and distribution maps.
International Nuclear Information System (INIS)
Harris, M.L.; Elliott, J.E.; Butler, R.W.; Wilson, L.K.
2003-01-01
Human disturbance and loss of nesting habitat were more important factors than chlorinated hydrocarbons in changing heron reproductive success. - Over the period 1977-2000, eggs of Pacific great blue heron (Ardea herodias fannini) were collected from 23 colonies along the southern coast of British Columbia, Canada, and analyzed for persistent organochlorine (OC) pesticides and polychlorinated biphenyls (PCBs). Concentrations of OC pesticides in eggs declined sharply in the late 1970s, after which there were minimal changes. The sums of PCB congeners were not reduced appreciably during the 1980s and 1990s, but Aroclor 1260 concentrations suggested a sharp decline in PCB contamination of eggs in the late 1970s, similar to that shown for OC pesticides. Eggs collected along or near the Fraser River delta showed higher levels of most pesticides compared to other monitored colonies. Although the delta lands support a long-standing agricultural economy, the primary factors influencing OC levels in the delta colonies were thought to be driven by estuarine processes. We suggest two possible influencing factors were: 1) a greater rate of bioaccumulation in the estuary due to the deposition of particulates collected over a vast area encompassed by the Fraser River watershed; or 2) a higher rate of biomagnification in the estuary due to species differences at lower trophic levels of the heron food chain. Eggs from urban colonies contained higher levels of PCBs. The congener pattern was not clearly different from that observed in less contaminated eggs from rural and pulp mill-influenced colonies, except that colonies in Vancouver had greater proportions of PCB-66, suggesting a local source of Aroclor 1242. Productivity in the coastal heron colonies was highly variable over the period of study, with 71% of recorded colony-wide reproductive failures occurring in colonies near pulp mills. However, the predominant factors influencing reproductive success were probably disturbance
The foraging behaviour of herons and egrets on the Magela Creek flood plain, Northern Territory
International Nuclear Information System (INIS)
Recher, H.F.; Holmes, R.T.
1982-03-01
Five species of diurnal herons are common on the Magela Creek flood plain and forage along the edges of natural and artifical waterbodies both inside and outside the Ranger Uranium Project Area. The species of heron differ in the kinds and sizes of prey they take, their foraging location, degree of sociality and foraging behaviour. Because it takes relatively large fish, the Great Egret, E. alba, is most likely to be affected by any contamination of the aquatic environment by heavy metals or radionuclides. The Nankeen Night Heron, Nycticorax caledonicus is also abundant on the flood plain and probably feeds on large fish and frogs. The other herons take smaller or immature prey or hunt mostly in terrestrial habitats and are therefore less likely to be affected by contamination of the aquatic environment
van der Schyff, V; Pieters, R; Bouwman, H
2016-06-01
Metal pollution issues are afforded the highest priority in developing countries. Only one previous study has addressed metals in African bird eggs. We determined the concentration of metals and metalloids in bird eggs from four sites in the Vaal River catchment (VRC) of South Africa to provide data on the current situation. We analysed 16 pools of 77 heron, ibis, darter, egret, and cormorant eggs for 18 metals and metalloids using ICP-MS. We found high concentrations of gold (Au), uranium (U), thallium (Tl), and platinum (Pt) in Grey Heron eggs from Baberspan. Great white egrets from Bloemhof Dam had high concentrations of mercury (Hg). Multivariate analyses revealed strong associations between Au and U, and between palladium (Pd) and Pt. The toxic reference value (TRV) for Hg was exceeded in seven pools. Selenium exceeded its TRV in one pool; in the same pool, copper (Cu) reached its TRV. Compared with other studies, VRC bird eggs had high concentrations of contaminants. Based on these high concentrations, human health might be at risk as Grey Herons and humans share similar food and are therefore exposed to the same contaminants.
Brussee, Brianne E.; Coates, Peter S.; Dwight, Ian; Young, Laura G.
2017-01-01
During 2011, four separate instances of indirect filial cannibalism, whereby adults consumed their young that died from unknown causes, were observed using video-monitoring techniques in a nesting colony of Black-crowned Night-Herons (Nycticorax nycticorax) on Alcatraz Island. Though they were not observed actively killing their young, in all four observations adult Black-crowned Night-Herons consumed their young following death (i.e., indirect filial cannibalism). We could not determine cause of chick mortality, but parental neglect was likely a contributing factor in at least two instances. Indirect filial cannibalism is not commonly documented among birds, and understanding how cannibalism contributes to nest failure can help researchers better understand factors that limit nesting populations.
Rattner, B.A.; Hatfield, J.S.; Melancon, M.J.; Custer, T.W.; Tillitt, D.E.
1994-01-01
Pipping black-crowned night-heron (Nycticorax nycticorax) embryos were collected from a relatively uncontaminated site (next to Chincoteague National Wildlife Refuge, VA) and three polluted sites (Cat Island, Green Bay, Lake Michigan, WI; Bair Island, San Francisco Bay, CA; West Marin Island, San Francisco Bay, CA). Hepatic cytochrome P-450-associated monooxygenases and cytochrome P-450 proteins, induced up to 85-fold relative to the reference site, were associated with concentrations of total polychlorinated biphenyls (PCBs) and 11 PCB congeners that are presumed to express toxicity through the arylhydrocarbon (Ah) receptor. Multiple regression revealed that up to 86% of the variation of cytochrome P450 measurements was accounted for by variation in the concentration of these PCB congeners. Toxic equivalents (TEQs) of sample extracts, predicted mathematically (summed product of PCB congener concentrations and toxic equivalency factors), and dioxin equivalents (TCDD-EQs), derived by bioassay (ethoxyresorufin-O-dealkylase activity of treated H4IIE rat hepatoma cells), were greatest in Cat Island samples. Cytochrome P450-associated monooxygenases and cytochrome P450 proteins were related to TEQs and TCDD-EQs; adjusted r-2 often exceeded 0.5 for the relation among mathematically predicted TEQs and cytochrome P450 measurements. These data extend previous observations in heron embryos of an association between P450 and total PCB burdens to include Ah-active PCB congeners, and presumably other compounds, which interact similarly with the Ah receptor. Benzyloxyresorufin O-dealkylase, ethoxyresorufin O-dealkylase, and cytochrome P450 1A appear to be the most reliable measures of exposure to Ah-active PCB congeners in black-crowned night-heron embryos. These findings provide further evidence that cytochrome P450-associated parameters have considerable value as a biomarker for assessing environmental contamination of wetlands.
Directory of Open Access Journals (Sweden)
Vovk M.V.
2012-11-01
Full Text Available The research was performed in the area of natural reserve "Dneprovsko-Orelsky" and its adjacent territory – the island Pogorely. We discovered the changes of number of grey heron in colonial settlements, determined the principal factors influencing the formation of spatial structure of island bird communities. The analysis of nest distribution towards tree breeding biotopes was performed and stability of spatial structure of bird colonies was proved. We were tracking the number dynamics of pioneer colony and revealed the principal ecological and anthropogenic factors influencing the fluctuation of its abundance.
ADAPTIVE CHARACTERISTICS OF HERONS PLUMAGE FOR THEIR WAY OF LIFE
Directory of Open Access Journals (Sweden)
Koshelev V. A.
2011-12-01
Full Text Available Feather cover of each bird species reflects spectra of species, age, sex and environmental attributes defined the phylogeny of taxa, habitat and life patterns. In turn, many ecological phenomena in the birds’ life patterns are directly dependent on the state of plumage (e.g., time of breeding, seasonal migration, roost flights. For the first time the quantitative characterization of six heron species' plumage were done as well as the description of powder down feathers. The adaptive features of feathers and various types of heron’s plumages were discussed.The structure of contour feathers of herons is related to the peculiarities of species life pattern. All the species have a relatively small number of contour feathers, despite their large body size. According to this index the herons are more similar to typical wading birds (gulls, sandpipers than for waterfowl. The total number of heron feathers slightly increase in winter, because they are migratory species. Structure of contour feathers of herons corresponds to that of other waterbirds. The rod is not bent, the feathers are large, and the mounting angle to the surface of the body is little. The cores of abdominal feather fracts reduce heat transfer and can be regarded as an adaptation factor to aquatic environment.Buoyancy is provided by heron’s feathers insignificantly, in contrast to the typical waterfowl species. Significant subcutaneous fat stores are typical for herons in spring, autumn and winter, increased buoyancy and being the energy reserves provide thermoregulation in cold environment. Our data indicate weak adaptation of herons’ plumage to aquatic environments, but also confirm its insulating properties, which is prove the herons semi-aquatic rather than aquatic life patterns.Due to color of plumage some three groups of herons were considered: white, mottled and camouflaged. Coloration of second and third group performs a protective function. We didn’t found a clear
Lichen Monitoring Delineates Biodiversity on a Great Barrier Reef Coral Cay
Rogers, Paul C.; Rogers, Roderick W.; Hedrich, Anne E.; Moss, Patrick T.
2015-01-01
Coral islands around the world are threatened by changing climates. Rising seas, drought, and increased tropical storms are already impacting island ecosystems. We aim to better understand lichen community ecology of coral island forests. We used an epiphytic lichen community survey to gauge Pisonia (Pisonia grandis R.BR.), which dominates forest conditions on Heron Island, Australia. Nine survey plots were sampled for lichen species presence and abundance, all tree diameters and species, GPS...
Wilson, Scott P; Verlis, Krista M
2017-04-15
Marine debris is one of the most significant issues facing oceans worldwide. The sources of this debris vary depending on proximity to urban centres and the nature of activities within an area. This paper examines the influence of tourism in the southern Great Barrier Reef (GBR), and its contribution to litter levels in the region. By conducting beach debris surveys on occupied and unoccupied islands, this study found that debris was prevalent throughout the region with significant differences in material types between locations. The greatest source of debris from publically accessible islands was tourist-related, with this source also influencing debris loads on nearby uninhabited islands. A focus on debris at Heron Island, showed that sites close to amenities had greater levels of tourist-sourced items like cigarette butts. These findings indicate the contribution of tourists to this problem and that working with operators and managers is needed to minimise visitor impacts. Copyright © 2017 Elsevier Ltd. All rights reserved.
Spendelow, J.A.; Kuter, M.
2004-01-01
Falkner Island (FICT), a unit of the U.S. Fish and Wildlife Service's Stewart B. McKinney National Wildlife Refuge (SBMNWR) since 1985, is located in Long Island Sound 5 km south of Guilford, CT. For more than three decades it has been the site of the only large breeding colony in Connecticut of the federally endangered Northwest Atlantic population of Roseate Terns (Sterna dougallii) and the state's largest colony of Common Terns (S. hirundo). Both species have been studied at this site since 1978 as part of the Falkner Island Tern Project (FITP), and since 1987 also as part of a regional Cooperative Roseate Tern Metapopulation Dynamics and Ecology Project (CRTMP), both coordinated by Dr. Jeffrey A. Spendelow of the U.S. Geological Survey's Patuxent Wildlife Research Center (USGS-PWRC). From 1997-2002 the Roseate Tern breeding population at this site declined by more than 50% from about 150 to about 70 nesting pairs, mostly as a result of the nocturnal predation and disturbance of tern chicks and eggs by Black-crowned Night-Herons (Nycticorax nycticorax). Here we report the results of research done with the goal of improving management of nocturnal predators and developing new practices/structures to reduce losses of tern eggs and chicks so as to prevent the abandonment of this site by Roseate Terns. Notification of release of the USGS 'Quick Response Funds' (QRF) that were to be used to support the part of this study entitled 'Nocturnal behavior/interactions of endangered Roseate Terns and Black-crowned Night-Herons', and final approval of the Study Plan for this research did not occur until after the breeding season in 2003 was well underway. As a result, some work will need to be completed during the 2004 field season. There are two major objectives of this study. The first is to collect basic information (a) on the nocturnal behavior and interactions of Roseate (and Common) Terns with predatory Black-crowned Night-Herons, and (b) on how the behavior of the
Lichen Monitoring Delineates Biodiversity on a Great Barrier Reef Coral Cay
Directory of Open Access Journals (Sweden)
Paul C. Rogers
2015-05-01
Full Text Available Coral islands around the world are threatened by changing climates. Rising seas, drought, and increased tropical storms are already impacting island ecosystems. We aim to better understand lichen community ecology of coral island forests. We used an epiphytic lichen community survey to gauge Pisonia (Pisonia grandis R.BR., which dominates forest conditions on Heron Island, Australia. Nine survey plots were sampled for lichen species presence and abundance, all tree diameters and species, GPS location, distance to forest-beach edge, and dominant forest type. Results found only six unique lichens and two lichen associates. A Multi-Response Permutation Procedures (MRPP test found statistically distinct lichen communities among forest types. The greatest group differences were between interior Pisonia and perimeter forest types. Ordinations were performed to further understand causes for distinctions in lichen communities. Significant explanatory gradients were distance to forest edge, tree density (shading, and Pisonia basal area. Each of these variables was negatively correlated with lichen diversity and abundance, suggesting that interior, successionally advanced, Pisonia forests support fewer lichens. Island edge and presumably younger forests—often those with greater tree diversity and sunlight penetration—supported the highest lichen diversity. Heron Island’s Pisonia-dominated forests support low lichen diversity which mirrors overall biodiversity patterns. Lichen biomonitoring may provide a valuable indicator for assessing island ecosystems for conservation purposes regionally.
Three new sympatric species of Remipedia (Crustacea) from Great Exuma Island, Bahamas Islands
Koenemann, Stefan; Iliffe, Thomas M.; Ham, van der Joris
2003-01-01
Three new sympatric species of remipede crustaceans, Speleonectes tanumekes, Speleonectes parabenjamini and Speleonectes minnsi, are described from an anchihaline cave on Great Exuma Island in the central Bahamas. Speleonectes tanumekes is a comparatively long and slender species distinguished by
Colony Development and Density-Dependent Processes in Breeding Grey Herons
Directory of Open Access Journals (Sweden)
Takeshi Shirai
2013-01-01
Full Text Available The density-dependent processes that limit the colony size of colonially breeding birds such as herons and egrets remain unclear, because it is difficult to monitor colonies from the first year of their establishment, and the most previous studies have considered mixed-species colonies. In the present study, single-species colonies of the Grey Heron (Ardea cinerea were observed from the first year of their establishment for 16 years in suburban Tokyo. Colony size increased after establishment, illustrating a saturation curve. The breeding duration (days from nest building to fledging by a pair increased, but the number of fledglings per nest decreased, with colony size. The reproductive season in each year began earlier, and there was greater variation in the timing of individual breeding when the colony size was larger. The prolonged duration until nestling feeding by early breeders of the colony suggests that herons at the beginning of the new breeding season exist in an unsteady state with one another, likely owing to interactions with immigrant individuals. Such density-dependent interference may affect reproductive success and limit the colony size of Grey Herons.
'HERON' as a dark matter detector?
International Nuclear Information System (INIS)
Adams, J.S.; Bandler, S.R.; Brouer, S.M.; Enss, C.; Lanou, R.E.; Maris, H.J.; More, T.; Seidel, G.M.
1996-01-01
''HERON'', which is the acronym for '' Helium: Roton detection of Neutrinos'', is a project whose principal goal is a next generation detector of solar neutrinos from the p-p and 7 Be branches. It will utilize superfluid helium as the target material and employ event energy transport out of the target by phonon and roton processes unique to helium. Many of the challenges presented for dark matter detection are very similar to those for low energy solar neutrinos. We present new results from our feasibility studies for HERON which indicate an asymmetry in the roton emission distribution from stopping particles and the ability to detect simultaneously the ultraviolet fluorescence photons also emitted. These features are potentially valuable for solar neutrino detection and the question is explored as to whether or not the same helium technique could be valuable for WIMP dark matter detection
Continuous resistivity profiling data from Great South Bay, Long Island, New York
Cross, V.A.; Bratton, J.F.; Kroeger, K.D.; Crusius, John; Worley, C.R.
2013-01-01
An investigation of submarine aquifers adjacent to the Fire Island National Seashore and Long Island, New York was conducted to assess the importance of submarine groundwater discharge as a potential nonpoint source of nitrogen delivery to Great South Bay. Over 200 kilometers of continuous resistivity profiling data were collected to image the fresh-saline groundwater interface in sediments beneath the bay. In addition, groundwater sampling was performed at sites (1) along the north shore of Great South Bay, particularly in Patchogue Bay, that were representative of the developed Long Island shoreline, and (2) at sites on and adjacent to Fire Island, a 50-kilometer-long barrier island on the south side of Great South Bay. Other field activities included sediment coring, stationary electrical resistivity profiling, and surveys of in situ pore water conductivity. Results of continuous resistivity profiling surveys are described in this report. The onshore and offshore shallow hydrostratigraphy of the Great South Bay shorelines, particularly the presence and nature of submarine confining units, appears to exert primary control on the dimensions and chemistry of the submarine groundwater flow and discharge zones. Sediment coring has shown that the confining units commonly consist of drowned and buried peat layers likely deposited in salt marshes. Low-salinity groundwater extends from 10 to 100 meters offshore along much of the north and south shores of Great South Bay based on continuous resistivity profiling data, especially off the mouths of tidal creeks and beneath shallow flats to the north of Fire Island adjacent to modern salt marshes. Human modifications of much of the shoreline and nearshore areas along the north shore of the bay, including filling of salt marshes, construction of bulkheads and piers, and dredging of navigation channels, has substantially altered the natural hydrogeology of the bay's shorelines by truncating confining units and increasing
Champoux, Louise; Boily, Monique
2017-12-31
Since 1991, great blue heron (Ardea herodias) eggs have been collected and analyzed for mercury (Hg), persistent organic contaminants (OCs), brominated and non-brominated flame retardants (FRs) as well as stable isotopes δ 13 C and δ 15 N. In the present study, temporal trends of contaminants were analyzed in eggs sampled in four regions along the St. Lawrence River (Quebec, Canada) and inland sites using new and previously published data. Most contaminants declined significantly over time in most regions. Globally, the highest annual change, -17.5%, was found for pp'-DDD, while the smallest annual decline, -0.54%, was observed for Hg. Concentrations of ΣDDT and ΣFR 8 (sum of 8 congeners) decreased by -11.6% and -7.3%, respectively. Declines in ΣPCBs differed among regions, from -5.6% in the fluvial section to -14.7% in the inland region. The highest concentration of ΣFR 8 was measured in eggs from Grande Ile in the fluvial section of the river in 1996 (2.39μg/g). Stable isotope ratios also showed temporal trends in some regions: δ 13 C decreased in the fluvial section and increased in Gulf region, while δ 15 N decreased in the fluvial section and increased in the upper estuary. Significant positive relationships were found between ΣDDT, ΣPCBs and ΣFRs and δ 15 N and δ 13 C in freshwater colonies, but not in estuarine or marine colonies. These results suggest that changes in trophic level and foraging areas over time were influential factors with respect to contaminant burden in great blue heron eggs in the fluvial section, but not in the other regions. Crown Copyright © 2017. Published by Elsevier B.V. All rights reserved.
The Great Depression and the New Deal on Long Island, New York.
Lupinskie-Huvane, Lorraine; Singer, Alan
2001-01-01
Presents information adapted from the introduction to "The Great Depression and the New Deal on Long Island: A Local History Curriculum Guide." Finds that even though people in Long Island, New York, were active participants in New Deal programs, there was still anti-Roosevelt opposition during the 1932 and 1936 presidential elections.…
DEFF Research Database (Denmark)
Graves, Gary R.
2015-01-01
I observed black-crowned night-herons (Nycticorax nycticorax) swimming and kleptoparasitizing American coots (Fulica americana) at an artificial lake in Pinal County, Arizona. This appears to be the first record of interspecific kleptoparasitism by a swimming ardeid.......I observed black-crowned night-herons (Nycticorax nycticorax) swimming and kleptoparasitizing American coots (Fulica americana) at an artificial lake in Pinal County, Arizona. This appears to be the first record of interspecific kleptoparasitism by a swimming ardeid....
2004-01-01
KENNEDY SPACE CENTER, FLA. White pelicans swim in a lake north of Kennedy Space Center. In the distance, at right, is a great blue heron. White pelicans winter from Florida and southern California south to Panama. Great blue herons range across the breadth of the United States, as well as north to Alaska and Canada and south to Mexico and the West Indies. The Center shares a boundary north, south and west with the 92,000-acre Merritt Island National Wildlife Refuge, which is a habitat for more than 310 species of birds, 25 mammals, 117 fishes and 65 amphibians and reptiles. The marshes and open water of the refuge also provide wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds.
The History of Research and Development Islands Peter the Great Bay, Sea of Japan
Directory of Open Access Journals (Sweden)
Aleksandr B. Kosolapov
2016-06-01
Full Text Available The article discusses the history of the discovery, research and development of the islands of Russian pioneers in Peter the Great Bay, Sea of Japan from the middle of the XIX century. The paper used in scientific papers and journalistic materials researchers Islands Peter the Great Bay, unpublished sources: Russian State Historical Archive of the Far East, Primorsky Region State Archives, Archives of Primorsky regional department of the All-Russian public organization "Russian Geographical Society" Society for the Study of the Amur region. The methodological basis of the work was the principle of historicism and objectivity, allowed to consider the issue of research and development of the islands of the Gulf of Peter the Great on a broad documentary basis in the process of development in the specific historical conditions. The history of hydrographic discoveries of natural and geographical studies. It touches upon the issues concerning the construction of Vladivostok fortress. In the periodical press materials recreated pages agricultural and industrial development of the islands. Examples of business entrepreneurs first edge (A.D. Startsev, M.I. Jankowski, O.V. Lindgolm. The Toponymic notes link the island territories with the names of their discoverers, explorers, industrialists. The authors conclude that the historical conditionality of development of the islands is linked mainly with the military interests of Russia on its southeastern edge, using the resources of the sea and the unique natural conditions suitable for the development of agricultural, industrial, recreation and tourism.
Inscribed polygons and Heron polynomials
International Nuclear Information System (INIS)
Varfolomeev, V V
2003-01-01
Heron's well-known formula expressing the area of a triangle in terms of the lengths of its sides is generalized in the following sense to polygons inscribed in a circle: it is proved that the area is an algebraic function of the lengths of the edges of the polygon. Similar results are proved for the diagonals and the radius of the circumscribed circle. The resulting algebraic equations are studied and elementary geometric applications of the algebraic results obtained are presented
Beale, D J; Crosswell, J; Karpe, A V; Ahmed, W; Williams, M; Morrison, P D; Metcalfe, S; Staley, C; Sadowsky, M J; Palombo, E A; Steven, A D L
2017-12-31
The impact of anthropogenic factors arising from point and non-point pollution sources at a multi commodity marine port and its surrounding ecosystems were studied using sediment samples collected from a number of onshore (Gladstone Harbour and Facing Island) and offshore (Heron Island and Fitzroy Reefs) sites in Australia's Central Queensland. Sediment samples were analyzed for trace metals, organic carbon, polycyclic aromatic hydrocarbons (PAH), emerging chemicals of concern (ECC) and sterols. Similarly, the biological and biochemical interaction between the reef and its environment was analyzed by the multi-omic tools of next-generation sequencing characterization of the bacterial community and microbial community metabolic profiling. Overall, the trace elements were observed at the lower end of the Australian environmental guideline values at the offshore sites, while higher values were observed for the onshore locations Nickel and copper were observed above the high trigger value threshold at the onshore sites. The levels of PAH were below limits of detection across all sites. However, some of the ECC and sterols were observed at higher concentrations at both onshore and offshore locations, notably, the cholesterol family sterols and 17α-ethynylestradiol. Multi-omic analyses also indicated possible thermal and photo irradiation stressors on the bacterial communities at all the tested sites. The observed populations of γ-proteobacteria were found in combination with an increased pool of fatty acids that indicate fatty acid synthesis and utilisation of the intermediates of the shikimate pathways. This study demonstrates the value of applying a multi-omics approach for ecological assessments, in which a more detailed assessment of physical and chemical contaminants and their impact on the community bacterial biome is obtained. Crown Copyright © 2017. Published by Elsevier B.V. All rights reserved.
Hill, Elwood F.; Henry, Charles J.; Grove, Robert A.
2008-01-01
Mercury concentrations in the floodplain of the Carson River Basin in northwestern Nevada are some of the highest ever reported in a natural system. Thus, a portion of the basin including Lahontan Reservoir was placed on the U.S. Environmental Protection Agency’s Natural Priorities List for research and cleanup. Preliminary studies indicated that reproduction in piscivorous birds may be at risk. Therefore, a 10-year study (1997–2006) was conducted to evaluate reproduction of snowy egrets (Egretta thula) and black-crowned night-herons (Nycticorax nycticorax) nesting on Gull Island in Lahontan Reservoir. Special attention was given to the annual flow of the Carson River, the resultant fluctuation of this irrigation reservoir, and the annual exposure of snowy egrets and night-herons to methylmercury (MeHg). The dynamic character of the river due to flooding and drought (drought effect) influenced snowy egret and night-heron reproduction more so than did MeHg contamination of eggs. During an extended drought (2000–2004) in the middle of the study, snowy egret nests containing eggs with concentrations of MeHg (measured as total mercury [THg] ∼ 100% MeHg) ≥0.80 μg THg/g, ww, all failed, but in 1997 and 2006 (wet years with general flooding), substantial numbers of young were produced (but fewer than at nests where eggs contained reproductive threshold of tolerance to MeHg may be associated with habitat quality (food type and abundance). Clearly, drought was the most important factor affecting snowy egret annual productivity. In contrast to snowy egrets, night-herons generally had fewer nests meeting the 0.80 μg THg/g criterion, and those above the criterion were less sensitive to mercury than were snowy egrets. Furthermore, night-herons appeared more tolerant of drought conditions than snowy egrets because they nested earlier, selected more protected nesting sites, and had a more generalist diet that provided additional food options including terrestrial
DEFF Research Database (Denmark)
Santos, Isaac R.; Eyre, Bradley D.; Glud, Ronnie N.
2012-01-01
Porewater flow enhances mineralization rates in organic-poor permeable sands. Here, a series of sediment column experiments were undertaken to assess the potential effect of advective porewater transport on denitrification in permeable carbonate sands collected from Heron Island (Great Barrier Re...
A white pelican and egrets in the Merritt Island National Wildlife Refuge
1999-01-01
A white pelican and several small egrets rest on the bank of a pond in in the waters of the Merritt Island National Wildlife Refuge, which shares a boundary with Kennedy Space Center. White pelicans inhabit marshy lakes and along the Pacific and Texas coasts. They winter from Florida and southern California south to Panama, chiefly in coastal lagoons. They are frequently seen flying in long lines, flapping and sailing in unison, but also ride rising air currents to soar gracefully in circles. The range of the egret includes southern and eastern states, Mexico, Central and South America, and the West Indies. The Refuge encompasses 92,000 acres that are a habitat for more than 331 species of birds, 31 mammals, 117 fishes, and 65 amphibians and reptiles. The marshes and open water of the refuge provide wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds, as well as a variety of insects.
Black-necked stilts share nesting in the Merritt Island National Wildlife Refuge
1999-01-01
A black-necked stilt waits near its nesting mate nest in the Merritt Island National Wildlife Refuge, which shares a boundary with Kennedy Space Center. Stilts usually produce three or four brown-spotted buff eggs in a shallow depression lined with grass or shell fragments. In the nesting season they are particularly agressive. Stilts are identified by a distinct head pattern of black and white, very long red legs, and straight, very thin bill. Their habitat is salt marshes and shallow coastal bays from Delaware and northern South America in the East, and freshwater marshes from Oregon and Saskatchewan to the Gulf Coast. The 92,000-acre wildlife refuge is a habitat for more than 310 species of birds, 25 mammals, 117 fishes and 65 amphibians and reptiles. The marshes and open water of the refuge also provide wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds.
Directory of Open Access Journals (Sweden)
M. Julian Caley
2011-09-01
Full Text Available Recently, the Census of Marine Life has explored methods to assess coral reef diversity by combining standardized sampling (to permit comparison across sites with molecular techniques (to make rapid counts of species possible. To date, this approach has been applied across geographically broad scales (seven sites spanning the Indian, Pacific and Atlantic Oceans, focusing on similar habitats at all sites (10–12 m forereef. Here we examine crustacean spatial diversity patterns for a single atoll, comparing results for four sites (comprising forereef, backreef, and lagoon habitats at French Frigate Shoals (FFS, Northwestern Hawaiian Islands, Hawaii, USA, within the Papahanaumokuakea Marine National Monument. The Bray-Curtis index of similarity across these habitats at FFS was the same or greater than the similarity between similar habitats on Heron Island and Lizard Island in the Great Barrier Reef and much greater than similarity between more widely separated localities in the Indo-Pacific Ocean (e.g., Ningaloo, Moorea, French Polynesia or the Line Islands. These results imply that, at least for shallow reefs, sampling multiple locations versus sampling multiple habitats within a site maximizes the rate at which we can converge on the best global estimate of coral reef biodiversity.
The 2006-2007 Kuril Islands great earthquake sequence
Lay, T.; Kanamori, H.; Ammon, C.J.; Hutko, Alexander R.; Furlong, K.; Rivera, L.
2009-01-01
The southwestern half of a ???500 km long seismic gap in the central Kuril Island arc subduction zone experienced two great earthquakes with extensive preshock and aftershock sequences in late 2006 to early 2007. The nature of seismic coupling in the gap had been uncertain due to the limited historical record of prior large events and the presence of distinctive upper plate, trench and outer rise structures relative to adjacent regions along the arc that have experienced repeated great interplate earthquakes in the last few centuries. The intraplate region seaward of the seismic gap had several shallow compressional events during the preceding decades (notably an MS 7.2 event on 16 March 1963), leading to speculation that the interplate fault was seismically coupled. This issue was partly resolved by failure of the shallow portion of the interplate megathrust in an MW = 8.3 thrust event on 15 November 2006. This event ruptured ???250 km along the seismic gap, just northeast of the great 1963 Kuril Island (Mw = 8.5) earthquake rupture zone. Within minutes of the thrust event, intense earthquake activity commenced beneath the outer wall of the trench seaward of the interplate rupture, with the larger events having normal-faulting mechanisms. An unusual double band of interplate and intraplate aftershocks developed. On 13 January 2007, an MW = 8.1 extensional earthquake ruptured within the Pacific plate beneath the seaward edge of the Kuril trench. This event is the third largest normal-faulting earthquake seaward of a subduction zone on record, and its rupture zone extended to at least 33 km depth and paralleled most of the length of the 2006 rupture. The 13 January 2007 event produced stronger shaking in Japan than the larger thrust event, as a consequence of higher short-period energy radiation from the source. The great event aftershock sequences were dominated by the expected faulting geometries; thrust faulting for the 2006 rupture zone, and normal faulting for
Clua, Eric; Séret, Bernard
2010-09-01
The case of a fatal, unprovoked shark attack is reported and analyzed. The incident took place on the 30th of September 2007, in the lagoon of Luengoni Bay, Lifou Island (Loyalty Islands, New Caledonia). A young French woman who was snorkeling was severely bitten on the right thigh and died of hemorrhage. An analysis based in particular on the size and color of the shark, the characteristics of the wounds, and the behavior of the shark before and after the bite suggests that the aggressor was a great white shark, Carcharodon carcharias.
Short Note Brood parasitism in the Green-backed Heron ( Butorides ...
African Journals Online (AJOL)
Short Note Brood parasitism in the Green-backed Heron (Butorides striatus). R Yosef, P Zduniak. Abstract. Ostrich 2005, 76(1&2): 78–79. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · http://dx.doi.org/10.2989/00306520509485476 · AJOL African Journals Online.
Watson, Charlotte
2015-09-18
Morphological investigation into the paleate genus Paleanotus Schmarda 1861 of the family Chrysopetalidae from northern Australian coral reefs, primarily Lizard Island and outlying reefs, included a complex of very small, slender individuals (length < 5 mm). This complex resolved into 7 new species, described herein: Paleanotus inornatus n. sp., P. adornatus n. sp., P. chrysos n. sp., P. aquifolia n. sp., P. latifolia n. sp., P. silus n. sp., and P. silopsis n. sp. A key is provided to the new species and Paleanotus distinguished from Treptopale and Hyalopale, two closely related genera. Diagnostic features of the apical structure and shape of the notochaetal main paleae plus median paleae shape and raised rib pattern, differentiates each species from the other. Gametous states are described. Two cryptic species pairs (Paleanotus silopsis n. sp. and P. silus n. sp.; Paleanotus aquifolia n. sp. and P. latifolia n. sp.) were identified. In each case one species is restricted to either the NE or NW Australian coast. In each pair the most eastern point for the NW Australian species range occurs at Darwin, western Arnhemland, Northern Territory. Additional material for each species pair extends their respective ranges northwards: NW Australia to Thailand, Andaman Sea, eastern Indian Ocean or NE Australia, Great Barrier Reef to the Philippines, western Pacific Ocean. Cryptic morphology and potential genetic diversity is discussed in Paleanotus inornatus n. sp. and P. adornatus n. sp. that possess overlapping widespread distribution patterns across northern Australia and Indo-Pacific reefs. The smallest bodied taxon, Paleanotus chrysos n. sp. is the only species with a Coral Sea range encompassing Lizard Island, Heron Island and New Caledonia.
2002-01-01
The skies over Northern India are filled with a thick soup of aerosol particles all along the southern edge of the Himalayan Mountains, and streaming southward over Bangladesh and the Bay of Bengal. Notice that the air over the Tibetan Plateau to the north of the Himalayas is very clear, whereas the view of the land surface south of the mountains is obstructed by the brownish haze. Most of this air pollution comes from human activities. The aerosol over this region is notoriously rich in sulfates, nitrates, organic and black carbon, and fly ash. These particles not only represent a health hazard to those people living in the region, but scientists have also recently found that they can have a significant impact on the region's hydrological cycle and climate (click to read the relevant NASA press release). This true-color image was acquired on December 4, 2001, by the Moderate-resolution Imaging Spectroradiometer (MODIS), flying aboard NASA's Terra satellite. It is interesting to compare the image above with this earlier MODIS image over the region, acquired on October 23, 2001. Notice the difference in the clarity of the air over the region in the earlier image. Under the thick plume of aerosol, the Brahmaputra (upper right) and Ganges Rivers are still visible. The many mouths of the Ganges have turned the northern waters of the Bay of Bengal a murky brown as they empty their sediment-laden waters into the bay. Toward the upper lefthand corner of the image, there appears to be a fresh swath of snow on the ground just south of the Himalayas. Image courtesy Jacques Descloitres, MODIS Land Rapid Response Team at NASA GSFC
Response of roseate tern to a shoreline protection project on Falkner Island, Connecticut
Rogers, C.J.; Spendelow, J.A.; Guilfoyle, Michael P.; Fischer, Richard A.; Pashley, David N.; Lott, Casey A.
2007-01-01
subterranean channels, especially in the main revetment area, made it difficult to measure chick growth and productivity as had been done for more than 12 years prior to construction. Also, observations of color-banded adults that were unable to locate and feed their young inside the main revetment, and of adults returning to courtship behavior and renesting after having hatched chicks from their initial clutches, indicated that a minimum of 20% of the chicks (mostly first hatched A-chicks, which usually have high rates of survival to fledging) that entered the main revetment died after doing so in 2001. The mortality rate of Roseate Tern chicks that entered the secondary revetment on the southwest shelf, however, was not unusually high in 2001. In an attempt to reduce the likelihood of nesting and chick losses in these sub-colonies, a research team led by the USGS in 2002-2003 did not put nest boxes on the northeast and east shelf areas where previous losses had been high. However, losses of tern eggs and young chicks to predatory Black-crowned Night Herons (Nycticorax nycticorax) were so great in 2002?2003 that few Roseate Tern chicks survived long enough to move into the main revetment area and little comparative survival data were collected. The USFWS continues to remove predatory night herons, to monitor the location and success of nesting Roseate Terns and to fill in some of problem areas near the tern nests in the main revetment. The extensive chick-searching fieldwork and observational procedures used by the USGS-led research team to determine the growth and survival of the Roseate Tern chicks at Falkner Island were not used in 2004?2005. The number of chicks lost in the revetment during these years is not known. Without additional fill, loss of chicks of this endangered species in the main revetment may rise again even though the night heron predation problem has been reduced.
New flags, upward forces and sheltered harbours: The new ‘Great Game’ in the Pacific Islands region
Directory of Open Access Journals (Sweden)
Kowasch, Matthias
2014-03-01
Full Text Available The centre of the global economy and the US-geostrategic focus seem to be shifting to the Asia-Pacific region. The present paper deals with the role of Pacific Island states in this new ‘Great Game’ between China and Western powers. Pacific Island states have a long tradition in building non-confrontational and open ties with rival powers. While only four countries in the Pacific have known mineral resources, others depend mainly on tourism, fisheries and remittances. China is interested in the vast mineral resources in the Pacific Island region, visible in increasing investment. Nevertheless, Australia remains the principal economic and key security partner for most of the Island states. Besides a painful colonial history, unequal distribution of mining benefits and social disparities are reasons for independence movements. Besides a painful colonial history, unequal distribution of mining benefits and social disparities are reasons for independence movements that are another issue in Pacific Island politics.
New flags, upward forces and sheltered harbours: The new ‘Great Game’ in the Pacific Islands region
Kowasch, Matthias; Lindenmann, Peter
2014-01-01
The centre of the global economy and the US-geostrategic focus seem to be shifting to the Asia-Pacific region. The present paper deals with the role of Pacific Island states in this new ‘Great Game’ between China and Western powers. Pacific Island states have a long tradition in building non-confrontational and open ties with rival powers. While only four countries in the Pacific have known mineral resources, others depend mainly on tourism, fisheries and remittances. China is interested in t...
Golden, N.H.; Rattner, B.A.; Cohen, J.B.; Hoffman, D.J.; Russek-Cohen, E.; Ottinger, M.A.
2003-01-01
Although lead can attain high concentrations in feathers, interpretation of the biological significance of this phenomenon is difficult. As part of an effort to develop and validate non-invasive methods to monitor contaminant exposure in free-ranging birds, lead uptake by feathers of nestling black-crowned night-herons (Nycticorax nycticorax) was evaluated in a controlled exposure study. Four to six day-old heron nestlings (one/nest) at Chincoteague Bay, Virginia, received a single intraperitoneal injection of dosing vehicle (control; n=7) or a dose of lead nitrate in water (0.01, 0.05, or 0.25 mg Pb/g body weight of nestling; n=6 or 7/dose) chosen to yield feather lead concentrations found at low to moderately polluted sites. Nestlings were euthanized at 15 days of age. Lead accumulation in feathers was associated with concentrations in bone, kidney, and liver (r = 0.32 - 0.74, p feather lead concentration. Culmen growth rate was depressed in nestlings treated with the highest dose of lead, but not correlated with feather lead concentration. These findings provide evidence that feathers of nestling herons are a sensitive indicator of lead exposure and have potential application for the extrapolation of lead concentrations in other tissues and the estimation of environmental lead exposure in birds.
Golden, Nancy H; Rattner, Barnett A; Cohen, Jonathan B; Hoffman, David J; Russek-Cohen, Estelle; Ottinger, Mary Ann
2003-07-01
Although lead can attain high concentrations in feathers, interpretation of the biological significance of this phenomenon is difficult. As part of an effort to develop and validate noninvasive methods to monitor contaminant exposure in free-ranging birds, lead uptake by feathers of nestling black-crowned night herons (Nycticorax nycticorax) was evaluated in a controlled exposure study. Four- to 6-d-old heron nestlings (one/nest) at Chincoteague Bay, Virginia (USA), received a single intraperitoneal injection of dosing vehicle (control, n = 7) or a dose of lead nitrate in water (0.01, 0.05, or 0.25 mg Pb/g body wt of nestling; n = 6 or 7/dose) chosen to yield feather lead concentrations found at low- to moderately polluted sites. Nestlings were euthanized at 15 d of age. Lead accumulation in feathers was associated with concentrations in bone, kidney, and liver (r = 0.32-0.74, p feather lead concentration. Culmen growth rate was depressed in nestlings treated with the highest dose of lead but not correlated with feather lead concentration. These findings provide evidence that feathers of nestling herons are a sensitive indicator of lead exposure and have potential application for the extrapolation of lead concentrations in other tissues and the estimation of environmental lead exposure in birds.
Vision and foraging in cormorants: more like herons than hawks?
Directory of Open Access Journals (Sweden)
Craig R White
Full Text Available BACKGROUND: Great cormorants (Phalacrocorax carbo L. show the highest known foraging yield for a marine predator and they are often perceived to be in conflict with human economic interests. They are generally regarded as visually-guided, pursuit-dive foragers, so it would be expected that cormorants have excellent vision much like aerial predators, such as hawks which detect and pursue prey from a distance. Indeed cormorant eyes appear to show some specific adaptations to the amphibious life style. They are reported to have a highly pliable lens and powerful intraocular muscles which are thought to accommodate for the loss of corneal refractive power that accompanies immersion and ensures a well focussed image on the retina. However, nothing is known of the visual performance of these birds and how this might influence their prey capture technique. METHODOLOGY/PRINCIPAL FINDINGS: We measured the aquatic visual acuity of great cormorants under a range of viewing conditions (illuminance, target contrast, viewing distance and found it to be unexpectedly poor. Cormorant visual acuity under a range of viewing conditions is in fact comparable to unaided humans under water, and very inferior to that of aerial predators. We present a prey detectability model based upon the known acuity of cormorants at different illuminances, target contrasts and viewing distances. This shows that cormorants are able to detect individual prey only at close range (less than 1 m. CONCLUSIONS/SIGNIFICANCE: We conclude that cormorants are not the aquatic equivalent of hawks. Their efficient hunting involves the use of specialised foraging techniques which employ brief short-distance pursuit and/or rapid neck extension to capture prey that is visually detected or flushed only at short range. This technique appears to be driven proximately by the cormorant's limited visual capacities, and is analogous to the foraging techniques employed by herons.
International Nuclear Information System (INIS)
Barata, C.; Fabregat, M.C.; Cotin, J.; Huertas, D.; Sole, M.; Quiros, L.; Sanpera, C.; Jover, L.; Ruiz, X.; Grimalt, J.O.; Pina, B.
2010-01-01
Blood biomarkers and levels of major pollutants in eggs and feathers were used to determine pollution effects in nestlings of the Purple Heron Ardea purpurea and the Little Egret Egretta garzetta, sampled on three Ebro River (NE Spain) areas: a reference site, a site affected by the effluents of a chlor-alkali industry and the river Delta. The two impacted heron populations showed mutually different pollutant and response patterns, suggesting different sources of contamination. In the population nesting near the chlor-alkali plant, elevated levels of hexachlorobenzene (HCB) and polychlorobiphenyls (PCBs) in eggs, and mercury in feathers in A. purpurea chicks were related with reduced blood antioxidant defenses and increased levels of micronuclei. In Ebro Delta, high levels of plasmatic lactate dehydrogenase in A. purpurea chicks and high frequency of micronuclei in blood of both species were tentatively associated with intensive agricultural activities taking place in the area. These results provide the first evidence of a biological response in heron chicks to the release of pollutants at a chlor-alkali plant. - High levels of organochlorine and mercury levels in eggs and feathers were related with altered blood biomarkers of heron nesting chicks.
A Modern Sr/Ca-δ18O-Sea Surface Temperature Calibration for Isopora Corals in the Great Barrier Reef
Brenner, L. D.; Linsley, B. K.; Potts, D. C.
2014-12-01
Most coral-based paleoceanographic studies have used massive colonies of Porites or Faviidae, due to their long, continuously accreted skeletal records and sub-annual resolution, but other sub-massive corals provide an untapped resource. The genus Isopora is a dominant reef builder in some high-energy environments in the tropical western Pacific, and was a major component of cores recovered on IODP Leg 325 off the Great Barrier Reef (GBR). Despite its abundance, Isopora remains largely unexplored and hence underutilized in paleoceanographic studies. We present a modern Sr/Ca-δ18O-Sea Surface Temperature (SST) calibration of modern Isopora corals (n=3) collected from inner and outer reef locations ranging from 1-13m depth by Heron Island in the southern GBR in 2012. Pairing the Isopora Sr/Ca record with monthly SST yielded an average relationship of SST=-11.48×(Sr/Ca)+131.1 (r2 = 0.42-0.78). The Sr/Ca sensitivity of -0.087 mmol/mol/°C is similar to the sensitivity for Porites that was corrected for tissue layer smoothing effects determined by Gagan et al. (2012). The similarity between our Sr/Ca-SST sensitivity and the corrected sensitivity for Porites suggests tissue layer effects are minimal in Isopora. The mean annual SST amplitude recorded by the corals from 2008-2011 (full annual cycles) was 5.3°C and the average δ18O annual cycle of 1.1‰ approximates that expected if salinity had little effect on coral δ18O, assuming a previously established conversion of -0.23‰ (δ18O)/°C for biogenic aragonite. The average annual salinity amplitude of 0.3 in gridded data from around Heron Island supports our conclusion that δ18O variability is forced almost completely by SST. This modern Sr/Ca-SST calibration will expand the paleoceanographic utility of Isopora and, by assisting interpretation of Sr/Ca data from fossil corals collected during IODP 325, will better constrain the timing and magnitude of sea level changes and surface conditions since the Last
Directory of Open Access Journals (Sweden)
M. V. Vovk
2005-01-01
Full Text Available The article is devoted to the research of the settlements of heron on the accumulation of heavy metals in the soil. The author considers accumulation of trace elements in different soil horizons. The reasons of the prohibitions has been rate.
Cyronak, T.; Santos, I. R.; Erler, D.; Maher, D. T.; Eyre, B.
2013-12-01
The carbon chemistry of coral reef lagoons can be highly variable over short time scales. While much of the diel variability in seawater carbon chemistry is explained by biological processes, external sources such as river and groundwater seepage may deliver large amounts of organic and inorganic carbon to coral reefs and represent a poorly understood feedback to ocean acidification. Here, we assess the impact of submarine groundwater discharge (SGD) on pCO2 variability in two coral reef lagoons with distinct SGD driving mechanisms. Diel variability of pCO2 in the two ecosystems was explained by a combination of biological drivers and SGD inputs. In Rarotonga, a South Pacific volcanic island, SGD was driven primarily by a steep terrestrial hydraulic gradient, and the lagoon was influenced by the high pCO2 (5,501 μatm) of the fresh groundwater. In Heron Island, a Great Barrier Reef coral cay, SGD was dominated by seawater recirculation through sediments (i.e. tidal pumping) and pCO2 was mainly impacted through the stimulation of biological processes. The Rarotonga water column had a relatively higher average pCO2 (549 μatm) than Heron Island (471 μatm). However, pCO2 exhibited a greater diel range in Heron Island (778 μatm) than in Rarotonga (507 μatm). The Rarotonga lagoon received 31.2 mmol CO2 m-2 d-1 from SGD, while the Heron Island lagoon received 12.3 mmol CO2 m-2 d-1. Over the course of this study both systems were sources of CO2 to the atmosphere (3.00 to 9.67 mmol CO2 m-2 d-1), with SGD-derived CO2 contributing a large portion to the air-sea CO2 flux. The relationship between both water column pH and aragonite saturation state (ΩAr) and radon (222Rn) concentrations indicate that SGD may enhance the local acidification of some coral reef lagoons. Studies measuring the carbon chemistry of coral reefs (e.g. community metabolism, calcification rates) may need to consider SGD-derived CO2.
Golden, N.H.; Rattner, B.A.; Cohen, J.B.; Hoffman, D.J.; Ottinger, M.A.
2000-01-01
Lead is a known environmental toxicant, and poisoning resulting from the ingestion of lead shot has been well-documented in many species of waterfowl. However, much less is known regarding exposure and effects of free environmental lead in species of birds other than waterfowl. In an attempt to evaluate toxicity of lead to herons and to determine the usefulness of feathers as a non-invasive exposure-monitoring tool, black-crowned night-heron nestlings were dosed with lead to determine its distribution among tissues, and its effects on biochemical biomarkers, growth, and survival. Five-day-old heron nestlings (one per nest) at Chincoteague Bay, Virginia were given a single intra-peritoneal injection of dosing vehicle (control; N=7) or one of three lead solutions (as lead nitrate) (10, 50, or 250 mg/kg body weight of nestling; N=7 per dose) chosen to represent levels below, at, and above those found in moderately-polluted environments. All nestlings treated with lead exhibited dose-dependent inhibition of delta-aminolevulinic acid dehydratase (ALAD) activity compared to controls, and nestlings treated with the highest concentration showed a reduced carcass weight compared to controls. Of several measures of oxidative stress that were analyzed, significant differences were found between low- and high-dosed nestlings in hepatic total thiol and protein-bound sulfhydryl concentrations. No differences in survival were detected between dosed nestlings, controls, or uninjected siblings. Lead concentrations in several matrices, including feathers, are being determined to assess distribution among tissues and will also be examined for relationships with measures of effect.
Custer, Thomas W.; Golden, Nancy H.; Rattner, Barnett A.
2008-01-01
The pattern of elements in nestling black-crowned night-heron feathers from a rural Minnesota colony differed from colonies in industrialized regions of Maryland and Delaware. Except for chromium, however, the differences did not reflect the elements associated with waters and sediments of the Maryland and Delaware colonies. Therefore, elements in water and sediment do not necessarily bioaccumulate in night-heron feathers in relation to potential exposure. Although trace element patterns in feathers indicated differences among geographical locations, they did not separate all locations well and their usefulness as an indicator of natal colony location may be limited.
Third Culture Kid's Effect on Character of Cady Heron in Mean Girls
Hapsari, Laily
2017-01-01
This thesis focuses on the movie, Mean Girls, specifically one of the character, Cady Heron,as a Third Culture Kid trying to adapt in new society. The purpose of this study is to understand the effect of Third Culture Kid in the movie character in socializing with the new surroundings and explain the way how one of the characters in Mean Girls adapts to the new surroundings.The writer uses library research to collect the data with the novel as the main data, and several relevant books, journa...
Prey diversity for Three Species Herons in Pulau Dua Nature Reserve Serang Distrik, Banten Province
Directory of Open Access Journals (Sweden)
DEWI ELFIDASARI
2006-10-01
Full Text Available The diversity of prey consumed by three species herons (Casmerodius albus, Egretta garzetta and Bubulcus ibis was studied in Pulau Dua Nature Reserve Serang, Banten Province using video tapes by following a focal individual for five minutes. In the laboratory the film was analysed every minutes to select complete sequences of feeding behavior in foraging site. There were differences on diversity and size of prey that consumed by three species herons among the different feeding locations. Casmerodius albus which was feeding on mudflat and fisheries consumed Chanos chanos (15.6%, Oreochromis sp (9.4% and Periophtalmus sp. (7.3%, and 36.5% couldn’t be identified. Egretta garzetta was feeding on mudflat, fisheries and rice-field, consumed Periophtalmus sp (15.4%, Mugil dussumeieri (7.9%, Chanos chanos (4.7%, Oreochromis sp (0.5%, including small frog and crustacean (0.5%. Bubulcus ibis was feeding on rice-field and grassland, consumed many variety of insects (92 % and many variety of snail (1.9% in their diet. The insects that B. ibis consumed including grasshopper (26.8%, caterpillar (0.9% and other invertebrates (worm, crustacean that could not be identified (64.3%.
Barata, C; Fabregat, M C; Cotín, J; Huertas, D; Solé, M; Quirós, L; Sanpera, C; Jover, L; Ruiz, X; Grimalt, J O; Piña, B
2010-03-01
Blood biomarkers and levels of major pollutants in eggs and feathers were used to determine pollution effects in nestlings of the Purple Heron Ardea purpurea and the Little Egret Egretta garzetta, sampled on three Ebro River (NE Spain) areas: a reference site, a site affected by the effluents of a chlor-alkali industry and the river Delta. The two impacted heron populations showed mutually different pollutant and response patterns, suggesting different sources of contamination. In the population nesting near the chlor-alkali plant, elevated levels of hexachlorobenzene (HCB) and polychlorobiphenyls (PCBs) in eggs, and mercury in feathers in A. purpurea chicks were related with reduced blood antioxidant defenses and increased levels of micronuclei. In Ebro Delta, high levels of plasmatic lactate dehydrogenase in A. purpurea chicks and high frequency of micronuclei in blood of both species were tentatively associated with intensive agricultural activities taking place in the area. These results provide the first evidence of a biological response in heron chicks to the release of pollutants at a chlor-alkali plant. Copyright (c) 2009 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Horrocks, M.; Nichol, S.; Cockrem, J.; Shane, P.
2008-01-01
Here we present results of analyses of sediment profiles and cores, and coprolites, from Harataonga Bay, Great Barrier Island. Using a range of analyses (sedimentological, plant microfossils, parasitological, microbial, and steroids and myoglobin) we concentrate on human impact and reconstruction of the geomorphology and vegetation of the near-shore environments. Two different sub--environments are represented: dunes and alluvial plain. Dune instability coincides with a major increase in disturbance-related plants (especially ground ferns) as a result of forest clearance. The present form of much of the Harataonga dunes and the swamp at the eastern end of the bay is directly a result of human impact, no earlier than 737 ± 178 14 C yr BP. In the record from the alluvial plain of the main Harataonga watercourse, at the western end of the bay, it is difficult to clearly resolve sedimentary inputs that directly relate to human presence in this former tidal inlet that was open to storm surge and stream floods. The only exception is the slopewash materials forming the terrace surface, sediments of which bear pollen consistent with vegetation disturbance. The landforms are natural but the rate at which the tidal inlet was infilled to form a terrace was accelerated by human activity. The nature and timing of the localised human impacts at Harataonga are consistent with those observed elsewhere on Great Barrier Island and mainland New Zealand. Some of our techniques (e.g. bacteria, steroids) are newly applied to coprolites in New Zealand but none provided any useful information because of poor preservation. (author). 34 refs., 13 figs., 3 tabs
McNamara, M K A; Adlard, R D; Bray, R A; Sasal, P; Cribb, T H
2012-06-01
Species richness and biogeography of the monorchiid genus Hurleytrematoides was studied by the examination of 2834 individuals of 45 species of Chaetodontidae at six major sites in the tropical Indo-West Pacific: Heron Island, Lizard Island, Ningaloo (Western Australia), Palau, New Caledonia and Moorea (French Polynesia). In total, 18 species were distributed among six sites; descriptions are provided for eight new species: H. boucheti n. sp., H. combesi n. sp., H. deblocki n. sp., H. dollfusi n. sp., H. euzeti n. sp., H. kulbickii n. sp., H. pasteuri n. sp., and H. planesi n. sp. Overall richness ranged from zero to five Hurleytrematoides species per chaetodontid species. Seven Hurleytrematoides species were found at only one locality and eleven were found at multiple localities. Only one species, H. morandi, was found at all localities. Individual localities had between six (Moorea) and 10 (Heron Island) species; we attribute Moorea's depauperate parasite fauna to its isolation and distance from the Indo-Philippine centre of biological diversity. Using cluster analysis of 18 species of Hurleytrematoides and 45 species of chaetodontids sampled in the Indo-West Pacific, we show that the localities on the Great Barrier Reef (Heron Island and Lizard Island) and New Caledonia have the most similar chaetodontid and parasite fauna of any locality pairs. Cluster analysis results also show that the similarity of the chaetodontid assemblages at five of the six localities is relatively high and that Ningaloo has the most distinct fauna. Similarity values based on sharing of species of Hurleytrematoides are generally lower than those for their hosts; Moorea, Ningaloo and Palau all have low similarity to New Caledonia and Great Barrier Reef sites. We attribute these distinctions to the differential dispersal capability of the fish and their parasites. Chaetodontids have long-lived mobile pelagic larvae, the dispersal of which would be most affected by prominent
Energy Technology Data Exchange (ETDEWEB)
Peterson, Trevor [Stantec Consulting Services Inc., Topsham, ME (United States); Pelletier, Steve [Stantec Consulting Services Inc., Topsham, ME (United States); Giovanni, Matt [Stantec Consulting Services Inc., Topsham, ME (United States)
2016-01-15
This report summarizes results of a long-term regional acoustic survey of bat activity at remote islands, offshore structures, and coastal sites in the Gulf of Maine, Great Lakes, and mid-Atlantic coast.
Esteban Fernandez-Juricic; Patrick A. Zollner; Cherie LeBlanc Fisher; Lynne M. Westphal
2007-01-01
We assessed the effects of the presence and the frequency of canoe and pedestrian disturbance during two breeding seasons on multiple behavioral responses (scanning, freezing, grooming, sleeping, moving, wing-raising, and standing-up) of Black-crowned Night Heron ( Nycticorax nycticorax ) nestlings in a breeding colony in southeast Chicago. Short-...
Directory of Open Access Journals (Sweden)
Devetaković, J.
2013-12-01
Full Text Available European White Elm is recognized as a rare and endangered species in the forest fund of the Republic of Serbia. During the past century massive drying of elms occurred and the indications of their extinction appeared, which consequently led to a reduction in genetic diversity and the danger of genetic drift. In the area of the Great War Island near Belgrade we found 56 trees of European White Elm that are spatially divided into three subpopulations. In order to assess the genetic potential of European White Elm in the Great War Island and to define adequate conservation measures variability of 14 selected test trees progeny was rated. Results shows that the satisfactory variability within the popoulation exists, which is a good basis for the conservation of genepool available.
Patten, N. L.; Harrison, P. L.; Mitchell, J. G.
2008-09-01
Transmission electron microscopy (TEM) was used to determine whether Acropora muricata coral colonies from the Great Barrier Reef (GBR), Australia, harboured virus-like particles (VLPs). VLPs were present in all coral colonies sampled at Heron Island (southern GBR) and in tagged coral colonies sampled in at least two of the three sampling periods at Lizard Island (northern GBR). VLPs were observed within gastrodermal and epidermal tissues, and on rarer occasions, within the mesoglea. These VLPs had similar morphologies to known prokaryotic and eukaryotic viruses in other systems. Icosahedral VLPs were observed most frequently, however, filamentous VLPs (FVLPs) and phage were also noted. There were no clear differences in VLP size, morphology or location within the tissues with respect to sample date, coral health status or site. The most common VLP morphotype exhibited icosahedral symmetry, 120-150 nm in diameter, with an electron-dense core and an electronlucent membrane. Larger VLPs of similar morphology were also common. VLPs occurred as single entities, in groups, or in dense clusters, either as free particles within coral tissues, or within membrane-bound vacuoles. VLPs were commonly observed within the perinuclear region, with mitochondria, golgi apparatus and crescent-shaped particles frequently observed within close proximity. The host(s) of these observed VLPs was not clear; however, the different sizes and morphologies of VLPs observed within A. muricata tissues suggest that viruses are infecting either the coral animal, zooxanthellae, intracellular bacteria and/or other coral-associated microbiota, or that the one host is susceptible to infection from more than one type of virus. These results add to the limited but emerging body of evidence that viruses represent another potentially important component of the coral holobiont.
Orality and Agency: Reading an Irish Autobiography from the Great Blasket Island
Directory of Open Access Journals (Sweden)
John Eastlake
2009-03-01
Full Text Available The Islandman (1934 by Tomás Ó Criomhthain is the first autobiography to be published by a member of the Irish-speaking community on the Great Blasket Island. This book, whose author was a member of a largely oral community and a participant in many communal oral traditions, has often been read as the work of a passive informant rather than that of an active author. By examining the critical attitudes towards Ó Criomhthain and his work, particularly those that associate orality with passivity and communalism and deny textual authority to members of largely oral communities, this article identifies a crucial tension between opposing readings of this text: reading Ó Criomhthain as a representative type and reading Ó Criomhthain as an author. By developing the latter reading of the text, the reader may recognize the agency of the author-subject of a collaborative autobiography that has its roots in a life lived largely through orality.
Nest survival is influenced by parental behaviour and heterospecifics in a mixed-species colony
Brussee, Brianne E.; Coates, Peter S.; Hothem, Roger L.; Howe, Kristy; Casazza, Michael L.; Eadie, John M.
2016-01-01
Studies of avian nest success often focus on examining influences of variation in environmental and seasonal factors. However, in-depth evaluations can also incorporate variation in individual incubation behaviour to further advance our understanding of avian reproductive ecology. We examined these relationships in colonially nesting Black-crowned Night-Herons Nycticorax nycticorax using intensive video-monitoring methods to quantify incubation behaviours. We modelled nest survival as a function of both extrinsic factors and incubation behaviours over a 3-year period (2010–12) on Alcatraz Island, USA. Model-averaged parameter estimates indicated that nest survival increased as a function of greater incubation constancy (% of time spent incubating eggs within a 24-h period), and average daily precipitation throughout the nesting stage. Common Ravens Corvus corax are the only known nest predator of Night-Herons on Alcatraz Island, as on many other coastal Pacific islands. We also investigated the effects of heterospecific nesting of California Gulls Larus californicus and Western Gulls Larus occidentalis in a mixed-species colony with Night-Herons, based on nesting proximity data collected over a 2-year period (2011–12). This second analysis indicated that, in addition to incubation behaviours, nesting heterospecifics are an important factor for explaining variation in Night-Heron nest survival. However, contrary to our original expectation, we found that Night-Herons experienced increased nest survival with increasing distance from gull colony boundaries. These results may apply to other areas with multiple colonial nesting species and similar predator communities and climatic patterns.
Island dynamics and Minoan expansion in the Aegean: the Kythera Island Project
Directory of Open Access Journals (Sweden)
Cyprian Broodbank
1999-11-01
Full Text Available In recent years archaeologists have become increasingly interested in the investigation of island societies. At a global level, discoveries in the Pacific, Caribbean, Mediterranean and elsewhere have greatly improved our understanding of the antiquity and dynamics of island life. Now archaeologists at the Institute, together with other colleagues, have embarked on a long-term interdisciplinary study of the island of Kythera in the Aegean.
Sandhill cranes browse for food near VAB
2000-01-01
A family of sandhill cranes searches for food on the grounds near the Vehicle Assembly Building. The cranes have been a constant sight in the Launch Complex 39 area during the month of May. Sandhill cranes range from Siberia, Alaska and Arctic islands to Michigan, Minnesota and California; from Florida to Texas. They prefer large freshwater marshes, prairie ponds and marshy tundra. KSC shares a boundary with the Merritt Island National Wildlife Refuge, which encompasses 92,000 acres that are a habitat for more than 331 species of birds, 31 mammals, 117 fishes, and 65 amphibians and reptiles. The marshes and open water of the refuge provide wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds, as well as a variety of insects.
Sandhill cranes hunting food at KSC
2000-01-01
A pair of Sandhill Cranes searches for food with their still- fluffy fledgling close by. The trio have been seen wandering the grassy areas in the KSC Launch Complex 39 area. Sandhill cranes range from Siberia, Alaska and Arctic islands to Michigan, Minnesota and California; from Florida to Texas. They prefer large freshwater marshes, prairie ponds and marshy tundra. KSC shares a boundary with the Merritt Island National Wildlife Refuge, which encompasses 92,000 acres that are a habitat for more than 331 species of birds, 31 mammals, 117 fishes, and 65 amphibians and reptiles. The marshes and open water of the refuge provide wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds, as well as a variety of insects.
Directory of Open Access Journals (Sweden)
Madeleine J.H. van Oppen
2015-07-01
Full Text Available Coral reefs surrounding the islands lying close to the coast are unique to the Great Barrier Reef (GBR in that they are frequently exposed to disturbance events including floods caused by cyclonic rainfall, strong winds and occasional periods of prolonged above-average temperatures during summer. In one such group of islands in the southern GBR, the Keppel Island archipelago, climate-driven disturbances frequently result in major coral mortality. Whilst these island reefs have clearly survived such dramatic disturbances in the past, the consequences of extreme mortality events may include the loss of genetic diversity, and hence adaptive potential, and a reduction in fitness due to inbreeding, especially if new recruitment from external sources is limited. Here we examined the level of isolation of the Keppel Island group as well as patterns of gene flow within the Keppel Islands using 10 microsatellite markers in nine populations of the coral, Acropora millepora. Bayesian cluster analysis and assignment tests indicated gene flow is restricted, but not absent, between the outer and inner Keppel Island groups, and that extensive gene flow exists within each of these island groups. Comparison of the Keppel Island data with results from a previous GBR-wide study that included a single Keppel Island population, confirmed that A. millepora in the Keppel Islands is genetically distinct from populations elsewhere on the GBR, with exception of the nearby inshore High Peak Reef just north of the Keppel Islands. We compared patterns of genetic diversity in the Keppel Island populations with those from other GBR populations and found them to be slightly, but significantly lower, consistent with the archipelago being geographically isolated, but there was no evidence for recent bottlenecks or deviation from mutation-drift equilibrium. A high incidence of private alleles in the Keppel Islands, particularly in the outer islands, supports their relative
Energy Technology Data Exchange (ETDEWEB)
Wienburg, Claire L.; Shore, Richard F
2004-11-01
Large scale temporal and spatial changes in the exposure of terrestrial vertebrates to PCBs have been monitored in the UK by measuring liver residues in sparrowhawks (Accipiter nisus), kestrels (Falco tinnunculus) and grey herons (Ardea cinerea) from throughout the country. Residues in the three species are typically characterised by large intra- and inter-specific variation. Data for 306 sparrowhawks, 186 kestrels and 47 herons collected between 1992 and 1997 as part of a national Predatory Bird Monitoring Scheme were examined to determine how much of this variation was explained by body condition, age and sex, rather than other factors. In all three species, body condition was the single most important factor and accounted for up to 49% of the variation in PCB liver residues; starved birds had the highest liver concentrations. Age and sex were also significant but of lesser importance. Adult sparrowhawks and kestrels had liver PCB residues that were 2 to 10-fold higher than in first-year birds. Sex did not affect residue magnitude in a consistent manner. PCB concentrations in the liver were higher in males than females in both first-year and adult kestrels and in first-year sparrowhawks, but adult female sparrowhawks had similar PCB residues to adult males. Liver residues also varied seasonally. PCB concentrations in first-year sparrowhawks increased during the first year following fledging and a similar pattern was detected in adult female sparrowhawks following egg laying. When these physiological factors were taken into account, it was evident that while kestrels with high fat scores had significantly lower PCB concentrations than either sparrowhawks or herons, liver residues were similar in all three species when birds were in a starved condition. Overall during 1992-1997, the combined influence of body condition, age and sex explained more of the variation in liver PCB concentrations than species differences or other factors, such as geographical variation
A male hooded merganser swims in the waters of KSC
1999-01-01
The distinctive fan-shaped, black-bordered crest and striped breast identify this hooded merganser, swimming in the waters of the Merritt Island National Wildlife Refuge at Kennedy Space Center. Usually found from Alaska and Canada south to Nebraska, Oregon and Tennessee, hooded mergansers winter south to Mexico and the Gulf Coast, including KSC. The open water of the refuge provides wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds. The 92,000-acre refuge is also habitat for more than 310 species of birds, 25 mammals, 117 fishes and 65 amphibians and reptiles.
A merganser swims in the waters of KSC
1999-01-01
A young female red-breasted merganser swims in the quicksilver water of the Merritt Island National Wildlife Refuge, which shares a boundary with Kennedy Space Center. Usually found from Alaska and Canada south to Nebraska, Oregon and Tennessee, hooded mergansers winter south to Mexico and the Gulf Coast, including KSC. The open water of the refuge provides wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds. The 92,000- acre refuge is also habitat for more than 310 species of birds, 25 mammals, 117 fishes and 65 amphibians and reptiles.
Keane, S.E.; Fraser, J.D.; Buckley, P.A.
2002-01-01
The large population of breeding herring gulls and great black-backed gulls on South Monomoy Island, Cape Cod, Massachusetts has been thought to negatively affect the breeding success of the threatened piping plover. Following the Piping Plover Recovery Plan's call for gull colonies to be removed from piping plover breeding sites, in 1996, the USFWS conducted gull removal on part of South Monomoy Island. We determined relative gull abundance on South Monomoy Island from 1998-2000 by counting gulls within 100-m radius plots located on the shoreline. We quantified piping plover behavior and habitat use by conducting instantaneous and 5-minute behavioral observations. We quantified characteristics of piping plover nesting habitat by measuring characteristics along random transects. We measured gull abundance, beach width, and prey abundance, and then used logistic regression to determine what habitat characteristics influenced piping plover nesting area selection. We monitored piping plover reproductive success and population fluctuations on South Monomoy Island. Gull abundance in the gull-removal area was lower than gull abundance in the reference area throughout the piping plover breeding season. The difference in gull abundance between the areas did not affect piping plover behavior, nest success, chick survival, or productivity. We found that gull removal did not result in an increased piping plover population on the island. In both management areas, prenesting plovers preferred to forage in moist substrate habitats. Wide backshore and open vegetation habitats characterized nesting areas. Broods spent most of their time foraging and preferred moist substrate habitats when available. Plovers were not prevented from occupying more suitable habitat by large gulls. Fewer large gulls were observed near prenesting plovers, plover nests, and plover broods than near random plots. Fewer large gulls were observed in plover nesting areas than in unused areas when the nesting
Great Blue Heron Range - CWHR [ds609
California Natural Resource Agency — Vector datasets of CWHR range maps are one component of California Wildlife Habitat Relationships (CWHR), a comprehensive information system and predictive model for...
Directory of Open Access Journals (Sweden)
Devetaković Jovana
2013-01-01
Full Text Available The European White Elm (Ulmus effusa Willd. is indicated as a rare and endangered species in the growing stock of the Republic of Serbia. In the area of Great War Island, its natural populations were reduced to 56 registered trees, which occur in three spatially isolated subpopulations. On the basis of the research conducted on the level of variability of adaptible morphometric characteristics of leaves from 14 selected test trees of European White Elm, it can be concluded that the degree of interpopulation variability is satisfactory, which is a good basis for the conservation of the available gene pool.
Stepping-stones to the Edge: Artistic Expressions of Islandness in an Ocean of Islands
Directory of Open Access Journals (Sweden)
Laurie Brinklow
2013-05-01
Full Text Available Since the earliest of times, islands have captured the artistic imagination—and, often, for the artist who finds his or her muse in being ‘islanded’, the smaller the island the better. Archipelagos offer an ideal setting for artists who take their inspiration from place: on small islands off islands they can experience an intensity of island living they might not otherwise have on a main island: boundedness and connection, isolation and community. This paper examines expressions of islandness by artists who live on islands off islands that are poles apart—‘archipelagos’ of the Canadian North Atlantic and the Great Southern Ocean. It draws upon interviews with those artists and writers to consider the nature of humans’ attachment and attraction to islands, exploring through the lens of phenomenology what Stratford et al. call the “entanglement between and among islands”.
MARINE BOTTOM COMMUNITIES OF BLOCK ISLAND WATERS
The sea has long been an integral part of Block Island's natural history, beginning when the rising sea surrounded the high spot on a Pleistocene terminal moraine that became Block Island. The southern New England continental shelf, which lies around Block Island, and the Great S...
2004-01-01
KENNEDY SPACE CENTER, FLA. -- Three male and one female hooded mergansers swim in the quicksilver water of the Merritt Island National Wildlife Refuge, which shares a boundary with Kennedy Space Center. Usually found from Alaska and Canada south to Nebraska, Oregon and Tennessee, hooded mergansers winter south to Mexico and the Gulf Coast, including KSC. The open water of the refuge provides wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds. The 92,000-acre refuge is also habitat for more than 310 species of birds, 25 mammals, 117 fishes and 65 amphibians and reptiles.
Hooded mergansers swim in the waters of KSC
1999-01-01
A male and two female hooded mergansers swim in the waters of the Merritt Island National Wildlife Refuge at Kennedy Space Center. The male displays its distinctive fan-shaped, black-bordered crest. Usually found from Alaska and Canada south to Nebraska, Oregon and Tennessee, hooded mergansers winter south to Mexico and the Gulf Coast, including KSC. The open water of the refuge provides wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds. The 92,000-acre refuge is also habitat for more than 310 species of birds, 25 mammals, 117 fishes and 65 amphibians and reptiles.
A female hooded merganser swims in the waters of KSC
1999-01-01
A female hooded merganser swims solo in the waters of the Merritt Island National Wildlife Refuge at Kennedy Space Center. The male is distinguished by a fan-shaped, black-bordered crest and striped breast. Usually found from Alaska and Canada south to Nebraska, Oregon and Tennessee, hooded mergansers winter south to Mexico and the Gulf Coast, including KSC. The open water of the refuge provides wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds. The 92,000-acre refuge is also habitat for more than 310 species of birds, 25 mammals, 117 fishes and 65 amphibians and reptiles.
Reliving Island Life: Staging Stories of the Blasket Islands
Directory of Open Access Journals (Sweden)
Daithí Kearney
2017-10-01
Full Text Available The Blasket Islands are located off the south-west coast of Ireland. No longer inhabited, the Great Blasket Island and its distinctive culture have been documented by a variety of writers and are celebrated today in an interpretative centre on the mainland and in performances by Siamsa Tíre, The National Folk Theatre of Ireland. “Siamsa” developed from local initiatives in North Kerry during the early 1960s and is located today in Tralee, Co. Kerry. It aims to present Irish folklore and folk culture through the medium of theatre involving music, song, dance and mime but invariably no dialogue. In this paper, I focus on the production Oiléan, based loosely on the stories of the Blasket Islanders, which was initially devised as part of the fiftieth anniversary commemoration of the departure of the last inhabitants of the islands in 2003.
Protein (Cyanobacteria): 553736347 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available WP_023070590.1 NZ_AWNH01000001 1117:18358 ... 1150:46430 1301283:66978 ... 47251:4271 1385935:793 ... dna alkyla...tion repair enzyme Leptolyngbya sp. Heron Island J MTADQISKTLRDLADPAIAEHSQRFFKTGKGE
The Galapagos Islands: Darwin and Modern Conservation Stories
Burr, Susan
2010-01-01
The author visited the Galapagos Islands in 2009 and here looks at their biodiversity through pictures taken then. The diverse habitats of the Islands are reflected in the great diversity of flora and fauna found on them, with many species endemic to the Islands. The stories of the land iguanas, control of introduced species and the giant…
International Nuclear Information System (INIS)
Lewis, S.E.; Brodie, J.E.; McCulloch, M.T.; Mallela, J.; Jupiter, S.D.; Stuart Williams, H.; Lough, J.M.; Matson, E.G.
2012-01-01
Coral cores were collected along an environmental and water quality gradient through the Whitsunday Island group, Great Barrier Reef (Australia), for trace element and stable isotope analysis. The primary aim of the study was to examine if this gradient could be detected in coral records and, if so, whether the gradient has changed over time with changing land use in the adjacent river catchments. Y/Ca was the trace element ratio which varied spatially across the gradient, with concentrations progressively decreasing away from the river mouths. The Ba/Ca and Y/Ca ratios were the only indicators of change in the gradient through time, increasing shortly after European settlement. The Mn/Ca ratio responded to local disturbance related to the construction of tourism infrastructure. Nitrogen isotope ratios showed no apparent trend over time. This study highlights the importance of site selection when using coral records to record regional environmental signals.
Sullivan Sealey, Kathleen; Bowleg, John
2017-04-01
Great Exuma has been a UNESCO Eco-hydrology Project Site with a focus on coastal restoration and flood management. Great Exuma and its largest settlement, George Town, support a population of just over 8.000 people on an island dominated by extensive coastal wetlands. The Victoria Pond Eco-Hydrology project restored flow and drainage to highly-altered coastal wetlands to reduce flooding of the built environment as well as regain ecological function. The project was designed to show the value of a protected wetland and coastal environment within a populated settlement; demonstrating that people can live alongside mangroves and value "green" infrastructure for flood protection. The restoration project was initiated after severe storm flooding in 2007 with Tropical Storm Noel. In 2016, the passing of Hurricane Matthew had unprecedented impacts on the coastal communities of Great Exuma, challenging past practices in restoration and flood prevention. This talk reviews the loss of natural capital (for example, fish populations, mangroves, salt water inundation) from Hurricane Matthew based on a rapid response survey of Great Exuma. The surprisingly find was the impact of storm surge on low-lying areas used primarily for personal farms and small-scale agriculture. Although women made up the overwhelming majority of people who attended Coastal Restoration workshops, women were most adversely impacted by the recent hurricane flooding with the loss of their small low-lying farms and gardens. Although increasing culverts in mangrove creeks in two areas did reduce building flood damage, the low-lying areas adjacent to mangroves, mostly ephemeral freshwater wetlands, were inundated with saltwater, and seasonal crops in these areas were destroyed. These ephemeral wetlands were designed as part of the wetland flooding system, it was not known how important these small areas were to artisanal farming on Great Exuma. The size and scope of Hurricane Matthew passing through the
Nichol, Scott L.; Lian, Olav B.; Carter, Charles H.
2003-01-01
A semi-continuous sheet of granule to cobble-size clasts forms a distinctive deposit on sand dunes located on a coastal barrier in Whangapoua Bay, Great Barrier Island, New Zealand. The gravel sheet extends from the toe of the foredune to 14.3 m above mean sea level and 200 m landward from the beach. Clasts are rounded to sub-rounded and comprise lithologies consistent with local bedrock. Terrestrial sources for the gravel are considered highly unlikely due to the isolation of the dunes from hillslopes and streams. The only source for the clasts is the nearshore to inner shelf of Whangapoua Bay, where gravel sediments have been previously documented. The mechanism for transport of the gravel is unlikely to be storm surge due to the elevation of the deposit; maximum-recorded storm surge on this coast is 0.8 m above mean high water spring tide. Aeolian processes are also discounted due to the size of clasts and the elevation at which they occur. Tsunami is therefore considered the most probable mechanism for gravel transport. Minimum run-up height of the tsunami was 14.3 m, based on maximum elevation of gravel deposits. Optical ages on dune sands beneath and covering the gravel allow age bracketing to 0-4.7 ka. Within this time frame, numerous documented regional seismic and volcanic events could have generated the tsunami, notably submarine volcanism along the southern Kermadec arc to the east-southeast of Great Barrier Island where large magnitude events are documented for the late Holocene. Radiocarbon ages on shell from Maori middens that appear to have been reworked by tsunami run-up constrain the age of this event to post ca. 1400 AD. Regardless of the precise age of this event, the well-preserved nature of the Whangapoua gravel deposit provides for an improved understanding of the high degree of spatial variability in tsunami run-up.
Hothem, R.L.; Roster, D.L.; King, K.A.; Keldsen, T.J.; Marois, Katherine C.; Wainwright, S.E.
1995-01-01
Between 1989 and 1991, reproduction by black-crowned night-herons (Nycticorax nycticorax) and snowy egrets (Egretta thula) was studied at sites in San Francisco Bay. Eggs were collected from these and other bay sites and from South Wilbur Flood Area, a reference site in California's San Joaquin Valley. Eggs were analyzed for inorganic trace elements, organochlorine pesticides, and polychlorinated biphenyls (PCBs). Results were compared among sites and years and with results of previous studies. There was some evidence of impaired reproduction, but concentrations of contaminants were generally lower than threshold levels for such effects. Egg hatchability was generally good, with predation being the factor that most limited reproductive success. Mean PCB concentrations were generally higher in eggs from the south end of San Francisco Bay than from the north, but the only temporal change, an increase, was observed at Alcatraz Island. There were spatial differences for p,p'-DDE in night-heron eggs in 1990, but the highest mean concentration of DDE was in night-heron eggs from South Wilbur in 1991. Temporal declines in maximum concentrations of DDE in eggs were observed in the bay, but means did not change significantly over time, At Bair Island in the southern end of the bay, mean concentrations of mercury decreased while selenium increased in night-heron eggs over time, but there were no clear bay-wide spatial or temporal trends for either element.
2010-06-17
... Settlement; Great Lakes Container Corporation Superfund Site, Coventry Rhode Island AGENCY: Environmental... and future response costs concerning the Great Lakes Container Corporation Superfund Site, located in...), Boston, MA 02109-3912, (617) 918-1216. Comments should reference the Great Lakes Container Corporation...
Directory of Open Access Journals (Sweden)
Michael A. Tabak
2015-01-01
Full Text Available Non-native rats (Rattus spp. threaten native island species worldwide. Efforts to eradicate them from islands have increased in frequency and become more ambitious in recent years. However, the long-term success of some eradication efforts has been compromised by the ability of rats, particularly Norway rats (Rattus norvegicus which are good swimmers, to recolonize islands following eradications. In the Falkland Islands, an archipelago in the South Atlantic Ocean, the distance of 250 m between islands (once suggested as the minimum separation distance for an effective barrier to recolonization has shown to be insufficient. Norway rats are present on about half of the 503 islands in the Falklands. Bird diversity is lower on islands with rats and two vulnerable passerine species, Troglodytes cobbi (the only endemic Falkland Islands passerine and Cinclodes antarcticus, have greatly reduced abundances and/or are absent on islands with rats. We used logistic regression models to investigate the potential factors that may determine the presence of Norway rats on 158 islands in the Falkland Islands. Our models included island area, distance to the nearest rat-infested island, island location, and the history of island use by humans as driving variables. Models best supported by data included only distance to the nearest potential source of rats and island area, but the relative magnitude of the effect of distance and area on the presence of rats varied depending on whether islands were in the eastern or western sector of the archipelago. The human use of an island was not a significant parameter in any models. A very large fraction (72% of islands within 500 m of the nearest potential rat source had rats, but 97% of islands farther than 1,000 m away from potential rat sources were free of rats.
Rudiastuti, A. W.; Munawaroh; Setyawan, I. E.; Pramono, G. H.
2018-04-01
Sustainable coastal management is playing an important role in coastal resources conservation, particularly on small islands. Karimata archipelago has unique characteristics and great potential to be developed as a tourism object, one of which is Karimata Island as the largest island and also reserve area. The concept of ecotourism focuses on the ecology conservation, economic benefits, and social life. Ecotourism aims to build sustainable tourism that provides economically viable and social benefits to the community. This study aims to develop coastal management strategy based on ecotourism at Karimata Island. Spatial approaching through coastal type was done. Qualitative descriptive analysis and SWOT are used to develop sustainable management strategies for the coast of Karimata Island, where the opportunities and challenges to the development of coastal ecotourism Karimata Island also included. If this potential is optimally utilized, it can be relied as an economic opportunity for local communities. Structurally shaped coast, marine depositional coast and coast build by organism are several of coastal types found at Karimata Island. Coastal ecosystems inhabited Karimata Island are mangroves, coral reefs, and macro-algae. Karimata Island have not been optimally utilized for tourist destinations. The biggest obstacle encountered is the accessibility from Kalimantan or other island at Karimata islands. Several problems related to the utilization of coastal resources were found such as mangrove and coral reef damage, also regulation that less supportive. The results of this study are expected to provide an overview of solutions for the development of coastal tourism potentials in Karimata Island.
Henny, Charles J.; Anderson, T.W.; Crayon, J.J.
2008-01-01
The Salton Sea is a highly eutrophic, hypersaline terminal lake that receives inflows primarily from agricultural drainages in the Imperial and Coachella valleys. Impending reductions in water inflow at Salton Sea may concentrate existing contaminants which have been a concern for many years, and result in higher exposure to birds. Thus, waterbird eggs were collected and analyzed in 2004 and compared with residue concentrations from earlier years; these data provide a base for future comparisons. Eggs from four waterbird species (black-crowned night-heron [Nycticorax nycticorax], great egret [Ardea alba], black-necked stilt [Himantopus mexicanus], and American avocet [Recurvirostra Americana]) were collected. Eggs were analyzed for organochlorine pesticides, polychlorinated biphenyls (PCBs), metals, and trace elements, with current results compared to those reported for eggs collected from the same species and others during 1985a??1993. The two contaminants of primary concern were p,pa??-DDE (DDE) and selenium. DDE concentrations in night-heron and great egret eggs collected from the northwest corner of Salton Sea (Whitewater River delta) decreased 91 and 95%, respectively, by 2004, with a concomitant increase in eggshell thickness for both species. Decreases in bird egg DDE levels paralleled those in tissues of tilapia (Oreochromis mossambicus ?? O. urolepis), an important prey species for herons and egrets. Despite most nests of night-herons and great egrets failing in 2004 due to predation, predicted reproductive effects based on DDE concentrations in eggs were low or negligible for these species. The 2004 DDE findings were in dramatic contrast to those in the past decade, and included an 81% decrease in black-necked stilt eggs, although concentrations were lower historically than those reported in night-herons and egrets. Selenium concentrations in black-necked stilt eggs from the southeast corner of Salton Sea (Davis Road) were similar in 1993 and 2004, with 4
The zooplankton of Mgazana, a mangrove estuary in Transkei
African Journals Online (AJOL)
continent. The estuary is in an excellent state of preservation and all three species of mangrove trees which occur south of K.osi Bay (260 54' S) are recorded here (Avicennia marina, Bruguieria gymnorhiza .... of Heron Island a shallow ford or drift occurs where depth may be less than 0,25 m at low tide. Above the island the ...
Dioxin, PCB and PBDE exposure in grey heron (ardea cinerea)
Energy Technology Data Exchange (ETDEWEB)
Fernandes, A.; Thompson, H.; Dsilva, K.; White, S.; Rose, M. [Central Science Laboratory, York (United Kingdom)
2004-09-15
In the United Kingdom recent investigations have detected elevated levels of mortality and bone disease in grey herons at an established colony in Nottinghamshire along the course of the river Trent (4). The causes of mortality are unclear but deformities recorded in the other birds include multiple fracture of the tarsus, tibia and metacarpal bones. These findings have prompted a pilot study into assessing the level of environmental contaminants in the tissue and eggs of these birds. Two classes of contaminants have the potential to cause the deformities observed in the birds - heavy metals such as selenium, cadmium, arsenic mercury and lead, and halogenated organic contaminants such as dioxins, and PCBs. This paper discusses levels of these contaminants in the samples of eggs taken from the colony. Additional samples of eggs were also collected from a colony in Hertfordshire and from a site in the north of the country. The discussion will be limited to the halogenated organic contaminants as the levels of heavy metals were similar in all sites and were generally at or above background levels. Given the increased utilisation of brominated flame retardant chemicals over the last decade and the similarities in structure and environmental persistence of some of these compounds to the dioxins and PCBs, polybrominated diphenylethers (PBDEs) were also measured in the samples.
Marine flora of Nicobar group of islands in Anadman Sea
Digital Repository Service at National Institute of Oceanography (India)
Jagtap, T.G.
The marine flora of 4 islands comprised 66 species of marine algae, 7 of seagrasses, and 10 of mangroves. Maximum number of marine algae (6) and mangroves (9) were reported from Great Nicobar Island, whereas more (7) species of seagrasses were...
Composite aster Inula L. (Asteraceae: a new generic record for Nicobar Islands, India
Directory of Open Access Journals (Sweden)
Rathinam Sathiyaseelan
2016-11-01
Full Text Available This paper presents a new generic record for the flora of Nicobar Islands, Inula L. (Asteraceae represented by the species Inula cappa (Buch.-Ham. ex D.Don DC., collected from Chowra Island, Great Nicobar Islands.
Energy Technology Data Exchange (ETDEWEB)
Sieglitz, Greg
2001-03-01
The Big Island site is located in the McKenzie River flood plain, containing remnant habitats of what was once more common in this area. A diverse array of flora and fauna, representing significant wildlife habitats, is present on the site. Stands of undisturbed forested wetlands, along with riparian shrub habitats and numerous streams and ponds, support a diversity of wildlife species, including neotropical migratory songbirds, raptors, mammals, reptiles, and amphibians (including two State-listed Sensitive Critical species). The project is located in eastern Springfield, Oregon (Figure 1). The project area encompasses 187 acres under several ownerships in Section 27 of Township 17S, Range 2W. Despite some invasion of non-native species, the site contains large areas of relatively undisturbed wildlife habitat. Over several site visits, a variety of wildlife and signs of wildlife were observed, including an active great blue heron rookery, red-Legged frog egg masses, signs of beaver, and a bald eagle, Wildlife habitat values resulting from the purchase of this site will contribute toward the goal of mitigating for habitat lost as outlined in the Bonneville Power Administration's (BPA) Mitigation and Enhancement Plan for the Willamette River Basin. Under this Plan, mitigation goals and objectives were developed as a result of the loss of wildlife habitat due to the construction of Federal hydroelectric facilities in the Willamette River Basin. Results of the Habitat Evaluation Procedures (HEP) will be used to: (1) determine the current habitat status of the study area and habitat enhancement potential of the site consistent with wildlife mitigation goals and objectives; and (2) develop a management plan for the area.
Energy Technology Data Exchange (ETDEWEB)
Anders, R.
2013-05-01
The Long Island Solar Farm (LISF) is a remarkable success story, whereby very different interest groups found a way to capitalize on unusual circumstances to develop a mutually beneficial source of renewable energy. The uniqueness of the circumstances that were necessary to develop the Long Island Solar Farm make it very difficult to replicate. The project is, however, an unparalleled resource for solar energy research, which will greatly inform large-scale PV solar development in the East. Lastly, the LISF is a superb model for the process by which the project developed and the innovation and leadership shown by the different players.
Gangoso, Laura; López-López, Pascual; Grande, Juan Manuel; Mellone, Ugo; Limiñana, Rubén; Urios, Vicente; Ferrer, Miguel
2013-01-01
The adaptive transition between behavioral strategies, such as the shift from migratoriness to sedentariness, remains an outstanding question in evolutionary ecology. Density-dependent variation in the age of first breeding has been proposed as a feasible mechanism through which long-lived migratory birds with deferred sexual maturity should become sedentary to persist on islands. Although this pattern seems to hold for most raptors and herons, a few exceptions have been identified. One of these exceptions is the Eleonora's falcon, a long-distance migratory bird, which shows one of the most peculiar adaptations in the timing of reproduction and food requirements among raptors. Here, we compiled data concerning demography, banding recoveries and satellite tracking of Eleonora's falcons to discuss likely explanations for the exceptional behavior of this insular long-distance migratory species. New data reveal that Eleonora's falcons do return to the natal colonies in their first year and young birds are able to breed. However, in contrast to previous hypothesis, the highly specialized strategy of this and other ecologically similar species, as well as the virtual lack of food during winter at breeding areas prevent them from becoming sedentary on islands. Although the ultimate mechanisms underlying the process of sedentarization remain poorly understood, the evidence provided reveal the existence of important trade-offs associated with ecological specialization that may become particularly relevant in the present context of global change.
Great deal achieved at Cape's nuclear island
International Nuclear Information System (INIS)
Anon.
1979-01-01
Since the civil engineering contract commenced a great deal has been achieved at Escom's Koeberg nuclear power station north of Cape Town. About 50 percent of the civil work has now been done and the entire project remains on schedule for a January 1982 start-up on nuclear reactor unit number one and a January 1983 start-up on unit two. Final handover is scheduled for January 1984. Completion of the civil works is scheduled for December 1981. The construction of the Koeberg nuclear power station is discussed, as well as the contractors for the civil engineering work
Directory of Open Access Journals (Sweden)
Sarah Hamylton
Full Text Available A geomorphic assessment of reef system calcification is conducted for past (3200 Ka to present, present and future (2010-2100 time periods. Reef platform sediment production is estimated at 569 m3 yr-1 using rate laws that express gross community carbonate production as a function of seawater aragonite saturation, community composition and rugosity and incorporating estimates of carbonate removal from the reef system. Key carbonate producers including hard coral, crustose coralline algae and Halimeda are mapped accurately (mean R2 = 0.81. Community net production estimates correspond closely to independent census-based estimates made in-situ (R2 = 0.86. Reef-scale outputs are compared with historic rates of production generated from (i radiocarbon evidence of island deposition initiation around 3200 years ago, and (ii island volume calculated from a high resolution island digital elevation model. Contemporary carbonate production rates appear to be remarkably similar to historical values of 573 m3 yr-1. Anticipated future seawater chemistry parameters associated with an RCP8.5 emissions scenario are employed to model rates of net community calcification for the period 2000-2100 on the basis of an inorganic aragonite precipitation law, under the assumption of constant benthic community character. Simulations indicate that carbonate production will decrease linearly to a level of 118 m3 yr-1 by 2100 and that by 2150 aragonite saturation levels may no longer support the positive budgetary status necessary to sustain island accretion. Novel aspects of this assessment include the development of rate law parameters to realistically represent the variable composition of coral reef benthic carbonate producers, incorporation of three dimensional rugosity of the entire reef platform and the coupling of model outputs with both historical radiocarbon dating evidence and forward hydrochemical projections to conduct an assessment of island evolution
Hamylton, Sarah
2014-01-01
A geomorphic assessment of reef system calcification is conducted for past (3200 Ka to present), present and future (2010-2100) time periods. Reef platform sediment production is estimated at 569 m3 yr-1 using rate laws that express gross community carbonate production as a function of seawater aragonite saturation, community composition and rugosity and incorporating estimates of carbonate removal from the reef system. Key carbonate producers including hard coral, crustose coralline algae and Halimeda are mapped accurately (mean R2 = 0.81). Community net production estimates correspond closely to independent census-based estimates made in-situ (R2 = 0.86). Reef-scale outputs are compared with historic rates of production generated from (i) radiocarbon evidence of island deposition initiation around 3200 years ago, and (ii) island volume calculated from a high resolution island digital elevation model. Contemporary carbonate production rates appear to be remarkably similar to historical values of 573 m3 yr-1. Anticipated future seawater chemistry parameters associated with an RCP8.5 emissions scenario are employed to model rates of net community calcification for the period 2000-2100 on the basis of an inorganic aragonite precipitation law, under the assumption of constant benthic community character. Simulations indicate that carbonate production will decrease linearly to a level of 118 m3 yr-1 by 2100 and that by 2150 aragonite saturation levels may no longer support the positive budgetary status necessary to sustain island accretion. Novel aspects of this assessment include the development of rate law parameters to realistically represent the variable composition of coral reef benthic carbonate producers, incorporation of three dimensional rugosity of the entire reef platform and the coupling of model outputs with both historical radiocarbon dating evidence and forward hydrochemical projections to conduct an assessment of island evolution through time
Mora, Miguel A.
1996-01-01
Eggs from four aquatic bird species nesting in the Lower Laguna Madre, Texas, were collected to determine differences and similarities in the accumulation of congener-specific polychlorinated biphenyls (PCBs) and to evaluate PCB impacts on reproduction. Because of the different toxicities of PCB congeners, it is important to know which congeners contribute most to total PCBs. The predominant PCB congeners were 153, 138, 180, 110, 118, 187, and 92. Collectively, congeners 153, 138, and 180 accounted for 26 to 42% of total PCBs. Congener 153 was the most abundant in Caspian terns (Sterna caspia) and great blue herons (Ardea herodias) and congener 138 was the most abundant in snowy egrets (Egretta thula) and tricolored herons (Egretta tricolor). Principal component analysis indicated a predominance of higher chlorinated biphenyls in Caspian terns and great blue herons and lower chlorinated biphenyls in tricolored herons. Snowy egrets had a predominance of pentachlorobiphenyls. These results suggest that there are differences in PCB congener patterns in closely related species and that these differences are more likely associated with the species' diet rather than metabolism. Total PCBs were significantly greater (p birds from the Lower Laguna Madre were below concentrations known to affect bird reproduction.
Observations ornithologiques au Sénégal
Rose, John; Virondeau, Anthony; Magne, Jean-François; Diop, Moussa Séga; Hooijmeijer, J.C.E.W.; Barlow, Clive
2016-01-01
Ornithological observations in Senegal. We present observations made in Senegal in January 2015. Five sightings of rare species are described: a White-crested Tiger Heron Tigriornis leucolopha in the Saloum delta, a Shorteared Owl Asio flammeus in Madeleine Islands National Park, an Egyptian
Sanctuaries for lake trout in the Great Lakes
Stanley, Jon G.; Eshenroder, Randy L.; Hartman, Wilbur L.
1987-01-01
Populations of lake trout, severely depleted in Lake Superior and virtually extirpated from the other Great Lakes because of sea lamprey predation and intense fishing, are now maintained by annual plantings of hatchery-reared fish in Lakes Michigan, Huron, and Ontario and parts of Lake Superior. The extensive coastal areas of the Great Lakes and proximity to large populations resulted in fishing pressure on planted lake trout heavy enough to push annual mortality associated with sport and commercial fisheries well above the critical level needed to reestablish self-sustaining stocks. The interagency, international program for rehabilitating lake trout includes controlling sea lamprey abundance, stocking hatchery-reared lake trout, managing the catch, and establishing sanctuaries where harvest is prohibited. Three lake trout sanctuaries have been established in Lake Michigan: the Fox Island Sanctuary of 121, 500 ha, in the Chippewa-Ottawa Treaty fishing zone in the northern region of the lake; the Milwaukee Reef Sanctuary of 160, 000 ha in midlake, in boundary waters of Michigan and Wisconsin; and Julian's Reef Sanctuary of 6, 500 ha, in Illinois waters. In northern Lake Huron, Drummond Island Sanctuary of 55, 000 ha is two thirds in Indian treaty-ceded waters in Michigan and one third in Ontario waters of Canada. A second sanctuary, Six Fathom Bank-Yankee Reef Sanctuary, in central Lake Huron contains 168, 000 ha. Sanctuary status for the Canadian areas remains to be approved by the Provincial government. In Lake Superior, sanctuaries protect the spawning grounds of Gull Island Shoal (70, 000 ha) and Devils Island Shoal (44, 000 ha) in Wisconsin's Apostle Island area. These seven sanctuaries, established by the several States and agreed upon by the States, Indian tribes, the U.S. Department of the Interior, and the Province of Ontario, contribute toward solving an interjurisdictional fishery problem.
36 CFR 7.20 - Fire Island National Seashore.
2010-07-01
... the Superintendent or by the posting of signs where appropriate: (i) Along the Atlantic Ocean on the... be operated on the waters of the Great South Bay and the Atlantic Ocean within the boundaries of Fire... the Great South Bay and the Atlantic Ocean within the boundaries of Fire Island National Seashore are...
A modern Sr/Ca-δ18O-sea surface temperature calibration for Isopora corals on the Great Barrier Reef
Brenner, Logan D.; Linsley, Braddock K.; Potts, Donald C.
2017-02-01
Isopora (Acroporidae) is a genus of often encrusting, branching to submassive corals that are common in many shallow habitats on modern and fossil Indo-West Pacific reefs. Although abundant, Isopora is largely absent from paleoceanographic literature. The scarcity of large Porites and the abundance of Isopora retrieved from the Great Barrier Reef (GBR) on Integrated Ocean Drilling Program Expedition 325 focused paleoceanographic attention on Isopora. Here we provide the first independent high-resolution calibration of both Sr/Ca and δ18O for temperature analyses based on Isopora and demonstrate its consistency with Porites records. We developed modern skeletal Sr/Ca- and δ18O-sea surface temperature (SST) calibrations based on five modern Isopora colonies from Heron Island in the southern GBR. Pairing the coral Sr/Ca record with monthly SST data yielded Sr/Ca-SST sensitivities from -0.061 ± 0.004 (centered) to -0.083 ± 0.007 (raw) mmol/mol °C-1 based on reduced major axis regressions. These sensitivities are in the middle of the range of published Porites values and overlap most published values for Isopora, -0.075 ± 0.011 to -0.065 ± 0.011 mmol/mol °C-1. The δ18O-SST sensitivities range from -0.184 ± 0.014 (centered) to -0.185 ± 0.014 (raw) ‰ °C-1, assuming that all seasonal variation in δ18O was due to SST. These δ18O-SST sensitivities are smaller than the widely accepted value of -0.23‰ °C-1 for biogenic aragonite but are at the upper end of high-resolution Porites-defined sensitivities that are consistently less than the aforementioned established value. Our results validate the use of Isopora as an alternative source of paleoceanographic records in habitats where large massive Porites are scarce or absent.
Initial evolution of nonlinear magnetic islands in high temperature plasmas
International Nuclear Information System (INIS)
Kotschenreuther, M.
1988-06-01
The evolution of nonlinear magnetic islands is computed in the kinetic collisionality regime called the semicollisional regime, which is appropriate to present fusion confinement devices. Realistic effects are included, such as the presence of small external field errors, radial electric fields, and omega. When present simultaneously, these effects can greatly change the stability of small amplitude nonlinear islands. Islands with Δ' > O can sometimes be prevented from growing to macroscopic size; it is also possible to produce moderate mode-number nonlinear instabilities in the plasma edge. Furthermore, island growth can be prevented by application of external fields with suitably chosen amplitude and frequency
Directory of Open Access Journals (Sweden)
Laura Gangoso
Full Text Available BACKGROUND: The adaptive transition between behavioral strategies, such as the shift from migratoriness to sedentariness, remains an outstanding question in evolutionary ecology. Density-dependent variation in the age of first breeding has been proposed as a feasible mechanism through which long-lived migratory birds with deferred sexual maturity should become sedentary to persist on islands. Although this pattern seems to hold for most raptors and herons, a few exceptions have been identified. One of these exceptions is the Eleonora's falcon, a long-distance migratory bird, which shows one of the most peculiar adaptations in the timing of reproduction and food requirements among raptors. METHODOLOGY/PRINCIPAL FINDINGS: Here, we compiled data concerning demography, banding recoveries and satellite tracking of Eleonora's falcons to discuss likely explanations for the exceptional behavior of this insular long-distance migratory species. CONCLUSIONS/SIGNIFICANCE: New data reveal that Eleonora's falcons do return to the natal colonies in their first year and young birds are able to breed. However, in contrast to previous hypothesis, the highly specialized strategy of this and other ecologically similar species, as well as the virtual lack of food during winter at breeding areas prevent them from becoming sedentary on islands. Although the ultimate mechanisms underlying the process of sedentarization remain poorly understood, the evidence provided reveal the existence of important trade-offs associated with ecological specialization that may become particularly relevant in the present context of global change.
Sociogeographical elements and determinants of Croatian Islands classification
Directory of Open Access Journals (Sweden)
Veni Marinković
2016-01-01
Full Text Available Although Croatian Islands belong to the same macro-region of the Adriatic Croatia, they are characterized by a great heterogeneity of their geospatial reality at regional, micro regional, interinsular and local level, as well as by the complexity of the socio-economic structure and dynamic characteristics, as a result of physical-geographical and historical processes and contemporary development trends on them. The paper deals with sociogeographical classification of Croatian archipelago and provides an overview and systematization of scientific and professional considerations of its geospatial heterogeneity. It also includes an overview of Croatian Islands typification based on multi-criteria indicators. The author concluded the work by presenting a proposal of Croatian Islands clusterization concept as a contribution to the islands developmental policy.
International Nuclear Information System (INIS)
Horrocks, M.; Ogden, J.; Nichol, S.L.; Alloway, B.V.; Sutton, D.G.
2000-01-01
Pollen and sediment analyses of two cores from southern Kaitoke (Forsythes' Paddock and Blackwells' Bush), Great Barrier Island, show that at c. 7500 cal. yr BP, the area was an estuary with tidal flats and Avicennia. By c. 3000 cal. yr BP, a Restionaceae (Leptocarpus) salt marsh had developed in the estuary as marine influences lessened. By c. cal. 2550 yr BP, fresh water swamp (Cyperacceae-Gleichenia-Leptspermum) had replaced the salt marsh. Conifer-hardwood forest surrounding the southern Kaitoke sites from c. 7500-c. 2800 cal. yr BP was dominated by Daceydium, Metrosideros and Libocedrus. After c. 2800 cal. yr BP Metrosideros was replaced by Agathis, Phyllocladus and Prumnopitys taxifolia, suggesting climatic change to more variable conditions. The presence of the Kaharoa Tephra suggests that major Polynesian deforestation at southern Kaitoke began c. 600 cal. yr BP Minor pre-Kaharoa fire disturbance is evident c. 1750 cal. yr BP and c. 1290-970 cal. yr BP (author). 52 refs., 4 figs., 2 tabs
Mercury Distribution Along the Food Chain of a Wetland Ecosystem at Sanjiang Plain, Northeast China.
Zhilong, Ma; Qiang, Wang; Zhongsheng, Zhang; Xuehong, Zhou
2017-02-01
Concentrations of total mercury (T-Hg) and methylmercury (MeHg) in a wetland food chain were determined at Majuan Island of the Sanjiang Plain in China. Four tissues (muscle, liver, kidney and brain) of three waterbird species (great cormorant, grey heron and great egret), muscle tissues of fish (grass carp, crucian carp and longnose gudgeon), insects (predacious diving beetle), aquatic plants (ditch reed) and soil were analyzed. The mean concentrations of T-Hg were 0.392 ± 0.237 mg/kg for tissues of all juveniles, 1.999 ± 2.053 mg/kg for great cormorant adults, and 0.029 ± 0.019 mg/kg for fish muscle, respectively. While the relative contents of T-Hg of insects, plants and sediments were 0.012 ± 0.002, 0.006 ± 0.001 and 0.020 ± 0.002 mg/kg, respectively. Bioaccumulation of Hg along the wetland food chain may be able to show the current situation of Hg contamination in remote regions of East Asia.
Ammar, Khalaf Nour Abd El-Wahed
2015-04-01
Apharyngostrigea ardeolina and Echinoparyphium recurvatum are two important digenean parasites that were recovered from small intestine of grey heron with an infection rate (16.2%) and (8.8%) respectively. The surface topography of two species was redescribed by both light and scanning electron microscopy. Using SEM studies showed that the body surface of two trematodes were covered by contact receptors, several types of sensory tegumental papillae which may have useful function in orientation and feeding through increasing the surface area of absorption, could also play a role in sensation or in selection of the materials for ingestion by the fluke. The head collar of E. recurvatum is reniform in shape, bearing uninterrupted double row of 41 collar finger-like spines, a total including 4 end group ones on both ventral corners., tegumental spines were tongue-shaped without a terminal tip.
Sable Island: A heritage to preserve
Energy Technology Data Exchange (ETDEWEB)
Villeneuve, C.
1997-09-01
Sable Island is strategically located on the edge of the teeming fisheries of the Newfoundland Grand Banks and near one of the main sea routes between North America and Europe. It has been the bane of navigators from 1583 onward, with 250 ships running aground, the latest in 1947. Marine productivity around Sable Island is very high owing to the temperature differences between the currents and the adjacent underwater topography. Dolphins and whales abound in the area known as the `Gully`, and there are no fewer than 36 fish species present in the waters surrounding the Island. Approximately 35 per cent of the Island is covered by vegetation which is limited to species adapted to sandy soil containing little organic matter and few nutrients. Some plants, such as the American beachgrass, grow in dense colonies and help to stabilize the dunes. Bird diversity is limited to species adapted to open areas, ponds and the littoral. Some 324 species have been recorded on the Island, but only 25 are known to nest there. The Island is one of world`s most important breeding sites for grey seals where they can be observed in great numbers during mating, whelping and moulting season. Among the many introduced animals only the legendary horses of Sable Island remain to this day. Despite its remoteness and isolation, the Island faces many threats, one of the most worrysome being the erosion of the eastern extremity of the Island during severe winter storms. The Island benefits from its status as a Migratory Bird Sanctuary, and is legally protected under Sable Island Regulations of the Navigation Act.
A Roseate Spoonbill hunts for food in the water.
1999-01-01
A Roseate Spoonbill sweeps the water for food in the Merritt Island National Wildlife Refuge, which shares a boundary with Kennedy Space Center. The brilliant pink bird is named for its straight bill with the broad spatulate tip. Preferring a habitat of mangroves, it is usually found on the coasts of southern Florida and Texas, occasionally in Louisiana., in the West Indies, Mexico and Central and South America. Spoonbills feed on shrimps and fish in shallow waters, sweeping their bills from side to side and scooping up whatever they encounter. The 92,000- acre refuge is a habitat for more than 310 species of birds, 25 mammals, 117 fishes and 65 amphibians and reptiles. The marshes and open water of the refuge also provide wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds.
Williams, S. Jeffress; Foley, Mary K.
2007-01-01
The U.S Army Corps of Engineers, New York District is developing engineering plans, including economic costs and benefits, for storm damage reduction along an 83 mile stretch of the coastal barrier islands and beaches on the south shore of Long Island, NY from Fire Island Inlet east to the Montauk Point headland. The plan, expected to include various alternatives for storm protection and erosion mitigation, is referred to as the Fire Island to Montauk Point Reformulation Plan (FIMP). These plans are expected to follow the Corps of Engineers’ Environmental Operating Principles striving for long term environmental sustainability and balance between environmental protection and protection of human health and property. Fire Island National Seashore (FIIS), a 19,579 acre unit of the National Park System includes a 32 mile long coastal barrier island located within the FIMP project area. A seven-mile section of the park, Otis Pike Fire Island High Dune Wilderness Area, is also a designated Federal Wilderness Area. The FIIS includes not only the barrier island and sand dunes, but also several islands, sand flats and wetlands landward of the barrier, submerged parts of Great South Bay shoreface, extending approximately 4,000 feet into the bay with the inner shelf region extending approximately 1,000 feet seaward of the Fire Island shoreline. The Fire Island barrier islands, a sand-starved system dominated by highly dynamic processes, are struggling to maintain their integrity in the face of sea-level rise and storms. Adding to the dilemma is that development on the barriers and the mainland has increased greatly during the past 50 years. As such, managers and decision makers in federal agencies, state agencies and local governments are challenged to balance tradeoffs between protection of lives and property, public access and long term conservation of natural habitats and processes and the plants and animals that depend on these habitats. National Park Service (NPS
Coetzee, Maryke L; Smit, Nico J; Grutter, Alexandra S; Davies, Angela J
2008-06-01
Third-stage juveniles (praniza 3) of Gnathia grandilaris n. sp. were collected from the gill filaments and septa of 5 requiem sharks, including a white tip reef shark, Triaenodon obesus, and 4 grey reef sharks, Carcharhinus amblyrhynchos, at Lizard Island, Great Barrier Reef, Australia, in March 2002. Some juvenile gnathiids were then maintained in fresh sea water until they molted to adults. Adult males appeared 19 days following detachment of juveniles from host fishes, but no juveniles molted successfully into females. The current description is based, therefore, on bright field and scanning electron microscopy observations of adult males and third-stage juveniles. Unique features of the male include the triangular-shaped inferior medio-frontal process, 2 areolae on the dorsal surface of the pylopod, and a slender pleotelson (twice as long as wide) with lateral concavities. The third-stage juvenile has distinctive white pigmentation on the black pereon when alive, while the mandible has 9 triangular backwardly directed teeth. This species has the largest male and third-stage juvenile of any Gnathia spp. from Australia and of any gnathiid isopods associated with elasmobranchs.
Introduced mammals on Western Indian Ocean islands
Directory of Open Access Journals (Sweden)
James C. Russell
2016-04-01
Full Text Available The diversity of introduced mammals and their introduction history varies greatly across the Western Indian Ocean (WIO islands, from ancient introductions in the past millennia on islands off the East coast of Africa where extant terrestrial native mammal communities exist, to very recent invasions in the past decades on islands in the Mascarene archipelago. We compile the distribution of 16 introduced mammal taxa on 28 island groups comprising almost 2000 islands. Through an exhaustive literature review and expert consultation process we recorded all mammal eradications, and species recoveries which could be attributed to introduced mammal eradication or control. All island groups have been invaded by mammals, and invasive cats and rats in particular are ubiquitous, but cultural contingency has also led to regional invasions by other mammals such as lemurs, civets and tenrecs. Mammal eradications have been attempted on 45 islands in the WIO, the majority in the Seychelles and Mauritius, and where successful have resulted in spectacular recovery of species and ecosystems. Invasive mammalian predator eradication or control in association with habitat management has led to improved conservation prospects for at least 24 species, and IUCN red-list down-listing of eight species, in the Mascarene Islands. Future island conservation prioritisation in the region will need to take account of global climate change and predicted sea-level rises and coastal inundation. Greater investment and prioritisation in island conservation in the region is warranted, given its high biodiversity values and the extent of invasions.
Great Knot Calidris tenuirostris at Lutembe Bay, Uganda
African Journals Online (AJOL)
Unfortunately it became nervous and flew to another island and we were unable to pursue it before darkness fell. I was, however, able to take some record shots. I circulated the best of four poor photographs to a few birding colleagues for their opinion, and the general consensus favoured Red Knot rather than Great Knot.
Jones, M K; Beveridge, I
2001-09-01
Echinobothrium chisholmae n. sp. is described from Rhinobatos typus Bennett (Rhinobatidae), collected from Heron Island, Great Barrier Reef, Australia. E. chisholmae differs from all congeners in possessing 11 hooks in each dorsal and ventral group on the rostellum and groups of 3-6 hooklets on either side of the hooks. A single metacestode of E. chisholmae was collected from the decapod crustacean Penaeus longistylus Kubo. Yellow pigmentation of the cephalic peduncle in immature adults is caused by the accumulation of large vesicles in the distal cytoplasm of the tegument. The vesicles probably provide materials for spine formation. Ultrastructural examination of the rostellar musculature revealed that the muscles are stratified (striated-like), consisting of a periodic repetition of sarcomeres separated by perforated Z-like lines that are oblique to the long axes of the myofilaments.
International Nuclear Information System (INIS)
Horrocks, M.; Ogden, J.; Nichol, S.L.; Alloway, B.V.; Sutton, D.G.
2000-01-01
Pollen and sediment analyses of two cores from coastal freshwater swamps at northern Kaitoke (Kaitoke Swamp and Police Station Swamp), Great Barrier Island, show that c. 7300 calibrated yr BP Kaitoke Swamp was an estuary with tidal flats. Avicennia, now absent from the swamp area, was present in the estuary. By c. 4500 yr BP fresh water conditions had developed at the Kaitoke Swamp site as marine influences decreased. Around the same time, fresh water swamp conditions commenced at the Police Station Swamp site on the surface of a low lying area of a Late Pleistocene dune. A sandy layer at Kaitoke may represent rapid infilling followed by a dry soil surface until c. 1000 yr BP. Conifer-hardwood forest on the hills surrounding the sites c. 7300-c. 1800 yr BP was dominated by Dacrydium and Metrosideros. During this period, environmental conditions were relatively stable, with little change in forest composition. Between 1800 yr and 800 yr BP Kaitoke Swamp was reflooded, and the Police Station Swamp extended as a shallow lake over the nearby dune flat. These new shallow swamps were invaded by swamp forest (mainly Dacrycaprus with some Laurelia). The presence of charcoal and Pteridium spores above the Kaharoa Tephra suggests that major Polynesian deforestation at northern Kaitoke began c. 600 calibrated yr BP. (author). 41 refs., 4 figs., 2 tabs
Holocene morphogenesis of Alexander the Great's isthmus at Tyre in Lebanon
Marriner, Nick; Morhange, Christophe; Meulé, Samuel
2007-05-01
In 332 B.C., Alexander the Great constructed an ≈1,000-m-long causeway to seize the offshore island of Tyre. The logistics behind this engineering feat have long troubled archaeologists. Using the Holocene sedimentary record, we demonstrate that Alexander's engineers cleverly exploited a shallow proto-tombolo, or sublittoral sand spit, to breach the offshore city's defensive impregnability. We elucidate a three-phase geomorphological model for the spit's evolution. Settled since the Bronze Age, the area's geological record manifests a long history of natural and anthropogenic forcings. (i) Leeward of the island breakwater, the maximum flooding surface (e.g., drowning of the subaerial land surfaces by seawater) is dated ≈8000 B.P. Fine-grained sediments and brackish and marine-lagoonal faunas translate shallow, low-energy water bodies at this time. Shelter was afforded by Tyre's elongated sandstone reefs, which acted as a 6-km natural breakwater. (ii) By 6000 B.P., sea-level rise had reduced the dimensions of the island from 6 to 4 km. The leeward wave shadow generated by this island, allied with high sediment supply after 3000 B.P., culminated in a natural wave-dominated proto-tombolo within 1-2 m of mean sea level by the time of Alexander the Great (4th century B.C.). (iii) After 332 B.C., construction of Alexander's causeway entrained a complete anthropogenic metamorphosis of the Tyrian coastal system.
Holocene morphogenesis of Alexander the Great's isthmus at Tyre in Lebanon.
Marriner, Nick; Morhange, Christophe; Meulé, Samuel
2007-05-29
In 332 B.C., Alexander the Great constructed an approximately 1,000-m-long causeway to seize the offshore island of Tyre. The logistics behind this engineering feat have long troubled archaeologists. Using the Holocene sedimentary record, we demonstrate that Alexander's engineers cleverly exploited a shallow proto-tombolo, or sublittoral sand spit, to breach the offshore city's defensive impregnability. We elucidate a three-phase geomorphological model for the spit's evolution. Settled since the Bronze Age, the area's geological record manifests a long history of natural and anthropogenic forcings. (i) Leeward of the island breakwater, the maximum flooding surface (e.g., drowning of the subaerial land surfaces by seawater) is dated approximately 8000 B.P. Fine-grained sediments and brackish and marine-lagoonal faunas translate shallow, low-energy water bodies at this time. Shelter was afforded by Tyre's elongated sandstone reefs, which acted as a 6-km natural breakwater. (ii) By 6000 B.P., sea-level rise had reduced the dimensions of the island from 6 to 4 km. The leeward wave shadow generated by this island, allied with high sediment supply after 3000 B.P., culminated in a natural wave-dominated proto-tombolo within 1-2 m of mean sea level by the time of Alexander the Great (4th century B.C.). (iii) After 332 B.C., construction of Alexander's causeway entrained a complete anthropogenic metamorphosis of the Tyrian coastal system.
Security assessment for intentional island operation in modern power system
DEFF Research Database (Denmark)
Chen, Yu; Xu, Zhao; Østergaard, Jacob
2011-01-01
be increased. However, when to island or how to ensure the islanded systems can survive the islanding transition is uncertain. This article proposes an Islanding Security Region (ISR) concept to provide security assessment of island operation. By comparing the system operating state with the ISR, the system......There has been a high penetration level of Distributed Generations (DGs) in distribution systems in Denmark. Even more DGs are expected to be installed in the coming years. With that, to utilize them in maintaining the security of power supply is of great concern for Danish utilities. During...... the emergency in the power system, some distribution networks may be intentionally separated from the main grid to avoid complete system collapse. If DGs in those networks could continuously run instead of immediately being shut down, the blackout could be avoided and the reliability of supply could...
International Nuclear Information System (INIS)
Burger, Joanna; Gochfeld, Michael; Jeitner, Christian; Burke, Sean; Stamm, Timothy
2007-01-01
Increasingly there is a need to assess the contaminant levels in fish as indicators of the health and well-being of both the fish and their consumers, including humans. This paper examines the levels of arsenic, cadmium, chromium, lead, manganese, mercury, and selenium in the kidney, liver, and muscle of great sculpin and flathead sole from Adak Island in the Aleutian Islands, Alaska. Both species are consumed by the local Aleuts and others. There were significant differences in the levels of heavy metals as a function of tissue for both fish species; the liver of sculpin and sole generally had the highest levels of most metals, except for arsenic, lead, and selenium. Sole had significantly higher mean levels of arsenic in kidney (32,384 vs. 531 ppb, wet weight), liver (18,954 vs. 2532 ppb), and muscle (19,452 vs. 1343 ppb) than did sculpin. Sole also had higher mean levels of cadmium (230 vs. 63 ppb), lead (1236 vs. 48 ppb), mercury (150 vs. 107 ppb), and selenium (5215 vs. 1861 ppb) in kidney than did sculpin. There were significant correlations among weight and length measurements for both species. However, except for mercury, there were few significant correlations among tissue types for most metals. Only mercury and manganese levels were significantly correlated with size for sculpin (but not for sole). Levels of arsenic, lead, and mercury may pose a risk to predators that consume them, and arsenic and mercury may pose a risk to human consumers
Hoffman, David J.; Henny, Charles J.; Hill, Elwood F.; Grove, Robert A.; Kaiser, James L.; Stebbins, Katherine R.
2009-01-01
A 10-year study (1997-2006) was conducted to evaluate reproduction and health of aquatic birds in the Carson River Basin of northwestern Nevada (on the U.S. Environmental Protection Agency Natural Priorities List) due to high mercury (Hg) concentrations from past mining activities. This part of the study evaluated physiological associations with blood Hg in young snowy egrets (Egretta thula) and black-crowned night-herons (Nycticorax nycticorax), and organ biochemistry and histopathological effects in snowy egrets on Lahontan Reservoir (LR) from the period 2002-2006. LR snowy egret geometric mean total Hg concentrations (μg/g ww) ranged from 1.5 to 4.8 for blood, 2.4 to 3.1 liver, 1.8 to 2.5 kidneys, 1.7 to 2.4 brain, and 20.5 to 36.4 feathers over these years. For night-herons, mean Hg for blood ranged from 1.6 to 7.4. Significant positive correlations were found between total Hg in blood and five plasma enzyme activities of snowy egrets suggesting hepatic stress. Histopathological findings revealed vacuolar changes in hepatocytes in LR snowy egrets as well as correlation of increased liver inflammation with increasing blood and tissue Hg. Hepatic oxidative effects were manifested by decreased hepatic total thiol concentration and glutathione reductase activity and elevated hepatic thiobarbituric acid-reactive substances (TBARS), a measure of lipid peroxidation. However, other hepatic changes indicated compensatory mechanisms in response to oxidative stress, including decreased oxidized glutathione (GSSG) concentration and decreased ratio of GSSG to reduced glutathione. In young black-crowned night-herons, fewer correlations were apparent. In both species, positive correlations between blood total Hg and plasma uric acid and inorganic phosphorus were suggestive of renal stress, which was supported by histopathological findings. Both oxidative effects and adaptive responses to oxidative stress were apparent in kidneys and brain. Vacuolar change and inflammation in
Kornati Islands on Old Geographic Maps and Charts
Directory of Open Access Journals (Sweden)
Josip Faričić
2005-09-01
Full Text Available Based on the analysis of cartographic sources, the paper analyses the historical and geographical development of the Kornati islands, the largest group of Croatian islands. The old maps were used first of all as the means of geographic research that, being necessarily correlated to the simultaneous historical written sources and modern topographic and maritime maps, make the basis for creating a research platform for relevant scientific results to be achieved. On the basis of the old maps it is possible, among other things to anticipate that the Kornati islands used to have great geotraffic significance on the eastern Adriatic sailing route. According to the development of geographic concepts and cartographic methods, the geographic vision of the Kornati islands has been gradually clarified ever since the 16th century. The chart from the Carta di cabotaggio del Mare Adriatico edition published by the Military and Geographic Institute from Milan (1822-1824 presents the turning point with the first complete and mostly precise presentation of the Kornati islands group on the basis of hydrographic and topographic field measurements.
Zhou, Yihui; Yin, Ge; Asplund, Lillemor; Stewart, Kathryn; Rantakokko, Panu; Bignert, Anders; Ruokojärvi, Päivi; Kiviranta, Hannu; Qiu, Yanling; Ma, Zhijun; Bergman, Åke
2017-06-01
Polychlorinated dibenzo-p-dioxins (PCDDs) and polychlorinated dibenzofurans (PCDFs) are highly toxic to humans and wildlife. In the present study, PCDD/Fs were analyzed in the eggs of whiskered terns (Chlidonias hybrida), and genetically identified eggs from black-crowned night herons (Nycticorax nycticorax) sampled from two lakes in the Yangtze River Delta area, China. The median toxic equivalent (TEQ) of PCDD/Fs were 280 (range: 95-1500) and 400 (range: 220-1100) pg TEQ g -1 lw (WHO, 1998 for birds) in the eggs of black-crowned night heron and whiskered tern, respectively. Compared to known sources, concentrations of PCDDs relative to the sum of PCDD/Fs in bird eggs, demonstrated high abundance of octachlorodibenzo-p-dioxin (OCDD), 1,2,3,4,6,7,8-heptaCDD and 1,2,3,6,7,8-hexaCDD indicating pentachlorophenol (PCP), and/or sodium pentachlorophenolate (Na-PCP) as significant sources of the PCDD/Fs. The presence of polychlorinated diphenyl ethers (PCDEs), hydroxylated and methoxylated polychlorinated diphenyl ethers (OH- and MeO-PCDEs, known impurities in PCP products), corroborates this hypothesis. Further, significant correlations were found between the predominant congener CDE-206, 3'-OH-CDE-207, 2'-MeO-CDE-206 and OCDD, indicating a common origin. Eggs from the two lakes are sometimes used for human consumption. The WHO health-based tolerable intake of PCDD/Fs is exceeded if eggs from the two lakes are consumed regularly on a weekly basis, particularly for children. The TEQs extensively exceed maximum levels for PCDD/Fs in hen eggs and egg products according to EU legislation (2.5 pg TEQ g -1 lw). The results suggest immediate action should be taken to manage the contamination, and further studies evaluating the impacts of egg consumption from wild birds in China. Likewise, studies on dioxins and other POPs in common eggs need to be initiated around China. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.
Sota, Teiji; Nagata, Nobuaki
2008-10-27
The Japanese Islands have been largely isolated from the East Asian mainland since the Early Pleistocene, allowing the diversification of endemic lineages. Here, we explore speciation rates and historical biogeography of the ground beetles of the subgenus Ohomopterus (genus Carabus) based on nuclear and mitochondrial gene sequences. Ohomopterus diverged into 15 species during the Pleistocene. The speciation rate was 1.92 Ma(-1) and was particularly fast (2.37 Ma(-1)) in a group with highly divergent genitalia. Speciation occurred almost solely within Honshu, the largest island with complex geography. Species diversity is highest in central Honshu, where closely related species occur parapatrically and different-sized species co-occur. Range expansion of some species in the past has resulted in such species assemblages. Introgressive hybridization, at least for mitochondrial DNA, has occurred repeatedly between species in contact, but has not greatly disturbed species distinctness. Small-island populations of some species were separated from main-island populations only after the last glacial (or the last interglacial) period, indicating that island isolation had little role in speciation. Thus, the speciation and formation of the Ohomopterus assemblage occurred despite frequent opportunities for secondary contact and hybridization and the lack of persistent isolation. This radiation was achieved without substantial ecological differentiation, but with marked differentiation in mechanical agents of reproductive isolation (body size and genital morphology).
Reahard, Ross; Mitchell, Brandie; Brown, Tevin; Billiot, Amanda
2010-01-01
Barrier Islands are the first line of defense against tropical storms and hurricanes for coastal areas. Historically, tropical cyclonic events have had a great impact on the transgression of barrier islands, especially the Chandeleur Island chain off the eastern coast of Louisiana. These islands are of great importance, aiding in the protection of southeastern Louisiana from major storms, providing habitat for nesting and migratory bird species, and are part of the second oldest wildlife refuge in the country. In 1998, Hurricane Georges caused severe damage to the chain, prompting restoration and monitoring efforts by both federal and state agencies. Since then, multiple storm events have steadily diminished the integrity of the islands. Hurricane Katrina in 2005 thwarted all previous restoration efforts, with Hurricane Gustav in 2008 exacerbating island erosion and vegetation loss. Data from the Advanced Spaceborne Thermal Emission and Reflection Radiometer (ASTER), Moderate Resolution Imaging Spectroradiometer (MODIS), Landsat 2-4 Multispectral Scanner (MSS), and Landsat 5 Thematic Mapper (TM) will be utilized to detect land loss, island transgression, and vegetation change from 1979 to 2009. This study looks to create a more synoptic view of the transgression of the Chandeleur Islands and correlate weather and sea surface phenomena with erosion trends over the past 30 years, so that partnering organizations such as the Pontchartrain Institute for Environmental Sciences (PIES) can better monitor and address the continual change of the island chain.
Nesting of Great Cormorants (Phalacrocorax carbo on man-made structures in Ukraine
Directory of Open Access Journals (Sweden)
A. I. Sidorenko
2016-07-01
Full Text Available In Ukraine the Great Cormorant (Phalacrocorax carbo Linnaeus, 1758 uses a rather wide range of habitats for nesting: islands, trees and shrubs, reedbeds and a variety of man-made structures. In general, the strategy of nesting on man-made structures is uncommon both in Ukraine and Europe, and Cormorantsdo this only in the absence of other sites suitable for nesting. Special research onCormorant colonies on technogenic constructions was carried out during the field expeditions by the Research Institute of Biodiversity of Terrestrial and Aquatic Ecosystems of Ukraine in 2002–2003 and 2012–2016. Besides this, we used retrospective and current data from the literature and Internet resources. Most of the field work was carried out by making surveys by boat and on foot. As a result, we found 8 Cormorant colonies on technogenic constructions in Ukraine: gas platforms in the Sea of Azov (near the village Strilkove, Henichesk district of Kherson region; sunken ships – targets for bombing training near the Arabat Spit (these are also known as «ship islands»; electricity pylons of the high-voltage Enerhodar Dnipro Power Line where it crosses the Kakhovka Reservoir; the dock in Yahorlyk Bayk, used in the past as a target for bombing training bombing; artificial island-platforms on Lake Chernine (Kinburn Peninsula; an artificial island on the Sasyk Lagoon (Odessa region; artificial islands, made as navigation markers on the Kremenchuk and Kiev reservoirs. The study found that in most cases the accompanying species was the CaspianGull (Larus cachinnans Pallas, 1811, which actively destroys the Cormorants’ nests and eats their eggs and chicks. The number of nests in the colonies varied greatly (5–30 nests on the navigation marker islands and ca. 2 000–2 300 on the «ship-islands» and gas platforms. This is due, primarily, to the area of the breeding territory. The research found that fierce territorial competition was observed in most of the
Directory of Open Access Journals (Sweden)
Carolina Buffoni
2018-01-01
Full Text Available In this study, the ambient seismic noise cross-correlation technique is applied to estimate the upper structure of the crust beneath Great Island of Tierra del Fuego (TdF, Argentina, by the analysis of short-period Rayleigh wave group velocities. The island, situated in the southernmost South America, is a key area of investigation among the interaction between the South American and Scotia plates and is considered as a very seismically active one. Through cross-correlating the vertical components of ambient seismic noise registered at four broadband stations in TdF, we were able to extract Rayleigh waves which were used to estimate group velocities in the period band of 2.5–16 s using a time-frequency analysis. Although ambient noise sources are distributed inhomogeneously, robust empirical Green's functions could be recovered from the cross-correlation of 12 months of ambient noise. The observed group velocities were inverted considering a non-linear iterative damped least-squares inversion procedure and several 1-D shear wave velocity models of the upper crust were obtained. According to the inversion results, the S-wave velocity ranges between 1.75 and 3.7 km/s in the first 10 km of crust, depending on the pair of stations considered. These results are in agreement to the major known surface and sub-surface geological and tectonic features known in the area. This study represents the first ambient seismic noise analysis in TdF in order to constraint the upper crust beneath this region. It can also be considered as a successful feasibility study for future analyses with a denser station deployment for a more detailed imaging of structure.
Directory of Open Access Journals (Sweden)
Matthew R. Nitschke
2018-02-01
Full Text Available Light availability is considered a key factor regulating the thermal sensitivity of reef building corals, where excessive excitation of photosystem II (PSII further exacerbates pressure on photochemical pathways already compromised by heat stress. Coral symbionts acclimate to changes in light availability (photoacclimation by continually fine-tuning the photochemical operating efficiency of PSII. However, how this process adjusts throughout the warmest months in naturally heat-tolerant or sensitive species is unknown, and whether this influences the capacity to tolerate transient heat stress is untested. We therefore examined the PSII photophysiology of 10 coral species (with known thermal tolerances from shallow reef environments at Heron Island (Great Barrier Reef, Australia, in spring (October-November, 2015 vs. summer (February-March, 2016. Corals were maintained in flow-through aquaria and rapid light curve (RLC protocols using pulse amplitude modulated (PAM fluorometry captured changes in the PSII photoacclimation strategy, characterized as the minimum saturating irradiance (Ek, and the extent of photochemical ([1 – C], operating efficiency vs. non-photochemical ([1 – Q] energy dissipation. Values of Ek across species were >2-fold higher in all coral species in spring, consistent with a climate of higher overall light exposure (i.e., higher PAR from lower cloud cover, rainfall and wind speed compared with summer. Summer decreases in Ek were combined with a shift toward preferential photochemical quenching in all species. All coral species were subsequently subjected to thermal stress assays. An equivalent temperature-ramping profile of 1°C increase per day and then maintenance at 32°C was applied in each season. Despite the significant seasonal photoacclimation, the species hierarchy of thermal tolerance [maximum quantum yields of PSII (Fv/Fm, monitored at dawn and dusk] did not shift between seasons, except for Pocillopora
An anhinga shows its iridescent plumage
2000-01-01
The greenish iridescence of a male Anhinga nearly blends into the green vegetation behind it on the grounds of the Kennedy Space Center. The mostly black-bodied bird is also known as a 'snakebird' because, when swimming, only its head and long, slender neck are visible above water. The anhinga inhabits freshwater ponds and swamps with thick vegetation and ranges the Atlantic and Gulf coasts from North Carolina to Texas, the Mississippi Valley north to Arkansas and Tennessee, and south to southern South America. The Center shares a boundary with the Merritt Island National Wildlife Refuge, which encompasses 92,000 acres that are a habitat for more than 331 species of birds, 31 mammals, 117 fishes, and 65 amphibians and reptiles. The marshes and open water of the refuge provide wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds, as well as a variety of insects.
Antibacterial use in the Faroe Islands, Iceland, and Denmark 1999-2011
DEFF Research Database (Denmark)
Magnussen, Marita Debess; Gudnason, Thorolfur; Jensen, Ulrich Stab
2014-01-01
BACKGROUND: The Faroe Islands, Iceland, and Denmark are neighbouring Nordic countries with great ethnic, cultural, and political similarities and are relatively homogeneous. Important information about prescribing practices can be obtained by comparing the antibacterial use in these countries...... in the Faroe Islands and Iceland, whereas in Denmark it increased gradually from 13.5 DID in 1999 to 19.5 DID in 2011. The higher use in Iceland can be explained by much higher consumption of tetracyclines. There was also considerable variation in the use of individual penicillins and macrolides between...... the countries. CONCLUSIONS: Despite the great ethnic and cultural similarities of these 3 countries, we found marked differences in total antibacterial use and important differences in the use of individual antibacterials....
Intensity of Urban Heat Islands in Tropical and Temperate Climates
Directory of Open Access Journals (Sweden)
Margarete Cristiane de Costa Trindade Amorim
2017-12-01
Full Text Available Nowadays, most of the Earth’s population lives in urban areas. The replacement of vegetation by buildings and the general soil sealing, associated with human activity, lead to a rise in cities temperature, resulting in the formation of urban heat islands. This article aims to evaluate the intensity and the hourly maintenance of the atmospheric heat islands in two climates: one tropical (Presidente Prudente, Brazil and one temperate (Rennes, France throughout 2016. For this, air temperature and hourly averages were measured and calculated using both a HOBO datalogger (U23-002—protected under the same RS3 brand and weather stations Davis Vantage PRO 2. The daily evolution of the heat islands presented characteristics that varied according to the hours and seasons of the year. For both Rennes and Presidente Prudente, the largest magnitudes occurred overnight, being more greatly expressed in the tropical environment and during the driest months (winter in the tropical city and summer in the temperate one. The variability of synoptic conditions from one month to another also leads to a great heterogeneity of UHI intensity throughout the year.
Aleixandre, Pau; Hernández Montoya, Julio; Milá, Borja
2013-01-01
The evolutionary divergence of island populations, and in particular the tempo and relative importance of neutral and selective factors, is of central interest to the study of speciation. The rate of phenotypic evolution upon island colonization can vary greatly among taxa, and cases of convergent evolution can further confound the inference of correct evolutionary histories. Given the potential lability of phenotypic characters, molecular dating of insular lineages analyzed in a phylogenetic framework provides a critical tool to test hypotheses of phenotypic divergence since colonization. The Guadalupe junco is the only insular form of the polymorphic dark-eyed junco (Junco hyemalis), and shares eye and plumage color with continental morphs, yet presents an enlarged bill and reduced body size. Here we use variation in mtDNA sequence, morphological traits and song variables to test whether the Guadalupe junco evolved rapidly following a recent colonization by a mainland form of the dark-eyed junco, or instead represents a well-differentiated "cryptic" lineage adapted to the insular environment through long-term isolation, with plumage coloration a result of evolutionary convergence. We found high mtDNA divergence of the island lineage with respect to both continental J. hyemalis and J. phaeonotus, representing a history of isolation of about 600,000 years. The island lineage was also significantly differentiated in morphological and male song variables. Moreover, and contrary to predictions regarding diversity loss on small oceanic islands, we document relatively high levels of both haplotypic and song-unit diversity on Guadalupe Island despite long-term isolation in a very small geographic area. In contrast to prevailing taxonomy, the Guadalupe junco is an old, well-differentiated evolutionary lineage, whose similarity to mainland juncos in plumage and eye color is due to evolutionary convergence. Our findings confirm the role of remote islands in driving
Two new species of Neozoanthus (Cnidaria, Hexacorallia, Zoantharia from the Pacific
Directory of Open Access Journals (Sweden)
James Reimer
2012-11-01
Full Text Available The zoanthid genus Neozoanthus was originally described in 1972 from a single species in Madagascar. This monotypic genus was placed within its own family, Neozoanthidae, given its unusual characters of only partial sand encrustation, and an endodermal sphincter muscle combined with a brachycnemic mesenterial arrangement. Recently, undescribed specimens of Neozoanthus were discovered thousands of kilometers away in both Australia and Japan. While the phylogenetic and evolutionary aspects of Neozoanthus spp. are now somewhat well understood, the new specimens remained undescribed. Here we describe the specimens as two new species, N. uchina sp. n. from the Middle Ryukyu Islands of southern Japan, and N. caleyi sp. n. from the waters around Heron Island, on the Great Barrier Reef in Australia. Both species can be distinguished from each other and the type species, N. tulearensis, by their distributions, oral disk colors, and average numbers of tentacles. Additionally, each species appears to have subtle differences in their cnidae. The division of Japanese and Australian specimens into two species is strongly supported by recently reported phylogenetic data. The discovery and description of these two species highlights how little is known of zoanthid species diversity in the Indo-Pacific.
Two new species of Neozoanthus (Cnidaria, Hexacorallia, Zoantharia) from the Pacific
Reimer, James Davis; Irei, Yuka; Fujii, Takuma
2012-01-01
Abstract The zoanthid genus Neozoanthus was originally described in 1972 from a single species in Madagascar. This monotypic genus was placed within its own family, Neozoanthidae, given its unusual characters of only partial sand encrustation, and an endodermal sphincter muscle combined with a brachycnemic mesenterial arrangement. Recently, undescribed specimens of Neozoanthus were discovered thousands of kilometers away in both Australia and Japan. While the phylogenetic and evolutionary aspects of Neozoanthus spp. are now somewhat well understood, the new specimens remained undescribed. Here we describe the specimens as two new species, Neozoanthus uchina sp. n. from the Middle Ryukyu Islands of southern Japan, and Neozoanthus caleyi sp. n. from the waters around Heron Island, on the Great Barrier Reef in Australia. Both species can be distinguished from each other and the type species, Neozoanthus tulearensis, by their distributions, oral disk colors, and average numbers of tentacles. Additionally, each species appears to have subtle differences in their cnidae. The division of Japanese and Australian specimens into two species is strongly supported by recently reported phylogenetic data. The discovery and description of these two species highlights how little is known of zoanthid species diversity in the Indo-Pacific. PMID:23275752
Poppe, Lawrence J.; McMullen, Katherine Y.; Danforth, William W.; Blankenship, Mark R.; Clos, Andrew R.; Glomb, Kimberly A.; Lewit, Peter G.; Nadeau, Megan A.; Wood, Douglas A.; Parker, Castleton E.
2014-01-01
Detailed bathymetric maps of the sea floor in Rhode Island and Block Island Sounds are of great interest to the New York, Rhode Island, and Massachusetts research and management communities because of this area's ecological, recreational, and commercial importance. Geologically interpreted digital terrain models from individual surveys provide important benthic environmental information, yet many applications of this information require a geographically broader perspective. For example, individual surveys are of limited use for the planning and construction of cross-sound infrastructure, such as cables and pipelines, or for the testing of regional circulation models. To address this need, we integrated 14 contiguous multibeam bathymetric datasets that were produced by the National Oceanic and Atmospheric Administration during charting operations into one digital terrain model that covers much of Block Island Sound and extends eastward across Rhode Island Sound. The new dataset, which covers over 1244 square kilometers, is adjusted to mean lower low water, gridded to 4-meter resolution, and provided in Universal Transverse Mercator Zone 19, North American Datum of 1983 and geographic World Geodetic Survey of 1984 projections. This resolution is adequate for sea-floor feature and process interpretation but is small enough to be queried and manipulated with standard Geographic Information System programs and to allow for future growth. Natural features visible in the data include boulder lag deposits of winnowed Pleistocene strata, sand-wave fields, and scour depressions that reflect the strength of oscillating tidal currents and scour by storm-induced waves. Bedform asymmetry allows interpretations of net sediment transport. Anthropogenic features visible in the data include shipwrecks and dredged channels. Together the merged data reveal a larger, more continuous perspective of bathymetric topography than previously available, providing a fundamental framework for
International Nuclear Information System (INIS)
Silva, Rita de Cassia A.; Saiki, Mitiko
2009-01-01
Predatory birds such as herons have been used as bioindicators of pollution since they are at the top of their food webs. The tissues of these animals are analyzed for assessing environmental pollution caused by toxic elements. In the present study, adequate experimental conditions were established for determination of trace elements concentrations in the liver samples of Great-white-egret (Ardea alba Linnaeus, 1758) for further application of this specimens as a bioindicator of environmental contamination. Four liver samples were collected from Greatwhite- egrets found in the metropolitan region of Sao Paulo and were they analyzed by the method of neutron activation analysis (NAA). Concentrations of the elements Br, Co, Cs, Fe, Na, Rb, Se and Zn were measured in these liver tissues. The findings of this present study demonstrated that the established procedure for liver sample treatment was appropriate to obtain a homogeneous sample. The method of neutron activation analysis (NAA) was very promising for liver sample analysis for evaluation of environmental contamination. (author)
Energy Technology Data Exchange (ETDEWEB)
Silva, Rita de Cassia A.; Saiki, Mitiko, E-mail: rcsilva@ipen.b, E-mail: mitiko@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)
2009-07-01
Predatory birds such as herons have been used as bioindicators of pollution since they are at the top of their food webs. The tissues of these animals are analyzed for assessing environmental pollution caused by toxic elements. In the present study, adequate experimental conditions were established for determination of trace elements concentrations in the liver samples of Great-white-egret (Ardea alba Linnaeus, 1758) for further application of this specimens as a bioindicator of environmental contamination. Four liver samples were collected from Greatwhite- egrets found in the metropolitan region of Sao Paulo and were they analyzed by the method of neutron activation analysis (NAA). Concentrations of the elements Br, Co, Cs, Fe, Na, Rb, Se and Zn were measured in these liver tissues. The findings of this present study demonstrated that the established procedure for liver sample treatment was appropriate to obtain a homogeneous sample. The method of neutron activation analysis (NAA) was very promising for liver sample analysis for evaluation of environmental contamination. (author)
Work, Thierry M.; Rameyer, Robert
1996-01-01
We describe a new species of Haemoproteus Kruse, 1890 from great frigatebirds (Fregata minor [Gmelin]) captured on Tern Island-French Frigate Shoals and Laysan Island in Hawaii. Parasite prevalence on Laysan Island (35%) was not significantly different than that of Tern Island (36%). On Laysan, prevalence was highest in juveniles (52%), followed by adult males (29%) and adult females (19%). Prevalence on Tern was 36% both for adult females and juveniles, and 28% for adult males. Parasitemia was low (mean parasites/10,000 red blood cell). Parasitized red cells had significantly greater areas than unparasitized cells. We named this parasite Haemoproteus iwa after the Hawaiian name for frigatebirds (iwa). This is the first documentation of a hemoparasite from tropical pelagic seabirds in Hawaii and the first description of an endemic hemoparasite in the archipelago.
National Oceanic and Atmospheric Administration, Department of Commerce — This data set contains sensitive biological resource data for bald eagle, great blue heron, and seabird nesting sites in Puget Sound and Strait of Juan de Fuca,...
Great Palm Island Extension, Density, and Calcification Data for 1872 to 1985
National Oceanic and Atmospheric Administration, Department of Commerce — Extension, Density, and Calcification data from 35 Porites coral cores covering the entire length of the Great Barrier Reef, Australia. Data set contains 35...
Unravelling feeding territoriality in the Little Blue Heron, Egretta caerulea, in Cananéia, Brazil
Directory of Open Access Journals (Sweden)
E Moralez-Silva
Full Text Available Habitat use by the Little Blue Heron (Egretta caerulea and discovery of feeding territoriality are discussed here. The results showed the existence of a territorial individual defending an area (2,564.46 ± 943.56 m² close to the mangrove, and non-territorial individuals (9.17 ± 2.54 in the rest of a demarcated area (mean area for the non-territorial: 893.25 ± 676.72. A weak positive correlation (r = 0.47, df = 46, p < 0.05 was found between the overlapping of territorial and non-territorial individuals (2.85 ± 3.07 m² and the mean overlapped area for territorial individuals (171.41 ± 131.40 m². Higher capture (1.52 ± 1.14 × 1.00 ± 1.37 catches/minutes and success rates (0.45 ± 0.31 × 0.21 ± 0.27 and lower energy expenditure rates (45.21 ± 14.96 × 51.22 ± 14.37 steps/minutes; and 3.65 ± 2.55 × 4.94 ± 3.28 stabs/minutes were observed for individuals foraging in areas close to the mangrove. The results suggest that the observed territorial behaviour is more related to a number of food parameters than to intruder pressure, and also that the observed territoriality might be related to defense of areas with higher prey availability.
Directory of Open Access Journals (Sweden)
Pau Aleixandre
Full Text Available The evolutionary divergence of island populations, and in particular the tempo and relative importance of neutral and selective factors, is of central interest to the study of speciation. The rate of phenotypic evolution upon island colonization can vary greatly among taxa, and cases of convergent evolution can further confound the inference of correct evolutionary histories. Given the potential lability of phenotypic characters, molecular dating of insular lineages analyzed in a phylogenetic framework provides a critical tool to test hypotheses of phenotypic divergence since colonization. The Guadalupe junco is the only insular form of the polymorphic dark-eyed junco (Junco hyemalis, and shares eye and plumage color with continental morphs, yet presents an enlarged bill and reduced body size. Here we use variation in mtDNA sequence, morphological traits and song variables to test whether the Guadalupe junco evolved rapidly following a recent colonization by a mainland form of the dark-eyed junco, or instead represents a well-differentiated "cryptic" lineage adapted to the insular environment through long-term isolation, with plumage coloration a result of evolutionary convergence. We found high mtDNA divergence of the island lineage with respect to both continental J. hyemalis and J. phaeonotus, representing a history of isolation of about 600,000 years. The island lineage was also significantly differentiated in morphological and male song variables. Moreover, and contrary to predictions regarding diversity loss on small oceanic islands, we document relatively high levels of both haplotypic and song-unit diversity on Guadalupe Island despite long-term isolation in a very small geographic area. In contrast to prevailing taxonomy, the Guadalupe junco is an old, well-differentiated evolutionary lineage, whose similarity to mainland juncos in plumage and eye color is due to evolutionary convergence. Our findings confirm the role of remote islands
Alexander the Great's tombolos at Tyre and Alexandria, eastern Mediterranean
Marriner, N.; Goiran, J. P.; Morhange, C.
2008-08-01
Tyre and Alexandria's coastlines are today characterised by wave-dominated tombolos, peculiar sand isthmuses that link former islands to the adjacent continent. Paradoxically, despite a long history of inquiry into spit and barrier formation, understanding of the dynamics and sedimentary history of tombolos over the Holocene timescale is poor. At Tyre and Alexandria we demonstrate that these rare coastal features are the heritage of a long history of natural morphodynamic forcing and human impacts. In 332 BC, following a protracted seven-month siege of the city, Alexander the Great's engineers cleverly exploited a shallow sublittoral sand bank to seize the island fortress; Tyre's causeway served as a prototype for Alexandria's Heptastadium built a few months later. We report stratigraphic and geomorphological data from the two sand spits, proposing a chronostratigraphic model of tombolo evolution.
Glas, Martin S; Motti, Cherie A; Negri, Andrew P; Sato, Yui; Froscio, Suzanne; Humpage, Andrew R; Krock, Bernd; Cembella, Allan; Bourne, David G
2010-07-01
Cyanobacterial toxins (i.e. microcystins) produced within the microbial mat of coral black band disease (BBD) have been implicated in disease pathogenicity. This study investigated the presence of toxins within BBD lesions and other cyanobacterial patch (CP) lesions, which, in some instances ( approximately 19%), facilitated the onset of BBD, from an outbreak site at Pelorus Island on the inshore, central Great Barrier Reef (GBR). Cyanobacterial species that dominated the biomass of CP and BBD lesions were cultivated and identified, based on morphology and 16S rRNA gene sequences, as Blennothrix- and Oscillatoria-affiliated species, respectively, and identical to cyanobacterial sequences retrieved from previous molecular studies from this site. The presence of the cyanotoxins microcystin, cylindrospermopsin, saxitoxin, nodularin and anatoxin and their respective gene operons in field samples of CP and BBD lesions and their respective culture isolations was tested using genetic (PCR-based screenings), chemical (HPLC-UV, FTICR-MS and LC/MS(n)) and biochemical (PP2A) methods. Cyanotoxins and cyanotoxin synthetase genes were not detected in any of the samples. Cyanobacterial species dominant within CP and BBD lesions were phylogenetically distinct from species previously shown to produce cyanotoxins and isolated from BBD lesions. The results from this study demonstrate that cyanobacterial toxins appear to play no role in the pathogenicity of CP and BBD at this site on the GBR.
International Nuclear Information System (INIS)
Burger, Joanna
2013-01-01
There is an abundance of data for levels of metals from a range of species, but relatively few long-term time series from the same location. In this paper I examine the levels of arsenic, cadmium, chromium, lead, manganese, mercury and selenium in feathers from fledgling great egrets (Ardea alba) collected at nesting colonies in Barnegat Bay, New Jersey from 1989 to 2011. The primary objectives were to test the null hypotheses that (1) There were no temporal differences in metal levels in feathers of fledgling great egrets, and (2) Great egrets nesting in different areas of Barnegat Bay (New Jersey) did not differ in metal levels. There were significant yearly variations in levels of all heavy metals in feathers of fledgling great egret, but levels decreased significantly from 1989 to 2011 only for lead (1470 ppb to 54.3 ppb), cadmium (277 ppb to 30.5 ppb), and manganese (only since 1996; 2669 ppb to 329 ppb)). Although mercury levels decreased from 2003–2008 (6430 ppb to 1042 ppb), there was no pattern before 2003, and levels increased after 2008 to 2610 ppb in 2011. Lead, cadmium, chromium, manganese and mercury were higher in feathers from great egrets nesting in the northern part of the bay, and selenium was highest in feathers from mid-bay. The lack of a temporal decline in mercury levels in feathers of great egrets is cause for concern, since the high levels in feathers from some years (means as high as 6430 ppb) are in the range associated with adverse effects (5000 ppb for feathers). -- Highlights: ► Metals were monitored in feathers of great egrets from Barnegat Bay, New Jersey. ► Levels of cadmium and lead decreased significantly from 1989–2011. ► Mercury levels in feathers from great egrets did not decline from 1989–2011. ► Metal levels were generally higher in great egrets and black-crowned night heron feathers than in snowy egrets
International Nuclear Information System (INIS)
Quiros, Laia; Ruiz, Xavier; Sanpera, Carolina; Jover, Lluis; Pina, Benjamin
2008-01-01
The frequency of micronuclei (MN) in peripheral erythrocytes was tested for 59 heron nestlings (Ardea purpurea, Egretta garzetta and Bubulcus ibis) sampled at two areas (polluted and reference) on the River Ebro (NE Spain) and at its Delta during Spring 2006. Flow-cytometry analysis revealed higher (three- to six-fold) MN counts in samples from the most polluted site relative to samples from the reference area. Samples from the Delta showed intermediate values. Age, morphometric parameters (weight, tarsus size and bill-head length) and maturation status showed no significant differences among the different populations for each species; nor were they correlated with MN levels. The data suggest that elevated levels of MN in chicks in impacted areas reflected the chemical pollution of their nesting sites. The use of nestlings for this assay appears to be a convenient, non-destructive method to assess the impact of pollution in natural bird populations. - Frequency of micronucleated erythrocytes in peripheral blood of waterbird nestlings correlates with chemical pollution loads in their nesting sites
Rahimi, A.; Shahrisvand, M.
2017-09-01
GRACE satellites (the Gravity Recovery And climate Experiment) are very useful sensors to extract gravity anomalies after earthquakes. In this study, we reveal co-seismic signals of the two combined earthquakes, the 2006 Mw8.3 thrust and 2007 Mw8.1 normal fault earthquakes of the central Kuril Islands from GRACE observations. We compute monthly full gravitational gradient tensor in the local north-east-down frame for Kuril Islands earthquakes without spatial averaging and de-striping filters. Some of gravitational gradient components (e.g. ΔVxx, ΔVxz) enhance high frequency components of the earth gravity field and reveal more details in spatial and temporal domain. Therefore, co-seismic activity can be better illustrated. For the first time, we show that the positive-negative-positive co-seismic ΔVxx due to the Kuril Islands earthquakes ranges from - 0.13 to + 0.11 milli Eötvös, and ΔVxz shows a positive-negative-positive pattern ranges from - 0.16 to + 0.13 milli Eötvös, agree well with seismic model predictions.
Deposition of organic material in a coral reef lagoon, One Tree Island, Great Barrier Reef
Koop, K.; Larkum, A. W. D.
1987-07-01
Deposition of organic material was measured at four sites on One Tree Island coral reef using fixed sediment traps. Although no reliable data were obtained for the reef crest area because of problems of resuspension, mean deposition in the backreef area amounted to some 4 g organic C m -2 day -1 whereas in the lagoon it was about 1·5 g C m -2 day -1. This amounted to mean nitrogen deposition rates of 160 and 95 mg N m -2 day -1, respectively. As primary production by turf algae, the principal producers at One Tree Island, has been estimated at about 2·3 g C m -2 day -1 for the whole reef system and the weighted mean carbon deposition is estimated at 2·2 g C m -2 day -1, it is clear that the carbon produced by plants is largely retained in the system. Nitrogen deposition, on the other hand, amounted to only about 60% of that produced by turf algae and it must be assumed that much of this leached into the water during sedimentation. Losses of nitrogen may be minimized by incorporation of dissolved nitrogen by pelagic microheterotrophs which may in turn be consumed by filter feeders before they leave the reef.
Clark, Adam T; Rykken, Jessica J; Farrell, Brian D
2011-01-01
Many studies have examined how island biogeography affects diversity on the scale of island systems. In this study, we address how diversity varies over very short periods of time on individual islands. To do this, we compile an inventory of the ants living in the Boston Harbor Islands National Recreation Area, Boston, Massachusetts, USA using data from a five-year All Taxa Biodiversity Inventory of the region's arthropods. Consistent with the classical theory of island biogeography, species richness increased with island size, decreased with island isolation, and remained relatively constant over time. Additionally, our inventory finds that almost half of the known Massachusetts ant fauna can be collected in the BHI, and identifies four new species records for Massachusetts, including one new to the United States, Myrmica scabrinodis. We find that the number of species actually active on islands depended greatly on the timescale under consideration. The species that could be detected during any given week of sampling could by no means account for total island species richness, even when correcting for sampling effort. Though we consistently collected the same number of species over any given week of sampling, the identities of those species varied greatly between weeks. This variation does not result from local immigration and extinction of species, nor from seasonally-driven changes in the abundance of individual species, but rather from weekly changes in the distribution and activity of foraging ants. This variation can be upwards of 50% of ant species per week. This suggests that numerous ant species on the BHI share the same physical space at different times. This temporal partitioning could well explain such unexpectedly high ant diversity in an isolated, urban site.
EPA's Heat Island Effect Site provides information on heat islands, their impacts, mitigation strategies, related research, a directory of heat island reduction initiatives in U.S. communities, and EPA's Heat Island Reduction Program.
Velankar, Avadhoot D; Kumara, Honnavalli N; Pal, Arijit; Mishra, Partha Sarathi; Singh, Mewa
2016-01-01
Natural disasters pose a threat to isolated populations of species with restricted distributions, especially those inhabiting islands. The Nicobar long tailed macaque.Macaca fascicularis umbrosus, is one such species found in the three southernmost islands (viz. Great Nicobar, Little Nicobar and Katchal) of the Andaman and Nicobar archipelago, India. These islands were hit by a massive tsunami (Indian Ocean tsunami, 26 December 2004) after a 9.2 magnitude earthquake. Earlier studies [Umapathy et al. 2003; Sivakumar, 2004] reported a sharp decline in the population of M. f. umbrosus after thetsunami. We studied the distribution and population status of M. f. umbrosus on thethree Nicobar Islands and compared our results with those of the previous studies. We carried out trail surveys on existing paths and trails on three islands to get encounter rate as measure of abundance. We also checked the degree of inundation due to tsunami by using Normalized Difference Water Index (NDWI) on landsat imageries of the study area before and after tsunami. Theencounter rate of groups per kilometre of M. f. umbrosus in Great Nicobar, Little Nicobar and Katchal was 0.30, 0.35 and 0.48 respectively with the mean group size of 39 in Great Nicobar and 43 in Katchal following the tsunami. This was higher than that reported in the two earlier studies conducted before and after the tsunami. Post tsunami, there was a significant change in the proportion of adult males, adult females and immatures, but mean group size did not differ as compared to pre tsunami. The results show that population has recovered from a drastic decline caused by tsunami, but it cannot be ascertained whether it has reached stability because of the altered group structure. This study demonstrates the effect of natural disasters on island occurring species.
DEFF Research Database (Denmark)
Whittaker, Robert James; Fernández-Palacios, José María; Matthews, Thomas J.
2017-01-01
Islands provide classic model biological systems. We review how growing appreciation of geoenvironmental dynamics of marine islands has led to advances in island biogeographic theory accommodating both evolutionary and ecological phenomena. Recognition of distinct island geodynamics permits gener...
Plastic ingestion by fulmars and shearwaters at Sable Island, Nova Scotia, Canada.
Bond, Alexander L; Provencher, Jennifer F; Daoust, Pierre-Yves; Lucas, Zoe N
2014-10-15
Plastic pollution is widespread in the marine environment, and plastic ingestion by seabirds is now widely reported for dozens of species. Beached Northern Fulmars, Great Shearwaters, Sooty Shearwaters and Cory's Shearwaters are found on Sable Island, Nova Scotia, Canada regularly, and they can be used to assess plastic pollution. All species except Cory's Shearwaters contained plastic debris in their gastrointestinal tracts. Northern Fulmars, Sooty Shearwaters and Great Shearwaters all showed high prevalence of plastic ingestion (>72%), with Northern Fulmars having the highest number and mass of plastics among the species examined. There was no difference in plastic ingestion between sexes or age classes. In all species user plastics made up the majority of the pieces found, with industrial pellets representing only a small proportion in the samples. Sable Island could be an important monitoring site for plastic pollution in Atlantic Canada. Copyright © 2014 Elsevier Ltd. All rights reserved.
Compositional searching of CpG islands in the human genome
Luque-Escamilla, Pedro Luis; Martínez-Aroza, José; Oliver, José L.; Gómez-Lopera, Juan Francisco; Román-Roldán, Ramón
2005-06-01
We report on an entropic edge detector based on the local calculation of the Jensen-Shannon divergence with application to the search for CpG islands. CpG islands are pieces of the genome related to gene expression and cell differentiation, and thus to cancer formation. Searching for these CpG islands is a major task in genetics and bioinformatics. Some algorithms have been proposed in the literature, based on moving statistics in a sliding window, but its size may greatly influence the results. The local use of Jensen-Shannon divergence is a completely different strategy: the nucleotide composition inside the islands is different from that in their environment, so a statistical distance—the Jensen-Shannon divergence—between the composition of two adjacent windows may be used as a measure of their dissimilarity. Sliding this double window over the entire sequence allows us to segment it compositionally. The fusion of those segments into greater ones that satisfy certain identification criteria must be achieved in order to obtain the definitive results. We find that the local use of Jensen-Shannon divergence is very suitable in processing DNA sequences for searching for compositionally different structures such as CpG islands, as compared to other algorithms in literature.
Tenarife Island, Canary Island Archipelago, Atlantic Ocean
1991-01-01
Tenarife Island is one of the most volcanically active of the Canary Island archipelago, Atlantic Ocean, just off the NW coast of Africa, (28.5N, 16.5W). The old central caldera, nearly filled in by successive volcanic activity culminating in two stratocones. From those two peaks, a line of smaller cinder cones extend to the point of the island. Extensive gullies dissect the west side of the island and some forests still remain on the east side.
Digital Repository Service at National Institute of Oceanography (India)
Desai, V.V.; Komarpant, D.S.; Jagtap, T.G.
importance in accumulating and binding the sediments and governing their movement. Lakshadweep islands are 1.5-2 m above sea level and mainly composed of sandstone and sand. Therefore, the natural sand-dune flora is of great importance to the island from... the point of shore stabilization. However, sand-dune habitats around the island have been largely reclaimed for agricultural and urbanization purposes. The entire tourist complex towards the south has been developed by reclaiming sand-dune areas. Species...
Directory of Open Access Journals (Sweden)
Adam T Clark
Full Text Available Many studies have examined how island biogeography affects diversity on the scale of island systems. In this study, we address how diversity varies over very short periods of time on individual islands. To do this, we compile an inventory of the ants living in the Boston Harbor Islands National Recreation Area, Boston, Massachusetts, USA using data from a five-year All Taxa Biodiversity Inventory of the region's arthropods. Consistent with the classical theory of island biogeography, species richness increased with island size, decreased with island isolation, and remained relatively constant over time. Additionally, our inventory finds that almost half of the known Massachusetts ant fauna can be collected in the BHI, and identifies four new species records for Massachusetts, including one new to the United States, Myrmica scabrinodis. We find that the number of species actually active on islands depended greatly on the timescale under consideration. The species that could be detected during any given week of sampling could by no means account for total island species richness, even when correcting for sampling effort. Though we consistently collected the same number of species over any given week of sampling, the identities of those species varied greatly between weeks. This variation does not result from local immigration and extinction of species, nor from seasonally-driven changes in the abundance of individual species, but rather from weekly changes in the distribution and activity of foraging ants. This variation can be upwards of 50% of ant species per week. This suggests that numerous ant species on the BHI share the same physical space at different times. This temporal partitioning could well explain such unexpectedly high ant diversity in an isolated, urban site.
1992-01-01
This easterly looking view shows the seven major volcanic islands of the Canary Island chain (28.0N, 16.5W) and offers a unique view of the islands that have become a frequent vacation spot for Europeans. The northwest coastline of Africa, (Morocco and Western Sahara), is visible in the background. Frequently, these islands create an impact on local weather (cloud formations) and ocean currents (island wakes) as seen in this photo.
Tsunami Numerical Simulation for Hypothetical Giant or Great Earthquakes along the Izu-Bonin Trench
Harada, T.; Ishibashi, K.; Satake, K.
2013-12-01
We performed tsunami numerical simulations from various giant/great fault models along the Izu-Bonin trench in order to see the behavior of tsunamis originated in this region and to examine the recurrence pattern of great interplate earthquakes along the Nankai trough off southwest Japan. As a result, large tsunami heights are expected in the Ryukyu Islands and on the Pacific coasts of Kyushu, Shikoku and western Honshu. The computed large tsunami heights support the hypothesis that the 1605 Keicho Nankai earthquake was not a tsunami earthquake along the Nankai trough but a giant or great earthquake along the Izu-Bonin trench (Ishibashi and Harada, 2013, SSJ Fall Meeting abstract). The Izu-Bonin subduction zone has been regarded as so-called 'Mariana-type subduction zone' where M>7 interplate earthquakes do not occur inherently. However, since several M>7 outer-rise earthquakes have occurred in this region and the largest slip of the 2011 Tohoku earthquake (M9.0) took place on the shallow plate interface where the strain accumulation had considered to be a little, a possibility of M>8.5 earthquakes in this region may not be negligible. The latest M 7.4 outer-rise earthquake off the Bonin Islands on Dec. 22, 2010 produced small tsunamis on the Pacific coast of Japan except for the Tohoku and Hokkaido districts and a zone of abnormal seismic intensity in the Kanto and Tohoku districts. Ishibashi and Harada (2013) proposed a working hypothesis that the 1605 Keicho earthquake which is considered a great tsunami earthquake along the Nankai trough was a giant/great earthquake along the Izu-Bonin trench based on the similarity of the distributions of ground shaking and tsunami of this event and the 2010 Bonin earthquake. In this study, in order to examine the behavior of tsunamis from giant/great earthquakes along the Izu-Bonin trench and check the Ishibashi and Harada's hypothesis, we performed tsunami numerical simulations from fault models along the Izu-Bonin trench
Coastal Impacts of the March 11th Tsunami in the Galapagos Islands
Lynett, P. J.; Weiss, R.; Renteria, W.
2011-12-01
On March 11, 2011 at 5:46:23 UTC (March 10 11:46:23 PM Local Time, Galapagos), the magnitude 9.0 Mw Great East Japan Earthquake occurred near the Tohoku region off the east coast of Japan. The purpose of this presentation is to provide the results of a tsunami field survey in the Galapagos Islands performed by an International Tsunami Survey Team (ITST) with great assistance from INOCAR, the oceanographic service of the Ecuadorian Navy, and the Galapagos National Park. The Galapagos Islands are a volcanic chain composed of many islands of various sizes. The four largest islands are the focus of this survey, and are, from west to east, Isabela, Santiagio, Santa Cruz, and San Cristobal. Aside from approximately 10 sandy beaches that are open to tourists, all other shoreline locations are strictly off limits to anyone without a research permit. All access to the shoreline is coordinated through the Galapagos National Park, and any landing requires a chaperone, a Park Ranger. While a few of the visited areas in this survey were tourist sites, the vast majority were not. Due to time constraints and a generally inaccessibility of the coastline, the survey locations were strongly guided by numerical computations performed previous to the surveys. This numerical guidance accurately predicted the regions of highest impact, as well as regions of relatively low impact. Tide-corrected maximum flow elevations were generally in the range of 3-4 meters, while Isabela experienced the largest flow elevation of 6 m in a small pocket beach. The largest harbor in the Islands, Puerto Ayora, experienced moderate damage, with significant flooding and some structural damage. Currents in the Baltra Channel, a small waterway between Santa Cruz and Baltra, were strong enough to transport navigation buoys distances greater than 800 m. Extreme dune erosion, and the associated destruction of sea turtle nesting habit, was widespread and noted on all of the islands visited.
Comparison of diffusion from a small island and an undisturbed ocean site
International Nuclear Information System (INIS)
Raynor, G.S.; Brown, R.M.; SethuRaman, S.
1978-01-01
Experiments were conducted to investigate the differences in diffusion from an obstacle to free air flow in the ocean and from an undisturbed ocean site. A small island was used as the obstacle and simultaneous releases of oil-fog smoke were made from the island and from a nearby boat. The widths of the plumes and their concentrations distributions were measured quantitatively during traverses across the plumes by a second boat. Extensive series of photographs were taken of the plumes from the surface and from the air. Meteorological measurements were made at two locations on the island, from the boats and from an aircraft. One test series was conducted during unstable conditions and a second series with neutral and stable conditions.Width of the island plume over short periods was from 1.5 to 4 times that of the boat plume with the greatest difference during stable periods. Over longer periods, the differences were somewhat greater and much of the dispersion was caused by plume meander. Height of the island plume averaged about twice that of the boat plume. Normalized maximum centerline concentrations from the boat plume were 1.4 times those of the island plume during unstable periods but about twice during stable and neutral conditions. Averaged over all tests, dispersion from the island was about twice as great as from the boat
Al-Salamah, Manalle
2014-12-01
With a dramatic decrease of biodiversity as a result of the increase in exploitation of marine ecosystems, the establishment of marine protected areas (MPAs) serves as an important means of protecting those resources. Although there is support for the effectiveness of these MPAs and MPA networks, there is room for improvement in terms of MPA management and design. For example, a better understanding of the dispersal dynamics of targeted species across these MPAs will serve as a more accurate means of reserve as well as fisheries management. While there have been many methods used to determine the larval dispersal of a certain species, parentage analysis is becoming the most robust. In this thesis, I attempt to determine the patterns of self-recruitment and larval dispersal of the Longfin Grouper (Epinephelus quoyanus) in one focal marine reserve within the Great Keppel Island group through the method of parentage. For this, I developed 14 microsatellite markers and with those, genotyped 610 adults as well as 478 juveniles from the study site. These genotypes allowed me to assign offspring to their potential parents, which then allowed me to measure the self-recruitment, local retention as well as larval dispersal percentages of this species from and within the reserve. My results indicate that there is 32% local retention to the reserve while 68% of the assigned juveniles were dispersed to other areas (4% of which dispersed to another reserve). Previous studies conducted in the same area showed higher reserve self-recruitment rates for both Plectropomus maculatus (~30%) and Lutjanus carponotatus (64%) despite their similar life history traits. The results from this study add to the growing evidence that dispersal patterns cannot be generalized across marine systems or even between species within a single system.
Rhode Island hurricanes and tropical storms: A fifty-six year summary 1936-1991. Technical memo
International Nuclear Information System (INIS)
Vallee, D.R.
1993-03-01
The paper was compiled to provide a general overview of all tropical cyclone activity near Rhode Island since 1936. The year of 1936 is arbitrary, chosen mainly to include a 'not so well known' system prior to the well documented Great New England Hurricane of 1938. Thirty-one such storms have affected the state in the past 56 years, either making landfall along the coast of southern New England, or passing close enough over the offshore waters to spread tropical storm or hurricane force conditions into the area. The intensities of these systems have ranged from weak, disorganized tropical storms to full fledged major hurricanes. The one feature common to almost all of the storms was a rapid acceleration toward Rhode Island, which greatly reduced the time to prepare and evacuate
Multidecadal shoreline changes of atoll islands in the Marshall Islands
Ford, M.
2012-12-01
Atoll islands are considered highly vulnerable to the impacts of continued sea level rise. One of the most commonly predicted outcomes of continued sea level rise is widespread and chronic shoreline erosion. Despite the widespread implications of predicted erosion, the decadal scale changes of atoll island shorelines are poorly resolved. The Marshall Islands is one of only four countries where the majority of inhabited land is comprised of reef and atoll islands. Consisting of 29 atolls and 5 mid-ocean reef islands, the Marshall Islands are considered highly vulnerable to the impacts of sea level rise. A detailed analysis of shoreline change on over 300 islands on 10 atolls was undertaken using historic aerial photos (1945-1978) and modern high resolution satellite imagery (2004-2012). Results highlight the complex and dynamic nature of atoll islands, with significant shifts in shoreline position observed over the period of analysis. Results suggest shoreline accretion is the dominant mode of change on the islands studied, often associated with a net increase in vegetated island area. However, considerable inter- and intra-atoll variability exists with regards to shoreline stability. Findings are discussed with respect to island morphodynamics and potential hazard mitigation and planning responses within atoll settings.
A New Great Game: US-China Competition in Guam and the CNMI
2017-06-01
media . It would appear the US in Guam and the CNMI is playing the role of the metaphorical frog being slowly boiled to death in a Chinese pot...nonimmigrant worker and tourism policy which greatly aid an aggressive Chinese intelligence collection posture. Finally, Chapter 5 will provide...island chain. This intersection of interest extends beyond physical geography. While the US has most significantly impacted the social geographies of
[Terrestrial flora of Malpelo Island, Colombia, Eastern Tropical Pacific].
González-Román, Rubén D; López-Victoria, Mateo; Silverstone-Sopkin, Philip A
2014-03-01
Malpelo Island is located 380km off the mainland continental coast of Colombia, in the Pacific Ocean. Several geological, ecological, and zoological studies, both marine and terrestrial, have been conducted in this island. Despite some marginal comments on some publications, no single specific survey has been devoted to botany so far. In order to make a floristic inventory of the terrestrial flora of this island, three field trips were made in 2010 to collect vascular plants, mosses, and lichens, as well as data on their distribution within the island. We collected and identified 25 species of lichens, two species of vascular plants and one moss. Lichens were the most diverse group found, including records of four new genera (Endocarpon, Fuscidea, Lecanographa and Verrucaria) and 13 new species for Colombia. The high lichen richness on Malpelo might be explained by their efficient form of asexual reproduction (soredia and isidia), that may have facilitated their transport to the island by migrating birds or wind. Once on the island, it is possible that lichens persist by being chemically protected against herbivores. The great number of new generic and species records for Colombia is explained by the low number of studies in saxicolous lichens conducted so far in the country, particularly on coastal areas and remote islands. Only two species of vascular plants were collected, a grass, Paspalum sp., and a fern, Pityrogramma calomelanos, and both of them correspond to new determinations for Malpelo. A moss species previously reported but with no positive identification was collected and identified as Octoblepharum albidum. Other species previously reported, for example, some species of shrubs, were not observed. The low number of vascular plants is probably due to a combination of soil conditions and herbivory by land crabs. This study is the first complete inventory of the flora of Malpelo and is a starting and reference point for future comparisons among islands in
Verboven, N.; Mateman, A.C.
1997-01-01
Multilocus DNA fingerprinting was used to estimate the frequency of extra-pair fertilizations in a low density, island population of Great Tits Parus major. A total of 69 pairs and 516 offspring from 82 breeding attempts were examined. Only 18 offspring (3.5%) in seven different nests were not
Foundation Investigation for Ground Based Radar Project-Kwajalein Island, Marshall Islands
1990-04-01
iL_ COPY MISCELLANEOUS PAPER GL-90-5 i iFOUNDATION INVESTIGATION FOR GROUND BASED RADAR PROJECT--KWAJALEIN ISLAND, MARSHALL ISLANDS by Donald E...C!assification) Foundatioa Investigation for Ground Based Radar Project -- Kwajalein Island, Marshall Islands 12. PERSONAL AUTHOR(S) Yule, Donald E...investigation for the Ground Based Radar Project -- Kwajalein Island, Marshall Islands , are presented.- eophysical tests comprised of surface refrac- tion
Directory of Open Access Journals (Sweden)
Banaszak Józef
2016-03-01
Full Text Available The study has contributed to the identification of the apifauna of central Wielkopolska. The study identified 161 bee species, accounting for 34.2% of the Polish bee fauna. The highest contribution (28.7% of the fauna comes from four species, namely Andrena haemorrhoa, A. helvola, Evylaeus calceatus and Osmia rufa, while Bombus terrestris and Evylaeus pauxillus are two subdominants. The assemblages of Apiformes in the study area are characterised by a significant contribution of spring-associated species, which is probably an effect of the presence of numerous willow thickets offering abundant host plants (mainly Salix sp. div.. Both the islands and the surroundings of the lake have a unique species composition, and there are differences in the proportions of the individual dominant species. The overall abundance of bees varies greatly, with mean seasonal density figures on Ostrów Lednicki Island being more than twice as high as that on the mainland grassland, with a distinct predominance of bumblebees. The exceptional richness of Apiformes, including bumblebees, on Ostrów Lednicki should be regarded as the basis for treating this island as a life refuge for bumblebees and including it and its environs in the list of sites of Community importance (SCI. A simultaneous study of the vegetation cover contributed significant data on the vascular plant flora and plant communities of the Lednica Landscape Park. For example, it was the first such investigation of Mewia Island. The study revealed the importance of marginal habitats (natural islands and habitat islands for the preservation of protected and endangered plant species and plant communities receding from an agricultural landscape.
Martinuzzi, Sebastiáin; Gould, William A; Ramos Gonzalez, Olga M; Martinez Robles, Alma; Calle Maldonado, Paulina; Pérez-Buitrago, Néstor; Fumero Caban, José J
2008-06-01
Assessing the status of tropical dry forest habitats using remote sensing technologies is one of the research priorities for Neotropical forests. We developed a simple method for mapping vegetation and habitats in a tropical dry forest reserve, Mona Island, Puerto Rico, by integrating the Normalized Difference Vegetation Index (NDVI) from Landsat, topographic information, and high-resolution Ikonos imagery. The method was practical for identifying vegetation types in areas with a great variety of plant communities and complex relief, and can be adapted to other dry forest habitats of the Caribbean Islands. NDVI was useful for identifying the distribution of forests, woodlands, and shrubland, providing a natural representation of the vegetation patterns on the island. The use of Ikonos imagery allowed increasing the number of land cover classes. As a result, sixteen land-cover types were mapped over the 5500 ha area, with a kappa coefficient of accuracy equal to 79%. This map is a central piece for modeling vertebrate species distribution and biodiversity patterns by the Puerto Rico Gap Analysis Project, and it is of great value for assisting research and management actions in the island.
Wainwright, S.E.; Mora, M.A.; Sericano, J.L.; Thomas, P.
2001-01-01
During 1997 we evaluated reproductive success in colonial water birds nesting in the Lower Rio Grande Valley (LRGV), Texas, and correlated success with concentrations of contaminants in eggs. We also measured steroid hormones and gonadosomatic index (GSI) as biomarkers of endocrine effects in common carp (Cyprinus carpio). Nest and fledging success of green herons (Butorides virescens) and great egrets (Ardea alba) were similar to those found in other parts of North America; however, nesting success of black-crowned night-herons (Nycticorax nycticorax) was lower, very likely due to flooding of the nesting area. Except for DDE and toxaphene, all chlorinated pesticides in bird eggs were low and not of concern for negative effects on any of the three species. DDE was highest in green heron eggs and seemed to increase along a geographic gradient from west to east, with eggs from Falcon Reservoir containing low concentrations, and those at Los Indios containing the highest concentrations (approx. 11,000 ng/g WW), near or above the threshold for reproductive impairment. DDE levels in great egrets and black-crowned night-herons were below those that are associated with reproductive impairment. Mean DDE levels in carp at the JAS Farms site were above the threshold level suggested for predator protection. Toxaphene was detected in about 20% of the samples with high levels observed in green heron eggs from Los Indios (mean = 4,402 ng/g WW). These are the highest toxaphene levels reported in bird eggs in the LRGV. Toxaphene levels in fish ranged between 90 and 312 ng/g WW. In general, PCBs in bird eggs and fish tissue were low and at levels not of concern for reproductive effects. The greatest concentrations of testosterone and 11-ketotestosterone were detected in fish from the JAS Farms site, which also had the greatest concentrations of DDE. Increased androgen production and gonad development in fish at this site, relative to Pharr, could be possibly associated with
AN ECOLOGICAL REVIEW OF CLADOPHORA GLOMERATA (CHLOROPHYTA) IN THE LAURENTIAN GREAT LAKES(1).
Higgins, Scott N; Malkin, Sairah Y; Todd Howell, E; Guildford, Stephanie J; Campbell, Linda; Hiriart-Baer, Veronique; Hecky, Robert E
2008-08-01
Cladophora glomerata (L.) Kütz. is, potentially, the most widely distributed macroalga throughout the world's freshwater ecosystems. C. glomerata has been described throughout North America, Europe, the Atlantic Islands, the Caribbean Islands, Asia, Africa, Australia and New Zealand, and the Pacific Islands. Cladophora blooms were a common feature of the lower North American Great Lakes (Erie, Michigan, Ontario) from the 1950s through the early 1980s and were largely eradicated through the implementation of a multibillion-dollar phosphorus (P) abatement program. The return of widespread blooms in these lakes since the mid-1990s, however, was not associated with increases in P loading. Instead, current evidence indicates that the resurgence in blooms was directly related to ecosystem level changes in substratum availability, water clarity, and P recycling associated with the establishment of dense colonies of invasive dreissenid mussels. These results support the hypothesis that dreissenid mussel invasions may induce dramatic shifts in energy and nutrient flow from pelagic zones to the benthic zone. © 2008 Phycological Society of America.
Human responses to Middle Holocene climate change on California's Channel Islands
Kennett, Douglas J.; Kennett, James P.; Erlandson, Jon M.; Cannariato, Kevin G.
2007-02-01
High-resolution archaeological and paleoenvironmental records from California's Channel Islands provide a unique opportunity to examine potential relationships between climatically induced environmental changes and prehistoric human behavioral responses. Available climate records in western North America (7-3.8 ka) indicate a severe dry interval between 6.3 and 4.8 ka embedded within a generally warm and dry Middle Holocene. Very dry conditions in western North America between 6.3 and 4.8 ka correlate with cold to moderate sea-surface temperatures (SST) along the southern California Coast evident in Ocean Drilling Program (ODP) Core 893A/B (Santa Barbara Basin). An episode of inferred high marine productivity between 6.3 and 5.8 ka corresponds with the coldest estimated SSTs of the Middle Holocene, otherwise marked by warm/low productivity marine conditions (7.5-3.8 ka). The impact of this severe aridity on humans was different between the northern and southern Channel Islands, apparently related to degree of island isolation, size and productivity of islands relative to population, fresh water availability, and on-going social relationships between island and continental populations. Northern Channel Islanders seem to have been largely unaffected by this severe arid phase. In contrast, cultural changes on the southern Channel Islands were likely influenced by the climatically induced environmental changes. We suggest that productive marine conditions coupled with a dry terrestrial climate between 6.3 and 5.8 ka stimulated early village development and intensified fishing on the more remote southern islands. Contact with people on the adjacent southern California Coast increased during this time with increased participation in a down-the-line trade network extending into the western Great Basin and central Oregon. Genetic similarities between Middle Holocene burial populations on the southern Channel Islands and modern California Uto-Aztecan populations suggest
Directory of Open Access Journals (Sweden)
Sia Rosalind Juo Ling
2017-01-01
Full Text Available Haidian Island, which situated at the Northern part of Haikou City of Hainan Province, is an island within a city. Haidian Island is unique in term of it's development which centered around an university, the Hainan University, besides some others important landmarks, such as Haikou city hospital, Baishamen municipal park, Golf Driving Range etc. All commercials, residential, recreational activities etc are planned to serve Hainan University in particular. The study, taking ‘Haidian Island Area Development Control Plan’ as case study, would like to look into the importance of transportation and traffic planning. The study used observation, site investigation and traffic study methods to gather data needed. Firstly the study analyzed the current state of transportation system for Haidian Island in accordance to the Island Development Control plan and Haikou master plan and identified the problems. Then, the study made some recommendations for these problems. The study highlighted the important of non-motorized, cycling and walking as the main transportation system for an education-based island and as supportive to domestic tourism activities found. The transportation planning suggested by the study took ‘green and low-carbon’ approaches considered the role of University as the core activity in the island.
Adapting postcolonial societies: two case studies from the Pacific island region
Directory of Open Access Journals (Sweden)
Adrien Rodd
2016-11-01
Full Text Available Sovereign Pacific island states attract little attention from the great powers. They achieved independence peacefully, mostly from the United Kingdom, and have generally maintained functional democratic societies. Nonetheless, some Pacific states have struggled with the political, institutional and economic legacy of colonization. Tensions between indigenous norms and practices and the expectations of a transposed Western model of society have led to crises. This paper focuses on two Pacific Island states, Fiji and the Solomon Islands. The collapse of the state in the Solomons at the turn of this century, and repeated military coups in Fiji, are due in part to the failure of British-derived institutions to be fully accepted. In both these countries, indigenous people have proposed reforms of these inherited models. Nonetheless, as we shall see, the recent rewriting of these two countries’ constitutions has maintained the fundamentals of the Westminster system, and a government by Westernized indigenous élites.
Bennett, Vanessa C. C.; Mulligan, Ryan P.; Hapke, Cheryl J.
2018-06-01
Hurricane Sandy was a large and intense storm with high winds that caused total water levels from combined tides and storm surge to reach 4.0 m in the Atlantic Ocean and 2.5 m in Great South Bay (GSB), a back-barrier bay between Fire Island and Long Island, New York. In this study the impact of the hurricane winds and waves are examined in order to understand the flow of ocean water into the back-barrier bay and water level variations within the bay. To accomplish this goal, a high resolution hurricane wind field is used to drive the coupled Delft3D-SWAN hydrodynamic and wave models over a series of grids with the finest resolution in GSB. The processes that control water levels in the back-barrier bay are investigated by comparing the results of four cases that include: (i) tides only; (ii) tides, winds and waves with no overwash over Fire Island allowed; (iii) tides, winds, waves and limited overwash at the east end of the island; (iv) tides, winds, waves and extensive overwash along the island. The results indicate that strong local wind-driven storm surge along the bay axis had the largest influence on the total water level fluctuations during the hurricane. However, the simulations allowing for overwash have higher correlation with water level observations in GSB and suggest that island overwash provided a significant contribution of ocean water to eastern GSB during the storm. The computations indicate that overwash of 7500-10,000 m3s-1 was approximately the same as the inflow from the ocean through the major existing inlet. Overall, the model results indicate the complex variability in total water levels driven by tides, ocean storm surge, surge from local winds, and overwash that had a significant impact on the circulation in Great South Bay during Hurricane Sandy.
The ecology of 'Acroporid white syndrome', a coral disease from the southern Great Barrier Reef.
Directory of Open Access Journals (Sweden)
George Roff
Full Text Available Outbreaks of coral disease have increased worldwide over the last few decades. Despite this, remarkably little is known about the ecology of disease in the Indo-Pacific Region. Here we report the spatiotemporal dynamics of a coral disease termed 'Acroporid white syndrome' observed to affect tabular corals of the genus Acropora on the southern Great Barrier Reef. The syndrome is characterised by rapid tissue loss initiating in the basal margins of colonies, and manifests as a distinct lesion boundary between apparently healthy tissue and exposed white skeleton. Surveys of eight sites around Heron Reef in 2004 revealed a mean prevalence of 8.1±0.9%, affecting the three common species (Acropora cytherea, A. hyacinthus, A. clathrata and nine other tabular Acropora spp. While all sizes of colonies were affected, white syndrome disproportionately affected larger colonies of tabular Acroporids (>80 cm. The prevalence of white syndrome was strongly related to the abundance of tabular Acroporids within transects, yet the incidence of the syndrome appears unaffected by proximity to other colonies, suggesting that while white syndrome is density dependant, it does not exhibit a strongly aggregated spatial pattern consistent with previous coral disease outbreaks. Acroporid white syndrome was not transmitted by either direct contact in the field or by mucus in aquaria experiments. Monitoring of affected colonies revealed highly variable rates of tissue loss ranging from 0 to 1146 cm(-2 week(-1, amongst the highest documented for a coral disease. Contrary to previous links between temperature and coral disease, rates of tissue loss in affected colonies increased threefold during the winter months. Given the lack of spatial pattern and non-infectious nature of Acroporid white syndrome, further studies are needed to determine causal factors and longer-term implications of disease outbreaks on the Great Barrier Reef.
Islands and non-islands in native and heritage Korean
Directory of Open Access Journals (Sweden)
Boyoung eKim
2016-02-01
Full Text Available To a large extent, island phenomena are cross-linguistically invariable, but English and Korean present some striking differences in this domain. English has wh-movement and Korean does not, and while both languages show sensitivity to wh-islands, only English has island effects for adjunct clauses. Given this complex set of differences, one might expect Korean/English bilinguals, and especially heritage Korean speakers (i.e. early bilinguals whose L2 became their dominant language during childhood to be different from native speakers, since heritage speakers have had more limited exposure to Korean, may have had incomplete acquisition and/or attrition, and may show significant transfer effects from the L2. Here we examine islands in heritage speakers of Korean in the U.S. Through a series of four formal acceptability experiments comparing these heritage speakers with native speakers residing in Korea, we show that the two groups are remarkably similar. Both show clear evidence for wh-islands and an equally clear lack of adjunct island effects. Given the very different linguistic environment that the heritage speakers have had since early childhood, this result lends support to the idea that island phenomena are largely immune to environmental influences and stem from deeper properties of the processor and/or grammar. Similarly, it casts some doubt on recent proposals that islands are learned from the input.
Class renormalization: islands around islands
International Nuclear Information System (INIS)
Meiss, J.D.
1986-01-01
An orbit of 'class' is one that rotates about a periodic orbit of one lower class with definite frequency. This contrasts to the 'level' of a periodic orbit which is the number of elements in its continued fraction expansion. Level renormalization is conventionally used to study the structure of quasi-periodic orbits. The scaling structure of periodic orbits encircling other periodic orbits in area preserving maps is discussed here. Fixed points corresponding to the accumulation of p/q bifurcations are found and scaling exponents determined. Fixed points for q > 2 correspond to self-similar islands around islands. Frequencies of the island boundary circles at the fixed points are obtained. Importance of this scaling for the motion of particles in stochastic regions is emphasized. (author)
Directory of Open Access Journals (Sweden)
Xiaoping Zhang
2014-10-01
Full Text Available Continued sea-level rise and coastal development have led to considerable concerns on coastline changes along inhabited islands. Analysis of long-term coastline changes of islands is however limited due to unavailable data and the cost of field work. In this study, high-resolution images taken from 1970–2011 at an interval of about 10 years and topographic maps were collected to determine coastline changes and their drivers in the Zhoushan Islands, China. Results show that nearly all inhabited islands appeared to have noteworthy seaward expansion during the past four decades. Coastline change rates varied among islands, and the annual change rate of Zhoushan Island (the main island reached 12.83 ± 0.17 m/year during the same period. Since 2003, the study area has been dominated by artificial coast. The proportion of harbor/port and urban/industrial coast has significantly increased, while rocky coasts and shelter-farm coasts have shrunk greatly. Preliminary analysis of drivers for these coastline changes across the Zhoushan Islands highlights the roles of human policies during different periods as well as location, which were the dominant factors controlling the great spatial and temporal complexity of coastline changes of the major islands. Sediment supply from the Yangtze River decreased after the completion of the Three Gorges Dam in 2003; however, the Zhoushan coast rapidly accreted seaward during the last decade and the artificial siltation, coastal engineering, and harbor dredging materials could be responsible for the observed coastline changes. Pressured by rapid development of the port industry, the Zhoushan coast may face unprecedented challenges in coastal use in the near future. This research provides the basic background information for future studies on coastal protection and management.
International Nuclear Information System (INIS)
Haynes, David; Loong, Dominica
2002-01-01
Antifoulant concentrations are generally low in the Great Barrier Reef, although ship grounding sites present a previously unidentified significant source of antifoulant pollutants in the Great Barrier Reef. - Antifoulant concentrations were determined in marine sediments collected from commercial harbours, marinas, mooring locations on mid-shelf continental islands, and outer reef sites in four regions within the Great Barrier Reef World Heritage Area in 1999. Highest copper concentrations were present in sediments collected from commercial harbour sampling sites (28-233 μg Cu g -1 dry wt.). In contrast, copper concentrations in sediments collected from boat mooring sites on mid-shelf continental islands and outer reef sites were at background concentrations (i.e. -1 dry wt.). Butyltin was only detectable in four of the 42 sediments sampled for analysis, and was only present in sediments collected from commercial harbours (18-1275 ng Sn g -1 dry wt.) and from marinas (4-5 ng Sn g -1 dry wt.). The detection of tributyltin at marina sites implies that this antifoulant may continue to be used illegally on the hulls of smaller recreational vessels. Sediment samples were also collected opportunistically from the site of a 22,000 t cargo ship grounding in May 1999 at Heath Reef, in the far northern Great Barrier Reef. Butyltin concentrations were grossly elevated (660-340,000 ng Sn g -1 dry wt.) at the grounding site. The impact of residual antifoulants at large ship grounding sites should be recognised as a significant, long-term environmental problem unless antfoulant clean-up strategies are undertaken
Precipitation in Madeira island and atmospheric rivers in the winter seasons
Couto, Flavio T.; Salgado, Rui; João Costa, Maria; Prior, Victor
2016-04-01
This study aims to analyse the distribution of the daily accumulated precipitation in the Madeira's highlands over a 10-year period, as well as the main characteristics associated with atmospheric rivers (ARs) affecting the island during 10 winter seasons, and their impact in the rainfall amounts recorded near the mountain crest in the south-eastern part of the island. The period between September 2002 and November 2012 is considered for the analysis. The ARs have been identified from the total precipitable water vapour field extracted from the Atmospheric Infrared Sounder (AIRS). The AIRS observations were downloaded for a domain covering large part of the North Atlantic Ocean. The precipitable water vapour field from the European Centre for Medium-range Weather Forecasts (ECMWF) analysis was also used aiming to support the AIRS data when there was no satellite information over the island. The daily accumulated precipitation at surface showed generally drier summers, while the highest accumulated precipitation are recorded mainly during the winter, although some significant events may occur also in autumn and spring seasons. The patterns of the precipitable water vapour field when ARs reach the island were investigated, and even if great part of the atmospheric rivers reaches the island in a dissipation stage, some rivers are heavy enough to reach the Madeira Island. In this situation, the water vapour transport could be observed in two main configurations and transporting significant water vapour amounts toward the Madeira from the tropical region. This study lead to conclude that the atmospheric rivers, when associated to high values of precipitable water vapour over the island can provide favourable conditions to the development of precipitation, sometimes associated with high amounts. However, it was also found that many cases of high to extreme accumulated precipitation at the surface were not associated to this kind of moisture transport.
Tuppiap Qeqertaa (Tobias Island): a newly discovered island off northeast Greenland
DEFF Research Database (Denmark)
Bennike, O.; Mikkelsen, N.; Forsberg, René
2006-01-01
The small island of Tuppiap Qeqertaa, formerly known as Tobias circle divide or Tobias Island, is situated 80 km off the northeast Greenland coast. The island was discovered in 1993 and is approximately 2 km long and 1.5 km wide. Most of the island is covered by an ice cap that rises to 35 in abo...
Cribb, Thomas H; Bray, Rodney A; Hall, Kathryn A; Cutmore, Scott C
2015-09-01
Species of the faustulid genus Antorchis Linton, 1911 of the tropical Indo-West Pacific are reviewed. We recognise five species in the region, including a novel form. Antorchis nasonis n. sp. is described from Naso annulatus (Quoy & Gaimard) and N. tonganus (Valenciennes) on the southern Great Barrier Reef (GBR). We interpret specimens reported from Naso hexacanthus (Bleeker) from Japan as the same species. This species appears to be the only faustulid known from acanthurid fishes and differs from all other species in the genus in having the prominent dorsal genital invagination close to the posterior end of the body. In addition, new host and locality records are reported for two described species of Antorchis, A. pomacanthi (Hafeezullah & Siddiqi, 1970) and A. tsushimaensis (Machida, 1971). The wide distribution of A. pomacanthi was further demonstrated by the generation of identical ITS2 rDNA sequences for specimens from Ningaloo Reef off Western Australia, off Lizard and Heron Islands (GBR) and off New Caledonia, localities separated by up to 5,300 km. The host-specificity of the genus is considered.
Diomede Islands, Bering Straight
2008-01-01
The Diomede Islands consisting of the western island Big Diomede (also known as Imaqliq, Nunarbuk or Ratmanov Island), and the eastern island Little Diomede (also known as Krusenstern Island or Inaliq), are two rocky islands located in the middle of the Bering Strait between Russia and Alaska. The islands are separated by an international border and the International Date Line which is approximately 1.5 km from each island; you can look from Alaska into tomorrow in Russia. At the closest land approach between the United States, which controls Little Diomede, and Russia, which controls Big Diomede, they are 3 km apart. Little Diomede Island constitutes the Alaskan City of Diomede, while Big Diomede Island is Russia's easternmost point. The first European to reach the islands was the Russian explorer Semyon Dezhnev in 1648. The text of the 1867 treaty finalizing the sale of Alaska uses the islands to designate the border between the two nations. The image was acquired July 8, 2000, covers an area of 13.5 x 10.8 km, and is located at 65.8 degrees north latitude, 169 degrees west longitude. The U.S. science team is located at NASA's Jet Propulsion Laboratory, Pasadena, Calif. The Terra mission is part of NASA's Science Mission Directorate.
Sociodemographic Factors Influencing Island Food Consumption in the Pacific Islander Health Study
Baumhofer, Nicole Kau'i
2016-01-01
This dissertation explores the relationships between island food consumption, sociodemographic variables, and cardiovascular risk using data from the Pacific Islander Health Study (PIHS). Chapter 1 explores the associations between self-reported level of island food consumption and key covariates. Island food consumption was modeled using Poisson regression and adjusted for demographic, socioeconomic, and cultural characteristics. Increased Pacific Island cultural affinity was the strongest p...
Paradise Islands? Island States and Environmental Performance
Directory of Open Access Journals (Sweden)
Sverker C. Jagers
2016-03-01
Full Text Available Island states have been shown to outperform continental states on a number of large-scale coordination-related outcomes, such as levels of democracy and institutional quality. The argument developed and tested in this article contends that the same kind of logic may apply to islands’ environmental performance, too. However, the empirical analysis shows mixed results. Among the 105 environmental outcomes that we analyzed, being an island only has a positive impact on 20 of them. For example, island states tend to outcompete continental states with respect to several indicators related to water quality but not in aspects related to biodiversity, protected areas, or environmental regulations. In addition, the causal factors previously suggested to make islands outperform continental states in terms of coordination have weak explanatory power in predicting islands’ environmental performance. We conclude the paper by discussing how these interesting findings can be further explored.
Evaluation of habitat quality for selected wildlife species associated with back channels.
Anderson, James T.; Zadnik, Andrew K.; Wood, Petra Bohall; Bledsoe, Kerry
2013-01-01
The islands and associated back channels on the Ohio River, USA, are believed to provide critical habitat features for several wildlife species. However, few studies have quantitatively evaluated habitat quality in these areas. Our main objective was to evaluate the habitat quality of back and main channel areas for several species using habitat suitability index (HSI) models. To test the effectiveness of these models, we attempted to relate HSI scores and the variables measured for each model with measures of relative abundance for the model species. The mean belted kingfisher (Ceryle alcyon) HSI was greater on the main than back channel. However, the model failed to predict kingfisher abundance. The mean reproduction component of the great blue heron (Ardea herodias) HSI, total common muskrat (Ondatra zibethicus) HSI, winter cover component of the snapping turtle (Chelydra serpentina) HSI, and brood-rearing component of the wood duck (Aix sponsa) HSI were all greater on the back than main channel, and were positively related with the relative abundance of each species. We found that island back channels provide characteristics not found elsewhere on the Ohio River and warrant conservation as important riparian wildlife habitat. The effectiveness of using HSI models to predict species abundance on the river was mixed. Modifications to several of the models are needed to improve their use on the Ohio River and, likely, other large rivers.
Ticks associated with macquarie island penguins carry arboviruses from four genera.
Directory of Open Access Journals (Sweden)
Lee Major
Full Text Available Macquarie Island, a small subantarctic island, is home to rockhopper, royal and king penguins, which are often infested with the globally distributed seabird tick, Ixodes uriae. A flavivirus, an orbivirus, a phlebovirus, and a nairovirus were isolated from these ticks and partial sequences obtained. The flavivirus was nearly identical to Gadgets Gully virus, isolated some 30 year previously, illustrating the remarkable genetic stability of this virus. The nearest relative to the orbivirus (for which we propose the name Sandy Bay virus was the Scottish Broadhaven virus, and provided only the second available sequences from the Great Island orbivirus serogroup. The phlebovirus (for which we propose the name Catch-me-cave virus and the previously isolated Precarious Point virus were distinct but related, with both showing homology with the Finnish Uukuniemi virus. These penguin viruses provided the second and third available sequences for the Uukuniemi group of phleboviruses. The nairovirus (for which we propose the name Finch Creek virus was shown to be related to the North American Tillamook virus, the Asian Hazara virus and Nairobi sheep disease virus. Macquarie Island penguins thus harbour arboviruses from at least four of the seven arbovirus-containing genera, with related viruses often found in the northern hemisphere.
Satisfaction with the quality of life on Croatian small islands: Zlarin, Kaprije and Žirje
Directory of Open Access Journals (Sweden)
Satisfaction with the quality of life on Croatian small islands: Zlarin, Kaprije and Žirje
2015-05-01
Full Text Available The purpose of this study is to determine the levels of satisfaction with various life domains that constitute objective conditions of the quality of island life, and which influence the perception of islanders’ personal well-being among the inhabitants of three small islands (Zlarin, Kaprije and Žirje in Croatia. The obtained results are based on a resident survey (N=141. A quality of life assessment was carried out by recognizing the specificity of an island’s surface area and its population (small communities, mostly elderly people, as well as by evaluating choices that respondents perceive to be important for their well-being. Based on applied multivariate analyses, the research suggests that life satisfaction, besides a significant correlation with material status (income, is also greatly affected by the extent of preserved social values, common to the rural communities to which the observed islands belong, such as the closeness of personal relationships (level of acceptance in the local community, solidarity and the social order maintained through informal control (which provides a sense of security. Both islanders who have never lived off their island, as well as returnees and in-migrants, positively value the way of life in island communities.
Directory of Open Access Journals (Sweden)
A.Y. Hatata
2018-03-01
Full Text Available Sandia frequency shift (SFS is one of the active anti-islanding detection methods that depend on frequency drift to detect an islanding condition for inverter-based distributed generation. The non-detection zone (NDZ of the SFS method depends to a great extent on its parameters. Improper adjusting of these parameters may result in failure of the method. This paper presents a proposed artificial immune system (AIS-based technique to obtain optimal parameters of SFS anti-islanding detection method. The immune system is highly distributed, highly adaptive, and self-organizing in nature, maintains a memory of past encounters, and has the ability to continually learn about new encounters. The proposed method generates less total harmonic distortion (THD than the conventional SFS, which results in faster island detection and better non-detection zone. The performance of the proposed method is derived analytically and simulated using Matlab/Simulink. Two case studies are used to verify the proposed method. The first case includes a photovoltaic (PV connected to grid and the second includes a wind turbine connected to grid. The deduced optimized parameter setting helps to achieve the “non-islanding inverter” as well as least potential adverse impact on power quality. Keywords: Anti-islanding detection, Sandia frequency shift (SFS, Non-detection zone (NDZ, Total harmonic distortion (THD, Artificial immune system (AIS, Clonal selection algorithm
"Disciplina clericorum" on VI century Sardinia according to the letters of Gregory the Great
Directory of Open Access Journals (Sweden)
Elena Marey
2018-12-01
Full Text Available This article deals with church life in Sardinia in the 6th century and is based on material from the letters of Gregory the Great. Metropolitan of Sardinia, Januarius, was not able to keep the island in order and to control his subordinate clerics; moreover, he himself was involved in crimes several times. The article studies various examples of violation of church discipline by clerics of Sardinia and their negligence of ordinances of church councils. Thus, priests often behaved in an improper and corrupt manner, did not obey the metropolitan, baptised incorrectly. The provincial council was rarely convened; several sees remained without a bishop due to Januarius’ negligence. All this much upset St. Gregory the Great, who did his best at trying to strengthen church discipline in the island. In his letters addressed to Januarius, the Pope scrutinised mistakes and faults of the latter appealing to the Bible and ordinances of conciliar canons. Typically, St. Gregory always provides arguments for his position. At the same time, he tried to raise Januarius’ authority in the eyes of the clergy, which he regarded as the base for order and stability. The letters of St. Gregory the Great demonstrate that church life in the region directly depended on metropolitan’s personality and character. This conclusion accords with the Cura pastoralis by St. Gregory which describes the epitome of a bishop: the bishop is able to manage his community and set his fl ock and clergy on the right path only on condition that he possesses certain moral standards.
Energy Technology Data Exchange (ETDEWEB)
NONE
1988-03-01
Out of the ASEAN countries, the Philippines is not rich in coal resource. The coal reserve is 3.7 million tons, which is only about 1/3 of that in Indonesia, 11.47 million tons. The coal is the one in the young period in quality, and most of the coal except that form the Cebu island is the low grade coal belonging from lignite to sub-bituminous C. The coal in the Himalian area, Semirara island, is expected to be supplied to Calaca No. 2 coal thermal power plant which is planned to be constructed in the south of Luzon island. If it agrees to the power plant side in terms of the coal quality specifications and the price, there is a great possibility of concluding a long-term contract on business. It may be said that developmental potentiality is great. Accordingly, it is important to enhance the quality of the study of developmental possibility in the Himalian area in future. On the other hand, the coal in the San Miguel area, Mindanao island, is extremely high in ash content, and has a problem on coal quality. The developmental potentiality is low. The developmental potentiality of the coal of the Himalian area is high, but the necessity of exporting it to Japan is low since there are no coal thermal power plants which use this kind of low grade coal in Japan. (NEDO)
Wiley, J.W.
1991-01-01
In the 1490s a minimum of 28 species of psittacines occurred in the West Indies. Today, only 43% (12) of the species survive. All macaws and most parakeet species have been lost. Although the surviving parrot fauna of the Greater Antilles, Cayman Islands, and Bahama Islands has fared somewhat better than that of the Lesser Antilles, every species has undergone extensive reductions of populations and all but two have undergone extensive reductions in range, mostly as a result of habitat loss, but also from persecution as agricultural pests, conflicts with exotic species, harvesting for pets, and natural disasters. The Cayman Brac Parrot Amazona leucocephala hesterna with its tiny population (less than 150 individuals in the wild) and range, and the Puerto Rican Parrot A. vittata, with about 22-23 birds in the wild and 56 individuals in captivity, must be considered on the verge of extinction and in need of (in the latter's case, continuing) aggressive programmes of research and management. Other populations declining in numbers and range include the Yellow-billed Amazona collaria, and Black-billed A. agilis Parrots of Jamaica, Hispaniolan Parakeet Aratinga chloroptera, Hispaniolan Parrot Amazona ventralis, Cuban Parrot A. leucocephala leucocephala and, most seriously, Cuban Parakeet Aratinga euops. The population of the Grand Cayman Parrot (Amazona leucocephala caymanensis), although numbering only about 1,000 birds, appears stable and the current conservation programme gives hope for the survival of the race. An active conservation and public education programme has begun for the Bahama Parrot A. l. bahamensis, which still occurs in good numbers on Great Inagua Island, but is threatened on Abaco Island. Recommendations for conservation of parrots and parakeets in the region include (1) instituting long-term programmes of research to determine distribution, status, and ecology of each species; (2) developing conservation programmes through education and management
Plastic debris in great skua (Stercorarius skua) pellets corresponds to seabird prey species.
Hammer, S; Nager, R G; Johnson, P C D; Furness, R W; Provencher, J F
2016-02-15
Plastic is a common item in marine environments. Studies assessing seabird ingestion of plastics have focused on species that ingest plastics mistaken for prey items. Few studies have examined a scavenger and predatory species that are likely to ingest plastics indirectly through their prey items, such as the great skua (Stercorarius skua). We examined 1034 regurgitated pellets from a great skua colony in the Faroe Islands for plastics and found approximately 6% contained plastics. Pellets containing remains of Northern fulmars (Fulmarus glacialis) had the highest prevalence of plastic. Our findings support previous work showing that Northern fulmars have higher loads of plastics than other sympatric species. This study demonstrates that marine plastic debris is transferred from surface feeding seabird species to predatory great skuas. Examination of plastic ingestion in species that do not ingest plastics directly can provide insights into how plastic particles transfer vertically within the food web. Copyright © 2015 Elsevier Ltd. All rights reserved.
Bennett, Vanessa C. C.; Mulligan, Ryan P.; Hapke, Cheryl J.
2018-01-01
Hurricane Sandy was a large and intense storm with high winds that caused total water levels from combined tides and storm surge to reach 4.0 m in the Atlantic Ocean and 2.5 m in Great South Bay (GSB), a back-barrier bay between Fire Island and Long Island, New York. In this study the impact of the hurricane winds and waves are examined in order to understand the flow of ocean water into the back-barrier bay and water level variations within the bay. To accomplish this goal, a high resolution hurricane wind field is used to drive the coupled Delft3D-SWAN hydrodynamic and wave models over a series of grids with the finest resolution in GSB. The processes that control water levels in the back-barrier bay are investigated by comparing the results of four cases that include: (i) tides only; (ii) tides, winds and waves with no overwash over Fire Island allowed; (iii) tides, winds, waves and limited overwash at the east end of the island; (iv) tides, winds, waves and extensive overwash along the island. The results indicate that strong local wind-driven storm surge along the bay axis had the largest influence on the total water level fluctuations during the hurricane. However, the simulations allowing for overwash have higher correlation with water level observations in GSB and suggest that island overwash provided a significant contribution of ocean water to eastern GSB during the storm. The computations indicate that overwash of 7500–10,000 m3s−1 was approximately the same as the inflow from the ocean through the major existing inlet. Overall, the model results indicate the complex variability in total water levels driven by tides, ocean storm surge, surge from local winds, and overwash that had a significant impact on the circulation in Great South Bay during Hurricane Sandy.
Researching Pacific island livelihoods:
DEFF Research Database (Denmark)
Egelund Christensen, Andreas; Mertz, Ole
2010-01-01
on contemporary theories of nissology and conceptual analytical frameworks for island research. Through a review of selected case-study-based island literature on changing livelihoods coming out of the South Pacific, we wish to illustrate and discuss advantages of finding common grounds for small island studies....... The focus is on two dimensions of island livelihood, migration and natural resource management, both of which are significant contributors in making island livelihoods and shaping Pacific seascapes. We argue that there is still a substantial lack of studies targeting small island dynamics that are empirical...
Observations of coupled seismicity and ground deformation at El Hierro Island (2011-2014)
Gonzalez, P. J.
2015-12-01
New insights into the magma storage and evolution at oceanic island volcanoes are now being achieved using remotely sensed space geodetic techniques, namely satellite radar interferometry. Differential radar interferometry is a technique tracking, at high spatial resolution, changes in the travel-time (distance) from the satellites to the ground surface, having wide applications in Earth sciences. Volcanic activity usually is accompanied by surface ground deformation. In many instances, modelling of surface deformation has the great advantage to estimate the magma volume change, a particularly interesting parameter prior to eruptions. Jointly interpreted with petrology, degassing and seismicity, it helps to understand the crustal magmatic systems as a whole. Current (and near-future) radar satellite missions will reduce the revisit time over global sub-aerial volcanoes to a sub-weekly basis, which will increase the potential for its operational use. Time series and filtering processing techniques of such streaming data would allow to track subsurface magma migration with high precision, and frequently update over vast areas (volcanic arcs, large caldera systems, etc.). As an example for the future potential monitoring scenario, we analyze multiple satellite radar data over El Hierro Island (Canary Islands, Spain) to measure and model surface ground deformation. El Hierro has been active for more than 3 years (2011 to 2014). Initial phases of the unrest culminated in a submarine eruption (late 2011 - early 2012). However, after the submarine eruption ended, its magmatic system still active and affected by pseudo-regular energetic seismic swarms, accompanied by surface deformation without resumed eruptions. Such example is a great opportunity to understand the crustal magmatic systems in low magma supply-rate oceanic island volcanoes. This new approach to measure surface deformation processes is yielding an ever richer level of information from volcanology to
78 FR 63860 - Amendment of Class D Airspace; Kwajalein Island, Marshall Islands, RMI
2013-10-25
...This action amends the Kwajalein Island Class D airspace description by amending the geographic coordinates for Bucholz Army Airfield (AAF), Kwajalein Island, Marshall Islands, RMI. The Bucholz AAF geographic coordinates information was updated in the Kwajalein Island Class E airspace descriptions in 2011, but was inadvertently overlooked in the Kwajalein Island Class D airspace description. This action ensures the safety of aircraft operating in the Kwajalein Island airspace area. This is an administrative action and does not affect the operating requirements of the airspace.
Garcia-Porta, Joan; Morales, Hernán E; Gómez-Díaz, Elena; Sindaco, Roberto; Carranza, Salvador
2016-05-01
In this study we used the complete fauna of geckos of the Socotra Archipelago to test whether the three gecko genera co-occurring in the islands (Pristurus, Hemidactylus and Haemodracon) produced similar outcomes of morphological and climatic diversification. To test this, we produced a time-calibrated tree of 346 geckos including all 16 endemic species of the archipelago and 26 potential close-relatives in the continent. Our dating estimates revealed that most of the diversity of geckos in the archipelago was the consequence of in situ diversification. However not all genera shared similar patterns of diversification. While in Hemidactylus and Haemodracon this involved great differences in body size and low levels of climatic diversification (mostly involving sympatric distributions), an opposite pattern appeared in Pristurus in which most of the diversification involved shifts in climatic envelopes (mostly involving allopatric and parapatric distributions) but almost no size differentiation. Consistently with this, Pristurus was the only genus in which rates of size diversification in islands were substantially lower than in the continent. This illustrates how different groups can greatly differ in their patterns of intra-island diversification and highlights the importance of taxon-dependent factors at determining different patterns of diversification in the same insular context. Copyright © 2016 Elsevier Inc. All rights reserved.
Rapid decay of vacancy islands at step edges on Ag(111): step orientation dependence
International Nuclear Information System (INIS)
Shen, Mingmin; Thiel, P A; Jenks, Cynthia J; Evans, J W
2010-01-01
Previous work has established that vacancy islands or pits fill much more quickly when they are in contact with a step edge, such that the common boundary is a double step. The present work focuses on the effect of the orientation of that step, with two possibilities existing for a face centered cubic (111) surface: A- and B-type steps. We find that the following features can depend on the orientation: (1) the shapes of islands while they shrink; (2) whether the island remains attached to the step edge; and (3) the rate of filling. The first two effects can be explained by the different rates of adatom diffusion along the A- and B-steps that define the pit, enhanced by the different filling rates. The third observation-the difference in the filling rate itself-is explained within the context of the concerted exchange mechanism at the double step. This process is facile at all regular sites along B-steps, but only at kink sites along A-steps, which explains the different rates. We also observe that oxygen can greatly accelerate the decay process, although it has no apparent effect on an isolated vacancy island (i.e. an island that is not in contact with a step).
Aranda, Silvia C.; Gabriel, Rosalina; Borges, Paulo A. V.; Santos, Ana M. C.; de Azevedo, Eduardo Brito; Patiño, Jairo; Hortal, Joaquín; Lobo, Jorge M.
2014-01-01
Species richness on oceanic islands has been related to a series of ecological factors including island size and isolation (i.e. the Equilibrium Model of Island Biogeography, EMIB), habitat diversity, climate (i.e., temperature and precipitation) and more recently island ontogeny (i.e. the General Dynamic Model of oceanic island biogeography, GDM). Here we evaluate the relationship of these factors with the diversity of bryophytes in the Macaronesian region (Azores, Madeira, Canary Islands and Cape Verde). The predictive power of EMIB, habitat diversity, climate and the GDM on total bryophyte richness, as well as moss and liverwort richness (the two dominant bryophyte groups), was evaluated through ordinary least squares regressions. After choosing the best subset of variables using inference statistics, we used partial regression analyses to identify the independent and shared effects of each model. The variables included within each model were similar for mosses and liverworts, with orographic mist layer being one of the most important predictors of richness. Models combining climate with either the GDM or habitat diversity explained most of richness variation (up to 91%). There was a high portion of shared variance between all pairwise combinations of factors in mosses, while in liverworts around half of the variability in species richness was accounted for exclusively by climate. Our results suggest that the effects of climate and habitat are strong and prevalent in this region, while geographical factors have limited influence on Macaronesian bryophyte diversity. Although climate is of great importance for liverwort richness, in mosses its effect is similar to or, at least, indiscernible from the effect of habitat diversity and, strikingly, the effect of island ontogeny. These results indicate that for highly vagile taxa on oceanic islands, the dispersal process may be less important for successful colonization than the availability of suitable ecological
33 CFR 80.717 - Tybee Island, GA to St. Simons Island, GA.
2010-07-01
... Island. (j) An east-west line from the southernmost extremity of Sea Island across Goulds Inlet to St... Tybee Island 255° true across Tybee Inlet to the shore of Little Tybee Island south of the entrance to... shoreline across Cabretta Inlet. (g) A north-south line (longitude 81°16.9′ W.) drawn from the south...
Energy Transition Initiative: Island Energy Snapshot - U.S. Virgin Islands (Fact Sheet)
Energy Technology Data Exchange (ETDEWEB)
2015-03-01
This profile provides a snapshot of the energy landscape of the U.S. Virgin Islands (USVI) - St. Thomas, St. John, and St. Croix. The Virgin Islands archipelago makes up the northern portion of the Lesser Antilles and the western island group of the Leeward Islands, forming the border between the Atlantic Ocean and the Caribbean Sea.
Genetic structure of the Common Eider in the western Aleutian Islands prior to fox eradication
Sonsthagen, Sarah A.; Talbot, Sandra L.; Wilson, Robert E.; Petersen, Margaret R.; Williams, Jeffrey C.; Byrd, G. Vernon; McCracken, Kevin G.
2013-01-01
Since the late 18th century bird populations residing in the Aleutian Archipelago have been greatly reduced by introduced arctic foxes (Alopex lagopus). We analyzed data from microsatellite, nuclear intron, and mitochondrial (mtDNA) loci to examine the spatial genetic structure, demography, and gene flow among four Aleutian Island populations of the Common Eider (Somateria mollissima) much reduced by introduced foxes. In mtDNA, we found high levels of genetic structure within and between island groups (ΦST = 0.643), but we found no population subdivision in microsatellites or nuclear introns. Differences in genetic structure between the mitochondrial and nuclear genomes are consistent with the Common Eider's breeding and winter biology, as females are highly philopatric and males disperse. Nevertheless, significant differences between islands in the mtDNA of males and marginal significance (P =0.07) in the Z-linked locus Smo 1 suggest that males may also have some level of fidelity to island groups. Severe reduction of populations by the fox, coupled with females' high philopatry, may have left the genetic signature of a bottleneck effect, resulting in the high levels of genetic differentiation observed in mtDNA (ΦST = 0.460–0.807) between islands only 440 km apart. Reestablishment of the Common Eider following the fox's eradication was likely through recruitment from within the islands and bolstered by dispersal from neighboring islands, as suggested by the lack of genetic structure and asymmetry in gene flow between Attu and the other Near Islands.
Peci, Luis Miguel; Berrocoso, Manuel; Fernández-Ros, Alberto; García, Alicia; Marrero, José Manuel; Ortiz, Ramón
2014-01-02
This paper describes the development of a multi-parameter system for monitoring volcanic activity. The system permits the remote access and the connection of several modules in a network. An embedded ARM™ processor has been used, allowing a great flexibility in hardware configuration. The use of a complete Linux solution (Debian™) as Operating System permits a quick, easy application development to control sensors and communications. This provides all the capabilities required and great stability with relatively low energy consumption. The cost of the components and applications development is low since they are widely used in different fields. Sensors and commercial modules have been combined with other self-developed modules. The Modular Volcano Monitoring System (MVMS) described has been deployed on the active Deception Island (Antarctica) volcano, within the Spanish Antarctic Program, and has proved successful for monitoring the volcano, with proven reliability and efficient operation under extreme conditions. In another context, i.e., the recent volcanic activity on El Hierro Island (Canary Islands) in 2011, this technology has been used for the seismic equipment and GPS systems deployed, thus showing its efficiency in the monitoring of a volcanic crisis.
Directory of Open Access Journals (Sweden)
Luis Miguel Peci
2014-01-01
Full Text Available This paper describes the development of a multi-parameter system for monitoring volcanic activity. The system permits the remote access and the connection of several modules in a network. An embedded ARMTM processor has been used, allowing a great flexibility in hardware configuration. The use of a complete Linux solution (DebianTM as Operating System permits a quick, easy application development to control sensors and communications. This provides all the capabilities required and great stability with relatively low energy consumption. The cost of the components and applications development is low since they are widely used in different fields. Sensors and commercial modules have been combined with other self-developed modules. The Modular Volcano Monitoring System (MVMS described has been deployed on the active Deception Island (Antarctica volcano, within the Spanish Antarctic Program, and has proved successful for monitoring the volcano, with proven reliability and efficient operation under extreme conditions. In another context, i.e., the recent volcanic activity on El Hierro Island (Canary Islands in 2011, this technology has been used for the seismic equipment and GPS systems deployed, thus showing its efficiency in the monitoring of a volcanic crisis.
Spatial Tourist and Functional Diversity on the Volcanic Island of Gran Canaria
Gonda-Soroczyńska, Eleonora; Olczyk, Hanna
2017-10-01
The conducted research is focused on spatial, functional and landscape diversity, the existing tourist potential and the possibilities for further development of a small, volcanic island of Gran Canaria. The discussed island was compared against other islands of the Canarian archipelago (Lanzarote, Fuerteventura, Tenerife, La Palma, El Hierro). Similarly to the remaining Canary Islands, the economy of Gran Canaria is predominantly based on tourism (approx. 4,5-5,0 million tourists visit the Canary Island annually and approx. 2,8 million come to Gran Canaria). Additionally, Puerto de la Luz transhipment centre in Las Palmas plays a very important role because of the goods imported from overseas. It is one of the largest ports in Spain (it reloads almost 2 million containers per year) also being an important Atlantic refuelling station. Apart from tourism, an important role is played here by agriculture, primarily the cultivation of bananas and tomatoes, which represent the most significant export good of the archipelago. The conducted spatial research showed an extensive diversity. This situation is, to a great extent, influenced by the climate. The northern part is cooler and dominated by agriculture, whereas the southern one is much warmer and characterized by a well-developed tourism infrastructure. Site inspections performed out along the outer contour of the island resembling a circle. Numerous architectural and urban sketches, urban analyses and photographic documentation were made. Community surveys were carried out. For a researcher, it was extremely interesting to answer the questions whether Gran Canaria is different from the other Canary Islands, especially in the functional and landscape context, and if so what exactly these differences consist of. What is Gran Canaria in particular characterized by and what kind of role it plays in the economic sector of Spain?
Directory of Open Access Journals (Sweden)
Jaime Gómez
2006-12-01
Full Text Available The breeding success of a double-brooding colony of Boat-billed Herons Cochlearius cochlearius was studied in pasturelands of Costa Rica. Mean clutch size in the first clutches (2.9 eggs/nest was higher than in second and repeat clutches (2.3 eggs/nest. Breeding success was similar in the first attempt and second attempts(20.7 % and 21.7 %, respectively. In both attempts earlier nests enjoyed a higher breeding success. Starvation of the youngest chicks within the nest and destruction of nests by bad weather conditions were the main factors related to nestling death. No effects of human activity on the reproduction of the breeding colony were observed. Rev. Biol. Trop. 54 (4: 1131-1134. Epub 2006 Dec. 15Estudiamos el éxito reproductivo de una colonia del ave Cochlearius cochlearius en una zona ganadera de Costa Rica. El promedio de huevos por nido fue mayor durante el periodo de primeras puestas (2.9 huevos/nido que durante el periodo de segundas puestas y reposiciones (2.3 huevos/nido. El éxito reproductor de los dos periodos fue similar (20.7 % y 21.7 %, respectivamente. En ambos tuvieron más éxito las parejas que comenzaron la puesta antes. Las principales causas de mortandad fueron inanición de los pollos más jóvenes del nido y la destrucción de los nidos debido a condiciones climáticas adversas. No notamos efectos adversos por la actividad humana
Tides at the east coast of Lanzarote Island
Benavent, M.; Arnoso, J.; Vélez, E. J.
2012-04-01
The main goal of this work is the study of the ocean tides at the east coast of Lanzarote (Canary Islands). We have analyzed time series of tide gauge and bottom pressure observations available in the region and we have made a further comparative validation with recent global and local ocean tide models. Lanzarote island shows singular features, with regard its volcanic structure and geomorphological properties and, also, concerning the characteristics of the ocean tides in the surrounding waters. For this reason, this region experiences a great interest in Geodesy and Geodynamics. Particularly, an accurate modelization of the ocean tides is of great importance to correct with high accuracy the effect of the ocean over the multiple geodetic measurements that are being carried out in the Geodynamic Laboratory of Lanzarote, LGL (Vieira et al., 1991; 2006). Furthermore, the analysis of tide gauge and bottom pressure records in this area is of great importance to investigate sea level variations, to evaluate and quantify the causes of these changes and the possible correlation with vertical movements of the Earth's crust. The time series of sea level and bottom pressure data considered in this work are obtained at two different locations of the island and, in each of them, using several sensors at different periods of time. First location is Jameos del Agua (JA) station, which belongs to the LGL. This station is placed in the open ocean, 200 meters distant from the northeastern coast of the island and at 8 meters depth. The observations have been carried out using 3 bottom pressure sensors (Aanderaa WLR7, SAIV TD301A and Aqualogger 210PT) at different periods of time (spanning a total of six years). Second location is Arrecife (AR) station, which is 23 km south of JA station. In this case, the sea level data come from a float tide gauge belonging to the Instituto Español de Oceanografía, installed at the beginning of the loading bay, and a radar tide gauge from the
46 CFR 7.70 - Folly Island, SC to Hilton Head Island, SC.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Folly Island, SC to Hilton Head Island, SC. 7.70 Section... BOUNDARY LINES Atlantic Coast § 7.70 Folly Island, SC to Hilton Head Island, SC. (a) A line drawn from the...′ W. (Port Royal Sound Lighted Whistle Buoy “2PR”); thence to the easternmost extremity of Hilton Head...
Red River of the North Reconnaissance Report: Sand Hill River Subbasin.
1980-12-01
0.j N- 71064 ko~e Co. us ;IEOfte Co. N I 9 0 5 10 mI les Soure : ulf out Resarc Insitued North Basir i Source: Gulf South Research Institute...J.R. Beer reported seeing the plains pocket mouse in Polk County in 1953 (Henderson and Reitter, 1979; Henderson, 1979). The great blue heron was
Ollivier, Quinn R; Hammill, Edward; Booth, David J; Madin, Elizabeth M P; Hinchliffe, Charles; Harborne, Alastair R; Lovelock, Catherine E; Macreadie, Peter I; Atwood, Trisha B
2018-01-01
Benthic fauna play a crucial role in organic matter decomposition and nutrient cycling at the sediment-water boundary in aquatic ecosystems. In terrestrial systems, grazing herbivores have been shown to influence below-ground communities through alterations to plant distribution and composition, however whether similar cascading effects occur in aquatic systems is unknown. Here, we assess the relationship between benthic invertebrates and above-ground fish grazing across the 'grazing halos' of Heron Island lagoon, Australia. Grazing halos, which occur around patch reefs globally, are caused by removal of seagrass or benthic macroalgae by herbivorous fish that results in distinct bands of unvegetated sediments surrounding patch reefs. We found that benthic algal canopy height significantly increased with distance from patch reef, and that algal canopy height was positively correlated with the abundances of only one invertebrate taxon (Nematoda). Both sediment carbon to nitrogen ratios (C:N) and mean sediment particle size (μm) demonstrated a positive correlation with Nematoda and Arthropoda (predominantly copepod) abundances, respectively. These positive correlations indicate that environmental conditions are a major contributor to benthic invertebrate community distribution, acting on benthic communities in conjunction with the cascading effects of above-ground algal grazing. These results suggest that benthic communities, and the ecosystem functions they perform in this system, may be less responsive to changes in above-ground herbivorous processes than those previously studied in terrestrial systems. Understanding how above-ground organisms, and processes, affect their benthic invertebrate counterparts can shed light on how changes in aquatic communities may affect ecosystem function in previously unknown ways.
Heupink, Tim H; van den Hoff, John; Lambert, David M
2012-08-23
Historically, king penguin populations on Macquarie Island have suffered greatly from human exploitation. Two large colonies on the island were drastically reduced to a single small colony as a result of harvesting for the blubber oil industry. However, recent conservation efforts have resulted in the king penguin population expanding in numbers and range to recolonize previous as well as new sites. Ancient DNA methods were used to estimate past genetic diversity and combined with studies of modern populations, we are now able to compare past levels of variation with extant populations on northern Macquarie Island. The ancient and modern populations are closely related and show a similar level of genetic diversity. These results suggest that the king penguin population has recovered past genetic diversity in just 80 years owing to conservation efforts, despite having seen the brink of extinction.
Leonard Lardaro
2010-01-01
How can a state like Rhode Island have such a high unemployment rate? This question has been asked often over the past year, especially since at one point, Rhode Island found itself with the dubious distinction of having the highest unemployment rate in the United States. Following that extreme, Rhode Island seemed to settle into a niche where its rank was third nationally.
DEFF Research Database (Denmark)
Ulstrup, Karin Elizabeth; Hill, R.; Van Oppen, M. J. H.
2008-01-01
Seasonal variation in the composition of the algal endosymbiont community and photo-physiology was determined in the corals Pocillopora damicornis, which show high local fidelity to one symbiont type (Symbiodinium C1), and Acropora valida, with a mixed Symbiodinium symbiont community, comprising...... members of both clades A and C. The relative abundances of Symbiodinium types varied over time. A significant decline in symbiont densities in both coral species during the summer of 2005 coincided with a NOAA ‘hotspot' warning for Heron Island. This also coincided with a relative increase in the presence...
Pesendorfer, Mario B.; Baker, Christopher M.; Stringer, Martin; McDonald-Madden, Eve; Bode, Michael; McEachern, A. Kathryn; Morrison, Scott A.; Sillett, T. Scott
2018-01-01
Seed dispersal by birds is central to the passive restoration of many tree communities. Reintroduction of extinct seed dispersers can therefore restore degraded forests and woodlands. To test this, we constructed a spatially explicit simulation model, parameterized with field data, to consider the effect of different seed dispersal scenarios on the extent of oak populations. We applied the model to two islands in California's Channel Islands National Park (USA), one of which has lost a key seed disperser.We used an ensemble modelling approach to simulate island scrub oak (Quercus pacifica) demography. The model was developed and trained to recreate known population changes over a 20-year period on 250-km2 Santa Cruz Island, and incorporated acorn dispersal by island scrub-jays (Aphelocoma insularis), deer mice (Peromyscus maniculatus) and gravity, as well as seed predation. We applied the trained model to 215-km2 Santa Rosa Island to examine how reintroducing island scrub-jays would affect the rate and pattern of oak population expansion. Oak habitat on Santa Rosa Island has been greatly reduced from its historical extent due to past grazing by introduced ungulates, the last of which were removed by 2011.Our simulation model predicts that a seed dispersal scenario including island scrub-jays would increase the extent of the island scrub oak population on Santa Rosa Island by 281% over 100 years, and by 544% over 200 years. Scenarios without jays would result in little expansion. Simulated long-distance seed dispersal by jays also facilitates establishment of discontinuous patches of oaks, and increases their elevational distribution.Synthesis and applications. Scenario planning provides powerful decision support for conservation managers. We used ensemble modelling of plant demographic and seed dispersal processes to investigate whether the reintroduction of seed dispersers could provide cost-effective means of achieving broader ecosystem restoration goals on
The Pacific Islands. Policy options for telecommunications investment.
Jussawalla, M; Ogden, M R
1989-03-01
The Independent Commission for World-Wide Telecommunications Development (Maitland Commission) reported that telecommunication networks, including public telephone systems, are an infrastructure which aids economic development throughout the world. The Commissions objective is to bring the majority of the world's population within easy access of a telephone and, in time, other communications services. Development in the Pacific Islands region is slowed by a lack of efficient communications. The islands are spread over 29 million square kilometers of ocean and extremely vulnerable to natural disasters. Pacific Island Nations (PINs) have problems of foreign exchange, skill shortages, and poor credit terms. Telecommunications infrastructure audits showed the overall regional teledensity of 3 telephones per 100 population. The individual countries vary form 8.3 in Fiji to 1.5 in Papua New Guinea and 25.2 in New Zealand. The population of the developing island countries is in mostly rural areas where there is a chronic shortage of telephones. The constraints on radio systems can be overcome with satellite technology. The new technologies are coming on the market faster than these countries can afford to handle them. By using satellite technology and sharing facilities PINs can greatly reduce the cost of telecommunications systems. Fiber optic cables will be used to carry large volumes of traffic over major routes while satellites can be used for a array of services for the smallest PIN nation to the largest route rim country. Work is being done to standardize the equipment specifications and to develop policies for the coordination of regional telecommunications training. To further facilitate communications development in this area, changes need to be made in international funding priorities for development, and recommendations by the Maitland Commission must be taken seriously.
Self-sustained magnetic islands
Energy Technology Data Exchange (ETDEWEB)
Chatenet, J H; Luciani, J F [Ecole Polytechnique, 91 - Palaiseau (France); Garbet, X [Association Euratom-CEA, Centre d` Etudes de Cadarache, 13 - Saint-Paul-lez-Durance (France). Dept. de Recherches sur la Fusion Controlee
1996-06-01
Numerical simulations of a single magnetic island evolution are presented in the regime where the island width is smaller than an ion Larmor radius. It is shown that the island rotation is controlled by particle diffusion due to collisions or a background of microturbulence. As expected from the theory of a stationary island, there exist cases where linearly stable magnetic perturbation are nonlinearly self-sustained. This situation corresponds to large poloidal beta and temperature gradient. The drive is due to diamagnetic frequency effects. However, this situation is not generic, and islands can also decay. It is found that a magnetic island is self-sustained for a negative off-diagonal diffusion coefficient. This case occurs in a tokamak if the inward particle pinch is due to the temperature gradient. (author). 30 refs.
Self-sustained magnetic islands
International Nuclear Information System (INIS)
Chatenet, J.H.; Luciani, J.F.; Garbet, X.
1996-06-01
Numerical simulations of a single magnetic island evolution are presented in the regime where the island width is smaller than an ion Larmor radius. It is shown that the island rotation is controlled by particle diffusion due to collisions or a background of microturbulence. As expected from the theory of a stationary island, there exist cases where linearly stable magnetic perturbation are nonlinearly self-sustained. This situation corresponds to large poloidal beta and temperature gradient. The drive is due to diamagnetic frequency effects. However, this situation is not generic, and islands can also decay. It is found that a magnetic island is self-sustained for a negative off-diagonal diffusion coefficient. This case occurs in a tokamak if the inward particle pinch is due to the temperature gradient. (author)
Subchronic effects of methylmercury on plasma and organ biochemistries in great egret nestlings
Hoffman, D.J.; Spalding, M.G.; Frederick, P.C.
2005-01-01
In recent years, high concentrations of mercury have been found in wading birds in Florida, USA. Great egret (Ardea alba) chicks (2 weeks old) were dosed orally daily with the equivalent of 0, 0.5, or 5 ug/g Hg as methylmercury chloride in the diet for up to 12 weeks. Weakness of the legs or paralysis occurred in all high-dosed birds. Geometric mean blood Hg concentrations were 0.17, 10.3, and 78.5 ug/g (wet wt), respectively. Mercury concentrations for organs (ug/g wet wt), including brain (0.22, 3.4, and 35, respectively), liver (0.34, 15.1, 138, respectively), and kidney (0.28, 8.1, and 120, respectively), increased in a dose-dependent manner. Total glutathione (GSH) peroxidase activity was significantly lower in the plasma, brain, liver, and kidney of the high-dosed group. Plasma aspartate aminotransferase activity increased with mercury treatment, whereas lactate dehydrogenase activity decreased. Four other plasma chemistries were decreased significantly in the high-dosed group and included uric acid, total protein, albumin, and inorganic phosphorus. Lipid peroxidation increased in liver (low and high dose) and brain (high dose). Tissue changes in concentrations of reduced thiols included decreased total thiols and protein-bound thiols in liver, decreased protein-bound thiols in kidney, and increased GSH in kidney and brain. Activities of GSH S-transferase and oxidized glutathione reductase increased in liver. In kidney, GSH S-transferase and glucose-6-phosphate dehydrogenase activities increased with mercury dose. These findings, including apparent compensatory changes, are compared to other Hg studies where oxidative stress was reported in egrets, herons, and diving ducks in the field and mallards in the laboratory.
46 CFR 7.85 - St. Simons Island, GA to Little Talbot Island, FL.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false St. Simons Island, GA to Little Talbot Island, FL. 7.85... BOUNDARY LINES Atlantic Coast § 7.85 St. Simons Island, GA to Little Talbot Island, FL. (a) A line drawn from latitude 31°04.1′ N. longitude 81°16.7′ W. (St. Simons Lighted Whistle Buoy “ST S”) to latitude 30...
Energy Technology Data Exchange (ETDEWEB)
Rutkiewicz, Jennifer [Department of Environmental Health Sciences, University of Michigan School of Public Health, 109 S. Observatory St, Ann Arbor, MI 48109 (United States); Scheuhammer, Anton; Crump, Doug; Jagla, Magdalena [Environment Canada, National Wildlife Research Centre, Carleton University, Ottawa, ON K1A 0H3 (Canada); Basu, Niladri, E-mail: niladri@umich.ed [Department of Environmental Health Sciences, University of Michigan School of Public Health, 109 S. Observatory St, Ann Arbor, MI 48109 (United States)
2010-08-15
Herring gulls (Larus argentatus) bioaccumulate mercury (Hg) but it is unknown whether they are exposed at levels of neurological concern. Here we studied brain tissues from gulls at five Great Lakes colonies and one non-Great Lakes colony during spring of 2001 and 2003. Total brain Hg concentrations ranged from 0.14 to 2.0 {mu}g/g (dry weight) with a mean of 0.54 {mu}g/g. Gulls from Scotch Bonnet Island, on the easternmost edge of the Great Lakes, had significantly higher brain Hg than other colonies. No association was found between brain Hg concentration and [3H]-ligand binding to neurochemical receptors (N-methyl-D-aspartate, muscarinic cholinergic, nicotinic cholinergic) or nicotinic receptor {alpha}-7 relative mRNA expression as previously documented in other wildlife. In conclusion, spatial trends in Hg contamination exist in herring gulls across the Great Lakes basin, and herring gulls accumulate brain Hg but not at levels associated with sub-clinical neurochemical alterations. - Spatial trends in brain mercury exist in herring gulls across the Laurentian Great Lakes though levels are not associated with neurochemical biomarkers.
International Nuclear Information System (INIS)
Rutkiewicz, Jennifer; Scheuhammer, Anton; Crump, Doug; Jagla, Magdalena; Basu, Niladri
2010-01-01
Herring gulls (Larus argentatus) bioaccumulate mercury (Hg) but it is unknown whether they are exposed at levels of neurological concern. Here we studied brain tissues from gulls at five Great Lakes colonies and one non-Great Lakes colony during spring of 2001 and 2003. Total brain Hg concentrations ranged from 0.14 to 2.0 μg/g (dry weight) with a mean of 0.54 μg/g. Gulls from Scotch Bonnet Island, on the easternmost edge of the Great Lakes, had significantly higher brain Hg than other colonies. No association was found between brain Hg concentration and [3H]-ligand binding to neurochemical receptors (N-methyl-D-aspartate, muscarinic cholinergic, nicotinic cholinergic) or nicotinic receptor α-7 relative mRNA expression as previously documented in other wildlife. In conclusion, spatial trends in Hg contamination exist in herring gulls across the Great Lakes basin, and herring gulls accumulate brain Hg but not at levels associated with sub-clinical neurochemical alterations. - Spatial trends in brain mercury exist in herring gulls across the Laurentian Great Lakes though levels are not associated with neurochemical biomarkers.
Muhs, Daniel R.
2013-01-01
Over a span of 50 years, native Californian Donald Lee Johnson made a number of memorable contributions to our understanding of the California Channel Islands. Among these are (1) recognizing that carbonate dunes, often cemented into eolianite and derived from offshore shelf sediments during lowered sea level, are markers of glacial periods on the Channel Islands; (2) identifying beach rock on the Channel Islands as the northernmost occurrence of this feature on the Pacific Coast of North America; (3) recognizing of the role of human activities in historic landscape modification; (4) identifying both the biogenic and pedogenic origins of caliche “ghost forests” and laminar calcrete forms on the Channel Islands; (5) providing the first soil maps of several of the islands, showing diverse pathways of pedogenesis; (6) pointing out the importance of fire in Quaternary landscape history on the Channel Islands, based on detailed stratigraphic studies; and (7), perhaps his greatest contribution, clarifying the origin of Pleistocene pygmy mammoths on the Channel Islands, due not to imagined ancient land bridges, but rather the superb swimming abilities of proboscideans combined with lowered sea level, favorable paleowinds, and an attractive paleovegetation on the Channel Islands. Don was a classic natural historian in the great tradition of Charles Darwin and George Gaylord Simpson, his role models. Don’s work will remain important and useful for many years and is an inspiration to those researching the California Channel Islands today.
Adaptive radiation of island plants: Evidence from Aeonium (Crassulaceae) of the Canary Islands
DEFF Research Database (Denmark)
Jorgensen, T.H.; Olesen, J.M.
2001-01-01
evidence that such traits have been acquired through convergent evolution on islands comes from molecular phylogenies; however, direct evidence of their selective value rarely is obtained. The importance of hybridization in the evolution of island plants is also considered as part of a more general......The presence of diverse and species-rich plant lineages on oceanic islands is most often associated with adaptive radiation. Here we discuss the possible adaptive significance of some of the most prominent traits in island plants, including woodiness, monocarpy and sexual dimorphisms. Indirect...... discussion of the mechanisms governing radiations on islands. Most examples are from the Hawaiian and Canarian floras, and in particular from studies on the morphological, ecological and molecular diversification of the genus Aeonium, the largest plant radiation of the Canarian Islands....
Valuing Puget Sound’s Valued Ecosystems Components
2007-07-01
Seattle District, U.S. Army Corps of Engineers, Seattle, Washington. Eissinger, A.M. 2007. Great Blue Herons in Puget Sound. Puget Sound Nearshore...among disparate elements of the PNCERS’ multidisci- plinary research program. Pacific salmon, Dungeness crab , Pacific oyster and shorelands were...oyster (Crassostrea gigas)—an introduced and possibly invasive species that is extensively cultivated in Washington and Oregon, particu- larly in
von Huene, Roland E.; Miller, John J.; Weinrebe, Wilhelm
2012-01-01
Three destructive earthquakes along the Alaska subduction zone sourced transoceanic tsunamis during the past 70 years. Since it is reasoned that past rupture areas might again source tsunamis in the future, we studied potential asperities and barriers in the subduction zone by examining Quaternary Gulf of Alaska plate history, geophysical data, and morphology. We relate the aftershock areas to subducting lower plate relief and dissimilar materials in the seismogenic zone in the 1964 Kodiak and adjacent 1938 Semidi Islands earthquake segments. In the 1946 Unimak earthquake segment, the exposed lower plate seafloor lacks major relief that might organize great earthquake rupture. However, the upper plate contains a deep transverse-trending basin and basement ridges associated with the Eocene continental Alaska convergent margin transition to the Aleutian island arc. These upper plate features are sufficiently large to have affected rupture propagation. In addition, massive slope failure in the Unimak area may explain the local 42-m-high 1946 tsunami runup. Although Quaternary geologic and tectonic processes included accretion to form a frontal prism, the study of seismic images, samples, and continental slope physiography shows a previous history of tectonic erosion. Implied asperities and barriers in the seismogenic zone could organize future great earthquake rupture.
Ford, Murray R.; Kench, Paul S.
2014-06-01
In 1905, a devastating typhoon hit Nadikdik Atoll (5°54‧ N and 172°09‧ E) in the southern Marshall Islands. Evidence suggests that large sections of reef islands on Nadikdik were overwashed and destroyed. Comparison of aerial photographs taken in 1945 and modern satellite imagery provides a unique record of the geomorphic adjustment of islands after the typhoon. Between 1945 and 2010 the vegetated area of islands on Nadikdik grew from 0.74 to 0.90 km2. Observed changes to Nadikdik reef islands manifested through a range of styles and were largely accretionary. Of note, the formation of a new island was tracked from an embryonic deposit to a fully vegetated and stable island over a 61 year period. Similarly, a number of previously discrete islands have agglomerated and formed a single larger island. These changes were rapid and indicate that reef island formation can occur quickly. Evidence suggests that despite the typhoon occurring over a century ago the geomorphic adjustment of islands is still on-going.
Low calcification in corals in the Great Barrier Reef
Bhattacharya, Atreyee
2012-10-01
Reef-building coral communities in the Great Barrier Reef—the world's largest coral reef—may now be calcifying at only about half the rate that they did during the 1970s, even though live coral cover may not have changed over the past 40 years, a new study finds. In recent decades, coral reefs around the world, home to large numbers of fish and other marine species, have been threatened by such human activities as pollution, overfishing, global warming, and ocean acidification; the latter affects ambient water chemistry and availability of calcium ions, which are critical for coral communities to calcify, build, and maintain reefs. Comparing data from reef surveys during the 1970s, 1980s, and 1990s with present-day (2009) measurements of calcification rates in One Tree Island, a coral reef covering 13 square kilometers in the southern part of the Great Barrier Reef, Silverman et al. show that the total calcification rates (the rate of calcification minus the rate of dissolution) in these coral communities have decreased by 44% over the past 40 years; the decrease appears to stem from a threefold reduction in calcification rates during nighttime.
Apparent Brecciation Gradient, Mount Desert Island, Maine
Hawkins, A. T.; Johnson, S. E.
2004-05-01
Mount Desert Island, Maine, comprises a shallow level, Siluro-Devonian igneous complex surrounded by a distinctive breccia zone ("shatter zone" of Gilman and Chapman, 1988). The zone is very well exposed on the southern and eastern shores of the island and provides a unique opportunity to examine subvolcanic processes. The breccia of the Shatter Zone shows wide variation in percent matrix and clast, and may represent a spatial and temporal gradient in breccia formation due to a single eruptive or other catastrophic volcanic event. The shatter zone was divided into five developmental stages based on the extent of brecciation: Bar Harbor Formation, Sols Cliffs breccia, Seeley Road breccia, Dubois breccia, and Great Head breccia. A digital camera was employed to capture scale images of representative outcrops using a 0.5 m square Plexiglas frame. Individual images were joined in Adobe Photoshop to create a composite image of each outcrop. The composite photo was then exported to Adobe Illustrator, which was used to outline the clasts and produce a digital map of the outcrop for analysis. The fractal dimension (Fd) of each clast was calculated using NIH Image and a Euclidean distance mapping method described by Bérubé and Jébrak (1999) to quantify the morphology of the fragments, or the complexity of the outline. The more complex the fragment outline, the higher the fractal dimension, indicating that the fragment is less "mature" or has had less exposure to erosional processes, such as the injection of an igneous matrix. Sols Cliffs breccia has an average Fd of 1.125, whereas Great Head breccia has an average Fd of 1.040, with the stages between having intermediate values. The more complex clasts of the Sols Cliffs breccia with a small amount (26.38%) of matrix material suggests that it is the first stage in a sequence of brecciation ending at the more mature, matrix-supported (71.37%) breccia of Great Head. The results of this study will be used to guide isotopic
Goymann, Wolfgang; Spina, Fernando; Ferri, Andrea; Fusani, Leonida
2010-01-01
Migration remains one of the great mysteries of animal life. Small migratory birds rely on refuelling stopovers after crossing ecological barriers such as deserts or seas. Previous studies have suggested that fuel reserves may determine stopover duration but this hypothesis could not be tested because of methodological limitations. Here, we provide evidence that subcutaneous fat stores determine stopover duration by measuring the permanence of migratory garden warblers (Sylvia borin) on a small Mediterranean island during spring migration with telemetry methods. Garden warblers with large amounts of fat stores departed the island significantly sooner than lean birds. All except one fat bird left the island on the same evening after capture, with a mean total stopover estimate of 8.8 hours. In contrast, the mean estimated total stopover duration of lean birds was 41.3 hours. To our knowledge, this is the first study that measures the true minimum stopover duration of a songbird during migration. PMID:20164077
One-Humped Camels (Camelus dromedaries Hard Ticks Infestation in Qeshm Island, Iran
Directory of Open Access Journals (Sweden)
Saeed Nazifi
2011-06-01
Full Text Available The economic importance of tick infestation on camels are important as they are important meat and milk producer animals in the less vegetation area of Iran and their health and production are greatly affected by the high tick infestation. In this investigation, tick infestations on camels (Camelus dromedarius were determined in Qeshm Island, Iran. A total number of 912 adult ticks (472 males and 440 females were collected and identified. Hyalomma dromedarii was the predominant tick specie and accounted for 61.9% of the adult ticks. Other hard ticks were H. anatolicum excavatum (22 %, H. asiaticum asiaticum (14.2 %, H. marginatum (1.9 %, H. impeltatum (0.4 % and Ripicephalus bursa (0.4 %. In conclusion, The provision of tick control programs in the Qeshm Island would seem a prerequisite for improving camel meat and milk production.
Frank, D.S.; Mora, M.A.; Sericano, J.L.; Blankenship, Alan L.; Kannan, K.; Giesy, J.P.
2001-01-01
Eggs of neotropic cormorants (Phalacrocorax brasilianus), black-crowned night herons (Nycticorax nycticorax), and great egrets (Ardea alba) nesting on several locations in Galveston Bay (TX, USA) and at two control sites outside the bay were collected during April–May 1996 and analyzed for chlorinated pesticides, PCBs, polychlorinated dibenzo-p-dioxins, and polychlor-inated dibenzofurans. Additionally, concentrations of 2,3,7,8-tetrachlorodibenzo-p-dioxin equivalents (TCDD-EQs) were determined by use of relative potency factors (TEQs) or the H4IIE-luc bioassay TCDD-EQs. Concentrations of 1,1,-dichloro-2,2-bis(p-chlo-rophenyl)ethylene (DDE) were greater in eggs of neotropic cormorants from Alexander Island (mean = 1,040 ng/g wet wt) in the Houston Ship Channel (Houston, TX, USA) and in those from Telfair Island (mean = 1,460 ng/g wet wt), a reference location outside the bay, than in most locations inside the bay (mean range = 119–453 ng/g wet wt). Mean PCB concentrations were greater in eggs of neotropic cormorants from Alexander Island (mean = 5,720 ng/g wet wt) than in eggs of cormorants from areas farther away from the ship channel, including two reference sites outside the bay (mean range = 404–3,140 ng/g wet wt). The TCDD was the main dioxin congener detected in eggs from all locations within Galveston Bay. Instrumental TEQs in eggs ranged from 67 pg/g wet weight at control sites to 452 pg/g wet weight at Alexander Island. Concentrations of TCDD-EQs determined in the H4IIE assay were correlated with instrumental TEQs and were greater in eggs of cormorants from islands within the bay, although these were farther away from the ship channel. Overall, concentrations of DDE, PCBs, TCDD, and TCDD-EQs were less than the threshold levels known to affect reproduction. However, some eggs contained concentrations of total PCBs or DDE greater than what would elicit adverse effects on birds. No identifiable deformities or abnormalities were detected in embryos
1994-05-19
the audit of two projects: P-608T, Building Modifications, valued at...Island, California, to the Naval Training Center Great Lakes, Illinois. The audit also evaluated the implementation of the DoD Internal Management...related to the two projects in this report and is discussed in Report No. 94-109, Quick-Reaction Report on the Audit of Defense Base Realignment and Closure Budget Data for the Naval Training Center Great Lakes, Illinois, May 19,
Bryophytes from Simeonof Island in the Shumagin Islands, southwestern Alaska
Schofield, W.B.; Talbot, S. S.; Talbot, S.L.
2004-01-01
Simeonof Island is located south of the Alaska Peninsula in the hyperoceanic sector of the middle boreal subzone. We examined the bryoflora of Simeonof Island to determine species composition in an area where no previous collections had been reported. This field study was conducted in sites selected to represent the spectrum of environmental variation within Simeonof Island. Data were analyzed using published reports to compare bryophyte distribution patterns at three levels, the Northern Hemisphere, North America, and Alaska. A total of 271 bryophytes were identified: 202 mosses and 69 liverworts. The annotated list of species for Simeonof Island expands the known range for many species and fills distribution gaps within Hulte??n's Western Pacific Coast district. Maps and notes on the distribution of 14 significant distribution records are presented. Compared with bryophyte distribution in the Northern Hemisphere, the bryoflora of Simeonof Island primarily includes taxa of boreal (55%), temperate (20%), arctic (10%), and cosmopolitan (8%) distribution; 6% of the moss flora are western North America endemics. A description of the bryophytes present in the vegetation and habitat types is provided as is a quantitative analysis of the most frequently occurring bryophytes in crowberry heath.
Tohoku-Oki Earthquake Tsunami Runup and Inundation Data for Sites Around the Island of Hawaiʻi
Trusdell, Frank A.; Chadderton, Amy; Hinchliffe, Graham; Hara, Andrew; Patenge, Brent; Weber, Tom
2012-01-01
At 0546 U.t.c. March 11, 2011, a Mw 9.0 ("great") earthquake occurred near the northeast coast of Honshu Island, Japan, generating a large tsunami that devastated the east coast of Japan and impacted many far-flung coastal sites around the Pacific Basin. After the earthquake, the Pacific Tsunami Warning Center issued a tsunami alert for the State of Hawaii, followed by a tsunami-warning notice from the local State Civil Defense on March 10, 2011 (Japan is 19 hours ahead of Hawaii). After the waves passed the islands, U.S. Geological Survey (USGS) scientists from the Hawaiian Volcano Observatory (HVO) measured inundation (maximum inland distance of flooding), runup (elevation at maximum extent of inundation) and took photographs in coastal areas around the Island of Hawaiʻi. Although the damage in West Hawaiʻi is well documented, HVO's mapping revealed that East Hawaiʻi coastlines were also impacted by the tsunami. The intent of this report is to provide runup and inundation data for sites around the Island of Hawaiʻi.
On the form of species–area relationships in habitat islands and true islands
DEFF Research Database (Denmark)
Matthews, Thomas J.; Guilhaumon, François; Triantis, Kostas A.
2016-01-01
and c vary between different island types. Location: Global. Methods: We used an information theoretic approach to compare the fit of 20 ISAR models to 207 habitat island datasets. Model performance was ranked according to pre-set criteria, including metrics of generality and efficiency. We also fitted......, and was the highest ranked model overall. In general, the more complex models performed badly. Average z-values were significantly lower for habitat island datasets than for true islands, and were higher for mountaintop and urban habitat islands than for other habitat island types. Average c-values were significantly...... multimodel comparisons demonstrated the nonlinear implementation of the power model to be the best overall model and thus to be a sensible choice for general use. As the z-value of the log–log power model varied in relation to ecological and geographical properties of the study systems, caution should...
Island formation without attractive interaction
Jansen, A.P.J.
2008-01-01
We show that adsorbates on surfaces can form islands even if there are no attractive interactions. Instead, strong repulsion between adsorbates at short distances can lead to islands, because such islands increase the entropy of the adsorbates that are not part of the islands. We suggest that this
The Great Recession was not so Great
van Ours, J.C.
2015-01-01
The Great Recession is characterized by a GDP-decline that was unprecedented in the past decades. This paper discusses the implications of the Great Recession analyzing labor market data from 20 OECD countries. Comparing the Great Recession with the 1980s recession it is concluded that there is a
Groot, de Alma V.; Oost, Albert P.; Veeneklaas, Roos M.; Lammerts, Evert Jan; Duin, van Willem E.; Wesenbeeck, van Bregje K.
2016-01-01
The Frisian islands (Southern North Sea) have extensive island tails, i.e. the entire downdrift side of an island consisting of salt marshes, dunes, beaches and beach plains, and green beaches. Currently, large parts of these tails are ageing and losing dynamics, partly due to human influence.
Channel and island change in the lower Platte River, Eastern Nebraska, USA: 1855 2005
Joeckel, R. M.; Henebry, G. M.
2008-12-01
The lower Platte River has undergone considerable change in channel and bar characteristics since the mid-1850s in four 20-25 km-long study stretches. The same net effect of historical channel shrinkage that was detected upstream from Grand Island, Nebraska, can also be detected in the lower river but differences in the behaviors of study stretches upstream and downstream from major tributaries are striking. The least relative decrease occurred downstream from the Loup River confluence, and the stretch downstream from the Elkhorn River confluence actually showed an increase in channel area during the 1940s. Bank erosion was also greater downstream of the tributaries between ca. 1860 and 1938/1941, particularly in stretch RG, which showed more lateral migration. The cumulative island area and the ratio of island area to channel area relative to the 1938/1941 baseline data showed comparatively great fluctuations in median island size in both downstream stretches. The erratic behavior of island size distributions over time indicates that large islands were accreted to the banks at different times, and that some small, newly-stabilized islands were episodically "flushed" out of the system. In the upstream stretches the stabilization of mobile bars to create new, small islands had a more consistent impact over time. Channel decrease by the abandonment of large, long-lived anabranches and by the in-place narrowing resulting from island accretion were more prominent in these upstream stretches. Across all of the study area, channel area appears to be stabilizing gradually as the rate of decrease lessens. This trend began earliest in stretch RG in the late 1950s and was accompanied by shifts in the size distributions of stabilized islands in that stretch into the 1960s. Elsewhere, even in the easternmost study stretch, stabilizing was occurring by the late 1960s, the same time frame documented by investigations of the Platte system upstream of the study area. Comprehensive
International Nuclear Information System (INIS)
Bratic, S.; Krajacic, G.; Duic, N.; Cotar, A.; Jardas, D.
2011-01-01
In order to analyze energy self-sufficient island, example of a smaller island, connected to the power system of a bigger island with an undersea cable, was taken. Mounting substation 10/0,4 is situated on the island and for the moment it provides enough electricity using the medium voltage line. It is assumed that the island is situated on the north part of the Adriatic Sea. The most important problem that occurs on the island is the population drop that occurs for a significant number of years, therefore, life standard needs to be improved, and economic development needs to be encouraged immediately. Local authorities to stimulate sustainable development on the island through different projects, to breath in a new life to the island, open new jobs and attract new people to come live there. Because of the planned development and increase of the population, energy projects, planned as a support to sustainable development, and later achievement of the energy self-sufficiency, is described in this paper. Therefore, Rewisland methodology appliance is described taking into the account three possible scenarios of energy development. Each scenario is calculated until year 2030. Also, what is taken into the account is 100% usage of renewable sources of energy in 2030. Scenario PTV, PP, EE - This scenario includes installation of solar photovoltaic modules and solar thermal collectors on the buildings roofs, as well as well as implementation of energy efficiency on the island (replacement of the street light bulbs with LED lightning, replacement of the old windows and doors on the houses, as well as the installation of the thermal insulation). Scenario PV island - This scenario, similarly to the previous one, includes installation of solar photovoltaic modules and solar thermal collectors an the residential buildings, as well as the 2 MW photovoltaic power plant and ''Green Hotel'', a building that satisfies all of its energy needs completely from renewable energy sources
One million served: Rhode Island`s recycling facility
Energy Technology Data Exchange (ETDEWEB)
Malloy, M.G.
1997-11-01
Rhode Island`s landfill and adjacent materials recovery facility (MRF) in Johnston, both owned by the quasi-public Rhode Island Resource Recovery Corp. (RIRRC, Johnston), serve the entire state. The $12-million recycling facility was built in 1989 next to the state`s sole landfill, the Central Landfill, which accepts only in-state trash. The MRF is operated for RIRRC by New England CRInc. (Hampton, N.H.), a unit of Waste Management, Inc. (WMI, Oak Brook, Ill.). It handles a wide variety of materials, from the usual newspaper, cardboard, and mixed containers to new streams such as wood waste, scrap metal, aseptic packaging (milk and juice boxes), and even textiles. State municipalities are in the process of adding many of these new recyclable streams into their curbside collection programs, all of which feed the facility.
International Nuclear Information System (INIS)
Diaz M, Juan Manuel; Garcia Llano, Cesar Fernando
2010-01-01
San Andres Island is the largest emerged portion of the oceanic archipelago of San Andres and Providencia, southwestern Caribbean Sea; it originated as a coralline atoll during Miocene times. The central and highest part of the island consists of a calcareous crest, the San Andres Formation, formed by Neogene lagoonal and reefal deposits. This crest is surrounded by a calcareous platform of Pleistocene age (San Luis Formation) which emerges only along the island coast, whereas its most part is submerged and covered by a Recent reef complex. Fossil material of molluscs from these two formations was collected in various sites throughout the island and taxonomically identified. In the four sites sampled in the San Andres Formation, material belonging to 19 gastropod and 37 bivalve species was obtained, most of them relatively well represented in other geologic formations of the Caribbean region that are stratigraphically situated between the upper Miocene and the middle Pliocene. Some elements occurring in this formation, such as Ostrea haitiensis, Meretrix dariena and Siphocypraea henekeni, were widely distributed in the Caribbean Miocene Province. In the San Luis Formation, material belonging to 18 gastropod and 11 bivalve species was obtained, most of them also represented in the Recent molluscan fauna of the region. The estimated age of this formation is Sangamonian, hence corresponding to similar formations occurring in Grand Cayman, Jamaica, Hispaniola, the Netherlands Antilles and other Caribbean islands, with which it also shows a great similarity in the composition of the molluscan fauna.
Immigrants, islandness and perceptions of quality-of-life on Prince Edward Island, Canada
Directory of Open Access Journals (Sweden)
Peter Kitchen
2014-11-01
Full Text Available This paper explores perceptions of immigrant quality-of-life (QOL and islandness in Charlottetown, Prince Edward Island, Canada, and compares these perceptions to those of Canadian-born residents of the same provincial capital. The study employed a mixed-methods approach, including a household telephone survey conducted in the summer of 2012 (n=302, focus group interviews with immigrants in late 2012 and observations on preliminary results by the staff of the PEI Association of Newcomers to Canada (PEIANC, the primary immigrant settlement service agency on the island. The analysis of the results suggests that immigrants have a high and undifferentiated assessment of their own QOL, sense of belonging and sense of place compared to Canadian-born islanders; immigrants are also critical of the quality of education and of the range of recreational and cultural events underway on the Island. While they express positive sentiments regarding life on the Island, immigrants still feel excluded from social and economic opportunities.
Meik, Jesse M; Makowsky, Robert
2018-01-01
We expand a framework for estimating minimum area thresholds to elaborate biogeographic patterns between two groups of snakes (rattlesnakes and colubrid snakes) on islands in the western Gulf of California, Mexico. The minimum area thresholds for supporting single species versus coexistence of two or more species relate to hypotheses of the relative importance of energetic efficiency and competitive interactions within groups, respectively. We used ordinal logistic regression probability functions to estimate minimum area thresholds after evaluating the influence of island area, isolation, and age on rattlesnake and colubrid occupancy patterns across 83 islands. Minimum area thresholds for islands supporting one species were nearly identical for rattlesnakes and colubrids (~1.7 km 2 ), suggesting that selective tradeoffs for distinctive life history traits between rattlesnakes and colubrids did not result in any clear advantage of one life history strategy over the other on islands. However, the minimum area threshold for supporting two or more species of rattlesnakes (37.1 km 2 ) was over five times greater than it was for supporting two or more species of colubrids (6.7 km 2 ). The great differences between rattlesnakes and colubrids in minimum area required to support more than one species imply that for islands in the Gulf of California relative extinction risks are higher for coexistence of multiple species of rattlesnakes and that competition within and between species of rattlesnakes is likely much more intense than it is within and between species of colubrids.
Pathogenicity island mobility and gene content.
Energy Technology Data Exchange (ETDEWEB)
Williams, Kelly Porter
2013-10-01
Key goals towards national biosecurity include methods for analyzing pathogens, predicting their emergence, and developing countermeasures. These goals are served by studying bacterial genes that promote pathogenicity and the pathogenicity islands that mobilize them. Cyberinfrastructure promoting an island database advances this field and enables deeper bioinformatic analysis that may identify novel pathogenicity genes. New automated methods and rich visualizations were developed for identifying pathogenicity islands, based on the principle that islands occur sporadically among closely related strains. The chromosomally-ordered pan-genome organizes all genes from a clade of strains; gaps in this visualization indicate islands, and decorations of the gene matrix facilitate exploration of island gene functions. A %E2%80%9Clearned phyloblocks%E2%80%9D method was developed for automated island identification, that trains on the phylogenetic patterns of islands identified by other methods. Learned phyloblocks better defined termini of previously identified islands in multidrug-resistant Klebsiella pneumoniae ATCC BAA-2146, and found its only antibiotic resistance island.
Directory of Open Access Journals (Sweden)
Kenji Suetsugu
2014-12-01
Full Text Available We found Gastrodia fontinalis T. P. Lin in a bamboo forest from Takeshima Island, which is the northernmost island of the Ryukyu Islands in Japan. This species is apparently rare and was previously considered to be an endemic Taiwanese species. Because there are a few minor differences between the original description and our specimens collected in Takeshima Island, here we report Gastrodia fontinalis from Takeshima Island as the first record outside of Taiwan, with a description of the specimens from Takeshima Island.
Impact of climate change and human activity on the eco-environment. An analysis of the Xisha Islands
International Nuclear Information System (INIS)
Xu, Liqiang
2015-01-01
This study describes the fundamentals of assessing the vulnerability of coral islands, as well as environmental management and resource exploitation. Using seabird subfossils, such as bones, guano, eggshells etc., which have been well preserved on the Xisha Islands in the South China Sea, the author identifies the influences of climate change and human activity on seabird populations and diets. Understanding the past is of great importance for predicting the future, and seabird subfossils provide valuable information, which can be used to study changes in seabird ecology, paleoceanography and palaeoclimate. Furthermore, this study proposes examining the biogeochemical cycling of some elements present in the geosphere, hydrosphere, biosphere and atmosphere.
Impact of climate change and human activity on the eco-environment. An analysis of the Xisha Islands
Energy Technology Data Exchange (ETDEWEB)
Xu, Liqiang [Heifei Univ. of Technology (China). School of Resources and Environmental Engineering
2015-06-01
This study describes the fundamentals of assessing the vulnerability of coral islands, as well as environmental management and resource exploitation. Using seabird subfossils, such as bones, guano, eggshells etc., which have been well preserved on the Xisha Islands in the South China Sea, the author identifies the influences of climate change and human activity on seabird populations and diets. Understanding the past is of great importance for predicting the future, and seabird subfossils provide valuable information, which can be used to study changes in seabird ecology, paleoceanography and palaeoclimate. Furthermore, this study proposes examining the biogeochemical cycling of some elements present in the geosphere, hydrosphere, biosphere and atmosphere.
Renewable energy islands in Europe
Energy Technology Data Exchange (ETDEWEB)
Oestergaard, Iben [ed.
1998-12-31
This publication includes a compiled presentation of various aspects concerning the possible transformation of some European islands into renewable energy communities and these projects were presented by a selection of pioneer islands at the first European Seminar on Renewable Energy Islands, held on the Danish island of Samsoee, 29-30 June 1998. This issue has increased in importance with the presentation of the ambitious EU-White Paper: `Energy for the future: Renewable Sources of Energy` which was adopted in 1998. One of the key elements of the strategy for an accelerated implementation of renewable energy is to transform 100 localities within Europe into communities which are to be 100% self-sufficient with renewable energy before 2010. In line with this strategy, the Danish Government appointed the island of Samsoe towards the end of 1997 to be the first `official` Danish, renewable energy island. This is to serve as a demonstration project for other local communities, both in Denmark as well as in the rest Europe. Gothland, Madeira, Canary Islands, Cape Verde, Arki, Crete, Minorca and Orkney Islands were represented. Environmental advantages of wind, solar and wave power for distant island communities were indicated. Serious savings would be achieved by limitation of fossil fuel import and utilization of local resources. (EG)
Barrier island habitat map and vegetation survey—Dauphin Island, Alabama, 2015
Enwright, Nicholas M.; Borchert, Sinéad M.; Day, Richard H.; Feher, Laura C.; Osland, Michael J.; Wang, Lei; Wang, Hongqing
2017-08-04
Barrier islands are dynamic environments due to their position at the land-sea interface. Storms, waves, tides, currents, and relative sea-level rise are powerful forces that shape barrier island geomorphology and habitats (for example, beach, dune, marsh, and forest). Hurricane Katrina in 2005 and the Deep Water Horizon oil spill in 2010 are two major events that have affected habitats and natural resources on Dauphin Island, Alabama. The latter event prompted a collaborative effort between the U.S. Geological Survey, the U.S. Army Corps of Engineers, and the State of Alabama funded by the National Fish and Wildlife Foundation to investigate viable, sustainable restoration options that protect and restore the natural resources of Dauphin Island, Alabama.In order to understand the feasibility and sustainability of various restoration scenarios, it is important to understand current conditions on Dauphin Island. To further this understanding, a detailed 19-class habitat map for Dauphin Island was produced from 1-foot aerial infrared photography collected on December 4, 2015, and lidar data collected in January 2015. We also conducted a ground survey of habitat types, vegetation community structure, and elevations in November and December 2015. These products provide baseline data regarding the ecological and general geomorphological attributes of the area, which can be compared with observations from other dates for tracking changes over time.
33 CFR 80.712 - Morris Island, SC to Hilton Head Island, SC.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Morris Island, SC to Hilton Head..., SC to Hilton Head Island, SC. (a) A line drawn from the easternmost tip of Folley Island to the... easternmost extremity of Hilton Head at latitude 32°13.0′ N. longitude 80°40.1′ W. [CGD 77-118a, 42 FR 35784...
Gleeson, Ricky; Adlard, Robert
2011-10-01
Three new species of Ceratomyxa Thélohan, 1892 are described from the gall-bladders of two species of carcharhinid sharks collected off Heron and Lizard Islands on the Great Barrier Reef, Australia. Ceratomyxa carcharhini n. sp. and C. melanopteri n. sp. are described from Carcharhinus melanopterus (Quoy & Gaimard), and Ceratomyxa negaprioni n. sp. is described from Negaprion acutidens (Rüppell). These species are the first ceratomyxids reported from Australian elasmobranchs, and this is the first paper to formally characterise a novel Ceratomyxa species from an elasmobranch using both morphology and small subunit ribosomal DNA sequence data. Maximum parsimony and Bayesian inference analyses of the SSU rDNA dataset revealed that ceratomyxids from elasmobranchs form a sister clade to that of species infecting marine teleosts and Palliatus indecorus Schulman, Kovaleva & Dubina, 1979. Furthermore, the only sequenced freshwater ceratomyxid, Ceratomyxa shasta Noble, 1950, fell outside the overall marine ceratomyxid clade. These data show that Ceratomyxa, as currently recognised, is polyphyletic and ignites discussion on whether Ceratomyxa should be split. However, further taxon sampling, particularly in freshwater systems, is required to establish relevant biological divisions within the genus.
Reef, Ruth; Pandolfi, John M; Lovelock, Catherine E
2012-08-01
The growth rate hypothesis (GRH) links growth rates with organism elemental stoichiometry. Support for the GRH was found for many animal species, but less so for plants. This is the first study to test the GRH in macroalgae. Tropical coral reef macroalgae from three lineages, Caulerpa serrulata (Chlorophyta), Laurencia intricata (Rhodophyta), and Sargassum polyphyllum (Phaeophyceae) were grown enriched with nitrogen or phosphorous and under control conditions at Heron Island on the Great Barrier Reef, Australia. Growth rate, photosynthesis, nucleic acid composition, and elemental stoichiometry were measured. Nutrient enrichment had positive effects on photosynthetic rates and on investment in RNA. However, growth rate was not correlated with either photosynthetic rates or RNA content; thus, we did not find support for the GRH in tropical macroalgae. Macroalgae, especially L. intricata, accumulated P to very high levels (>0.6% of dry weight). The growth rate response to tissue P concentrations was unimodal. Above 0.21%, P accumulation had negative effects on growth. Nitrogen was not stored, but evidence of futile cycling was observed. The capacity to store large amounts of P is probably an adaptation to the low and patchy nutrient environment of the tropical oceans.
Species of Juglandaceae at Peter the Great Botanic Garden at Apothecaries Island
Directory of Open Access Journals (Sweden)
Firsov Gennadii
2015-12-01
Full Text Available The first exotic species of Juglandaceae family at Peter the Great Botanic Garden of the Komarov Botanical Institute RAS in Saint-Petersburg was Juglans regia - mentioned at M. M. Terechovskij ‘s Catalogue in 1796. Twenty five taxa from 4 genera have been tested since then: Carya - 6, Juglans - 14, Platycarya - 1, Pterocarya - 4. There are 14 taxa from 3 genera in modern collection: Carya - 2, Juglans - 9, Pterocarya - 3. All species besides Carya cordiformis and Juglans nigra produce fruits. Four species of Juglans (J. ailanthifolia, J. cinerea, J. cordiformis, J. mandshurica and its hybrids produce self-sowing. There are 2 species, Juglans ailanthifolia and Pterocarya pterocarpa, which are included into the Red Data Book of Russian Federation (2008. They need In situ and Ex situ conservation and may be recommended for Saint-Petersburg’s city planting. There are considerable prospects for both repeated introduction (Carya illinoensis and primary introduction (Juglans sigillata.
Directory of Open Access Journals (Sweden)
J. P. Roux
1992-10-01
Full Text Available The physiography and climate of Inaccessible and Nightingale Islands are briefly discussed. The vegetation and the major plant associations are described. Notes are given on the ecology and distribution of each taxon. Taxa newly recorded for Inaccessible Island include Agrostis goughensis, A.holgateana, A. wacei, Calamagrostis deschampsiiformis, Carex thouarsii var. recurvata, Conyza albida, Elaphoglossum campylolepium and Uncinia meridensis. One species, C. albida, is alien to the Tristan group. Two native ferns Asplenium platybasis var. subnudum and Blechnum australe were found on Nightingale Island for the first time, and the presence of introduced Malus domestica orchards was recorded. Two unidentified taxa were found that may represent new species: Elaphoglossum sp. at Inaccessible Island and Apium sp. at both Inaccessible and Nightingale Islands. The total number of vascular plant species recorded at Inaccessible and Nightingale Islands now stands at 98 and 43, respectively, of which 26 (28% and seven (16% are introduced species. Only Airiplex plebeja and two species of Cotula occur at Nightingale Island but are absent from Inaccessible Island.
World Bank
2015-01-01
This note aims to build understanding of the existing disaster risk financing and insurance (DRFI) tools in use in The Marshall Islands and to identify gaps where potential engagement could further develop financial resilience. The likelihood that a hazardous event will have a significant impact on the Marshall Islands has risen with the increasing levels of population and assets in the urban ...
A man and his island: The island mirror in Michael Crummey’s Sweetland
Directory of Open Access Journals (Sweden)
Laurie Brinklow
2016-05-01
Full Text Available Between 1946 and 1975, dozens of islands and outports in the Canadian province of Newfoundland and Labrador were abandoned as part of a government resettlement policy. Families and communities were torn apart, and a culture and way of life that revolved around the fishery changed irrevocably. The practice, which continues to this day, has been well documented, particularly by artists and writers. Michael Crummey’s 2014 novel Sweetland is a recent iteration. The relationship between humans and place is complex: on an island, with compressed space and a very real boundary that is the ocean, emotional attachments to one’s place are often heightened and distilled. What happens when a person is displaced from his or her island; when bonds of attachment are severed and one’s mirrored double is destroyed? Sweetland offers a fictional lens through which we see an example of a mirrored relationship between an island protagonist and his island setting. Exploring themes of attachment to place, and what Barry Lopez calls a “storied” or “reciprocal” relationship with the land, this paper examines what happens to a man when confronted with leaving an island he knows as deeply as his own body and soul; and how the island reacts.
Chesapeake Bay Future Conditions Report. Volume 11. Biota.
1977-12-01
vertebrates , the cattle egret , glossy ibis and nutr ia are highly success ful new- comers , with an ecological impact yet to be assessed. Eurasian wa...Horned grebe Podiceps aur i tus Protected Cattle egret Bubulcus ibis Protected Great blue heron Ardea herodias Protected Glossy ibis Plegadis...xanthid crabs but not R. harrisii. Non-nutritional Role of Other Species Fertilization: Loxothylacus castrates the sexual organs. Appendix 15 119
Island development: Local governance under globalization
Directory of Open Access Journals (Sweden)
Huei-Min Tsai
2014-12-01
Full Text Available Issues surrounding island development have generated a growing volume of research. What does it mean to develop? How can island communities maintain control over development processes to the benefit of the local economy, rather than seeing economic flows enter and exit the island with little or a primarily negative impact? And how important is local knowledge for edifying local governance and enhancing potentials for innovation in island development? Island histories have repeatedly been forwarded as exemplars and ‘lessons’ for global learning on (unsustainability. To consider these issues, we have selected a number of papers from among the presentations given at the International Geographical Union’s Commission on Islands Conference, Island Development: Local Economy, Culture, Innovation and Sustainability, which took place in the Penghu Archipelago, Taiwan, 1–5 October 2013. These papers serve as examples of how the processes of globalization have penetrated the borders and changed the political and economic structures of islands. They also explore how island-based innovations in science, technology, culture, and formal or informal governance might contribute to sustainable island development.
Energy Transition Initiative, Island Energy Snapshot - British Virgin Islands (Fact Sheet)
Energy Technology Data Exchange (ETDEWEB)
2015-03-01
This profile provides a snapshot of the energy landscape of the British Virgin Islands (BVI), one of three sets of the Virgin Island territories in an archipelago making up the northern portion of the Lesser Antilles.
Demographic Ageing on Croatian Islands
Directory of Open Access Journals (Sweden)
Ivo Nejašmić
2013-08-01
Full Text Available This paper analyses the changes in the population structure of the Croatian islands by age, warns of the degree of ageing, provides spatial differentiation of this process and presents perspective of ageing at the level of settlement. Typing of population ageing is based on scores and has seven types. The total island population in 2011 belongs to the type 5 – very old population. Almost a half of the settlements (out of 303 have been affected by the highest levels of ageing (types 6 and 7. It was found that a quarter of island settlements will become “dead villages” in a foreseeable future; most of them are on small islands but also in the interior of larger islands. These are villages decaying in every respect, in which the way of life, as we know it, veins and goes out. The present ageing villagers are their last residents in most cases. Eve¬rything suggests that demographic recovery of the islands is not possible with the forces in situ. It is important to strike a balance between the needs and opportunities in order to successfully organize life on the islands, both small and large ones, and the fact is that there is a continuing disparity, which is especially profound in small islands. A sensitive and selective approach is needed to overcome the unfavourable demographic trends. Therefore it is necessary to respect the particularities of indi¬vidual islands and island groups in devising development strategy. Solutions to the problems must come of the local and wider community in synergy with relevant professional and scientific institutions. However, if the solutions are not found or measures do not give results, if the islands are left to desorganisation and senilisation, a part of the islands will become a wasteland. With regard to the value of this area whose wealth are people in the first place, this would be an intolerable civilization decline.
The Island Smart Energy System and Market
DEFF Research Database (Denmark)
Ma, Zheng; Billanes, Joy Dalmacio; Jørgensen, Bo Nørregaard
2017-01-01
developing island smart energy systems with the integration of renewable energy resources can increase the energy supply and address the global island energy issues. The island smart energy system operates either in a single-island or in multi-islands. However the island characteristics and influ...
Terrestrial bird population trends on Aguiguan (Goat Island), Mariana Islands
Amidon, Fred; Camp, Richard J.; Marshall, Ann P.; Pratt, Thane K.; Williams, Laura; Radley, Paul; Cruz, Justine B.
2014-01-01
The island of Aguiguan is part of the Mariana archipelago and currently supports populations of four endemic species, including one endemic genus, Cleptornis. Bird population trends since 1982 were recently assessed on the neighbouring islands of Saipan, Tinian, and Rota indicating declines in some native species. Point-transect surveys were conducted in 2008 by the U.S. Fish and Wildlife Service to assess population densities and trends on Aguiguan. Densities for six of the nine native birds—White-throated Ground-dove Gallicolumba xanthonura, Collared Kingfisher Todiramphus chloris, Rufous Fantail Rhipidura rufifrons, Golden White-eye Cleptornis marchei, Bridled White-eye Zosterops conspicillatus and Micronesian Starling Aplonis opaca—and the non-native bird—Island Collared-dove Streptopelia bitorquata—were significantly greater in 2008 than in 1982. No differences in densities were detected among the surveys for Mariana Fruit-dove Ptilinopus roseicapilla, and Micronesian MyzomelaMyzomela rubratra. Three federally and locally listed endangered birds—Nightingale Reed-warbler Acrocephalus luscinius, Mariana Swiftlet Collocalia bartschi, and Micronesian Megapode Megapodius laperous)—were either not detected during the point-transect counts, the surveys were not appropriate for the species, or the numbers of birds detected were too small to estimate densities. The factors behind the increasing trends for some species are unknown but may be related to increased forest cover on the island since 1982. With declining trends for some native species on neighbouring islands, the increasing and stable trends on Aguiguan is good news for forest bird populations in the region, as Aguiguan populations can help support conservation efforts on other islands in the archipelago.
Directory of Open Access Journals (Sweden)
Delia Davies
2015-06-01
Full Text Available The critically endangered Tristan Albatross Diomedea dabbenena breeds almost exclusively on Gough Island, in the central South Atlantic, where breeding success is much lower than other great albatrosses (Diomedea spp. worldwide. Most breeding failures occur during the chick-rearing stage, when other great albatrosses suffer few failures. This unusual pattern of breeding failure is assumed to be largely due to predation by introduced house mice Mus musculus, but there have been few direct observations of mouse attacks. We closely monitored the fates of 20 chicks in the Gonydale study colony (123 chicks in 2014 using motion-activated cameras to determine the causes of chick mortality. Only 5 of 20 chicks survived to fledge, and of the 15 failures, 14 (93% were due to mouse predation. One mouse-wounded chick was killed by a Southern Giant Petrel Macronectes giganteus; the rest died outright from their wounds within 3.9 ± 1.2 days of the first attack. Despite this high impact, most chicks were attacked by only 1-2 mice at once (maximum 9. The remaining 103 chicks in the study colony were checked less frequently, but the timing of failures was broadly similar to the 20 closely monitored nests, and the presence of mouse wounds on other chicks strongly suggests that mice were responsible for most chick deaths. Breeding success in the Gonydale study colony averages 28% from 2001 to 2014; far lower than the normal range of breeding success of Diomedea species occurring on islands free from introduced predators. Island-wide breeding success fell below 10% for the first time in 2014, making it even more urgent to eradicate mice from Gough Island.
Mendoza Vizcaino, Javier; Sumper, Andreas; Sudrià Andreu, Antoni; Ramirez, J.M.
2016-01-01
The electric generation systems on islands are based generally on fossil fuel. This fact and its supply make the electricity cost higher than in systems used in the continent. In this article, we present a review of the renewable energy generation systems on islands. To do it we analysed 77 islands from 45 different countries. This work will allow us to know how the implementation of renewable energy sources could help these islands in developing a renewable and sustainable energy sector, inc...
CRED Gridded Bathymetry near Laysan Island (100-006), Northwestern Hawaiian Islands
National Oceanic and Atmospheric Administration, Department of Commerce — File 100-006b is a 60-m ASCII grid of depth data collected near Laysan Island in the Northwestern Hawaiian Islands as of May 2003. This grid has been produced as...
CRED Gridded Bathymetry near Lisianski Island (100-001), Northwestern Hawaiian Islands
National Oceanic and Atmospheric Administration, Department of Commerce — File 100-001b is a 60-m ASCII grid of depth data collected near Lisianski Island in the Northwestern Hawaiian Islands as of May 2003. This grid has been produced as...
75 FR 61993 - Amendment of Class E Airspace; Kwajalein Island, Marshall Islands, RMI
2010-10-07
...This action removes the reference to the Kwajalein Tactacial Air Navigation (TACAN) System from the legal description of the Class E airspace areas for Kwajalein Island, Bucholz AAF, Marshall Islands, RMI. The U.S. Army notified the FAA that the Kwajalein TACAN was decommissioned. This action corrects the legal descriptions for the Class E airspace areas in the vicinity of the Marshall Islands.
The Great Basin Canada goose in southcentral Washington: A 40-year nesting history
International Nuclear Information System (INIS)
Fitzner, R.E.; Rickard, W.H.; Eberhardt, L.E.; Gray, R.H.
1991-04-01
Overall, the nesting population of Great Basin Canada geese (Branta canadensis moffitti) on the Hanford Site in southcentral Washington State is doing well and appears to be increasing. The average annual total nests for the period 1981 through 1990 was 215 nests, which is slightly above the average reported for the period 1950 through 1970. The nesting population has shifted its nucleus from upriver islands (1--10) to the lower river islands (11--20) with over 70% of the present-day nesting occurring on Islands 17, 18, 19, 20. The annual percent-successful nests from 1981 through 1990 was 80%. This is above the 71% reported for 1950 to 1970, but is below the 82% reported for 1971 to 1980. Average annual clutch size for 1981 to 1990 was 6.05, which is above the 1971-to-1980 average of 5.6 and the 1950-to-70 average of 5.5. Next desertions for 1981 to 1990 averaged 8%. This rate is well below the 14% reported for 1950 to 1970. Predators were responsible for an annual predation rate of 9% from 1981 to 1990. This is below the 1950-to-1970 annual average predation rate of 14%. Flooding losses to nests were low during the 1980s, except for 1989 and 1990 when 6% and 9% of the total nests, respectively, were destroyed by flooding. 9 refs., 4 figs., 1 tab
Returning from the Horizon: Introducing Urban Island Studies
Directory of Open Access Journals (Sweden)
Xavier Barceló Pinya
2015-12-01
Full Text Available Island studies tends to focus on peripheral, isolated, and marginal aspects of island communities, while urban studies has showed scant awareness of islandness: Although many people research cities on islands, there is little tradition of researching island cities or urban archipelagos per se. Island cities (densely populated small islands and population centres of larger islands and archipelagos nevertheless play import cultural, economic, political, and environmental roles on local, regional, and global scales. Many major cities and ports have developed on small islands, and even villages can fulfil important urban functions on lightly populated islands. Island concepts are also deployed to metaphorically describe developments in urban space. The journal Urban Island Studies explores island and urban processes around the world, taking an island approach to urban research and an urban approach to island research.
Barrier island facies models and recognition criteria
Mulhern, J.; Johnson, C. L.
2017-12-01
Barrier island outcrops record transgressive shoreline motion at geologic timescales, providing integral clues to understanding how coastlines respond to rising sea levels. However, barrier island deposits are difficult to recognize. While significant progress has been made in understanding the modern coastal morphodynamics, this insight is not fully leveraged in existing barrier island facies models. Excellent outcrop exposures of the paralic Upper Cretaceous Straight Cliffs Formation of southern Utah provide an opportunity to revise facies models and recognition criteria for barrier island deposits. Preserved barrier islands are composed of three main architectural elements (shorefaces, tidal inlets, and tidal channels) which occur independently or in combination to create larger-scale barrier island deposits. Barrier island shorefaces record progradation, while barrier island tidal inlets record lateral migration, and barrier island tidal channels record aggradation within the tidal inlet. Four facies associations are used to describe and characterize these barrier island architectural elements. Barrier islands occur in association with backarrier fill and internally contain lower and upper shoreface, high-energy upper shoreface, and tidal channel facies. Barrier islands bound lagoons or estuaries, and are distinguished from other shoreface deposits by their internal facies and geometry, association with backbarrier facies, and position within transgressive successions. Tidal processes, in particular tidal inlet migration and reworking of the upper shoreface, also distinguish barrier island deposits. Existing barrier island models highlight the short term heterogeneous and dynamic nature of barrier island systems, yet overlook processes tied to geologic time scales, such as multi-directional motion, erosion, and reworking, and their expressions in preserved barrier island strata. This study uses characteristic outcrop expressions of barrier island successions to
Gridded multibeam bathymetry of Howland Island, Pacific Remote Island Areas, Central Pacific
National Oceanic and Atmospheric Administration, Department of Commerce — Gridded bathymetry at 40m resolution surrounding Howland Island, within the Pacific Remote Island Areas - Central Pacific Ocean. Bottom coverage was achieved in...
The effects of agriculture on the volcanic aquifers of the canary islands
Custodio, E.; Guerra, J. A.; Jiménez, J.; Medina, J. A.; Soler, C.
1983-12-01
Agriculture is a basic economic activity in the Canary Islands, a Spanish region in the Atlantic Ocean, facing the Sahara. The main crops are bananas, tomatoes, and other special ones suitable for exportation. Fertilizers are applied in high quantities on the scarce land available. The relatively good vertical permeability of the soils favors the deep infiltration of irrigation return flows. Water is obtained by an extraordinary net of shaft wells and water galleries, supplemented when possible by surface reservoirs in the deep gullies. Water is distributed by an extensive network of pipes and canals, allowing the transportation of water to virtually any point from any water source. Water quality is widely variable, from almost rain water to brackish, with a high frequency of sodium bicarbonate types. Return flows, especially when water is applied with good irrigation techniques and the original quality is poor, are saline and contain chemicals leached from the fertilizers. On Tenerife Island, most of the return flows go to coastal aquifers, while most of the water comes from high-altitude water galleries. Agricultural pollution is not generally appraised, but it exists. It can be masked by the frequent, high natural nitrate content in groundwater. On Gran Canaria Island, since water comes mainly from deep shaft wells near the irrigated areas, the nitrate pollution is much more clear. On La Palma Island, besides the nitrate pollution, a potassium pollution of agricultural origin has been mentioned. Other situations on the remaining islands are also discussed. It can be concluded that agriculture is a big concern for the water quality in many areas and impairs its suitability for other uses. Because of the great depth of the water table, the nitrate pollution may not become obvious for many years, especially for the deep-water galleries.
Energy Technology Data Exchange (ETDEWEB)
Hoke, Anderson [National Renewable Energy Lab. (NREL), Golden, CO (United States); Nelson, Austin [National Renewable Energy Lab. (NREL), Golden, CO (United States); Miller, Brian [National Renewable Energy Lab. (NREL), Golden, CO (United States); Chakraborty, Sudipta [National Renewable Energy Lab. (NREL), Golden, CO (United States); Bell, Frances [SolarCity, San Mateo, CA (United States); McCarty, Michael [SolarCity, San Mateo, CA (United States)
2016-07-01
As PV and other DER systems are connected to the grid at increased penetration levels, island detection may become more challenging for two reasons: 1.) In islands containing many DERs, active inverter-based anti-islanding methods may have more difficulty detecting islands because each individual inverter's efforts to detect the island may be interfered with by the other inverters in the island. 2.) The increasing numbers of DERs are leading to new requirements that DERs ride through grid disturbances and even actively try to regulate grid voltage and frequency back towards nominal operating conditions. These new grid support requirements may directly or indirectly interfere with anti-islanding controls. This report describes a series of tests designed to examine the impacts of both grid support functions and multi-inverter islands on anti-islanding effectiveness. Crucially, the multi-inverter anti-islanding tests described in this report examine scenarios with multiple inverters connected to multiple different points on the grid. While this so-called 'solar subdivision' scenario has been examined to some extent through simulation, this is the first known work to test it using hardware inverters. This was accomplished through the use of power hardware-in-the-loop (PHIL) simulation, which allows the hardware inverters to be connected to a real-time transient simulation of an electric power system that can be easily reconfigured to test various distribution circuit scenarios. The anti-islanding test design was a modified version of the unintentional islanding test in IEEE Standard 1547.1, which creates a balanced, resonant island with the intent of creating a highly challenging condition for island detection. Three common, commercially available single-phase PV inverters from three different manufacturers were tested. The first part of this work examined each inverter individually using a series of pure hardware resistive-inductive-capacitive (RLC
International Nuclear Information System (INIS)
Tarik Ogurtani, Omer; Celik, Aytac; Emre Oren, Ersin
2014-01-01
Quantum dots (QD) have discrete energy spectrum, which can be adjusted over a wide range by tuning composition, density, size, lattice strain, and morphology. These features make quantum dots attractive for the design and fabrication of novel electronic, magnetic and photonic devices and other functional materials used in cutting-edge applications. The formation of QD on epitaxially strained thin film surfaces, known as Stranski-Krastanow (SK) islands, has attracted great attention due to their unique electronic properties. Here, we present a systematic dynamical simulation study for the spontaneous evolution of the SK islands on the stochastically rough surfaces (nucleationless growth). During the development of SK islands through the mass accumulation at randomly selected regions of the film via surface drift-diffusion (induced by the capillary and mismatch stresses) with and/or without growth, one also observes the formation of an extremely thin wetting layer having a thickness of a few Angstroms. Above a certain threshold level of the mismatch strain and/or the size of the patch, the formation of multiple islands separated by shallow wetting layers is also observed as metastable states such as doublets even multiplets. These islands are converted into a distinct SK islands after long annealing times by coalescence through the long range surface diffusion. Extensive computer simulation studies demonstrated that after an initial transient regime, there is a strong quadratic relationship between the height of the SK singlet and the intensity of the lattice mismatch strain (in a wide range of stresses up to 8.5 GPa for germanium thin crystalline films), with the exception at those critical points where the morphological (shape change with necking) transition takes place.
Gridded multibeam bathymetry of Baker Island, Pacific Remote Island Areas, Central Pacific
National Oceanic and Atmospheric Administration, Department of Commerce — Gridded bathymetry at 40m resolution surrounding Baker Island, within the Pacific Remote Island Areas - Central Pacific Ocean. Bottom coverage was achieved in depths...
Directory of Open Access Journals (Sweden)
Silvia Mantilla
2011-06-01
materials typically attributed to the Great Caribbean where patterns of security threats, geopolitical relations with the United States, and social and economic impacts of the narcotrafficking epidemic are commonly observed. The article presents San Andres Island (Colombia as a case that adheres more to the insular dynamics of the Great Caribbean region rather than one that mimics the tendencies of continental Colombia. This perspective permits the establishment of connections between both regional spaces -insular and continental-, and simultaneously evaluates the phenomenon´s regional impact by exploring the illegal connections formed in the archipelago with neighboring Caribbean countries. Finally, the hypothesis is sustained that the trafficking phenomenon on the island is a result of historical, cultural and socioeconomic factors that explain the active participation of certain sectors of the island´s society in these illegal activities.
Poppe, L.J.; Danforth, W.W.; McMullen, K.Y.; Parker, Castle E.; Doran, E.F.
2011-01-01
Detailed bathymetric maps of the sea floor in Long Island Sound are of great interest to the Connecticut and New York research and management communities because of this estuary's ecological, recreational, and commercial importance. The completed, geologically interpreted digital terrain models (DTMs), ranging in area from 12 to 293 square kilometers, provide important benthic environmental information, yet many applications require a geographically broader perspective. For example, individual surveys are of limited use for the planning and construction of cross-sound infrastructure, such as cables and pipelines, or for the testing of regional circulation models. To address this need, we integrated 12 multibeam and 2 LIDAR (Light Detection and Ranging) contiguous bathymetric DTMs, produced by the National Oceanic and Atmospheric Administration during charting operations, into one dataset that covers much of eastern Long Island Sound and extends into westernmost Block Island Sound. The new dataset is adjusted to mean lower low water, is gridded to 4-meter resolution, and is provided in UTM Zone 18 NAD83 and geographic WGS84 projections. This resolution is adequate for sea floor-feature and process interpretation but is small enough to be queried and manipulated with standard Geographic Information System programs and to allow for future growth. Natural features visible in the grid include exposed bedrock outcrops, boulder lag deposits of submerged moraines, sand-wave fields, and scour depressions that reflect the strength of the oscillating and asymmetric tidal currents. Bedform asymmetry allows interpretations of net sediment transport. Anthropogenic artifacts visible in the bathymetric data include a dredged channel, shipwrecks, dredge spoils, mooring anchors, prop-scour depressions, buried cables, and bridge footings. Together the merged data reveal a larger, more continuous perspective of bathymetric topography than previously available, providing a fundamental
Vegetation assessment of forests of Pagan Island, Commonwealth of the Northern Mariana Islands
Pratt, Linda W.
2011-01-01
As part of the Marianas Expedition Wildlife Surveys-2010, the forest vegetation of the island of Pagan, Commonwealth of the Northern Mariana Islands (CNMI), was sampled with a series of systematic plots along 13 transects established for monitoring forest bird populations. Shrubland and grassland were also sampled in the northern half of the island. Data collected were woody plant density, tree diameter at breast height, woody plant density in height classes below 2 m, and ground cover measured with the point-intercept method. Coconut forests (Cocos nucifera) were generally found to have low native tree diversity, little regeneration of trees and shrubs in the forest understory, and little live ground cover. The sole exception was a coconut-dominated forest of the northeast side of the island that exhibited high native tree diversity and a large number of young native trees in the understory. Ironwood (Casuarina equisetifolia) forests on the northern half of the island were nearly monocultures with almost no trees other than ironwood in vegetation plots, few woody plants in the understory, and low ground cover dominated by native ferns. Mixed native forests of both northern and southern sections of the island had a diversity of native tree species in both the canopy and the sparse understory. Ground cover of native forests in the north had a mix of native and alien species, but that of the southern half of the island was dominated by native ferns and woody plants.
Island biogeography of marine organisms
Pinheiro, Hudson T.; Bernardi, Giacomo; Simon, Thiony; Joyeux, Jean-Christophe; Macieira, Raphael M.; Gasparini, João Luiz; Rocha, Claudia; Rocha, Luiz A.
2017-09-01
Studies on the distribution and evolution of organisms on oceanic islands have advanced towards a dynamic perspective, where terrestrial endemicity results from island geographical aspects and geological history intertwined with sea-level fluctuations. Diversification on these islands may follow neutral models, decreasing over time as niches are filled, or disequilibrium states and progression rules, where richness and endemism rise with the age of the archipelago owing to the splitting of ancestral lineages (cladogenesis). However, marine organisms have received comparatively little scientific attention. Therefore, island and seamount evolutionary processes in the aquatic environment remain unclear. Here we analyse the evolutionary history of reef fishes that are endemic to a volcanic ridge of seamounts and islands to understand their relations to island evolution and sea-level fluctuations. We also test how this evolutionary history fits island biogeography theory. We found that most endemic species have evolved recently (Pleistocene epoch), during a period of recurrent sea-level changes and intermittent connectivity caused by repeated aerial exposure of seamounts, a finding that is consistent with an ephemeral ecological speciation process. Similar to findings for terrestrial biodiversity, our data suggest that the marine speciation rate on islands is negatively correlated with immigration rate. However, because marine species disperse better than terrestrial species, most niches are filled by immigration: speciation increases with the random accumulation of species with low dispersal ability, with few opportunities for in situ cladogenesis and adaptive radiation. Moreover, we confirm that sea-level fluctuations and seamount location play a critical role in marine evolution, mainly by intermittently providing stepping stones for island colonization.
Interaction of bootstrap-current-driven magnetic islands
International Nuclear Information System (INIS)
Hegna, C.C.; Callen, J.D.
1991-10-01
The formation and interaction of fluctuating neoclassical pressure gradient driven magnetic islands is examined. The interaction of magnetic islands produces a stochastic region around the separatrices of the islands. This interaction causes the island pressure profile to be broadened, reducing the island bootstrap current and drive for the magnetic island. A model is presented that describes the magnetic topology as a bath of interacting magnetic islands with low to medium poloidal mode number (m congruent 3-30). The islands grow by the bootstrap current effect and damp due to the flattening of the pressure profile near the island separatrix caused by the interaction of the magnetic islands. The effect of this sporadic growth and decay of the islands (''magnetic bubbling'') is not normally addressed in theories of plasma transport due to magnetic fluctuations. The nature of the transport differs from statistical approaches to magnetic turbulence since the radial step size of the plasma transport is now given by the characteristic island width. This model suggests that tokamak experiments have relatively short-lived, coherent, long wavelength magnetic oscillations present in the steep pressure-gradient regions of the plasma. 42 refs
Island tameness: an altered cardiovascular stress response in Galápagos marine iguanas.
Vitousek, Maren N; Romero, L Michael; Tarlow, Elisa; Cyr, Nicole E; Wikelski, Martin
2010-03-30
Island tameness is a widely documented phenomenon in which island species, particularly those that have evolved with no or few natural predators, show a greatly reduced behavioral response when faced with unfamiliar predators. This insufficient anti-predator response has led to widespread population declines among many island species exposed to novel predators, and has become a serious conservation problem. Despite its prevalence, the underlying physiology of island tameness is not known. Here we report that although Galápagos marine iguanas (Amblyrhynchus cristatus) initiated flight from an evolutionarily recent and unfamiliar potential predator (humans), they failed to show the cardiovascular stress response that facilitates successful escape, even after a prior capture experience. In contrast, when approached by a native predator (the Galápagos hawk; Buteo galapagoensis), marine iguanas show markedly increased heart rate independent of initiating escape movement. The secretion of catecholamines appears to be central to the initiation of escape behavior: naïve animals remotely injected with epinephrine immediately increased flight initiation distance, whereas those injected with corticosterone did not. Our results provide the first evidence that muted escape behavior in predator-naïve species is indicative of both a cognitive deficit in recognizing potential predators and a catecholamine deficit in response. Understanding how the response to predators differs in predator-naïve species could enable the design of maximally effective techniques for inducing an anti-predator response in these vulnerable species. (c) 2010 Elsevier Inc. All rights reserved.
Some data on the avifauna of the Island of Roti, Lesser Sunda Islands, Indonesia
Verheijen, J.A.J.
1976-01-01
INTRODUCTION For several years I had been looking for an opportunity to visit the island of Roti (Rotti, Roté, Loté). Junge (1954) mentions that only once an ornithological collection was made in the island, namely by Dr. H. F. C. ten Kate, an ethnologist who visited the island in 1891. Büttikofer
Islanded operation of distribution networks
Energy Technology Data Exchange (ETDEWEB)
NONE
2005-07-01
This report summarises the results of a study assessing the benefits and risks to distribution network of generator islanding and examining the technical, commercial and regulatory changes required to facilitate the operation of islanding. The background to the study is traced, and details are given of a literature review, the technical criteria for operating sections of the network in islanding mode, and the impact of islanding on trading. Case studies and a detailed implementation plan, data acquisition, and commercial incentives are discussed.
Islanded operation of distribution networks
International Nuclear Information System (INIS)
2005-01-01
This report summarises the results of a study assessing the benefits and risks to distribution network of generator islanding and examining the technical, commercial and regulatory changes required to facilitate the operation of islanding. The background to the study is traced, and details are given of a literature review, the technical criteria for operating sections of the network in islanding mode, and the impact of islanding on trading. Case studies and a detailed implementation plan, data acquisition, and commercial incentives are discussed
HYDROGEOLOGICAL RELATIONS ON KARSTIFIED ISLANDS - VIS ISLAND CASE STUDY
Directory of Open Access Journals (Sweden)
Josip Terzić
2004-12-01
Full Text Available An approach to the hydrogeological investigations on Adriatic islands is presented on the Island of Vis case study. Infiltration, accumulation and discharge of the groundwater occur in karstified rock mass. Hydrogeological relations are mostly a consequence of the geological setting, because of the complete hydrogeologic barrier in Komiža bay, and relative barrier in the area of karst poljes. Significant research was performed in the 1999 – 2000 period aimed of better understanding of hydrogeological relations. These investigations, as well as reinterpretation of some previously known data, included structural geology, hydrogeology, hydrology and hydrochemistry. Approximate rock mass hydraulic conductivity calculation is also shown, as well as level of its usability in such terrain. Based on all these methods, it is possible to conclude that on the Island of Vis there is no saline water present underneath the entire island. There is only a saline water wedge which is formed on the top of relatively impermeable base rock, some few tens of meters under recent sea level. With such a model, and taking in account the hydrological balance, it is possible to conclude that there is possibility of higher amount of groundwater exploitation then it is today (the paper is published in Croatian.
Mangrove diversity in the Serewe Gulf of Lombok Island West Nusa Tenggara
Irwansah, Sugiyarto, Mahajoeno, Edwi
2017-08-01
Mangrove forests are a valuable economic resource as important breeding grounds and nursery sites for various animal species, stabilizing coastal lands and offering protection against storms, tsunamis, and sea level rise. Mangrove forest growing along the coastline of Serewe Gulf. The Serewe Gulf has great potential in tourism and sea cultivation sector. The research was conducted in the Serewe Gulf of Lombok Island, West Nusa Tenggara for 2 months (November up to December 2016). The objective of this research is to determine the diversity of mangrove in the Serewe Gulf, Lombok Island, West Nusa Tenggara using belt transect method. The identification result shows that there are 9 families with 9 types such as Rhizophoraceae (Rhizophora mucronata), Avicenniaceae (Avicennia officinalis), Sonneratiaceae (Sonneratia alba), Casuarinaceae (Casuarina equisetifolia), Bignoniaceae (Dilochnadrone sthaceae), Malvaceae (Hibiscus tiliaceus), Lythraceae (Pemphis adicula), Aizoaceae (Sesivium portulacastrum), and Euphorbiaceae (Ricinus communis). The diversity of mangrove types in the research area is in medium rate with H' index of 1.668.
International Nuclear Information System (INIS)
Horrocks, M.; Ogden, J.; Nichol, S.L.; Alloway, B.V.; Sutton, D.G.
1999-01-01
Pollen and sediment analysis of two Holocene cores from Awana, Great Barrier Island, shows that at 7000 calibrated yr B.P. the local swamp was an estuarine salt marsh dominated by Restionaceae. By c. 6000 yr B.P. the water table was lower, and a fresh water swamp (Gleichenia-Leptospermum) had replaced the salt marsh. Regional conifer-hardwood forest c. 7000 yr B.P. was initially co-dominated by Libocedrus and Dacrydium cupressinum. Libocedrus declined from c. 6000 yr B.P. During the period c. 6000-c. 2500 yr B.P., relatively stable environmental conditions ensued with little change in local or regional vegetation. Around 2500 yr B.P., the swamp surface became drier and was invaded by Dacrycarpus and Laurelia swamp forest. This forest was subsequently repeatedly disturbed (not by fire), indicating climatic change to drier and windier conditions. Ascarina lucida was periodically a major component of swamp forest. Disturbance is also recorded in the clastic (mineral) sediments, where beds of sand within finer-grained sediment and peat are interpreted as wind blown material derived from partly devegetated dunes to seaward. The presence of the Kaharoa Tephra allows the timing of major Polynesian deforestation at Awana to be reliably dated to c. 600 calibrated yr B.P. In contrast, we see no evidence in the clastic sediment record of disturbance at Awana since Kaharoa time. We attribute this to the maintenance of stable dunes by a herb/scrub cover despite nearby fires, or to the presence of scrub or forest buffering the swamp from ablating dunes. (author). 45 refs., 4 figs., 1 tab
Native Shellfish in Nearshore Ecosystems of Puget Sound
2006-04-01
California Dungeness crabs (Cancer magister). California Fish and Game 63:43-51. Griffin, K. 1997. Commercial oyster cultivation and eelgrass...A.M. 2007. Great Blue Herons in Puget Sound. Puget Sound Nearshore Partnership Report No. 2007-06. Published by Seattle District, U.S. Army Corps of...non-native Pacific oyster, but more than $40 million is from native crabs , clams, and mussels. Recreationally, personal harvest of shellfish is a
Directory of Open Access Journals (Sweden)
Cruce Stark
2009-09-01
Full Text Available In the closing moment of F. Scott Fitzgerald's The Great Gateby, Nick returns for one last look at what once was Gateby's house. But instead of physical buildings, he has a vision of an earlier time, a vision of the "old island" that "flowered once for Dutch sailor's eyes -- a fresh green breast of the new world." "For a transitory enchanted moment," Nick thinks, "man must have held his breath in the presence of this continent, compelled into an aesthetic contemplation he neither understood nor desired, face to face for the last time in history with something commensurate to his capacity for wonder (182." In the closing moment of F. Scott Fitzgerald's The Great Gateby, Nick returns for one last look at what once was Gateby's house. But instead of physical buildings, he has a vision of an earlier time, a vision of the "old island" that "flowered once for Dutch sailor's eyes -- a fresh green breast of the new world." "For a transitory enchanted moment," Nick thinks, "man must have held his breath in the presence of this continent, compelled into an aesthetic contemplation he neither understood nor desired, face to face for the last time in history with something commensurate to his capacity for wonder (182."
Energy Technology Data Exchange (ETDEWEB)
Polido, Alexandra, E-mail: a.polido@campus.fct.unl.pt [CENSE, Center for Environmental and Sustainability Research, Departamento de Ciências e Engenharia do Ambiente, Faculdade de Ciências e Tecnologia, Universidade NOVA de Lisboa, Campus da Caparica, 2829-516 Caparica (Portugal); João, Elsa, E-mail: elsa.joao@strath.ac.uk [Department of Civil and Environmental Engineering, University of Strathclyde, Level 5, James Weir Building, 75 Montrose Street, Glasgow G1 1XJ, Scotland (United Kingdom); Ramos, Tomás B., E-mail: tabr@fct.unl.pt [CENSE, Center for Environmental and Sustainability Research, Departamento de Ciências e Engenharia do Ambiente, Faculdade de Ciências e Tecnologia, Universidade NOVA de Lisboa, Campus da Caparica, 2829-516 Caparica (Portugal)
2016-02-15
The literature concerning Strategic Environmental Assessment (SEA) often refers to the importance of context-specific approaches. However, there is a lack of systematised and consistent studies that enhance tailor-made SEA practices and procedures. Small islands are bounded units of study which may help explore SEA theory and practice in special territories. Small islands present particular features and unique values, such as, small size and population, geographic isolation, limited resources and vulnerable ecosystems. Hence, the main goal of this research was to profile SEA practices and procedures in European small islands and provide a background for future research aiming to improve context-specific SEA applications. To achieve this goal, an exploratory case study was developed using Azores (Portugal) and Orkney (Scotland) archipelagos. An analysis of the corresponding mainland was also carried out to contextualise both case studies. The data collection was achieved through a qualitative content analysis of 43 Environmental Reports. The research found that there is not an SEA context-specific approach used within these European small islands, including guidelines, assessment topics, assessment techniques, follow-up and stakeholders engagement. The debate concerning specific approaches to small islands must be re-focused on the enhancement of SEA capacity-building amongst different stakeholders (including decision-makers), on the development and implementation of collaborative approaches, and on the exchange of knowledge and experiences between small islands networks. - Highlights: • Reviewed the differences between the Portuguese and Scottish SEA system • Showed a low integration of SEA specific features in reports of European small islands • Provides background for future SEA research for small islands approaches.
International Nuclear Information System (INIS)
Polido, Alexandra; João, Elsa; Ramos, Tomás B.
2016-01-01
The literature concerning Strategic Environmental Assessment (SEA) often refers to the importance of context-specific approaches. However, there is a lack of systematised and consistent studies that enhance tailor-made SEA practices and procedures. Small islands are bounded units of study which may help explore SEA theory and practice in special territories. Small islands present particular features and unique values, such as, small size and population, geographic isolation, limited resources and vulnerable ecosystems. Hence, the main goal of this research was to profile SEA practices and procedures in European small islands and provide a background for future research aiming to improve context-specific SEA applications. To achieve this goal, an exploratory case study was developed using Azores (Portugal) and Orkney (Scotland) archipelagos. An analysis of the corresponding mainland was also carried out to contextualise both case studies. The data collection was achieved through a qualitative content analysis of 43 Environmental Reports. The research found that there is not an SEA context-specific approach used within these European small islands, including guidelines, assessment topics, assessment techniques, follow-up and stakeholders engagement. The debate concerning specific approaches to small islands must be re-focused on the enhancement of SEA capacity-building amongst different stakeholders (including decision-makers), on the development and implementation of collaborative approaches, and on the exchange of knowledge and experiences between small islands networks. - Highlights: • Reviewed the differences between the Portuguese and Scottish SEA system • Showed a low integration of SEA specific features in reports of European small islands • Provides background for future SEA research for small islands approaches
Muhs, D.R.; Budahn, J.; Reheis, M.; Beann, J.; Skipp, G.; Fisher, E.
2007-01-01
Islands are natural dust traps, and San Clemente Island, California, is a good example. Soils on marine terraces cut into Miocene andesite on this island are clay-rich Vertisols or Alfisols with vertic properties. These soils are overlain by silt-rich mantles, 5-20 cm thick, that contrast sharply with the underlying clay-rich subsoils. The silt mantles have a mineralogy that is distinct from the island bedrock. Silt mantles are rich in quartz, which is rare in the island andesite. The clay fraction of the silt mantles is dominated by mica, also absent from local andesite, and contrasts with the subsoils, dominated by smectite. Ternary plots of immobile trace elements (Sc-Th-La and Ta-Nd-Cr) show that the island andesite has a composition intermediate between average upper continental crust and average oceanic crust. In contrast, the silt and, to a lesser extent, clay fractions of the silt mantles have compositions closer to average upper continental crust. The silt mantles have particle size distributions similar to loess and Mojave Desert dust, but are coarser than long-range-transported Asian dust. We infer from these observations that the silt mantles are derived from airborne dust from the North American mainland, probably river valleys in the coastal mountains of southern California and/or the Mojave Desert. Although average winds are from the northwest in coastal California, easterly winds occur numerous times of the year when "Santa Ana" conditions prevail, caused by a high-pressure cell centered over the Great Basin. Examination of satellite imagery shows that easterly Santa Ana winds carry abundant dust to the eastern Pacific Ocean and the California Channel Islands. Airborne dust from mainland North America may be an important component of the offshore sediment budget in the easternmost Pacific Ocean, a finding of potential biogeochemical and climatic significance.
Late Quaternary climate change shapes island biodiversity.
Weigelt, Patrick; Steinbauer, Manuel Jonas; Cabral, Juliano Sarmento; Kreft, Holger
2016-04-07
Island biogeographical models consider islands either as geologically static with biodiversity resulting from ecologically neutral immigration-extinction dynamics, or as geologically dynamic with biodiversity resulting from immigration-speciation-extinction dynamics influenced by changes in island characteristics over millions of years. Present climate and spatial arrangement of islands, however, are rather exceptional compared to most of the Late Quaternary, which is characterized by recurrent cooler and drier glacial periods. These climatic oscillations over short geological timescales strongly affected sea levels and caused massive changes in island area, isolation and connectivity, orders of magnitude faster than the geological processes of island formation, subsidence and erosion considered in island theory. Consequences of these oscillations for present biodiversity remain unassessed. Here we analyse the effects of present and Last Glacial Maximum (LGM) island area, isolation, elevation and climate on key components of angiosperm diversity on islands worldwide. We find that post-LGM changes in island characteristics, especially in area, have left a strong imprint on present diversity of endemic species. Specifically, the number and proportion of endemic species today is significantly higher on islands that were larger during the LGM. Native species richness, in turn, is mostly determined by present island characteristics. We conclude that an appreciation of Late Quaternary environmental change is essential to understand patterns of island endemism and its underlying evolutionary dynamics.
Geochemical Investigations In Soils And Waters Of Ischia Island (southern Italy)
Avino, R.; Capaldi, G.; Di Matteo, V.; Pece, R.
The island of Ischia is localized in the Gulf of Naples and is a volcanic field belonging to the volcanic district of the Phlegraean Fields. It covers an area of about 42 Km2 and is characterized by a complex system of faults and fractures of tectonic and volcano- tectonic origin. The highest peak of the island is Mt Epomeo (787 m), situated in the central part of Ischia. The last eruption on this island took place in 1302 (Arso) and from that time the volcanic activity has reduced only to hydrothermal manifestations (fumaroles and thermal springs) localized especially along the faults that border Mt Epomeo. So the area around the Epomeo is an area of great interest for geochemical investigations, and in fact in this place high concentration of mercury, carbon dioxide and radon have been measured. In this work are presented the data of a study on the concentration of CO2 and mercury and of the activity of radon in the soils and in the waters of the island of Ischia. For these investigations 184 samples of soils have been collected and analyzed in laboratory to calculate the concentration of mercury using the Jerome 511 Mercury Vapor Analyzer. In the same sampling sites measurements of CO2 and of the activity of radon-222 in the soils have also been made using the Track- etch@ method. As regards the waters, a sampling of 50 wells localized all around the coast of the island has been carried out. In these waters measures of mercury and of the activity of some radioactive elements have been done. The measures of radioactivity has been carried out by gamma spectrometry with a HPE Ge detector. All the investigations (in soils and in waters) allow to have preliminary information about the concentrations of these investigated elements and will be a starting-point for a more detailed sampling in those place where anomalies have been found. This set of data can also help to better understand the degassing process of these elements through the principal structures of the
Virtually Impossible: Deleuze and Derrida on the Political Problem of Islands (and Island Studies
Directory of Open Access Journals (Sweden)
Stewart Williams
2012-11-01
Full Text Available It is commonplace to think of an island as a discreetly bounded unit. Selected writings on islands by the poststructuralist philosophers Gilles Deleuze and Jacques Derrida reveal the island variously to be both real and imaginary, mythological and scientific, but as most problematic when constituted in political terms as an indivisible, sovereign entity. These two thinkers’ more broadly developed concepts of the virtual and the impossible, respectively, are seen to disrupt any assumptions about the fixity and closure of the island polity. Instead they emphasize its actualization through processual relations that can be difficult yet dynamic and decisive in effecting the move from being to becoming-other. As the possibilities for instituting more ethical as well as different political relations open up, the question of island studies remaining in its currently coherent, familiar form is raised for consideration.
Bamboo Diversity in Sumba Island
Directory of Open Access Journals (Sweden)
KARSONO
2005-04-01
Full Text Available Bamboo is one of the economic plant which grow widely in the villages and have been used by the local people in the villages. Indonesia has about 10% of the world bamboo, 50% among them was endemic to Indonesia. According Widjaja (2001 Lesser Sunda Island which consists of Lombok, Sumbawa, Flores, Timor, Sumba and other small island eastern of Flores has 14 bamboo species, however, the information from the Sumba Island was lacking because of lacking data from this area except one species which was proposed by S. Soenarko in 1977 where the type specimens was collected by Iboet 443 in 1925. To fullfill data from the Sumba Island, an exploration to this area has been conducted on July 2003. The observation was done in West Sumba and East Sumba District, especially in two natioal parks at both districts. According to this inventory study in the Sumba Island, there were 10 bamboo species in Sumba Island, 1 species among them (Dinochloa sp. was a new species which has not been collected before, whereas the other species (Dinochloa kostermansiana has a new addition record from this area. The bamboo species in Sumba Island were Bambusa blumeana, Bambusa vulgaris, Dendocalamus asper, Dinochloa kostermansiana, Dinochloa sp., Gigantochloa atter, Nastus reholtumianus, Phyllostachys aurea, Schisotachyum brachycladum and Schizostachyum lima. From 10 recorded species, the genera Dinochloa and Nastus grow wild in the forest, whereas another species grow widly or cultivated in the garden. Furthermore, the genus Dinochloa was the only genus grow climbing. The endemic species found in Sumba Island was Nastus reholttumianus, whereas Dinochloa kostermansiana was also found in Flores Island.
Occurrence of Somma-Vesuvio fine ashes in the tephrostratigraphic record of Panarea, Aeolian Islands
Donatella, De Rita; Daniela, Dolfi; Corrado, Cimarelli
2008-10-01
Ash-rich tephra layers interbedded in the pyroclastic successions of Panarea island (Aeolian archipelago, Southern Italy) have been analyzed and related to their original volcanic sources. One of these tephra layers is particularly important as it can be correlated by its chemical and morphoscopic characteristics to the explosive activity of Somma-Vesuvio. Correlation with the Pomici di Base eruption, that is considered one of the largest explosive events causing the demolition of the Somma stratovolcano, seems the most probable. The occurrence on Panarea island of fine ashes related to this eruption is of great importance for several reasons: 1) it allows to better constrain the time stratigraphy of the Panarea volcano; 2) it provides a useful tool for tephrochronological studies in southern Italy and finally 3) it allows to improve our knowledge on the distribution of the products of the Pomici di Base eruption giving new insights on the dispersion trajectories of fine ashes from plinian plumes. Other exotic tephra layers interbedded in the Panarea pyroclastic successions have also been found. Chemical and sedimentological characteristics of these layers allow their correlation with local vents from the Aeolian Islands thus constraining the late explosive activity of Panarea dome.
Biological invasions on oceanic islands: Implications for island ecosystems and avifauna
Dean E. Pearson
2009-01-01
Biological invasions present a global threat to biodiversity, but oceanic islands are the systems hardest hit by invasions. Islands are generally depauperate in species richness, trophic complexity, and functional diversity relative to comparable mainland ecosystems. This situation results in low biotic resistance to invasion and many empty niches for invaders to...
Oak restoration trials: Santa Catalina Island
Lisa Stratton
2002-01-01
Two restoration trials involving four oak species have been implemented as part of a larger restoration program for Catalina Island. In 1997 the Catalina Island Conservancy began an active program of restoration after 50 years of ranching and farming activities on the island. The restoration program includes removing feral goats and pigs island-wide and converting 80...
Sargis, Eric J.; Woodman, Neal; Morningstar, Natalie C.; Reese, Aspen T.; Olson, Link E.
2014-01-01
The Mentawai and Batu Island groups off the west coast of Sumatra have a complicated geological and biogeographical history. The Batu Islands have shared a connection with the Sumatran ‘mainland’ during periods of lowered sea level, whereas the Mentawai Islands, despite being a similar distance from Sumatra, have remained isolated from Sumatra, and probably from the Batu Islands as well. These contrasting historical relationships to Sumatra have influenced the compositions of the respective mammalian faunas of these island groups. Treeshrews (Scandentia, Tupaiidae) from these islands have, at various times in their history, been recognized as geographically circumscribed populations of a broadly distributed Tupaia glis, subspecies, or distinct species. We used multivariate analyses of measurements from the skull and hands to compare the island populations from Siberut (Mentawai Islands) and Tanahbala (Batu Islands) with the geographically adjacent species from the southern Mentawai Islands (T. chrysogaster) and Sumatra (T. ferruginea). Results from both the skull and manus of the Siberut population show that it is most similar to T. chrysogaster, whereas the Tanahbala population is more similar to T. ferruginea, confirming predictions based on island history. These results are further corroborated by mammae counts. Based on these lines of evidence, we include the Siberut population in T. chrysogaster and the Tanahbala population in T. ferruginea. Our conclusions expand the known distributions of both the Mentawai and Sumatran species. The larger geographical range of the endangered T. chrysogaster has conservation implications for this Mentawai endemic, so populations and habitat should be re-evaluated on each of the islands it inhabits. However, until such a re-evaluation is conducted, we recommend that the IUCN Red List status of this species be changed from ‘Endangered’ to ‘Data Deficient’.
Control of malaria in the Comoro Islands over the past century.
Chakir, Ismaël; Said, Ali Ibrahim; Affane, Bacar; Jambou, Ronan
2017-09-26
The Comoros are an archipelago located in the Indian Ocean between the eastern coasts of Africa and north of Madagascar. Malaria transmission appeared late in the 19th century due to the intensification of human migration. The story of malaria transmission for the past century is depicted to provide useful lessons for the future. Currently, malaria transmission occurs differently on each island; thus, control strategies must be adapted for each particular island. Tentative malaria control in Comoros has a long history of success and failure. This study reviews the data available as a basis for recommendations for the future. There has been much effort to reach a pre-eradication state in Anjouan and Moheli, but only control steps have been taken in the Great Comoro. To date, the primary strategy used is mass treatment of the population using artemisinin-based combination therapy (ACT), which is similar to the strategy deployed during the 1950s in other countries. ACT appears efficient in two of the three islands; however, the sustainability of the strategy is unknown. This sustainability is compromised by (i) the huge level of uncontrolled exchange between the Comoro Islands and their neighbours, increasing the risk of introducing ACT-resistant strains, (ii) the use of large quantities of pesticides for agriculture usually associated with the resistance of mosquitoes, and (iii) the cost of the actions themselves. In view of the history of malaria in this area, the first recommendation is to enhance the training of health workers and the population. The second step is to establish a national strategy to assess malaria and related factors, which is currently lacking. A survey to assess the drug sensitivity of the parasites is particularly important in a context of low transmission associated with mass treatment of the population. The last point should be to secure financial support, which is not obvious in a context of pre-elimination. The Comoro Islands are thus a
Islanded operation of distributed networks
Energy Technology Data Exchange (ETDEWEB)
NONE
2005-07-01
This report summarises the findings of a study to investigate the regulatory, commercial and technical risks and benefits associated with the operation of distributed generation to power an islanded section of distributed network. A review of published literature was carried out, and UK generators were identified who could operate as part of an island network under the existing technical, regulatory, and safety framework. Agreement on case studies for consideration with distributed network operators (DNOs) is discussed as well as the quantification of the risks, benefits and costs of islanding, and the production of a case implementation plan for each case study. Technical issues associated with operating sections of network in islanded mode are described, and impacts of islanding on trading and settlement, and technical and commercial modelling are explored.
Islanded operation of distributed networks
International Nuclear Information System (INIS)
2005-01-01
This report summarises the findings of a study to investigate the regulatory, commercial and technical risks and benefits associated with the operation of distributed generation to power an islanded section of distributed network. A review of published literature was carried out, and UK generators were identified who could operate as part of an island network under the existing technical, regulatory, and safety framework. Agreement on case studies for consideration with distributed network operators (DNOs) is discussed as well as the quantification of the risks, benefits and costs of islanding, and the production of a case implementation plan for each case study. Technical issues associated with operating sections of network in islanded mode are described, and impacts of islanding on trading and settlement, and technical and commercial modelling are explored
Oberle, Ferdinand K. J.; Swarzenski, Peter W.; Storlazzi, Curt
2017-04-01
Atoll islands, most of which only average 1-2 meters above today's sea level, provide a tremendous natural laboratory in which to study and better understand the intensifying impacts of high rates of sea-level rise on tropical reef-lined islands globally due to their unique geologic structure and limited water supply. Groundwater resources of atolls are typically minimal due to the low elevation and small surface area of the islands and are also subject to recurring droughts, and more frequent, storm-driven seawater overwash events. Although groundwater is the principal means of freshwater storage on atoll islands and is a major factor in determining the overall sustainability of island communities, hydrological data on how an aquifer will response to changes in sea-level rise or storm-driven overwash remain limited. We here present high-resolution time series hydrogeological and geochemical data to determine the role of the atoll's carbonate geology, land use, and atmospheric and oceanographic forcing in driving coastal groundwater exchange on the island of Roi Namur on Kwajalein Atoll in the Republic of the Marshall Islands. This information can provide new estimates on the recovery and resilience of coastal groundwater resources on such islands to expected climate change-driven perturbations.
The coastline remote sensing survey for Zhao Shu Island in Xisha Islands based on WorldView-2
Li, Li; Zhong, Chang; Kong, Fanping
2014-11-01
Due to diastrophism, tide action and human activities, the coastline is always in flux. There are lots of coral islands in the south sea of China. Remote sensing survey for the coastline not only can reassert the necessity and importance of coral protection, but also can provide basic data and scientific basis for island ecologic protection, reasonable utilization of land resources. The study area named Zhao Shu Island lies in Jintong Islands of Xisha. It is a coral island which has people inhabited. Using WorldView-2 satellite remote sensing images as data sources we carry out three phases of coastline investigation and monitoring. The satellite data phases are 2002, 2010 and 2013. Firstly, affirm the bands valuable for color composition on the basis of spectral and correlation analysis. Then extract the coastline by a series of image process, such as image correction, fusion, waterline extraction and coastline revision. Finally determine the coastline types and length by artificial interpretation. The results show that the island length is gradually smaller, which means the island area is reducing. The beach bedrock coast in northern island was eroded seriously especially during the period between 2010 and 2013. In addition, the shoal head shape in the western island changed a lot.
Concentration ratios to great cormorant (Phalacrocorax carbo) at Olkiluoto repository site
Energy Technology Data Exchange (ETDEWEB)
Kangasniemi, Ville; Ikonen, Ari T.K. [Environmental Research and Assessment EnviroCase, Ltd., Hallituskatu 1 D 4, 28100 Pori (Finland); Haavisto, Fiia [FM Meri and Erae Oy, Seijaistentie 133a, 21230 Lemu (Finland); Salmi, Juhani A. [Finnish Game and Fisheries Research Institute, Itaeinen Pitkaekatu 3, 20520 Turku (Finland)
2014-07-01
Olkiluoto Island on the western coast of Finland has been selected as a repository site for spent nuclear fuel disposal. The great cormorant was a common species in the Finnish coastal area and possibly also a resource for human uses before the decline of the cormorant population in the 18. century. During the last decade, the great cormorant has become again a relevant part of food web in the Bothnian Sea coastal area. Due to the regulatory requirements, the biosphere assessment demonstrating the long-term safety of the repository is developed into more and more site specific. As the adequate literature data on common waterfowl is sparse or in some cases lacking, samples of adult cormorants, eggs and guano together with water and fish samples were collected from the Olkiluoto coastal area. This contribution will present concentration ratios of stable element based on these samples with focus on the elements of a high relevance to the biosphere assessment of the Olkiluoto spent fuel repository together with discussion on the role of food (fish) versus the application of the water-to-bird concentration ratio. (authors)
Late Quaternary climate change shapes island biodiversity
DEFF Research Database (Denmark)
Weigelt, Patrick; Steinbauer, Manuel; Cabral, Juliano
2016-01-01
Island biogeographical models consider islands either as geologically static with biodiversity resulting from ecologically neutral immigration–extinction dynamics1, or as geologically dynamic with biodiversity resulting from immigration–speciation–extinction dynamics influenced by changes in island...... sea levels3, 4 and caused massive changes in island area, isolation and connectivity5, orders of magnitude faster than the geological processes of island formation, subsidence and erosion considered in island theory2, 6. Consequences of these oscillations for present biodiversity remain unassessed5, 7...
Autumn monitoring of resident avifauna on Guana Island, British Virgin Islands
C.W. Boal; J.M. Wunderle Jr.; W.J. Arendt
2013-01-01
Although the Caribbean region is considered a biodiversity hotspot and a priority for ecological conservation efforts, little information exists on population trends of West Indian landbirds. We combined avian survey data collected from three studies spanning a 16-year period on a small island with a minimal human presence in the British Virgin Islands. Although...
The pacific island health care project.
Person, Donald Ames
2014-01-01
US Associated/Affiliated Pacific Islands (USAPI) include three freely associated states: Marshall Islands, Federated States of Micronesia, Palau, and three Territories: American Samoa, Guam, and Commonwealth of the Northern Mariana Islands. The Pacific Island Health Care Project (PIHCP) provides humanitarian medical referral/consultation/care to >500,000 indigenous people of these remote islands. In the mid-1990s, we developed a simple store-and-forward program to link the USAPI with Tripler Army Medical Center. This application allowed image attachment to email consultations. More than 8000 Pacific Islanders have benefited from the program. Three thousand Pacific Islanders prior to telemedicine (1990-1997) and since store-and-forward telemedicine (1997-present), the PIHCP has helped an additional 5000. Records post dynamically and are stored in an archival database. The PIHCP is the longest running telemedicine program in the world delivering humanitarian medical care. It has bridged the Developing World of the remote Pacific Islands with advanced medical and surgical care available at a major US military teaching hospital. (The opinions expressed here are those of the author and not that of the Army, Department of Defense, or the US Government.).
The Pacific Island Health Care Project
Directory of Open Access Journals (Sweden)
Donald Ames Person
2014-10-01
Full Text Available Introduction/BackgroundUS Associated/Affiliated Pacific Islands (USAPI include 3 Freely Associated States: Marshall Islands, Federated States of Micronesia, Palau and 3 Territories: American Samoa, Guam, and Commonwealth of the Northern Mariana Islands. ObjectiveThe Pacific Island Health Care Project (PIHCP provides humanitarian medical referral/consultation/care to >500,000 indigenous people of these remote islands. Methods In the mid-1990s, we developed a simple store-and-forward program to link the USAPI with Tripler Army Medical Center (TAMC. This application allowed image attachment to email consultations. ResultsMore than 8000 Pacific Islanders have benefited from the program. 3000 Pacific Islanders prior to telemedicine (1990-1997 and since store-and-forward telemedicine (1997-present, the PIHCP has helped an additional 5000. Records post dynamically and are stored in an archival database. Conclusion The PIHCP is the longest running telemedicine program in the world delivering humanitarian medical care. It has bridged the Developing World of the remote Pacific islands with advanced medical and surgical care available at a major US military teaching hospital.(The opinions expressed here are those of the author and not that of the Army, Department of Defense, or the US Government.
Yucel, M.; Sueishi, T.; Inagaki, A.; Kanda, M.
2017-12-01
`Great Garuda' project is an eagle-shaped offshore structure with 17 artificial islands. This project has been designed for the coastal protection and land reclamation of Jakarta due to catastrophic flooding in the city. It offers an urban generation for 300.000 inhabitants and 600.000 workers in addition to its water safety goal. A broad coalition of Indonesian scientists has criticized the project for being negative impacts on the surrounding environment. Despite the vast research by Indonesian scientist on maritime environment, studies on wind and thermal environment over built-up area are still lacking. However, the construction of the various islands off the coast may result changes in wind patterns and thermal environment due to the alteration of the coastline and urbanization in the Jakarta Bay. Therefore, it is important to understand the airflow within the urban canopy in case of unpredictable gust events. These gust events may occur through the closely-packed high-rise buildings and pedestrians may be harmed from such gusts. Accordingly, we used numerical simulations to investigate the impact of the sea wall and the artificial islands over built-up area and, the intensity of wind gusts at the pedestrian level. Considering the fact that the size of turbulence organized structure sufficiently large computational domain is required. Therefore, a 19.2km×4.8km×1.0 km simulation domain with 2-m resolution in all directions was created to explicitly resolve the detailed shapes of buildings and the flow at the pedestrian level. This complex computation was accomplished by implementing a large-eddy simulation (LES) model. Two case studies were conducted considering the effect of realistic surface roughness and upward heat flux. Case_1 was conducted based on the current built environment and Case_2 for investigating the effect of the project on the chosen coastal region of the city. Fig.1 illustrates the schematic of the large-eddy simulation domains of two cases
Directory of Open Access Journals (Sweden)
Lucas J. Siegfried
2014-12-01
Full Text Available doi: http://dx.doi.org/10.15447/sfews.2014v12iss4art2Water use estimation is central to managing most water problems. To better understand water use in California’s Sacramento–San Joaquin Delta, a collaborative, integrated approach was used to predict Delta island diversion, consumption, and return of water on a more detailed temporal and spatial resolution. Fabian Tract and Staten Island were selected for this pilot study based on available data and island accessibility. Historical diversion and return location data, water rights claims, LiDAR digital elevation model data, and Google Earth were used to predict island diversion and return locations, which were tested and improved through ground-truthing. Soil and land-use characteristics as well as weather data were incorporated with the Integrated Water Flow Model Demand Calculator to estimate water use and runoff returns from input agricultural lands. For modeling, the islands were divided into grid cells forming subregions, representing fields, levees, ditches, and roads. The subregions were joined hydrographically to form diversion and return watersheds related to return and diversion locations. Diversions and returns were limited by physical capacities. Differences between initial model and measured results point to the importance of seepage into deeply subsided islands. The capabilities of the models presented far exceeded current knowledge of agricultural practices within the Delta, demonstrating the need for more data collection to enable improvements upon current Delta Island Consumptive Use estimates.
International Nuclear Information System (INIS)
Lodding, L.
2006-01-01
Monaco's Prince Albert II followed the footsteps of his great great grandfather when he ventured to the Arctic Archipelago to track climate change, this time with IAEA Marine scientists. He undertook this trip to draw global attention to the environmental damage to the Arctic regions caused by global warming. Although far away from industrialized areas, Svalbard Island is eminently suitable to observe the evolution of climate change and long-range pollutants transported from northern European countries by water currents and from North America by winds. Using nuclear techniques, it is hoped that some of the causes of climate change can be unlocked. The first of these studies was undertaken to evaluate the shell laminations of a very long-lived marine bivalve mollusc, the Ocean Quahog. The mollusc, with a life expectancy well over a century, acts as a recording of temperature variations and water chemistry. The second project aimed at determining levels of contaminates in marine zooplankton in remote arctic environments for comparison with other climatic regions
The Great Whale review and the federal government's disappearing act
International Nuclear Information System (INIS)
Fenge, T.
1991-01-01
After considerable political and legal pressure, the Canadian and Quebec governments, plus the electric utility Hydro-Quebec, agreed to a global review and environmental assessment of the Great Whale hydroelectric project in northern Quebec. The assessment is being handled by five committees, each covering distinct areas of geography and responsibility. The initial task of the review committees was to determine the scope of the assessment, and 23 days of public hearings were held in northern and southern Quebec and on the Belcher Islands. The federal government's absence from the scoping hearings was a curious development, since federal agencies normally participate actively in such hearings. A federal guidelines order upheld recently by the Canadian Supreme Court requires federal participation in environmental assessment processes. The Great Whale project affects areas of federal jurisdiction as well as areas outside Quebec, and federal expertise in such matters as the marine environment is crucial in airing environmental issues related to the project. Interviews with federal officials on the reasons for federal absence are summarized. It is concluded that the federal agencies did not really regard scoping hearings as part of the public review, and that this review does not start until hearings begin on the environmental impact statement
Dunn, Michael J; Jackson, Jennifer A; Adlard, Stacey; Lynnes, Amanda S; Briggs, Dirk R; Fox, Derren; Waluda, Claire M
2016-01-01
We report long-term changes in population size of three species of sympatrically breeding pygoscelid penguins: Adélie (Pygoscelis adeliae), chinstrap (Pygoscelis antarctica) and gentoo (Pygoscelis papua ellsworthii) over a 38 year period at Signy Island, South Orkney Islands, based on annual counts from selected colonies and decadal all-island systematic counts of occupied nests. Comparing total numbers of breeding pairs over the whole island from 1978/79 to 2015/16 revealed varying fortunes: gentoo penguin pairs increased by 255%, (3.5% per annum), chinstrap penguins declined by 68% (-3.6% per annum) and Adélie penguins declined by 42% (-1.5% per annum). The chinstrap population has declined steadily over the last four decades. In contrast, Adélie and gentoo penguins have experienced phases of population increase and decline. Annual surveys of selected chinstrap and Adélie colonies produced similar trends from those revealed by island-wide surveys, allowing total island population trends to be inferred relatively well. However, while the annual colony counts of chinstrap and Adélie penguins showed a trend consistent in direction with the results from all-island surveys, the magnitude of estimated population change was markedly different between colony wide and all island counts. Annual population patterns suggest that pair numbers in the study areas partly reflect immigration and emigration of nesting birds between different parts of the island. Breeding success for all three species remained broadly stable over time in the annually monitored colonies. Breeding success rates in gentoo and chinstrap penguins were strongly correlated, despite the differing trends in population size. This study shows the importance of effective, standardised monitoring to accurately determine long-term population trajectories. Our results indicate significant declines in the Adélie and chinstrap penguin populations at Signy Island over the last five decades, and a gradual
DEFF Research Database (Denmark)
Patino, Jairo; Whittaker, Robert J.; Borges, Paulo A.V.
2017-01-01
Aims: The 50th anniversary of the publication of the seminal book, The Theory of Island Biogeography, by Robert H. MacArthur and Edward O. Wilson, is a timely moment to review and identify key research foci that could advance island biology. Here, we take a collaborative horizon-scanning approach...... to identify 50 fundamental questions for the continued development of the field. Location: Worldwide. Methods: We adapted a well-established methodology of horizon scanning to identify priority research questions in island biology, and initiated it during the Island Biology 2016 conference held in the Azores......); global change (5); conservation and management policies (5); and invasive alien species (4). Main conclusions: Collectively, this cross-disciplinary set of topics covering the 50 fundamental questions has the potential to stimulate and guide future research in island biology. By covering fields ranging...
Pediatrics in the Marshall Islands
International Nuclear Information System (INIS)
Dungy, C.I.; Morgan, B.C.; Adams, W.H.
1984-01-01
The delivery of health care to children living on isolated island communities presents unique challenges to health professionals. An evolved method of providing longitudinal services to infants and children residing on islands of the Marshall Island chain - a central Pacific portion of the Micronesian archipelago - is presented. The difficulties associated with provision of comprehensive health care in a vast ocean area are discussed
Directory of Open Access Journals (Sweden)
Mario Fernández-Mazuecos
Full Text Available BACKGROUND: Population genetic theory holds that oceanic island populations are expected to have lower levels of genetic variation than their mainland counterparts, due to founder effect after island colonization from the continent. Cistus monspeliensis (Cistaceae is distributed in both the Canary Islands and the Mediterranean region. Numerous phylogenetic results obtained in the last years allow performing further phylogeographic analyses in Cistus. METHODOLOGY/PRINCIPAL FINDINGS: We analyzed sequences from multiple plastid DNA regions in 47 populations of Cistus monspeliensis from the Canary Islands (21 populations and the Mediterranean basin (26 populations. The time-calibrated phylogeny and phylogeographic analyses yielded the following results: (1 a single, ancestral haplotype is distributed across the Mediterranean, whereas 10 haplotypes in the Canary Islands; (2 four haplotype lineages are present in the Canarian Islands; (3 multiple colonization events across the archipelago are inferred; (4 the earliest split of intraspecific lineages occurred in the Early to Middle Pleistocene (<930,000 years BP. CONCLUSIONS/SIGNIFICANCE: The contrasting pattern of cpDNA variation is best explained by genetic bottlenecks in the Mediterranean during Quaternary glaciations, while the Canarian archipelago acted as a refugium of high levels of genetic diversity. Active colonization across the Canarian islands is supported not only by the distribution of C. monspeliensis in five of the seven islands, but also by our phylogeographic reconstruction in which unrelated haplotypes are present on the same island. Widespread distribution of thermophilous habitats on every island, as those found throughout the Mediterranean, has likely been responsible for the successful colonization of C. monspeliensis, despite the absence of a long-distance dispersal mechanism. This is the first example of a plant species with higher genetic variation among oceanic island
Issues and Tensions in Island Heritage Management: A Case Study of Motuihe Island, New Zealand
Directory of Open Access Journals (Sweden)
David Bade
2010-05-01
Full Text Available This paper draws on a New Zealand case study, Motuihe Island, to examine the challenges of conserving cultural heritage in places renowned for natural heritage values. In keeping with the broader trend toward the ecological restoration of islands close to Auckland, Motuihe Island is undergoing conversion into an ecosystem of native flora and fauna. Issues and tensions relating to the management of natural and cultural heritage will be discussed and influencing aspects investigated: the nature/culture dualism, the effect of New Zealand’s history and identity, and the influence of islandness on heritage management.
DEFF Research Database (Denmark)
Chen, Yu
, the feasibility of the application of Artificial Neural Network (ANN) to ICA is studied, in order to improve the computation efficiency for ISR calculation. Finally, the integration of ICA into Dynamic Security Assessment (DSA), the ICA implementation, and the development of ICA are discussed....... to utilize them for maintaining the security of the power supply under the emergency situations, has been of great interest for study. One proposal is the intentional island operation. This PhD project is intended to develop a control architecture for the island operation in distribution system with high...... amount of DGs. As part of the NextGen project, this project focuses on the system modeling and simulation regarding the control architecture and recommends the development of a communication and information exchange system based on IEC 61850. This thesis starts with the background of this PhD project...
Fellers, Gary M.; Drost, Charles A.; Murphey, Thomas G.
2008-01-01
More than 900 individually marked island night lizards (Xantusia riversiana) were captured on San Nicolas Island, California, between 1984 and 2007 as part of an ongoing study to monitor the status of this threatened species. Our data suggest that at least a few lizards are probably more than 20 years old, and one lizard would be 31.5 years old if it grew at an average rate for the population. Ages of 20 and 30 years seem reasonable given the remarkably slow growth during capture intervals of more than a decade for five of the lizards which we estimated to be 20 or more years old. Like other lizards, island night lizard growth rates vary by size, with larger lizards growing more slowly. In general, growth rates were somewhat greater on San Nicolas Island (compared with Santa Barbara Island), and this increase was sustained through all of the intermediate size classes. The higher growth rate may account for the somewhat larger lizards present on San Nicolas Island, although we cannot discount the possibility that night lizards on San Nicolas are merely living longer. The high percentage of small lizards in the Eucalyptus habitat might seem to reflect a healthy population in that habitat, but the high proportion of small lizards appears to be caused by good reproduction in the 1900s and substantially poorer reproduction in subsequent years. The Eucalyptus habitat has dried quite a bit in recent years. Night lizards in the Haplopappus/Grassland habitat have shown an increase in the proportion of larger lizards since 2000. There has also been an increase in the proportion of large lizards in the Rock Cobble habitat at Redeye Beach. However, there are has been some change in habitat with more elephant seals occupying the same area just above the high tide as do the night lizards. Southern alligator lizards and side-blotched lizards are both non-native on San Nicolas Island. Neither lizard causes obvious harm to island night lizards, and management time and effort should
A Novel Method to Predict Genomic Islands Based on Mean Shift Clustering Algorithm.
Directory of Open Access Journals (Sweden)
Daniel M de Brito
Full Text Available Genomic Islands (GIs are regions of bacterial genomes that are acquired from other organisms by the phenomenon of horizontal transfer. These regions are often responsible for many important acquired adaptations of the bacteria, with great impact on their evolution and behavior. Nevertheless, these adaptations are usually associated with pathogenicity, antibiotic resistance, degradation and metabolism. Identification of such regions is of medical and industrial interest. For this reason, different approaches for genomic islands prediction have been proposed. However, none of them are capable of predicting precisely the complete repertory of GIs in a genome. The difficulties arise due to the changes in performance of different algorithms in the face of the variety of nucleotide distribution in different species. In this paper, we present a novel method to predict GIs that is built upon mean shift clustering algorithm. It does not require any information regarding the number of clusters, and the bandwidth parameter is automatically calculated based on a heuristic approach. The method was implemented in a new user-friendly tool named MSGIP--Mean Shift Genomic Island Predictor. Genomes of bacteria with GIs discussed in other papers were used to evaluate the proposed method. The application of this tool revealed the same GIs predicted by other methods and also different novel unpredicted islands. A detailed investigation of the different features related to typical GI elements inserted in these new regions confirmed its effectiveness. Stand-alone and user-friendly versions for this new methodology are available at http://msgip.integrativebioinformatics.me.
Bonin, Mary C.; Harrison, Hugo B.; Williamson, David H.; Frisch, Ashley J.; Saenz Agudelo, Pablo; Berumen, Michael L.; Jones, Geoffrey P.
2015-01-01
The development of parentage analysis to track the dispersal of juvenile offspring has given us unprecedented insight into the population dynamics of coral reef fishes. These tools now have the potential to inform fisheries management and species conservation, particularly for small fragmented populations under threat from exploitation and disturbance. In this study we resolve patterns of larval dispersal for a population of the anemonefish Amphiprion melanopus in the Keppel Islands (southern Great Barrier Reef). Habitat loss and fishing appear to have impacted this population and a network of no-take marine reserves currently protects 75% of the potential breeders. Using parentage analysis, we estimate that 21% of recruitment in the island group was generated locally, and that breeding adults living in reserves were responsible for 79% (31 out of 39) of these of locally-produced juveniles. Overall, the network of reserves was fully connected via larval dispersal; however one reserve was identified as a critical source of larvae for the island group. The population in the Keppel Islands also appears to be well-connected to other source populations at least 60 km away, given that 79% (145 out of 184) of the juveniles sampled remained unassigned in the parentage analysis. We estimated the effective size of the A. melanopus metapopulation to be 745 (582-993 95% CI) and recommend continued monitoring of its genetic status. Maintaining connectivity with populations beyond the Keppel Islands and recovery of local recruitment habitat, potentially through active restoration of host anemone populations, will be important for its long-term persistence.
Bonin, Mary C.
2015-11-21
The development of parentage analysis to track the dispersal of juvenile offspring has given us unprecedented insight into the population dynamics of coral reef fishes. These tools now have the potential to inform fisheries management and species conservation, particularly for small fragmented populations under threat from exploitation and disturbance. In this study we resolve patterns of larval dispersal for a population of the anemonefish Amphiprion melanopus in the Keppel Islands (southern Great Barrier Reef). Habitat loss and fishing appear to have impacted this population and a network of no-take marine reserves currently protects 75% of the potential breeders. Using parentage analysis, we estimate that 21% of recruitment in the island group was generated locally, and that breeding adults living in reserves were responsible for 79% (31 out of 39) of these of locally-produced juveniles. Overall, the network of reserves was fully connected via larval dispersal; however one reserve was identified as a critical source of larvae for the island group. The population in the Keppel Islands also appears to be well-connected to other source populations at least 60 km away, given that 79% (145 out of 184) of the juveniles sampled remained unassigned in the parentage analysis. We estimated the effective size of the A. melanopus metapopulation to be 745 (582-993 95% CI) and recommend continued monitoring of its genetic status. Maintaining connectivity with populations beyond the Keppel Islands and recovery of local recruitment habitat, potentially through active restoration of host anemone populations, will be important for its long-term persistence.
Directory of Open Access Journals (Sweden)
Fery Kurniawan
2016-04-01
Full Text Available The Indonesian government is currently directing its focus of development on the optimum uses of marine and coastal ecosystem services including the marine and coastal tourism. One of the main locus of coastal and marine tourism is the small islands tourism such as Gili Matra Islands among others. Small islands tourism is one of the favourite touristic activities because the destination provides beauty, exotism, aesthetic and a diversity of natural habitats including the warm, clear and attractive water. Tourism is being considered as a development instrument in order to boost a country’s economy and has become part of the global industry. However, tourism is also one of the actors that is responsible for environmental depletion, due to the constructions of buildings and tourism activities. This paper aims to study the level of vulnerability in small islands to tourism as a basis of integrated small islands management in Indonesian conservation area. The group of islands in this study consists of three islands namely Gili Ayer Island, Gili Meno Island and Gili Trawangan Island (known as Gili Matra Islands that were observed using Small Islands Vulnerability Index (SIVI. The results indicate that Gili Matra Islands have a vulnerability status from low into moderate, ranging from 2.25 to 2.75. Gili Ayer Island has the highest vulnerability with SIVI of 2.75 (Moderate, followed by Gili Meno Island with SIVI of 2.50 (Low and Gili Trawangan Island with SIVI of 2.25 (Low. The driving factor of vulnerability is the intensive utilization of marine tourism activities. Tourism is the sole stress to Gili Matra Island’s ecosystem due to its direct damaging impact and reducing its environmental quality. The vulnerability index which was built from the coastline, coral reef, live coral reef, and development area was applicable to assess the small island’s vulnerability in Indonesia, especially for coral island.
Dendrochronology of Strain-Relaxed Islands
International Nuclear Information System (INIS)
Merdzhanova, T.; Kiravittaya, S.; Rastelli, A.; Stoffel, M.; Denker, U.; Schmidt, O.G.
2006-01-01
We report on the observation and study of tree-ring structures below dislocated SiGe islands (superdomes) grown on Si(001) substrates. Analogous to the study of tree rings (dendrochronology), these footprints enable us to gain unambiguous information on the growth and evolution of superdomes and their neighboring islands. The temperature dependence of the critical volume for dislocation introduction is measured and related to the composition of the islands. We show clearly that island coalescence is the dominant pathway towards dislocation nucleation at low temperatures, while at higher temperatures anomalous coarsening is effective and leads to the formation of a depletion region around superdomes
Dendrochronology of strain-relaxed islands.
Merdzhanova, T; Kiravittaya, S; Rastelli, A; Stoffel, M; Denker, U; Schmidt, O G
2006-06-09
We report on the observation and study of tree-ring structures below dislocated SiGe islands (superdomes) grown on Si(001) substrates. Analogous to the study of tree rings (dendrochronology), these footprints enable us to gain unambiguous information on the growth and evolution of superdomes and their neighboring islands. The temperature dependence of the critical volume for dislocation introduction is measured and related to the composition of the islands. We show clearly that island coalescence is the dominant pathway towards dislocation nucleation at low temperatures, while at higher temperatures anomalous coarsening is effective and leads to the formation of a depletion region around superdomes.
The Limacidae of the Canary Islands
Regteren Altena, van C.O.
1950-01-01
CONTENTS Introduction............... 3 Systematic survey of the Limacidae of the central and western Canary Islands 5 Biogeographical notes on the Limacidae of the Canary Islands . . . . 21 Alphabetical list of the persons who collected or observed Limacidae in the Canary Islands.............. 31
International Nuclear Information System (INIS)
Mueller, Peter
2010-01-01
We discuss the great theoretical insights on nuclear stability that emerged in the late 1960s, especially the realization that observable nuclei might include a superheavy island 20+ protons beyond uranium with 92 protons. However, we now realize that the early models were not sufficiently quantitative to yield definite conclusions. Further groundwork for such models was laid in the 1970s. Around 1980 more quantitative, global and universal models appeared and together with experimental advances the mapping of the superheavy island, or as it turns out now, continent started in earnest. We review these early developments and conclude with some examples of our current insights. In particular, 1) some theoretical models do have predictive capabilities for nuclear properties such as ground-state masses, shapes, and half-lives 10 or more neutrons and protons away from previously known regions and 2) the superheavy island may be a continent connected to the actinides by a narrow land bridge; the continent itself may extend from about proton number Z = 110 to Z = 120 or slightly beyond. (author)
Genomic island excisions in Bordetella petrii
Directory of Open Access Journals (Sweden)
Levillain Erwan
2009-07-01
Full Text Available Abstract Background Among the members of the genus Bordetella B. petrii is unique, since it is the only species isolated from the environment, while the pathogenic Bordetellae are obligately associated with host organisms. Another feature distinguishing B. petrii from the other sequenced Bordetellae is the presence of a large number of mobile genetic elements including several large genomic regions with typical characteristics of genomic islands collectively known as integrative and conjugative elements (ICEs. These elements mainly encode accessory metabolic factors enabling this bacterium to grow on a large repertoire of aromatic compounds. Results During in vitro culture of Bordetella petrii colony variants appear frequently. We show that this variability can be attributed to the presence of a large number of metastable mobile genetic elements on its chromosome. In fact, the genome sequence of B. petrii revealed the presence of at least seven large genomic islands mostly encoding accessory metabolic functions involved in the degradation of aromatic compounds and detoxification of heavy metals. Four of these islands (termed GI1 to GI3 and GI6 are highly related to ICEclc of Pseudomonas knackmussii sp. strain B13. Here we present first data about the molecular characterization of these islands. We defined the exact borders of each island and we show that during standard culture of the bacteria these islands get excised from the chromosome. For all but one of these islands (GI5 we could detect circular intermediates. For the clc-like elements GI1 to GI3 of B. petrii we provide evidence that tandem insertion of these islands which all encode highly related integrases and attachment sites may also lead to incorporation of genomic DNA which originally was not part of the island and to the formation of huge composite islands. By integration of a tetracycline resistance cassette into GI3 we found this island to be rather unstable and to be lost from
CRED Gridded Bathymetry of Necker Island (100-021) in the Northwestern Hawaiian Islands
National Oceanic and Atmospheric Administration, Department of Commerce — File 100-021b is a 60-m ASCII grid of depth data collected near Necker Island in the Northwestern Hawaiian Islands as of May 2003. This grid has been produced as...
The geology of the Falkland Islands
Aldiss, D.T.; Edwards, E.J.
1999-01-01
This report is complementary to the 1:250 000 scale geological map of the Falkland Islands compiled in 1998. The report and map are products of the Falkland Islands Geological Mapping Project (1996-1998). Geological observation and research in the Islands date from 1764. The Islands were visited during two pioneering scientific cruises in the 19th century. Subsequently, many scientists visited en route to the Antarctic or Patagonia. Geological affinities to other parts of the sout...
The Solomon Islands tsunami of 6 February 2013 field survey in the Santa Cruz Islands
Fritz, H. M.; Papantoniou, A.; Biukoto, L.; Albert, G.
2013-12-01
On February 6, 2013 at 01:12:27 UTC (local time: UTC+11), a magnitude Mw 8.0 earthquake occurred 70 km to the west of Ndendo Island (Santa Cruz Island) in the Solomon Islands. The under-thrusting earthquake near a 90° bend, where the Australian plate subducts beneath the Pacific plate generated a locally focused tsunami in the Coral Sea and the South Pacific Ocean. The tsunami claimed the lives of 10 people and injured 15, destroyed 588 houses and partially damaged 478 houses, affecting 4,509 people in 1,066 households corresponding to an estimated 37% of the population of Santa Cruz Island. A multi-disciplinary international tsunami survey team (ITST) was deployed within days of the event to document flow depths, runup heights, inundation distances, sediment and coral boulder depositions, land level changes, damage patterns at various scales, performance of the man-made infrastructure and impact on the natural environment. The 19 to 23 February 2013 ITST covered 30 locations on 4 Islands: Ndendo (Santa Cruz), Tomotu Noi (Lord Howe), Nea Tomotu (Trevanion, Malo) and Tinakula. The reconnaissance completely circling Ndendo and Tinakula logged 240 km by small boat and additionally covered 20 km of Ndendo's hard hit western coastline by vehicle. The collected survey data includes more than 80 tsunami runup and flow depth measurements. The tsunami impact peaked at Manoputi on Ndendo's densely populated west coast with maximum tsunami height exceeding 11 m and local flow depths above ground exceeding 7 m. A fast tide-like positive amplitude of 1 m was recorded at Lata wharf inside Graciosa Bay on Ndendo Island and misleadingly reported in the media as representative tsunami height. The stark contrast between the field observations on exposed coastlines and the Lata tide gauge recording highlights the importance of rapid tsunami reconnaissance surveys. Inundation distance and damage more than 500 m inland were recorded at Lata airport on Ndendo Island. Landslides were
Matsumura, Yuko; Miyoshi, Emako
2018-01-01
Japan, one of the most famous islander nations in the world, has promoted the development of its remote islands for over 60 years after the Second World War. The target islands and projects for fostering development have been steadily expanded. However, the country is facing serious socio-economic challenges such as aging and recession, resulting in less available funding for preferential treatment to remote islands. Thus, the framework for boosting island development should be reconsidered, ...
Directory of Open Access Journals (Sweden)
Michael J Dunn
Full Text Available We report long-term changes in population size of three species of sympatrically breeding pygoscelid penguins: Adélie (Pygoscelis adeliae, chinstrap (Pygoscelis antarctica and gentoo (Pygoscelis papua ellsworthii over a 38 year period at Signy Island, South Orkney Islands, based on annual counts from selected colonies and decadal all-island systematic counts of occupied nests. Comparing total numbers of breeding pairs over the whole island from 1978/79 to 2015/16 revealed varying fortunes: gentoo penguin pairs increased by 255%, (3.5% per annum, chinstrap penguins declined by 68% (-3.6% per annum and Adélie penguins declined by 42% (-1.5% per annum. The chinstrap population has declined steadily over the last four decades. In contrast, Adélie and gentoo penguins have experienced phases of population increase and decline. Annual surveys of selected chinstrap and Adélie colonies produced similar trends from those revealed by island-wide surveys, allowing total island population trends to be inferred relatively well. However, while the annual colony counts of chinstrap and Adélie penguins showed a trend consistent in direction with the results from all-island surveys, the magnitude of estimated population change was markedly different between colony wide and all island counts. Annual population patterns suggest that pair numbers in the study areas partly reflect immigration and emigration of nesting birds between different parts of the island. Breeding success for all three species remained broadly stable over time in the annually monitored colonies. Breeding success rates in gentoo and chinstrap penguins were strongly correlated, despite the differing trends in population size. This study shows the importance of effective, standardised monitoring to accurately determine long-term population trajectories. Our results indicate significant declines in the Adélie and chinstrap penguin populations at Signy Island over the last five decades, and a
CpG island mapping by epigenome prediction.
Directory of Open Access Journals (Sweden)
Christoph Bock
2007-06-01
Full Text Available CpG islands were originally identified by epigenetic and functional properties, namely, absence of DNA methylation and frequent promoter association. However, this concept was quickly replaced by simple DNA sequence criteria, which allowed for genome-wide annotation of CpG islands in the absence of large-scale epigenetic datasets. Although widely used, the current CpG island criteria incur significant disadvantages: (1 reliance on arbitrary threshold parameters that bear little biological justification, (2 failure to account for widespread heterogeneity among CpG islands, and (3 apparent lack of specificity when applied to the human genome. This study is driven by the idea that a quantitative score of "CpG island strength" that incorporates epigenetic and functional aspects can help resolve these issues. We construct an epigenome prediction pipeline that links the DNA sequence of CpG islands to their epigenetic states, including DNA methylation, histone modifications, and chromatin accessibility. By training support vector machines on epigenetic data for CpG islands on human Chromosomes 21 and 22, we identify informative DNA attributes that correlate with open versus compact chromatin structures. These DNA attributes are used to predict the epigenetic states of all CpG islands genome-wide. Combining predictions for multiple epigenetic features, we estimate the inherent CpG island strength for each CpG island in the human genome, i.e., its inherent tendency to exhibit an open and transcriptionally competent chromatin structure. We extensively validate our results on independent datasets, showing that the CpG island strength predictions are applicable and informative across different tissues and cell types, and we derive improved maps of predicted "bona fide" CpG islands. The mapping of CpG islands by epigenome prediction is conceptually superior to identifying CpG islands by widely used sequence criteria since it links CpG island detection to
CpG island mapping by epigenome prediction.
Bock, Christoph; Walter, Jörn; Paulsen, Martina; Lengauer, Thomas
2007-06-01
CpG islands were originally identified by epigenetic and functional properties, namely, absence of DNA methylation and frequent promoter association. However, this concept was quickly replaced by simple DNA sequence criteria, which allowed for genome-wide annotation of CpG islands in the absence of large-scale epigenetic datasets. Although widely used, the current CpG island criteria incur significant disadvantages: (1) reliance on arbitrary threshold parameters that bear little biological justification, (2) failure to account for widespread heterogeneity among CpG islands, and (3) apparent lack of specificity when applied to the human genome. This study is driven by the idea that a quantitative score of "CpG island strength" that incorporates epigenetic and functional aspects can help resolve these issues. We construct an epigenome prediction pipeline that links the DNA sequence of CpG islands to their epigenetic states, including DNA methylation, histone modifications, and chromatin accessibility. By training support vector machines on epigenetic data for CpG islands on human Chromosomes 21 and 22, we identify informative DNA attributes that correlate with open versus compact chromatin structures. These DNA attributes are used to predict the epigenetic states of all CpG islands genome-wide. Combining predictions for multiple epigenetic features, we estimate the inherent CpG island strength for each CpG island in the human genome, i.e., its inherent tendency to exhibit an open and transcriptionally competent chromatin structure. We extensively validate our results on independent datasets, showing that the CpG island strength predictions are applicable and informative across different tissues and cell types, and we derive improved maps of predicted "bona fide" CpG islands. The mapping of CpG islands by epigenome prediction is conceptually superior to identifying CpG islands by widely used sequence criteria since it links CpG island detection to their characteristic
CRED Gridded Bathymetry of Nihoa Island (100-025) in the Northwestern Hawaiian Islands
National Oceanic and Atmospheric Administration, Department of Commerce — File 100-025b is a 60-m ASCII grid of depth data collected near Nihoa Island in the Northwestern Hawaiian Islands as of May 2003. This grid has been produced as part...
Equilibrium theory of island biogeography: A review
Angela D. Yu; Simon A. Lei
2001-01-01
The topography, climatic pattern, location, and origin of islands generate unique patterns of species distribution. The equilibrium theory of island biogeography creates a general framework in which the study of taxon distribution and broad island trends may be conducted. Critical components of the equilibrium theory include the species-area relationship, island-...
Directory of Open Access Journals (Sweden)
Y. G. Arsanov
2014-01-01
Full Text Available Aim. Ecological-faunistic investigations of island Chechen are great interest for understanding the law of formation of island biotas and reconstruction of zoogeological history of the Caspian Sea. Faunistic investigations of islands and coastal areas , habitats and others chorologic aspects illuminate the ways of their probable settlement,explains the paradoxes of propagation of some species. Study of relationships with host plants appear the crucial stage of ecological-faunistic investigathions of the weevils.Location. Materials of the work were expeditionary duties of the authors, as well as staff and the students of ecologo-geografical faculty of Dagistan State University and the Institute for Applied Ecology ( Makhachkala from 2009 to 2013 year for the island Chechen.Methods. Charges were made with the help of light traps, soil traps, including trap, enhanced light source .Geografpical coordinates of all locations were recorded using GPS- navigator: T1 - 43°57’58” N 47°38’35” E; T2 - 43°58’17” N 47°42’55”; T3 - 43°59’08” N 47°44’39” E; T4 - 43°57’27” N 47°45’05” E; T5 - 43°58’11” N47°38’46” E.Results. As a result of studies were set the species composition of the faun of the beetle-weevils of the island Chechen, the analyses of the distribution of species by locality; mounted forage plants of the beetles and quantitative distribution of the beetls for families forage plants; conduct the zoogeographical analysis of studied fauna.Main conclusions. The studies on the island of Chechen were collected 187 specimens belonging to 16 species and 14 geniuse; the most common type was Coniatus splendidulus. The food base of the weevil beetles in the island of Chechen are 10 plant families,thelargest number of species focused on Chenopodiаceae, then followed Polygonaceae, Poaceae, Fabaceae. Analysis of fauna habitats of the beetle- weevils of the island Chechen allowed to allocate 7
DeWitt, Nancy T.; Stalk, Chelsea A.; Fredericks, Jake J.; Flocks, James G.; Kelso, Kyle W.; Farmer, Andrew S.; Tuten, Thomas M.; Buster, Noreen A.
2018-04-13
The U.S. Geological Survey (USGS) St. Petersburg Coastal and Marine Science Center, in cooperation with the U.S. Army Corps of Engineers, Mobile District, conducted bathymetric surveys of the nearshore waters surrounding Ship and Horn Islands, Gulf Islands National Seashore, Mississippi. The objective of this study was to establish base-level elevation conditions around West Ship, East Ship, and Horn Islands and their associated active littoral system prior to restoration activities. These activities include the closure of Camille Cut and the placement of sediment in the littoral zone of East Ship Island. These surveys can be compared with future surveys to monitor sediment migration patterns post-restoration and can also be measured against historic bathymetric datasets to further our understanding of island evolution.The USGS collected 667 line-kilometers (km) of single-beam bathymetry data and 844 line-km of interferometric swath bathymetry data in July 2016 under Field Activity Number 2016-347-FA. Data are provided in three datums: (1) the International Terrestrial Reference Frame of 2000 (ellipsoid height); (2) the North American Datum of 1983 (NAD83) CORS96 realization and the North American Vertical Datum of 1988 with respect to the GEOID12B model (orthometric height); and (3) NAD83 (CORS96) and Mean Lower Low Water (tidal datum). Data products, including x,y,zpoint datasets, trackline shapefiles, digital and handwritten Field Activity Collection Systems logs, 50-meter digital elevation model, and formal Federal Geographic Data Committee metadata, are available for download.
Kuriiwa, Kaoru; Arihara, Hisashi; Chiba, Satoru; Kato, Shoichi; Senou, Hiroshi; Matsuura, Keiichi
2014-01-01
The Zunan Islands are located 360–650 km south of Tokyo, and consist of four uninhabited volcanoes: the Bayonnaise Rocks, the Smith Rocks, Torishima Island and the Sofugan Rock. Although all of the elements of the Zunan Islands are tiny islets and rocks, they form a series of stepping stones for shallow water fishes between the Izu Islands in the north and the Ogasawara (Bonin) Islands in the south. We report here the first comprehensive survey of marine fishes in the Zunan Islands. A total o...
Ecology and Evolution: Islands of Change.
Benz, Richard
This book was designed for middle and junior high school science classes and focuses on island biogeography, ecology, and evolution. Sections include: (1) "Galapagos: Frame of Reference"; (2) "Ecology and Islands"; and (3) "Evolution." Nineteen standards-based activities use the Galapagos Islands as a running theme…
Directory of Open Access Journals (Sweden)
Isabel Banos-González
2016-05-01
Full Text Available An integral dynamic model, in combination with other methods (indicators, policy and scenario analysis, is presented as a tool for sustainability assessment in island socio-ecological systems (SES. The Fuerteventura sustainability model (FSM, tested for the 1996-2011, allows a better understanding of the dynamic interactions between sustainability indicators and other factors of this island. The FSM was first applied to analyse the vulnerability of this island to climate change for the 2012-2025 period; results point to the need for urgent measures to mitigate its effects on some of the analysed indicators. A set of policy measures was then assessed from the behaviour of nine indicators and their sustainability thresholds. Finally, the FSM facilitated the development of a dynamic model of the island of El Hierro, extrapolating the features common to both SES. We propose this to be a useful tool for the quantitative sustainability assessment and the management of real island socio-ecological systems
A survey of the water resources of St. Thomas, Virgin Islands
Jordon, D.G.; Cosner, O.J.
1973-01-01
St. Thomas, with an area of 32 square miles, is the second largest of the Virgin Islands of the United States. The island is mountainous, and slopes commonly exceed 35 degrees along a central ridge 800 to 1,200 feet high running the length of the island. The general appearance is a panorama of numerous steep interstream spurs and rounded peaks. The island is made up of rocks of Cretaceous age, mostly volcanic flows and breccia s. A thin limestone and tuffaceous wacke complete the sequence of major rock types. All the rocks have been tilted and dip about 50 degrees north. Water in Charlotte Amalie, the capital, is supplied by sea-water desalting and water barged from Puerto Rico and is augmented by hillside rain catchments and individual roof catchments. Rainwater augmented by water hauling and a few wells is the source of water for the rural areas. Streamflow is meager--2 to 8 percent of the annual rainfall-and is predominantly storm runoff. Runoff after rainstorms seldom exceeds 5 percent of the rainfall. Runoff is rapid, however, and flash floods occasionally occur. Test drilling has shown that water can be obtained from fractured volcanic rocks in nearly all parts of the island. Wells will yield, generally, less than 1,000 gpd (gallons per day). In the upper Turpentine Run Valley and the Lovenlund Valley, short-term yields of individual wells are as great as 100 gallons per minute. Estimates of potential yield from these areas are 300,000 and 100,000 gpd, respectively. Two smaller areas--Long Bay and Lindberg Bay on the outskirts of Charlotte Amalie have estimated ground-water yields of 70,000 and 30,000 gpd, respectively. Fully developed, the surface- and ground-water resources of the island could yield 1.3 million gallons of water per day. Ground water is slightly saline, commonly containing more than 1,000 milligrams per liter dissolved solids. The principal source of the minerals is bulk fallout of sea- and land-derived dust from the atmosphere. Solution of
The Idea of the Archipelago: Contemplating Island Relations
Directory of Open Access Journals (Sweden)
Elaine Stratford
2013-05-01
Full Text Available Creative, innovative, and timely research on islands and island futures is warranted and pressing, not least because island(ers are poorly served by established tropes of them as subordinate to continents or mainlands. Opportunities exist to provide a more thoroughgoing account of island life and island relations, and the seven papers in this special issue address that task. In works that consider islands in the Timor Sea, the Caribbean, the Pacific, Atlantic and Southern Oceans, and that span several different disciplinary frames—archival-historical, critical theoretical, literary, cultural, geopolitical, sociological and artistic—these papers evidence both the diversity of approach to thinking with the archipelago, and numerous points in common. Among the latter is an understanding that island relations are built on connection, assemblage, mobility, and multiplicity, and a commitment to critically examine the ways in which these entanglements affect and give effect to island life. The models of island relationality brought to light by this collective focus on the archipelago reveal new and diverse connections of island peoples with their physical and cultural environments, and with the world beyond; create spaces for growing resilience, association and engagement; and invite further study.
seal Arctocephaius tropicaiis at Gough Island
African Journals Online (AJOL)
Population increase in the Amsterdam Island fur seal Arctocephaius tropicaiis at Gough Island. M.N. Bester. Mammal Research Institute, University of Pretoria, Pretoria. Population size of Arctocephalus tropicalis on Gough Island was determined by direct censuses of parts of the coast duro ing the summers of 1974 - 1976 ...
Simple method for calculating island widths
International Nuclear Information System (INIS)
Cary, J.R.; Hanson, J.D.; Carreras, B.A.; Lynch, V.E.
1989-01-01
A simple method for calculating magnetic island widths has been developed. This method uses only information obtained from integrating along the closed field line at the island center. Thus, this method is computationally less intensive than the usual method of producing surfaces of section of sufficient detail to locate and resolve the island separatrix. This method has been implemented numerically and used to analyze the buss work islands of ATF. In this case the method proves to be accurate to at least within 30%. 7 refs
Mosquito Surveys Carried out On Green Island, Orchid Island, and Penghu Island, Taiwan, in 2003
Directory of Open Access Journals (Sweden)
Hwa-Jen Teng
2005-02-01
Full Text Available Field surveys of mosquitoes were carried out on Green, Orchid, and Penghu Islands in 2003 to ascertain the status of mosquito vectors. Eighteen species of mosquitoes were collected, including three species of Anopheles, four species of Aedes, eight species of Culex, two species of Armigeres, and one species of Malaya. Seventeen previously recorded species were not collected in this study but 11 species collected had not previously been recorded. Ten newly recorded species, An. maculatus, An. takasagoensis, Ae. alcasidi, Ae. lineatopennis, Ae. vexans vexans, Ar. omissus, Cx. vishnui, Cx. halifaxii, Cx. hayashii, and Cx. neomimulus, were collected on Green Island and one previously unrecorded species, Ar. subalbatus, was collected on Orchid Island. Potential vectors An. maculatus and An. sinensis, malaria vectors in Korea and Mainland China, Ae. albopictus, a vector of dengue in Taiwan and West Nile virus in the USA, Cx. vishnui and Cx. tritaeniorhynchus, Japanese encephalitis vectors in Taiwan, Ae. vexans vexans, an eastern equine encephalitis vector in the USA, and Cx. quinquefasciatus, a vector of filariasis in Taiwan and West Nile virus in the USA, were among the mosquito species collected.
Setoguchi, H; Watanabe, I
2000-06-01
Hybridization and introgression play important roles in plant evolution, and their occurrence on the oceanic islands provides good examples of plant speciation and diversification. Restriction fragment length polymorphisms (RFLPs) and trnL (UAA) 3'exon-trnF (GAA) intergenic spacer (IGS) sequences of chloroplast DNA (cpDNA), and the sequences of internal transcribed spacer (ITS) of nuclear ribosomal DNA were examined to investigate the occurrence of gene transfer in Ilex species on the Bonin Islands and the Ryukyu Islands in Japan. A gene phylogeny for the plastid genome is in agreement with the morphologically based taxonomy, whereas the nuclear genome phylogeny clusters putatively unrelated endemics both on the Bonin and the Ryukyu Islands. Intersectional hybridization and nuclear gene flow were independently observed in insular endemics of Ilex on both sets of islands without evidence of plastid introgression. Gene flow observed in these island systems can be explained by ecological features of insular endemics, i.e., limits of distribution range or sympatric distribution in a small land area.
Seed islands driven by turbulence and NTM dynamics
Muraglia, M.; Agullo, O.; Poye, A.; Benkadda, S.; Horton, W.; Dubuit, N.; Garbet, X.; Sen, A.
2014-10-01
Magnetic reconnection is an issue for tokamak plasmas. Growing magnetic islands expel energetic particles from the plasma core leading to high energy fluxes in the SOL and may cause damage to the plasma facing components. The islands grow from seeds from the bootstrap current effects that oppose the negative delta-prime producing nonlinear island growth. Experimentally, the onset of NTM is quantified in terms of the beta parameter and the sawtooth period. Indeed, in experiments, (3;2) NTM magnetic islands are often triggered by sawtooth precursors. However (2;1) magnetic islands can appear without noticeable MHD event and the seed islands origin for the NTM growth is still an open question. Macroscale MHD instabilities (magnetic islands) coexist with micro-scale turbulent fluctuations and zonal flows which impact island dynamics. Nonlinear simulations show that the nonlinear beating of the fastest growing small-scale ballooning interchange modes on a low order rational surface drive a magnetic islands located on the same surface. The island size is found to be controlled by the turbulence level and modifies the NTM threshold and dynamics.
Wave and offshore wind potential for the island of Tenerife
International Nuclear Information System (INIS)
Veigas, M.; Iglesias, G.
2013-01-01
Highlights: • The island aims to reduce its carbon footprint by developing renewable energy. • The substantial wave and offshore wind resources around the island are examined. • One area is appropriate for installing a hybrid wave–offshore wind farm. - Abstract: The island of Tenerife, a UNESCO Biosphere Reserve in the Atlantic Ocean, aims to be energy self-sufficient in order to reduce its carbon footprint. To accomplish this goal it should develop the renewable sources, in particular wave and offshore wind energy. The objectives of this work are twofold; (i) to characterize the wave and offshore wind power distribution around the island and (ii) to determine which offshore area is best suited for their exploitation, taking into account the resource and other conditioning factors such as the bathymetry, distance to the coastline and ports, and offshore zoning. To carry out this research, hindcast wave and wind data obtained with numerical models are used alongside observations from meteorological stations. One area, in the vicinity of Puerto de la Cruz, is identified as having great potential for installing a hybrid floating wave–wind farm. Both resources are characterized for the area selected: the wave resource in terms of wave directions, significant wave heights and energy periods; the offshore wind resource in terms of directions and speeds in addition to the seasonality for the both resources. It is found that most of the wave resource is provided by N and NNW waves with significant wave heights between 1.5 m and 3.0 m and energy periods between 10 s and 14 s. It follows that the Wave Energy Converters deployed in the area should have maximum efficiency in those ranges. As for the offshore wind resource, most of the energy corresponds to NNE and NE winds with speeds between 9 and 14 m s −1 , which should be taken into account when selecting the offshore wind turbines
International Nuclear Information System (INIS)
Des Brisay, C.
2005-01-01
Terasen Gas is pursuing alternatives for the supply of additional natural gas capacity to Vancouver Island. Its subsidiary, Terasen Gas (Vancouver Island) Inc. (TGVI), is responding to the need for delivery of increased gas supply and, is supporting plans for new gas-fired power generation on Vancouver Island. TGVI's proposal for new natural gas capacity involves a combination of compression and pipeline loops as well as the addition of a storage facility for liquefied natural gas (LNG) at Mt. Hayes to help manage price volatility. This presentation outlined the objectives and components of the resource planning process, including demand forecast scenarios and the preferred infrastructure options. tabs., figs
DeLiberto, A.
2016-02-01
Nitrogen fixation is an important process which allows organisms access to biologically unavailable dinitrogen gas. Bacteria, known as diazotrophs use the enzyme nitrogenase to convert N2 to NH3. These bacteria, including certain species of heterotrophic bacteria and cyanobacteria, can be symbiotically associated with marine macroalgae, facilitating nutrient cycling in oligotrophic regions. As many species within the genera Sargassum are associated with nitrogen fixation, this study hypothesized that nitrogenase activity would be associated with the benthic invasive Sargassum horneri on Catalina Island. In the past decade, Sargassum horneri, an invasive from Japan, has spread throughout the waters around Catalina Island. Using the acetylene reduction procedure using flame ionization detection, initial nitrogenase activity of S. horneri sampled from Indian Rock was observed. Nitrogen fixation rates increased with decomposition, particularly in dark/anaerobic treatments, suggesting the presence of heterotrophic bacteria. In addition, acetate additions greatly increase nitrogen fixation rates, once again indicating heterotrophic nitrogen fixing bacteria.
International Nuclear Information System (INIS)
Kamaruzzaman Sopian
2000-01-01
Wind data collected at three east coast islands of Peninsular Malaysia namely Tioman, Redang and Perhentian Island were analyzed for the wind energy potential. The results were presented as Weibull distribution and preliminary analysis indicate that the site at Redang Island have the greatest potential with a mean power density of 85.1 w/m 2 at 10 meters above sea level. (Author)
Carroll, A.; McNamara, D.; Schupp, C.
2009-12-01
Assateague Island National Seashore comprises a long barrier island located off the coasts of Maryland and Virginia. Geological evidence suggests that over recent centuries Assateague Island has steadily transgressed up the continental shelf in response to rising sea level. More recently, the natural barrier island dynamics governing Assateague’s evolution have been altered by human activity in three ways: the construction of a jetty and the subsequent interruption of alongshore sediment transport on the north end of Assateague and both the ongoing and abandoned maintenance of a continuous dune system along portions of Assateague with the concomitant modification to overwash dynamics. It is unclear how these varied human alterations to the natural barrier island dynamics will influence the response of Assateague to climate change induced shifts in forcing such as increased rates of sea level rise and changing storm patterns. We use LIDAR detected morphological data of Assateague Island as initial conditions in an alongshore extended model for barrier island dynamics including beach erosion, island overwash and inlet cutting during storms, and beach accretion, tidal delta growth and dune and vegetation growth between storms to explore the response of the various human altered segments of Assateague Island to forcing changes. Traditional models exploring barrier island evolution contain only cross-shore dynamics therefore lacking important alongshore-spatial dynamics in aeolian and surf zone sediment transport. Results show that including alongshore dynamics alter the steady state of Assateague relative to simulations that only include cross-shore dynamics. Results will also be presented exploring the potential for regime shifts in steady state behavior under various scenarios for the rate of sea level rise and storm climate and varying management strategies.
Terrestrial radiation measurements in Marshall Islands
International Nuclear Information System (INIS)
Gudiksen, P.H.
1978-01-01
With the prospect of habitation in the near future, radiological surveys were undertaken of Enewetak and Bikini Atolls to provide a basis for determining whether or not the atolls can be safely reinhabited. The surveys included all of the forty islands within Enewetak Atoll, but only the two principal islands, Bikini and Eneu Islands, of Bikini Atoll. These atolls were former U.S. nuclear weapons test sites in the Pacific. Integral parts of the surveys were the measurements of the distributions of radioactivity in the soil and the resulting gamma ray exposure rates for external dose estimation. Numerous soil samples were collected from both atolls for analysis by Ge (Li) gamma spectrometry and by wet chemistry techniques. At Enewetak Atoll the gamma exposure rates were measured by TLDs and a helicopter-borne array of Nal detectors, while at Bikini Atoll portable Nal detectors, pressurized ion-chambers, and TLDs were utilized. The predominant species measured in the soil samples collected from both atolls were 90 Sr, 239,240 Pu, 137 Cs and 60 Co with the latter two nuclides being the primary contributors to the gamma-ray exposure rates. The geographical distribution of the exposure rates measured on both atolls, was highly variable ranging from less than 1 μR/h on islands that had not been impacted radiologically by the testing program, to over 100 μR/h near weapon detonation sites. Thus, within Enewetak Atoll, the highest soil activities and gamma-ray exposure rates were measured on the northern islands, where the weapons testing had been most intense. Bikini Island exhibited contamination levels that were considerably higher than those on Eneu Island. Generally, the highest activity levels were observed within the island interiors or in proximity to ground zero sites, and could usually be related to the surrounding vegetation density. The island of Yvonne, within Enewetak Atoll, is the most severely contaminated land area. Particles containing as much as several
Globally threatened vertebrates on islands with invasive species.
Spatz, Dena R; Zilliacus, Kelly M; Holmes, Nick D; Butchart, Stuart H M; Genovesi, Piero; Ceballos, Gerardo; Tershy, Bernie R; Croll, Donald A
2017-10-01
Global biodiversity loss is disproportionately rapid on islands, where invasive species are a major driver of extinctions. To inform conservation planning aimed at preventing extinctions, we identify the distribution and biogeographic patterns of highly threatened terrestrial vertebrates (classified by the International Union for Conservation of Nature) and invasive vertebrates on ~465,000 islands worldwide by conducting a comprehensive literature review and interviews with more than 500 experts. We found that 1189 highly threatened vertebrate species (319 amphibians, 282 reptiles, 296 birds, and 292 mammals) breed on 1288 islands. These taxa represent only 5% of Earth's terrestrial vertebrates and 41% of all highly threatened terrestrial vertebrates, which occur in vertebrates was available for 1030 islands (80% of islands with highly threatened vertebrates). Invasive vertebrates were absent from 24% of these islands, where biosecurity to prevent invasions is a critical management tool. On the 76% of islands where invasive vertebrates were present, management could benefit 39% of Earth's highly threatened vertebrates. Invasive mammals occurred in 97% of these islands, with Rattus sp. as the most common invasive vertebrate (78%; 609 islands). Our results provide an important baseline for identifying islands for invasive species eradication and other island conservation actions that reduce biodiversity loss.
North Aegean island landscapes as ecomuseums: the case of Lesvos Island
Directory of Open Access Journals (Sweden)
Evangelos Pavlis
2017-05-01
Full Text Available The main advantage of the Aegean islands, in generating national, regional, or international competitiveness, compared to the areas on the continental mainland, is their natural and cultural assets, their cultural landscapes. Consequently, the organized utilization of cultural heritage, rich biodiversity, and the unique Aegean landscape, could make the islands attractive as places to live or work and help them fulfill their sustainability goals. Ecomuseums are ‘in situ’ museums, aimed at local communities and managed by them, aiming at the interpretation, protection, utilization, and promotion of natural and cultural assets of a place, and at the economic revival of marginal regions through the combinational development of small-scale tourism, local manufacturing, and primary production sectors. They could function as laboratories of sustainable development. The island of Lesvos has been selected as a case study for such a potential ecomuseum.
Directory of Open Access Journals (Sweden)
Raoni Rebouças
Full Text Available Island Rule postulated that individuals on islands tend to dwarfism when individuals from mainland populations are large and to gigantism when mainland populations present small individuals. There has been much discussion about this rule, but only few studies were carried out aiming to reveal this pattern for anurans. Our study focused on measuring the size of individuals on islands and to find a possible pattern of size modification for insular anurans. Individuals were collected on continental islands, measured and compared to mainland populations. We selected four species with different natural history aspects during these analyses. Island parameters were compared to size of individuals in order to find an explanation to size modification. Three of the four species presented size shifting on islands. Ololygon trapicheiroi and Adenomera marmorata showed dwarfism, Boana albomarginata showed gigantism and in Thoropa miliaris there was no evident size modification. Allometric analysis also revealed differential modification, which might be a result of different selective pressures on islands in respect of mainland populations. Regression model explained most of the size modification in B. albomarginata, but not for the other species. Our results indicate that previous assumptions, usually proposed for mammals from older islands, do not fit to the anurans studied here. We support the assumption that size modification on islands are population-specific. Hence, in B. albomarginata some factor associated to competition, living area and isolation time might likely be responsible for gigantism on islands.
Ford, M.; Becker, J. M.; Merrifield, M. A.
2012-12-01
Atoll islands are highly vulnerable to a range of inundation hazards. The impacts of such hazards are expected to be magnified as a result of continued sea-level rise. Both recent and historic inundation events provide unique insights into the requisite conditions necessary to initiate island inundation. A number of recent and historic inundation events are presented in order to examine the oceanographic and meteorological conditions driving inundation of a densely populated, urbanized atoll in the central Pacific. Analysis of inundation events suggests that a number of key drivers contribute to the spatial and temporal extent of island inundation, with unique degrees of predictability and resultant impact signatures apparent on island geomorphology and local anthropogenic activities. Results indicate three distinct drivers of inundation hazards exist. Firstly, tropical storms and typhoons elevate sea level through inverse barometric setup, wind setup and a range of wave driven processes and have caused considerable impact on atolls within the Marshall Islands. Secondly, super-elevated sea level conditions resulting from the combination of seasonal high tides and quasi-cyclical La Nina conditions drive inundation of low-lying lagoon facing coastal areas. Thirdly, long period swell conditions, typically generated by distant storms, can elevate reef-flat water levels through wave setup and infragravity wave oscillations. Such wave conditions can over wash the ocean-facing island ridge, often inundating large sections of the island. Reef-flat wave conditions are tidally modulated, with inundation events typically occurring around high tide. However, the two most recent destructive swell-driven inundation events have occurred while tide levels were significantly lower than spring tide levels, suggesting high water levels are not a necessary prerequisite for wave-driven inundation. The different modes of inundation are discussed and grounded within recent and historic
Chronic Liver Disease and Asian Americans/Pacific Islanders
... Cancer Asian/Pacific Islander Women Non-Hispanic White Women Asian/Pacific Islander/ Non-Hispanic White Ratio All Sites ... Cancer Asian/Pacific Islander Women Non-Hispanic White Women Asian/Pacific Islander/ Non-Hispanic White Ratio Liver & IBD* ...
Solid waste management on small islands. The case of Green Island, Taiwan
Energy Technology Data Exchange (ETDEWEB)
Chen, M.C.; Ruijs, A.; Wesseler, J. [Environmental Economics and Natural Resources Group, Wageningen University, P.O. Box 8130, 6700 EW Wageningen (Netherlands)
2005-09-01
Municipalities of small islands have limited capacities for waste disposal. In the case of Green Island, Taiwan, continuing with business as usual would only allow the disposal of waste on the island for another 8 years. Three alternatives for solid waste management (SWM) are compared. The cost-effective solution is the one, which is the most expensive in the short run: continuing business as usual and introducing an incineration plant in the year 2010. The results indicate furthermore that deviations from optimal timing of investment only slightly change average annual costs. In the long run, the municipality can hardly avoid transporting waste to the mainland. By investing in an incineration plant, they can buy additional time to investigate alternative SWM strategies.
Environmental Prime Movers for Prehistoric Colonization of Islands in Remote Oceania
Montenegro, Alvaro; Callaghan, Richard T.; Fitzpatrick, Scott M.
2016-04-01
The peopling of Remote Oceania was one of the last great waves of human migration in the ancient past. Beginning around 3500 BP, peoples from Island Southeast Asia began colonizing western Micronesia, and shortly thereafter ca. 3400 BP, Lapita groups began moving east from Near Oceania (e.g., the Solomons and Bismarck Archipelago) to islands in Eastern Melanesia and West Polynesia, including Vanuatu, Fiji, Tonga, and Samoa. It is remarkable that over the next 2500 years, even the most remote islands, known now to represent the distant nodes of the Polynesian triangle (New Zealand, Hawaii, and Easter Island), were eventually visited by Austronesian speakers and their descendants across this seemingly boundless ocean. One of the more enduring questions - and one that has perplexed scholars for decades - is how and when these ancient seafarers were able to develop navigational/wayfinding techniques and seafaring technologies to overcome a number of environmental challenges. This would ultimately help determine what combination of social and environmental stimuli forced or encouraged people to colonize some of the most isolated patches of land on earth. To advance our understanding of ancient Pacific colonization strategies, we integrate seafaring simulation models, ease of eastward travel estimates based on land distribution and wind pattern analysis, and new climatic datasets for precipitation in Micronesia and Polynesia to examine intra-annual variations in wind and precipitation that would have influenced travel. Combined with statistical modeling of winds and currents, we argue that: land distribution could have contributed to the pause in eastward expansion seen at about 3000 BP; simple downwind sailing and downwind sailing during eastward spells are viable navigation strategies for reaching islands to the east; seasonality of eastward winds would facilitate voyage planning and increase chances of success; knowledge of annual and interannual variability
National Oceanic and Atmospheric Administration, Department of Commerce — File 100-002b is a 60-m ASCII grid of depth data collected near Lisianski Island and Pioneer Bank in the Northwestern Hawaiian Islands as of May 2003. This grid has...
Revisiting the Metaphor of the Island: Challenging "World Culture" from an Island Misunderstood
Rappleye, Jeremy
2015-01-01
This article revisits the newly "discovered" island that world culture theorists have repeatedly utilised to explain their theoretical stance, conceptual preferences and methodological approach. Yet, it seeks to (re)connect world culture with the real world by replacing their imagined atoll with a real one--the island-nation of Japan. In…
Fisher, Robert N; Niukula, Jone; Watling, Dick; Harlow, Peter S
2017-06-06
The south Pacific iguanas (Brachylophus) currently have three recognized living species in Fiji. Recent surveys have uncovered more specific variation (morphological and genetic) within the genus and have better defined the geographic ranges of the named species. One of these recent discoveries is a strikingly different iguana from all other island populations in Fiji which is restricted to Gau Island of the Lomaiviti Province. Gau is the fifth largest island in Fiji and maintains excellent upland forests in the higher elevations. We describe this population from Gau Island as a new species, Brachylophus gau sp. nov., in recognition of its type locality.
Fisher, Robert N.; Niukula, Jone; Watling, Dick; Harlow, Peter S.
2017-01-01
The south Pacific iguanas (Brachylophus) currently have three recognized living species in Fiji. Recent surveys have uncovered more specific variation (morphological and genetic) within the genus and have better defined the geographic ranges of the named species. One of these recent discoveries is a strikingly different iguana from all other island populations in Fiji which is restricted to Gau Island of the Lomaiviti Province. Gau is the fifth largest island in Fiji and maintains excellent upland forests in the higher elevations. We describe this population from Gau Island as a new species, Brachylophus gau sp. nov., in recognition of its type locality.
Island forming processes in the Okavango Delta, Botswana
McCarthy, T. S.; Humphries, M. S.; Mahomed, I.; Le Roux, P.; Verhagen, B. Th.
2012-12-01
The Okavango Delta in Botswana is a large (40,000 km2) alluvial fan that is characterised by the presence of numerous tree-covered islands. Thought to originate from the mound-building activities of termites or through fluvial processes associated with development of scroll bars and inverted channels, islands have been shown to play an important role in the structure and functioning of the Delta through the creation of habitat diversity, focusing of nutrients, and disposal of toxic salts. This study investigates the processes responsible for the maintenance and growth of two such islands in the seasonal swamps. Transpiration by vegetation is shown to result in substantial increases in groundwater salinity beneath the islands, contributing to their growth through chemical precipitation. Detailed chemical analyses revealed that the precipitation of magnesian calcite and silica within the island soils contributes 30-40% of the total island volume. Isotopic analyses of carbonate samples show that vegetation plays an important role in providing carbon for carbonate precipitation. Variations in δ13C carbonate values appear to reflect the relative proportion of C3 to C4 plants on the island, with C4 species becoming more dominant toward island centres in response to increases in groundwater salinity. The study suggests that continued island growth is also related to the deposition of aerosols and the accumulation of dust preferentially on islands and possibly to ongoing termite activity. Tall trees that characterise the island margins trap dust carried from the floodplains, resulting particularly in the lateral growth of islands. Islands in the Okavango are considered to be the product of long-term aggradation processes, with the two islands studied estimated to be in the order of tens of thousands of years old.
Opatova, Vera; Arnedo, Miquel A.
2014-01-01
Studies conducted on volcanic islands have greatly contributed to our current understanding of how organisms diversify. The Canary Islands archipelago, located northwest of the coast of northern Africa, harbours a large number of endemic taxa. Because of their low vagility, mygalomorph spiders are usually absent from oceanic islands. The spider Titanidiops canariensis, which inhabits the easternmost islands of the archipelago, constitutes an exception to this rule. Here, we use a multi-locus approach that combines three mitochondrial and four nuclear genes to investigate the origins and phylogeography of this remarkable trap-door spider. We provide a timeframe for the colonisation of the Canary Islands using two alternative approaches: concatenation and species tree inference in a Bayesian relaxed clock framework. Additionally, we investigate the existence of cryptic species on the islands by means of a Bayesian multi-locus species delimitation method. Our results indicate that T. canariensis colonised the Canary Islands once, most likely during the Miocene, although discrepancies between the timeframes from different approaches make the exact timing uncertain. A complex evolutionary history for the species in the archipelago is revealed, which involves two independent colonisations of Fuerteventura from the ancestral range of T. canariensis in northern Lanzarote and a possible back colonisation of southern Lanzarote. The data further corroborate a previously proposed volcanic refugium, highlighting the impact of the dynamic volcanic history of the island on the phylogeographic patterns of the endemic taxa. T. canariensis includes at least two different species, one inhabiting the Jandia peninsula and central Fuerteventura and one spanning from central Fuerteventura to Lanzarote. Our data suggest that the extant northern African Titanidiops lineages may have expanded to the region after the islands were colonised and, hence, are not the source of colonisation. In
Directory of Open Access Journals (Sweden)
Vera Opatova
Full Text Available Studies conducted on volcanic islands have greatly contributed to our current understanding of how organisms diversify. The Canary Islands archipelago, located northwest of the coast of northern Africa, harbours a large number of endemic taxa. Because of their low vagility, mygalomorph spiders are usually absent from oceanic islands. The spider Titanidiops canariensis, which inhabits the easternmost islands of the archipelago, constitutes an exception to this rule. Here, we use a multi-locus approach that combines three mitochondrial and four nuclear genes to investigate the origins and phylogeography of this remarkable trap-door spider. We provide a timeframe for the colonisation of the Canary Islands using two alternative approaches: concatenation and species tree inference in a Bayesian relaxed clock framework. Additionally, we investigate the existence of cryptic species on the islands by means of a Bayesian multi-locus species delimitation method. Our results indicate that T. canariensis colonised the Canary Islands once, most likely during the Miocene, although discrepancies between the timeframes from different approaches make the exact timing uncertain. A complex evolutionary history for the species in the archipelago is revealed, which involves two independent colonisations of Fuerteventura from the ancestral range of T. canariensis in northern Lanzarote and a possible back colonisation of southern Lanzarote. The data further corroborate a previously proposed volcanic refugium, highlighting the impact of the dynamic volcanic history of the island on the phylogeographic patterns of the endemic taxa. T. canariensis includes at least two different species, one inhabiting the Jandia peninsula and central Fuerteventura and one spanning from central Fuerteventura to Lanzarote. Our data suggest that the extant northern African Titanidiops lineages may have expanded to the region after the islands were colonised and, hence, are not the source
Opatova, Vera; Arnedo, Miquel A
2014-01-01
Studies conducted on volcanic islands have greatly contributed to our current understanding of how organisms diversify. The Canary Islands archipelago, located northwest of the coast of northern Africa, harbours a large number of endemic taxa. Because of their low vagility, mygalomorph spiders are usually absent from oceanic islands. The spider Titanidiops canariensis, which inhabits the easternmost islands of the archipelago, constitutes an exception to this rule. Here, we use a multi-locus approach that combines three mitochondrial and four nuclear genes to investigate the origins and phylogeography of this remarkable trap-door spider. We provide a timeframe for the colonisation of the Canary Islands using two alternative approaches: concatenation and species tree inference in a Bayesian relaxed clock framework. Additionally, we investigate the existence of cryptic species on the islands by means of a Bayesian multi-locus species delimitation method. Our results indicate that T. canariensis colonised the Canary Islands once, most likely during the Miocene, although discrepancies between the timeframes from different approaches make the exact timing uncertain. A complex evolutionary history for the species in the archipelago is revealed, which involves two independent colonisations of Fuerteventura from the ancestral range of T. canariensis in northern Lanzarote and a possible back colonisation of southern Lanzarote. The data further corroborate a previously proposed volcanic refugium, highlighting the impact of the dynamic volcanic history of the island on the phylogeographic patterns of the endemic taxa. T. canariensis includes at least two different species, one inhabiting the Jandia peninsula and central Fuerteventura and one spanning from central Fuerteventura to Lanzarote. Our data suggest that the extant northern African Titanidiops lineages may have expanded to the region after the islands were colonised and, hence, are not the source of colonisation. In
Elastic energies of coherent germanium islands on silicon
International Nuclear Information System (INIS)
Vanderbilt, D.; Wickham, L.K.
1991-01-01
Motivated by recent observations of coherent Ge island formation during growth of Ge on Si (100), the authors of this paper have carried out a theoretical study of the elastic energies associated with the evolution of a uniform strained overlayer as it segregates into coherent islands. In the context of a two-dimensional model, the authors have explored the conditions under which coherent islands may be energetically favored over both uniform epitaxial films and dislocated islands. The authors find that if the interface energy (for dislocated islands) is more than about 15% of the surface energy, then there is a range of island sizes for which the coherent island structure is preferred
Shape and coarsening dynamics of strained islands
DEFF Research Database (Denmark)
Schifani, Guido; Frisch, Thomas; Argentina, Mederic
2016-01-01
and numerically the formation of an equilibrium island using a two-dimensional continuous model. We have found that these equilibrium island-like solutions have a maximum height h_{0} and they sit on top of a flat wetting layer with a thickness h_{w}. We then consider two islands, and we report that they undergo...... and leads to the shrinkage of the smallest island. Once its height becomes smaller than a minimal equilibrium height h_{0}^{*}, its mass spreads over the entire system. Our results pave the way for a future analysis of coarsening of an assembly of islands....
Review of islanding detection methods for distributed generation
DEFF Research Database (Denmark)
Chen, Zhe; Mahat, Pukar; Bak-Jensen, Birgitte
2008-01-01
This paper presents an overview of power system islanding and islanding detection techniques. Islanding detection techniques, for a distribution system with distributed generation (DG), can broadly be divided into remote and local techniques. A remote islanding detection technique is associated...
International Nuclear Information System (INIS)
Ding, Haitao; Shao, Jinyou; Ding, Yucheng; Liu, Weiyu; Li, Xiangming; Tian, Hongmiao; Zhou, Yaopei
2015-01-01
Highlights: • Conductive island shape influences the dynamic process occurring in DEP assembly of 10 nm gold nanoparticles in a conductive-island-based microelectrode system. • The DEP-assembled nanoparticle wires form a straighter conduction path with the increase in the geometric angle of conductive island tip. • The different island shapes distort the DEP force distribution and increase the local electrothermally induced fluid flow to different extents, which is important for the morphology and electrical conductance quality of the DEP-assembled metal nanoparticle chains. - Abstract: The electrical conduction quality of an electric circuit connection formed by dielectrophoretic (DEP)-assembled metal nanoparticle wires between small conductive elements plays a significant role in electronic devices. One of the major challenges for improving the electrical conductance of nanowires is optimizing their geometric morphology. So far, the electrical conduction quality has been enhanced by optimizing the AC frequency and conductivity of nanoparticle suspensions. Herein, the effect of the conductive island shapes on the dynamic process occurring in a DEP assembly of 10 nm gold nanoparticles was investigated in a conductive-island-based microelectrode system. The nanoparticle wires between the microelectrodes were assembled in situ from colloidal suspensions. The wires were grown in a much straighter route by increasing the geometric angle of the conductive-island tip. To validate the experiments, the effects of mutual DEP interactions and electrothermally induced fluid flow on the dynamic behavior of particle motion for different island geometric configurations in the conductive-island-based microelectrode system were determined by numerical simulations. The simulation results are consistent with those of experiments. This indicates that different conductive island shapes change the distribution of DEP force and increase the electrothermally induced fluid flow to
Hariss, M.; Purkis, S.; Ellis, J. M.; Swart, P. K.; Reijmer, J.
2013-12-01
Great Bahama Bank (GBB) has been used in many models to illustrate depositional facies variation across flat-topped, isolated carbonate platforms. Such models have served as subsurface analogs at a variety of scales. In this presentation we have integrated Landsat TM imagery, a refined bathymetric digital elevation model, and seafloor sample data compiled into ArcGIS and analyzed with eCognition to develop a depositional facies map that is more robust than previous versions. For the portion of the GBB lying to the west of Andros Island, the facies map was generated by pairing an extensive set of GPS-constrained field observations and samples (n=275) (Reijmer et al., 2009, IAS Spec Pub 41) with computer and manual interpretation of the Landsat imagery. For the remainder of the platform, which lacked such rigorous ground-control, the Landsat imagery was segmented into lithotopes - interpreted to be distinct bodies of uniform sediment - using a combination of edge detection, spectral and textural analysis, and manual editing. A map was then developed by assigning lithotopes to facies classes on the basis of lessons derived from the portion of the platform for which we had rigorous conditioning. The new analysis reveals that GBB is essentially a very grainy platform with muddier accumulations only in the lee of substantial island barriers; in this regard Andros Island, which is the largest island on GBB, exerts a direct control over the muddiest portion of GBB. Mudstones, wackestones, and mud-rich packstones cover 7%, 6%, and 15%, respectively, of the GBB platform top. By contrast, mud-poor packstones, grainstones, and rudstones account for 19%, 44%, and 3%, respectively. Of the 44% of the platform-top classified as grainstone, only 4% is composed of 'high-energy' deposits characterized by the development of sandbar complexes. The diversity and size of facies bodies is broadly the same on the eastern and western limb of the GBB platform, though the narrower eastern
International Nuclear Information System (INIS)
Maragos, J.E.; Agegian, Catherine
1986-01-01
This environmental assessment evaluates various alternatives to return the Bikini people to their homeland on Bikini Atoll. Eneu Island was spared the heavy nuclear contamination that rendered Bikini Island, the largest and main inhabitable island on the atoll, presently unsuitable for resettlement. The economic, social, technical and environmental consequences of all alternatives were compared, and alternative sites, purposes and scales for resettlement were included in the analysis. This environmental assessment explores these alternatives in detail and concludes that the resettlement of Eneu Island by some of the Bikini people at this time will not result in significant adverse effects to the environment nor will it foreclose any other full scale resettlement option involving the cleanup of Bikini Atoll. In addition, it concludes that the resettlement of Eneu can be accomplished independently from the planned cleanup and resettlement of Bikini Island. Plans and combination of plans involving the early resettlement of Eneu are fully feasible and implementable at this time. (author)
Energy Technology Data Exchange (ETDEWEB)
Maragos, J E [Environmental Resources Section, U.S. Army Corps of Engineers, Pacific Ocean Division, HI (United States); Agegian, Catherine [University of Hawaii, Department of Oceanography, Honolulu, HI (United States)
1986-07-01
This environmental assessment evaluates various alternatives to return the Bikini people to their homeland on Bikini Atoll. Eneu Island was spared the heavy nuclear contamination that rendered Bikini Island, the largest and main inhabitable island on the atoll, presently unsuitable for resettlement. The economic, social, technical and environmental consequences of all alternatives were compared, and alternative sites, purposes and scales for resettlement were included in the analysis. This environmental assessment explores these alternatives in detail and concludes that the resettlement of Eneu Island by some of the Bikini people at this time will not result in significant adverse effects to the environment nor will it foreclose any other full scale resettlement option involving the cleanup of Bikini Atoll. In addition, it concludes that the resettlement of Eneu can be accomplished independently from the planned cleanup and resettlement of Bikini Island. Plans and combination of plans involving the early resettlement of Eneu are fully feasible and implementable at this time. (author)
Assessing qualitative long-term volcanic hazards at Lanzarote Island (Canary Islands)
Becerril, Laura; Martí, Joan; Bartolini, Stefania; Geyer, Adelina
2017-07-01
Conducting long-term hazard assessment in active volcanic areas is of primary importance for land-use planning and defining emergency plans able to be applied in case of a crisis. A definition of scenario hazard maps helps to mitigate the consequences of future eruptions by anticipating the events that may occur. Lanzarote is an active volcanic island that has hosted the largest (> 1.5 km3 DRE) and longest (6 years) eruption, the Timanfaya eruption (1730-1736), on the Canary Islands in historical times (last 600 years). This eruption brought severe economic losses and forced local people to migrate. In spite of all these facts, no comprehensive hazard assessment or hazard maps have been developed for the island. In this work, we present an integrated long-term volcanic hazard evaluation using a systematic methodology that includes spatial analysis and simulations of the most probable eruptive scenarios.
Ramjan, S.; Mahmud, M. S.; Hossain, M. A.; Hasan, M.; Ashrafi, Z. M.
2016-12-01
Bangladesh is recognized for its high vulnerability to sea level rise (SLR). SLR directly and indirectly (by altering morphology of river estuary) accelerates erosion processes, washes out the loose materials of the coast and coastal islands. Hatiya, highly populated coastal island, located in Meghna river estuary is under severe threat of coastal erosion, which has not been quantified yet. The accurate mapping of the shoreline and coastal changes are very important for adopting conservation measures e.g. protection of human life, property and the natural environment. The objectives of the present study are to use remote sensing and Geographical Information System techniques to evaluate spatial and temporal changes in the shoreline and coastal land area of the Hatiya Island between the year of 1985 and 2016 from multi-temporal satellite images, i.e. assessing shifting of the shoreline position through digital shoreline analysis besides the erosion-accretion measurements. Study reveals that about 67 square kilometer areas has been lost between 1985 and 2016 which was about 17 percent of original area (1985). Erosion mainly took place in northern, north-western banks of the island. In these areas, the landward movement and rate of the shoreline were higher with a highest value of the net shoreline movement (NSM) around 6.2 km. Erosion rate is significant in exposed part of the island where tidal water pressure, shoreline configuration, loose bank materials and steep slope were observed. However, the accretion was noticed in recent years (2010-2016) in southern part of the island where slopes were gentle, perhaps due to backwash sediment deposition. As erosion process is prominent in this island, significant amounnt of usable land was lost. Therefore, local livelihood pattern has changed that has noticable effect on local economy. By quantifying the erosion-accretion rate, livelihood planning can be initiated in climatically threated vulnerable islands.
Haryono, E.; Sasongko, M. H. D.; Barianto, D. H.; Setiawan, J. B.; Hakim, A. A.; Zaenuri, A.
2018-04-01
Maratua Island is one of the islands of Berau District, East Kalimantan which has great potential of natural beauty for tourism development. The area currently is one of famous tourist destination in East Kalimantan which is a carbonate reef built-up or so-called karst island. This paper is an endeavor 1) to unveil geomorphological and hydrogeological characteristics of the island, and 2) to recommend Island development as a tourist destination. Maratua Island is a V shape atoll with the open lagoon. Six geomorphological units were found on the island, i.e., fringing reef, beach, marine terrace, karst ridge, structural valley, and lagoon. Caves are also found in the karst ridge and the coast as an inundated passage. Three structural depressions in the karst ridge are other unique geomorphological feature in the area of which a marine lake environment with jellyfish is inhabited. The island is typified by two different aquifer units, i.e., porous media and fractured media aquifer. Porous aquifer lies on the beach of Boibukut area. Fractured-aquifer characterizes the other geomorphological units in the area. Freshwater accordingly is found in the beach area with a limited amount. Unfortunately, the groundwater in the marine terrace and karst ridge are saline. Maratua Island has enormous potential for tourism destination development. The major tourist activities in the area based on the geomorphological unit are snorkeling and diving (in fringing reef and lagoo n), hiking, cave exploration and marine lake exploration and cave diving (in karst ridge and structural valley); recreation and picnic (beach). The major limitation in the area is a shortage of freshwater resource and land. Limited water supply should be extracted from the beach area of Bohe Bukut village. Groundwater extraction from the beach area of Bohe Bukut must be for drinking water only. Supply of drinking water should be substituted from collected rainwater or desalination from sea water and water in
Rising sea levels and small island states
International Nuclear Information System (INIS)
Leatherman, S.P.
1994-01-01
A review is given of the problems small island nations face with respect to sea level rise caused by global warming. Many small island nations are very vulnerable to sea level rise. Particularly at risk are coral reef atolls, which are generally quite small, lie within three metres of current sea levels, and have no land at higher elevations to relocate populations and economic activity. Volcanic islands in the Pacific have high ground, but it is largely rugged, high relief and soil-poor. The most vulnerable islands are those that consist entirely of atolls and reef islands, such as Kirabai, Maldives, Tokelau and Tuvalu. Small island states, which by themselves have little power or influence in world affairs, have banded together to form the Strategic Alliance of Small Island States (AOSIS). This alliance had grown to include 42 states by the time of the 1992 U.N. Earth Summit. Although the greenhouse effect is mainly caused by industrial nations, developing countries will suffer the most from it. Choices of response strategy will depend on environmental, economic and social factors. Most small island nations do not have the resources to fight sea level rise in the way that the Dutch have. Retreat can occur as a gradual process or as catastrophic abandonment. Prohibiting construction close to the water's edge is a good approach. Sea level histories for each island state should be compiled and updated, island geomorphology and settlement patterns should be surveyed to determine risk areas, storm regimes should be determined, and information on coastal impacts of sea level rise should be disseminated to the public
Vicia vulcanorum (Fabaceae a new species from the island of Lanzarote (Canary Islands
Directory of Open Access Journals (Sweden)
Morales-Mateos, J. B.
2012-12-01
Full Text Available Vicia vulcanorum J. Gil & M. L. Gil (Fabaceae, a new species of subg. Cracca (Dumort. Peterm., sect. Cracca Dumort. is described and illustrated from the island of Lanzarote, Canary Islands, north-west of Africa. It is related to and compared with Vicia cirrhosa C. Sm. ex Webb & Berthel. and Vicia filicaulis Webb & Berthel., two endemic species from the western and central group of the Canary Islands, and Vicia ferreirensis Goyder, an endemic species from Porto Santo Island, Madeira Archipelago.Se describe e ilustra Vicia vulcanorum J. Gil & M. L. Gil (Fabaceae, una nueva especie y endemismo de la isla de Lanzarote, Islas Canarias, perteneciente al subg. Cracca (Dumort. Peterm., sect. Cracca Dumort. Se encuentra relacionada y es comparada con Vicia cirrhosa C. Sm. ex Webb & Berthel. y Vicia filicaulis Webb & Berthel., especies endémicas de las islas centrales y occidentales del archipiélago canario, y con Vicia ferreirensis Goyder, especie endémica de la isla de Porto Santo, en el archipiélago de Madeira.
Shadow management applied in the first AP1000 project under the islands contract condition
International Nuclear Information System (INIS)
Liu Xiao
2010-01-01
As the global first AP1000 nuclear project, Sanmen phase I nuclear project itself has many challenges from design, procurement to construction managements for non practical nuclear project and experience can be referenced. Islands contract pattern was adopted by this project and this contract pattern has its own strength and weakness. Considering the negative influence result from the first unit, this project has the great postpone risk. Shadow management here tries to reduce these risks and enhance the project surveillance and control by the owner to promote the final goal of this project. (authors)
Neoclassical islands on COMPASS-D
International Nuclear Information System (INIS)
Gates, D.A.; Lloyd, B.; Morris, A.W.; McArdle, G.; O'Brien, M.R.; Valovic, M.; Warrick, C.D.; Wilson, H.R.
1997-01-01
Neoclassical magnetic islands are observed to limit the achievable β in COMPASS-D low collisionality single null divertor tokamak plasmas with ITER-like geometry (R 0 = 0.56 m, B 0 1.2 T, I p = 120-180 kA, κ = 1.6, ε = 0.3). The limiting β is typically well below that expected from ideal instabilities with maximum βN in the range of 1.6 to 2.1. The plasma is heated with up to 1.8 MW of 60 GHz electron cyclotron resonance heating (ECRH) at the second harmonic with X mode polarization. The time history of the measured island width is compared with the predictions of neoclassical tearing mode theory, with good agreement between theory and experiment. The measured islands have a threshold width below which the mode will not grow. The density scaling of the point of onset of the measured instabilities is compared with two theories that predict a threshold island width for the onset of neoclassical tearing modes. Applied resonant helical error fields are used to induce islands in collisionality regimes wherein the neoclassical islands do not occur naturally, allowing the study of the behaviour of neoclassical tearing modes in this regime. The critical β for the onset of neoclassical tearing modes is seen to be ∼3 times higher in the naturally stable region. This observation is compared with the predictions of both threshold theories. A simple expression for the q scaling of the maximum achievable β N in the presence of neoclassical tearing modes is derived on the basis of the assumption of a maximum allowable island width. The predicted q scaling of this β limit is compared with data from a q scan, and the results are in good agreement. (author)
Directory of Open Access Journals (Sweden)
Desiderio Juan García-Almeida
2017-05-01
Full Text Available This paper sheds light on the relationship between immigration and tourism competitiveness on the island of Lanzarote through the analysis of reputation from the demand perspective. The tourists’ knowledge about news on immigration from a destination, their contact with immigrants in the area, and the influence of the presence of immigrants there are studied, as all these factors can have a major impact on island competitiveness in tourism. The empirical work has been conducted with a survey of tourists on Lanzarote, Canary Islands, Spain. A total of 359 valid questionnaires were obtained. Results show a relatively low impact and retention of immigration news about the destination, and a low perceived contact with non-European immigrants when visiting the island. Moreover, tourists tend to recognize the positive value created by immigrants on the island, though some negative effects are also indicated. Finally, immigration seems to have a positive impact on the tourist’s global satisfaction and loyalty to the island destination.
Backscatter 0.5m TIFF Mosaic of St. Croix (Buck Island), US Virgin Islands, 2004
National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 0.5 meter resolution backscatter mosaic of the north shore of Buck Island, St. Croix, US Virgin Islands. NOAA's NOS/NCCOS/CCMA Biogeography...
Schneider, James C.; Kruse, Sarah E.
2003-12-01
The freshwater lens on small islands may easily be overexploited or polluted due to dense development combined with improper management. On small carbonate islands complexities in fresh groundwater distribution are most commonly driven by geologic heterogeneities and their attendant impact on permeability and effective recharge patterns. Siliciclastic islands (composed primarily of quartz sand and other silica-based minerals) have been less well studied, and fewer common patterns of lens development have emerged. On some siliciclastic islands correlations between geology and lens geometries are weak; on these islands the freshwater lens geometry may be largely determined by how vegetation and terrain elevation affect recharge. Other factors such as unequal sea level on opposite sides of an island and transient variability (natural island migration and climate variability) may also be locally significant. Two barrier islands in the northeast Gulf of Mexico fall into this category of siliciclastic islands. Relationships between lens morphology, geology, vegetation, terrain, and sea level and transient effects are documented on St George Island and Dog Island, FL. Patterns of fresh groundwater occurrence are deduced with electrical and electromagnetic geophysical methods. Although isolated cores show geologic layering that could potentially control freshwater lens development, ground penetrating radar and seismic surveys show no evidence of semi-continuous subhorizontal layering. Inferred lens thickness and geometry suggests that site geology plays a relatively minor role as a cause of complexity in lens formation. Lens geometry does appear to be related to terrain and vegetation variability, and further complicated by the continuous reforming of these islands by coastal processes and human development.
Directory of Open Access Journals (Sweden)
Eli Sarnat
2013-01-01
Full Text Available The intent of this paper is to facilitate future research of the Solomon Islands ant fauna by providing the first comprehensively researched species inventory in over 75 years. The species list presented here includes the names of all ant species recorded from the islands that are available in the literature together with specimen records from several museum collections and new records from our 2008 Makira field expedition. All the names of described species presented are valid in accordance with the most recent Formicidae classification. In total, the checklist is composed of 237 species and subspecies (including 30 morphospecies in 59 genera representing nine subfamilies. We report that the recent field expedition added 67 new species records to Makira and 28 new species records to the Solomon Islands. Our research recovered species occurrence records for 32 individual islands and five island groups. The five islands with the highest number of recorded species are: Makira (142 spp., Guadalcanal (107 spp., Malaita (70 spp., Santa Isabel (68 spp., and Rennell (66 spp.. Based on our results, we discuss the taxonomic composition of the archipelago’s ant fauna, which islands are most in need of additional sampling, and the importance of establishing biodiversity baselines before environmental threats such as the invasive ant Wasmannia auropunctata cause irrevocable harm to the native biodiversity.
Reduction of Islands in Full-pressure Stellarator Equilibria
International Nuclear Information System (INIS)
Hudson, S.R.; Monticello, D.A.; Reiman, A.H.
2001-01-01
The control of magnetic islands is a crucial issue in designing Stellarators. Islands are associated with resonant radial magnetic fields at rational rotational-transform surfaces and can lead to chaos and poor plasma confinement. In this article, we show that variations in the resonant fields of a full-pressure stellarator equilibrium can be related to variations in the boundary via a coupling matrix, and inversion of this matrix determines a boundary modification for which the island content is significantly reduced. The numerical procedure is described and the results of island optimization are presented. Equilibria with islands are computed using the Princeton Iterative Equilibrium Solver, and resonant radial fields are calculated via construction of quadratic-flux-minimizing surfaces. A design candidate for the National Compact Stellarator Experiment [Phys. Plasmas 8, 2001], which has a large island, is used to illustrate the technique. Small variations in the boundary shape are used to reduce island size and to reverse the phase of a major island chain
Indonesia's great frontier and migration policy.
Maloney, C
1987-01-01
The population of Indonesia is 175 million, of which 65% live in Java. Java has only 7% of the land area, causing a population density of 2,000/square mile. This has lead the government to introduce a policy of transmigration which encourages people to move from Java to the larger outer islands. In the last 35 years 4.3 million people have moved from Java to Sumatra, Borneo, Celebes, and Irian Jaya. The total area of Indonesia stretches over 3,200 miles and has 16,000 islands of which 1,000 are inhabited. It has vast resources of oil, lumber, rubber, tin, palm oil, copra, coffee, tea, pepper, cloves, nutmeg, and quinine. Indonesia is also rich in minerals, including coal, bauxite, iron ore, and gold. Even with a national family planning program, population growth has reached 2.1% a year. 3 other islands that people are induced to move from are Madura, Bali, and Lombok, although their population densities are less then Java. The small islands near Singapore are being developed and Batam will be a free port to compete with Hong Kong. The most intense migration has been to Kalimantan (Borneo) which has 4 provinces. The migration policy began in 1905 and by 1930 100,000 people, had moved to other islands; 600,000 people were relocated to plantations in Java for labor needs. In 1979-84, a more ambitious program costing 2.3 billion moved 1.5 million people. In the most recent 1984-89 plan, a goal of 3.1 million were to be relocated but due to budgetary restrictions only 150,000 families have moved. The main social issue addresses the domination of other people by Javanese, not only in numbers but cultural differences. Some observers say the real reason for migration is political in ensuring the boundaries and geographic integrity of Indonesia.
Sleeman, Jonathan M.; Cerveny, Shannon
2014-01-01
Anesthesia of great apes is often necessary to conduct diagnostic analysis, provide therapeutics, facilitate surgical procedures, and enable transport and translocation for conservation purposes. Due to the stress of remote delivery injection of anesthetic agents, recent studies have focused on oral delivery and/or transmucosal absorption of preanesthetic and anesthetic agents. Maintenance of the airway and provision of oxygen is an important aspect of anesthesia in great ape species. The provision of analgesia is an important aspect of the anesthesia protocol for any procedure involving painful stimuli. Opioids and nonsteroidal anti-inflammatory drugs (NSAIDs) are often administered alone, or in combination to provide multi-modal analgesia. There is increasing conservation management of in situ great ape populations, which has resulted in the development of field anesthesia techniques for free-living great apes for the purposes of translocation, reintroduction into the wild, and clinical interventions.
36 CFR 13.1178 - Closed waters, islands and other areas.
2010-07-01
... southeast of Flapjack Island; or Eider Island; or Boulder Island; or Geikie Rock; or Lone Island; or the... islands) of the easternmost point of Russell Island; or Graves Rocks (on the outer coast); or Cormorant... and Preserve Vessel Operating Restrictions § 13.1178 Closed waters, islands and other areas. The...
Cliffs and quarries in the eastern coast of the Favignana island (Sicily, Italy)
International Nuclear Information System (INIS)
Falconi, Luca; Peloso, Alessandro; Screpanti Tatì, Angelo; Verrubbi, Vladimiro
2015-01-01
Favignana Island (Sicily, Italy) is a historical and environmental attraction site frequented by tourists especially during the long warm season of the year. Over several centuries the sea cliffs constituted by calcareous sandstone outcropping in the east side of the island have been exploited for the production of building stone. Currently the quarries used for the rock extraction as well as the natural cliffs are undergoing extensive erosional and gravitational processes. Besides putting at risk the safety of the people attending the area, the widespread rock falls are likely to threaten sites of great historical and anthropological value that, once destroyed, can no longer be reconstructed. The rock mass quality assessment and slope displacements monitoring of cliffs were conducted with the aim of identifying the most active areas and providing support to the local authorities in the implementation of effective and sustainable mitigation measures. If adequate measures are taken in the future, operators and users of the tourist circuit will have the opportunity to enjoy these amazing sites with a lower landslide risk [it
Functional and phylogenetic structure of island bird communities.
Si, Xingfeng; Cadotte, Marc W; Zeng, Di; Baselga, Andrés; Zhao, Yuhao; Li, Jiaqi; Wu, Yiru; Wang, Siyu; Ding, Ping
2017-05-01
Biodiversity change in anthropogenically transformed habitats is often nonrandom, yet the nature and importance of the different mechanisms shaping community structure are unclear. Here, we extend the classic Theory of Island Biogeography (TIB) to account for nonrandom processes by incorporating species traits and phylogenetic relationships into a study of faunal relaxation following habitat loss and fragmentation. Two possible mechanisms can create nonrandom community patterns on fragment islands. First, small and isolated islands might consist of similar or closely related species because they are environmentally homogeneous or select for certain shared traits, such as dispersal ability. Alternatively, communities on small islands might contain more dissimilar or distantly related species than on large islands because limited space and resource availability result in greater competitive exclusion among species with high niche overlap. Breeding birds were surveyed on 36 islands and two mainland sites annually from 2010 to 2014 in the Thousand Island Lake region, China. We assessed community structure of breeding birds on these subtropical land-bridge islands by integrating species' trait and evolutionary distances. We additionally analysed habitat heterogeneity and variance in size ratios to distinguish biotic and abiotic processes of community assembly. Results showed that functional-phylogenetic diversity increased with island area, and decreased with isolation. Bird communities on the mainland were more diverse and generally less clustered than island bird communities and not different than randomly assembled communities. Bird communities on islands tend to be functionally similar and phylogenetically clustered, especially on small and isolated islands. The nonrandom decline in species diversity and change in bird community structure with island area and isolation, along with the relatively homogeneous habitats on small islands, support the environmental
Energy Technology Data Exchange (ETDEWEB)
Krause, P. [Inst. fuer Oekologie, Umweltvertraeglichkeit, Landschaftsplanung und Landesentwicklung, Westheim (Germany). igi Niedermeyer Inst.
1997-12-01
As part of the efforts made to collect ecological evidence in connection with the Nantenbach Bend project to link the Wuerzburg-Aschaffenburg-Frankfurt line with the new Wuerzburg-Hanover line the colony was observed at regular intervals after completion of the construction work with the intention of quantifying any effects on the population of grey herons. The counts that were carried out indicate that the number of breeding pairs halved in the period from 1990 to 1995 (49 pairs in 1995). On completion of the construction work the pairs once again increased in number, to 56 in 1996 and 52 in 1997. The conclusion that can be drawn from this is that the effects of construction work on the environment in the immediate vicinity were the main cause of negative developments in a bird population and that such measures have more extensive effects than has been assumed in the past. (orig.) [Deutsch] Im Rahmen der oekologischen Beweissicherung zum Vorhaben der Nantenbacher Kurve, die die Anbindung der Eisenbahnstrecke Wuerzburg-Aschaffenburg-Frankfurt am Main an die Neubaustrecke Wuerzburg-Hannover ermoeglicht, wurde die Graureiherkolonie in regelmaessigen Zeitabstaenden nach Fertigstellung der Baumassnahme untersucht. Die Bestandsaufnahmen sollen dazu dienen moegliche Auswirkungen auf die Graureiherpopulation zu quantifizieren. Aufgrund der Bestandszaehlungen wurde vom Jahr 1990 bis 1995 eine Halbierung der Brutpaare (49 Bp. in 1995) in der Kolonie festgestellt. Nach Beendigung der Bautaetigkeiten nahmen die Brutpaare von 56 Bp. in 1996 und 52 Bp. in 1997 wieder zu. Dies laesst darauf schliessen, dass baubedingte Auswirkungen im unmittelbaren Umfeld die hauptsaechliche Ursache fuer die negative Entwicklung eines Bestandes darstellen und einen groesseren Wirkungsgrad haben, als dieser bisher immer angenommen wurde. (orig.)
Oil exploration and production offshore Sakhalin Island
Energy Technology Data Exchange (ETDEWEB)
Reed, I.C. [Sakhalin Energy Investment Company, Yuzhno-Sakhalinsk (Russian Federation)
2006-11-15
The offshore oil and gas exploration that is currently taking place on Sakhalin Island was discussed, with particular reference to the status of Sakhalin Energy and the challenges facing oil and exportation from the ice covered waters of Russia's Sea of Okhotsk. Sakhalin Energy, an incorporated joint venture of a consortium of companies, completed a feasibility study for oil production off the east coast of Sakhalin Island in December 1992. Sakhalin Energy has two fields, namely the Piltun Astokhskoye and Lunskoye fields. The Piltun Astokhskoye field is currently under production via the Molikpaq platform and the Lunskoye field and northern part of Piltun Astokhskoye field are currently being developed under the Phase 2 project. Since 1999, Sakhalin Energy has been producing oil from a caisson structure drilling rig which was fitted with ice protection shielding around the waterline in order to comply with Russian requirements. Production is via an undersea pipeline to a Single Anchor Leg Mooring (SALM) unit and then to a Floating Storage and Offloading unit (FSO). A brief outline of the structure was presented along with current ice management procedures and arrangements. In order to maximize the length of the production season, ice management is used to enable an early start and a late end to production. It was noted that great care is taken to ensure that the operations in ice are carried out with consideration of the environmentally sensitive area that is home to the endangered Western Gray Whale and Stellar Sea Eagle. 3 refs., 1 tab., 7 figs.
Short term solar radiation forecasting: Island versus continental sites
International Nuclear Information System (INIS)
Boland, John; David, Mathieu; Lauret, Philippe
2016-01-01
Due its intermittency, the large-scale integration of solar energy into electricity grids is an issue and more specifically in an insular context. Thus, forecasting the output of solar energy is a key feature to efficiently manage the supply-demand balance. In this paper, three short term forecasting procedures are applied to island locations in order to see how they perform in situations that are potentially more volatile than continental locations. Two continental locations, one coastal and one inland are chosen for comparison. At the two time scales studied, ten minute and hourly, the island locations prove to be more difficult to forecast, as shown by larger forecast errors. It is found that the three methods, one purely statistical combining Fourier series plus linear ARMA models, one combining clear sky index models plus neural net models, and a third using a clear sky index plus ARMA, give similar forecasting results. It is also suggested that there is great potential of merging modelling approaches on different horizons. - Highlights: • Solar energy forecasting is more difficult for insular than continental sites. • Fourier series plus linear ARMA models are one forecasting method tested. • Clear sky index models plus neural net models are also tested. • Clear sky index models plus linear ARMA is also an option. • All three approaches have similar skill.
Fleischer, R C; McIntosh, C E; Tarr, C L
1998-04-01
The Hawaiian Islands form as the Pacific Plate moves over a 'hot spot' in the earth's mantle where magma extrudes through the crust to build huge shield volcanos. The islands subside and erode as the plate carries them to the north-west, eventually to become coral atolls and seamounts. Thus islands are ordered linearly by age, with the oldest islands in the north-west (e.g. Kauai at 5.1 Ma) and the youngest in the south-east (e.g. Hawaii at 0.43 Ma). K-Ar estimates of the date of an island's formation provide a maximum age for the taxa inhabiting the island. These ages can be used to calibrate rates of molecular change under the following assumptions: (i) K-Ar dates are accurate; (ii) tree topologies show that derivation of taxa parallels the timing of island formation; (iii) populations do not colonize long after island emergence; (iv) the coalescent point for sister taxa does not greatly predate the formation of the colonized younger island; (v) saturation effects and (vi) among-lineage rate variation are minimal or correctable; and (vii) unbiased standard errors of distances and regressions can be estimated from multiple pairwise comparisons. We use the approach to obtain overall corrected rate calibrations for: (i) part of the mitochondrial cytochrome b gene in Hawaiian drepanidines (0.016 sequence divergence/Myr); (ii) the Yp1 gene in Hawaiian Drosophila (0.019/Myr Kambysellis et al. 1995); and (iii) parts of the mitochondrial 12S and 16S rRNA and tRNAval in Laupala crickets (0.024-0.102/Myr, Shaw 1996). We discuss the reliability of the estimates given the assumptions (i-vii) above and contrast the results with previous calibrations of Adh in Hawaiian Drosophila and chloroplast DNA in lobeliods.
Deer Island Aquatic Ecosystem Restoration Project
2015-07-01
across the U.S. Army Corps of Engineers (USACE) requires that a broad base of EWN understanding and support be built . The Deer Island Aquatic...USACE) requires that a broad base of EWN understanding and support be built . The Deer Island Aquatic Ecosystem Restoration Project (Deer Island AERP...Mississippi Wetlands Restoration Projects). The project received additional funding through several public laws in response to hurricane damages
Sedimentary Fatty Alcohols in Kapas Island, Terengganu
International Nuclear Information System (INIS)
Noor Farahin Amiruddin; Mohamad Iznul Muazim Mohamad Zabidi; Nurul Fathihah Mt Nanyan; Masni Mohd Ali; Masni Mohd Ali
2015-01-01
A geochemical study was carried out to identify the composition and sources of fatty alcohols in Kapas Island, Terengganu, Malaysia. Fatty alcohols in surface sediments were extracted and analyzed using Gas Chromatography - Mass Spectrometry (GC-MS). A total of 23 fatty alcohol compounds were identified in the Kapas Island sediment. Total concentrations of fatty alcohols ranged from 0.53 to 21.31 ng/ g dry weight and the highest total concentration was found at S2, which is probably due to its location profile that is located north of Kapas Island which is close to several small islands. The short chain/ long chain fatty alcohol ratio and alcohol source index (ASI) were used together to identify the dominant input in Kapas Island. Kapas Island sediments contained a mixture of organic sources, of which terrestrial sources were indicated to be the most abundant sources in these marine sediments. (author)
Assessing qualitative long-term volcanic hazards at Lanzarote Island (Canary Islands
Directory of Open Access Journals (Sweden)
L. Becerril
2017-07-01
Full Text Available Conducting long-term hazard assessment in active volcanic areas is of primary importance for land-use planning and defining emergency plans able to be applied in case of a crisis. A definition of scenario hazard maps helps to mitigate the consequences of future eruptions by anticipating the events that may occur. Lanzarote is an active volcanic island that has hosted the largest (> 1.5 km3 DRE and longest (6 years eruption, the Timanfaya eruption (1730–1736, on the Canary Islands in historical times (last 600 years. This eruption brought severe economic losses and forced local people to migrate. In spite of all these facts, no comprehensive hazard assessment or hazard maps have been developed for the island. In this work, we present an integrated long-term volcanic hazard evaluation using a systematic methodology that includes spatial analysis and simulations of the most probable eruptive scenarios.
Notes from the church of the Virgin at the island of Mali grad
Directory of Open Access Journals (Sweden)
Cvetkovski Sašo
2010-01-01
Full Text Available In this text the unknown parts of the wall paintings from the Church of the Virgin at the island of Mali Grad (The Great Prespa Lake are analyzed: the figure of a monk praying to St. Paraskeve, on the southern wall of the nave, as well as the painting on the southern faüade with the depictions of St. George on horseback, the Virgin as Empress enthroned, and the bust of two saints, St. Paraskeve and St. Nicholas. The monk is identified with the hegoumenos Jona, mentioned in the donor’s inscription dating from 1369.
Fuelwood production in Prince Edward Island
International Nuclear Information System (INIS)
McCallum, B.
1992-01-01
The most recent Prince Edward Island Fuelwood Survey occurred in 1990-91. Consumption of fuelwood rose again to 49% of Prince Edward Island's 43,170 households. Total residential fuelwood consumption was estimated to be 242,000 m 3 . The fuelwood industry makes an important contribution to the economy of Prince Edward Island. In the 1990-91 heating season, fuelwood valued at USD 9 million displaced approximately 43 million litres of domestic heating oil valued at USD 16.4 million. In addition, it is estimated that 70 cents of every dollar spent on fuelwood remains in the province and contributes spin-off benefits, whereas 90 cents of every dollar spent on heating oil is lost to the economy of Prince Edward Island. The percentage of people cutting their own fuelwood decreased from 52 in 1984-85 to only 23.4 in 1990-91. The governments of Canada and Prince Edward Island have implemented a series of Forest Resource Development Agreements (FRDAs) starting in 1983. The current 1988-1993 FRDA provides USD 24 million for research and incentives for reforestation and management of Prince Edward Island woodlots. It is expected that 3,800 Prince Edward Island woodlot owners will be participating in a woodlot management program by 1993. Silviculture treatments of hardwood stands include thinning, stand conversion (removal of lowgrade softwoods such as balsam fir in mainly hardwood stands), and shelterwood (strip) cutting, particularly in marginal stands. (9 refs.)
A Novel Unscheduled Islanding Detection Method for Microgrid
Directory of Open Access Journals (Sweden)
Li Hui
2018-01-01
Full Text Available Microgrid with its intelligent and flexible control characteristics conform to the trend of sustainable development of electricity, and when the microgrid in the unplanned island state, the successful detection of the island is a prerequisite, energy storage inverter as the key equipment in the microgrid system, island protection is one of the necessary functions. In this paper, an improved islanding detection method based on active frequency drift and q-axis reactive power perturbation is proposed. The method has the advantages of faster detection speed and minor influence on power quality, which makes the energy storage inverter with better output power quality when it works on grid-connected state, and can be detected the islanding state quickly from grid-connected mode to islanded mode. Finally, the validity and superiority of the improved island detection method are verified by simulation experiments.
Spatial and temporal fish diversity patterns from Santa Catarina Island, Brazil
Directory of Open Access Journals (Sweden)
André Cattani
2015-11-01
Full Text Available The Santa Catarina Island has a mosaic of ecosystems, with great importance for the fishes. There is the presence of estuaries, lagoons, mangroves and sandy beaches in the same island. Thus, the objectives of this study were to evaluate the spatio and temporal fish diversity patterns in estuaries, lagoons and beach systems of Santa Catarina Island, Santa Catarina, Brazil. Fish data collected between 1983 to 2011 in the baía Norte, saco dos Limões, Itacorubi and Ratones mangroves, Conceição lagoon and Índio beach was analyzed. Fish were sampled with different gear techniques. In the North Bay and saco dos Limões individuals were caught by trawl, but in the mangroves and lagoon were used gillnets, cast nets and dip nets. In the Índio beach the fishes were collected using fyke nets. For each local, species accumulation curves were plotted to compare the observed pattern with modelled data, using first order Jackknife estimator. Species richness differences among locals and seasons were tested using PERMANOVA, followed by a canonical analysis of principal coordinates (CAP. To assess the taxonomic structures at each location, the average taxonomic distinctness (AvTD and the variation in taxonomic distinctness (VarTD were also used. Higher average species richness was found in the saco dos Limões (mean ± SE; 59.8 ± 2.5, followed by Índio Beach (55.7 ± 2.7, Conceição lagoon (52.3 ± 6.4, North bay (45.0 ± 2.5, mangrove Itacorubi (34.5 ± 3.2 and mangrove Ratones (30.8 ± 3.8. No significate differences for the taxonomic patterns were observed between seasons. Furthermore the hereby data suggest that the fish assemblages of the inner portion of the island of Santa Catarina are mainly formed by estuarine and marine fish, but differing in species richness among locals.
Economic–environmental hierarchical frequency management of a droop-controlled islanded microgrid
International Nuclear Information System (INIS)
Rezaei, Navid; Kalantar, Mohsen
2014-01-01
Highlights: • Modeling the steady-state frequency of the droop-controlled microgrids. • Precise formulation the hierarchical control levels of islanded microgrids. • Economic–environmental frequency management using mixed-integer linear programming. • Proposing a novel objective function based on the microgrid daily frequency profile. • Scheduling primary and secondary control reserves using a stochastic optimization. - Abstract: This paper presents a novel energy management system (EMS) for a microgrid to enhance the power system security in a cost-effective manner. Small size of the islanded microgrids, high levels of intermittency and energy fluctuations, lower inertia potential of inverter-interfaced distributed energy resources (DERs) makes the frequency a vital factor in the microgrid energy management system that should be managed subject to the economic–environmental policies of the microgrid EMS. The proposed model is based on precise energy and reserve scheduling of the DERs in a droop-controlled islanded microgrid to manage the possible microgrid frequency excursions. The expected value of the microgrid frequency excursions stem from system power deviations is employed as a new objective function in this study, which is aimed to be minimized using a two stage stochastic mixed-integer linear programming method. In order to model the hierarchical control structure of the islanded microgrid, the frequency dependent behavior of the droop-controlled inverter-interfaced DERs is formulated thoroughly. The proposed model is applied to a typical microgrid test system. The primary and secondary frequency control reserves are appropriately scheduled over a 24 h period. A methodology based on the Monte-Carlo simulation strategy is adapted to generate some random scenarios corresponding to renewable generation variations, load consumption deviations and contingencies of line/unit outages. The generated scenarios are reduced and applied to the
Muhs, D.R.; Budahn, J.R.; Johnson, D.L.; Reheis, M.; Beann, J.; Skipp, G.; Fisher, E.; Jones, J.A.
2008-01-01
There is an increasing awareness that dust plays important roles in climate change, biogeochemical cycles, nutrient supply to ecosystems, and soil formation. In Channel Islands National Park, California, soils are clay-rich Vertisols or Alfisols and Mollisols with vertic properties. The soils are overlain by silt-rich mantles that contrast sharply with the underlying clay-rich horizons. Silt mantles contain minerals that are rare or absent in the volcanic rocks that dominate these islands. Immobile trace elements (Sc-Th-La and Ta-Nd-Cr) and rare-earth elements show that the basalt and andesite on the islands have a composition intermediate between upper-continental crust and oceanic crust. In contrast, the silt fractions and, to a lesser extent, clay fractions of the silt mantle have compositions closer to average upper-continental crust and very similar to Mojave Desert dust. Island shelves, exposed during the last glacial period, could have provided a source of eolian sediment for the silt mantles, but this is not supported by mineralogical data. We hypothesize that a more likely source for the silt-rich mantles is airborne dust from mainland California and Baja California, either from the Mojave Desert or from the continental shelf during glacial low stands of sea. Although average winds are from the northwest in coastal California, easterly winds occur numerous times of the year when "Santa Ana" conditions prevail, caused by a high-pressure cell centered over the Great Basin. The eolian silt mantles constitute an important medium of plant growth and provide evidence that abundant eolian silt and clay may be delivered to the eastern Pacific Ocean from inland desert sources. ?? 2007 Geological Society of America.
Sagonas, Kostas; Pafilis, Panayiotis; Valakos, Efstratios D.
2015-10-01
Living on islands entails numerous challenges for animals, among which resource scarcity stands out. In order to survive, animals have to optimize energy acquisition. We examined the impact of insularity on digestion comparing a series of physiological and morphological traits of adult males between insular and mainland populations of the Balkan green lizard. Island lizards had longer gastrointestinal tracts and gut passage times and higher digestive efficiencies. The dissection of the hindgut revealed an unexpected finding, the presence of cecal valves that were more frequent in island lizards. Thanks to all above islanders retain food for longer periods and thus maximize energy income and increase the amount of the extracted nutrients. That way, they secure energy income from the limited, in time and quantity, food resources of the islands.
International Nuclear Information System (INIS)
MacLeod, G.K.
1986-01-01
The accident at Three Mile Island proved that the Pennsylvania Department of Health lacked the tools to deal with the serious health consequences that occurred during and after this emergency. Despite the relative safety of nuclear power generation, we must be better prepared for the health and medical consequences of serous radiation emergencies. The author reviews the Three Mile Island accident through the eyes of newspaper reporters
Coastal Impacts of the March 11th Tohoku, Japan Tsunami in the Galapagos Islands
Lynett, Patrick; Weiss, Robert; Renteria, Willington; De La Torre Morales, Giorgio; Son, Sangyoung; Arcos, Maria Elizabeth Martin; MacInnes, Breanyn Tiel
2013-06-01
On March 11, 2011 at 5:46:23 UTC (March 10 11:46:23 PM Galapagos Local Time), the Mw 9.0 Great East Japan Earthquake occurred near the Tohoku region off the east coast of Japan, spawning a Pacific-wide tsunami. Approximately 12,000 km away, the Galapagos Islands experienced moderate tsunami impacts, including flooding, structural damage, and strong currents. In this paper, we present observations and measurements of the tsunami effects in the Galapagos, focusing on the four largest islands in the archipelago; (from west to east) Isabela, Santiagio, Santa Cruz, and San Cristobal. Access to the tsunami affected areas was one of the largest challenges of the field survey. Aside from approximately ten sandy beaches open to tourists, all other shoreline locations are restricted to anyone without a research permit; open cooperation with the Galapagos National Park provided the survey team complete access to the Islands coastlines. Survey locations were guided by numerical simulations of the tsunami performed prior to the field work. This numerical guidance accurately predicted the regions of highest impact, as well as regions of relatively low impact. Tide-corrected maximum tsunami heights were generally in the range of 3-4 m with the highest runup of 6 m measured in a small pocket beach on Isla Isabela. Puerto Ayora, on Santa Cruz Island, the largest harbor in the Galapagos experienced significant flooding and damage to structures located at the shoreline. A current meter moored inside the harbor recorded relatively weak tsunami currents of less than 0.3 m/s (0.6 knot) during the event. Comparisons with detailed numerical simulations suggest that these low current speed observations are most likely the result of data averaging at 20-min intervals and that maximum instantaneous current speeds were considerably larger. Currents in the Canal de Itabaca, a natural waterway between Santa Cruz Island and a smaller island offshore, were strong enough to displace multiple 5
Surficial geology of the sea floor in Long Island Sound offshore of Plum Island, New York
McMullen, K.Y.; Poppe, L.J.; Danforth, W.W.; Blackwood, D.S.; Schaer, J.D.; Ostapenko, A.J.; Glomb, K.A.; Doran, E.F.
2010-01-01
The U.S. Geological Survey (USGS), the Connecticut Department of Environmental Protection, and the National Oceanic and Atmospheric Administration (NOAA) have been working cooperatively to interpret surficial sea-floor geology along the coast of the Northeastern United States. NOAA survey H11445 in eastern Long Island Sound, offshore of Plum Island, New York, covers an area of about 12 square kilometers. Multibeam bathymetry and sidescan-sonar imagery from the survey, as well as sediment and photographic data from 13 stations occupied during a USGS verification cruise are used to delineate sea-floor features and characterize the environment. Bathymetry gradually deepens offshore to over 100 meters in a depression in the northwest part of the study area and reaches 60 meters in Plum Gut, a channel between Plum Island and Orient Point. Sand waves are present on a shoal north of Plum Island and in several smaller areas around the basin. Sand-wave asymmetry indicates that counter-clockwise net sediment transport maintains the shoal. Sand is prevalent where there is low backscatter in the sidescan-sonar imagery. Gravel and boulder areas are submerged lag deposits produced from the Harbor Hill-Orient Point-Fishers Island moraine segment and are found adjacent to the shorelines and just north of Plum Island, where high backscatter is present in the sidescan-sonar imagery.
From 3D to 4D seismic tomography at El Hierro Island (Canary Islands, Spain)
Garcia-Yeguas, A.; Koulakov, I.; Jakovlev, A.; Ibáñez, J. M.
2012-04-01
In this work we are going to show the advantages of a dynamic tomography 4D, versus a static image 3D related with a volcanic reactivation and eruption at El Hierro island (Canary Islands, Spain). In this process a high number of earthquakes before and during the eruptive processes have been registered. We are going to show a 3D image as an average of the velocity structure and then the characteristics and physical properties on the medium, including the presence or not of magma. This image will be complemented with its evolution along the time, observing its volcanic dynamic and its influence over the medium properties, including its power as an important element on early warnings protocols. After more than forty years of quiet at Canary Islands, since 1971 with Teneguía eruption at La Palma Island, and more than 200 years on El Hierro Island (The last eruption known at El Hierro took place in 1793, volcán de Lomo Negro), on 19th July on 2011 the Spanish seismic national network, administered by IGN (Instituto Geográfico Nacional), detected an increase of local seismic activity below El Hierro island (Canary Islands, Spain). Since this moment an intense swarm took place, with more than 11000 events, until 11th December, with magnitudes (MLg) from 0.2 to 4.4. In this period two eruptive processes have been declared in front of the South coast of El Hierro island, and they have not finished yet. This seismic swarm has allowed carrying out a 3D seismic tomography, using P and S waves traveltimes. It has showed a low velocity from the North to the South. On the other hand, we have performed a 4D seismic tomography, taking the events occurred at different intervals of time. We can observe the evolution of the negative anomaly along the time, from the North to the South, where has taken place La Restinga submarine eruption. 4D seismic tomography is an innovative and powerful tool able to show the evolution in time of a volcanic process.
DeGange, Anthony R.; Byrd, G. Vernon; Walker, Lawrence R.; Waythomas, C.F.
2010-01-01
deepwater basin of the Bering Sea to the north and shallower areas of intense upwelling in Atka and Fenimore Passes in the North Pacific Ocean to the south. This area apparently produces high marine productivity based on concentrations of feeding marine birds and mammals (see Drew et al., 2010 [this issue]). Kasatochi is about 85 km northeast of Adak, the nearest community and a regional transportation hub, and about 19 km northwest of the western end of Atka Island. The nearest historically active volcanoes are Great Sitkin volcano, about 35 km to the west, and Korovin volcano on Atka Island, about 94 km to the east. Koniuji Island, another small volcanic island, is located about 25 km east of Kasatochi (Fig. 1).
Hypersonic drift-tearing magnetic islands in tokamak plasmas
International Nuclear Information System (INIS)
Fitzpatrick, R.; Waelbroeck, F. L.
2007-01-01
A two-fluid theory of long wavelength, hypersonic, drift-tearing magnetic islands in low-collisionality, low-β plasmas possessing relatively weak magnetic shear is developed. The model assumes both slab geometry and cold ions, and neglects electron temperature and equilibrium current gradient effects. The problem is solved in three asymptotically matched regions. The 'inner region' contains the island. However, the island emits electrostatic drift-acoustic waves that propagate into the surrounding 'intermediate region', where they are absorbed by the plasma. Since the waves carry momentum, the inner region exerts a net force on the intermediate region, and vice versa, giving rise to strong velocity shear in the region immediately surrounding the island. The intermediate region is matched to the surrounding 'outer region', in which ideal magnetohydrodynamic holds. Isolated hypersonic islands propagate with a velocity that lies between those of the unperturbed local ion and electron fluids, but is much closer to the latter. The ion polarization current is stabilizing, and increases with increasing island width. Finally, the hypersonic branch of isolated island solutions ceases to exist above a certain critical island width. Hypersonic islands whose widths exceed the critical width are hypothesized to bifurcate to the so-called 'sonic' solution branch
Directory of Open Access Journals (Sweden)
Vroom, P.S.
2012-05-01
Full Text Available The marine benthic algae from Jarvis Island and Kingman Reef were identified from collections obtained from the Whippoorwill Expedition in 1924, the Itasca Expedition in 1935, the U.S. Coast Guard Cutter Taney in 1938, the Smithsonian Institution’s Pacific Ocean Biological Survey Program in 1964 and the U.S. National Oceanic and Atmospheric Administration’s Reef Assessment and Monitoring Program (RAMP in 2000, 2001, 2002, 2004 and 2006. A total of 124 species, representing 8 Cyanobacteria (blue-green algae, 82 Rhodophyta (red algae, 6 Heterokontophyta (brown algae and 28 Chlorophyta (green algae, are reported from both islands. Seventy-nine and 95 species of marine benthic algae are recorded from Jarvis Island and Kingman Reef, respectively. Of the 124 species, 77 species or 62% (4 blue-green algae, 57 red algae, 2 brown algae and 14 green algae have never before been reported from the 11 remote reefs, atolls and low islands comprising the Line Islands in the Central Pacific.
Small Island Visitor Attractions
Directory of Open Access Journals (Sweden)
Haven Allahar
2015-03-01
Full Text Available This article proposes a process framework for developing and managing visitor attractions (VA in small island developing states with Trinidad and Tobago, a two-island state in the Caribbean, as the case study. An extensive literature review was conducted, supported by field observations, individual depth interviews, and small and large focus group meetings. The process framework identified four sets of processes: national policy formulation and legislation; inventory, classification, evaluation, and ranking of VA; general operations management involving project management activities; and site specific activities of development, operations, and maintenance. The value of the framework lies in the fact that no similar framework applicable to small islands was covered in the literature and validation was obtained from a panel of experts and a cross section of tourism stakeholders in Tobago.
Predictable evolution toward flightlessness in volant island birds.
Wright, Natalie A; Steadman, David W; Witt, Christopher C
2016-04-26
Birds are prolific colonists of islands, where they readily evolve distinct forms. Identifying predictable, directional patterns of evolutionary change in island birds, however, has proved challenging. The "island rule" predicts that island species evolve toward intermediate sizes, but its general applicability to birds is questionable. However, convergent evolution has clearly occurred in the island bird lineages that have undergone transitions to secondary flightlessness, a process involving drastic reduction of the flight muscles and enlargement of the hindlimbs. Here, we investigated whether volant island bird populations tend to change shape in a way that converges subtly on the flightless form. We found that island bird species have evolved smaller flight muscles than their continental relatives. Furthermore, in 366 populations of Caribbean and Pacific birds, smaller flight muscles and longer legs evolved in response to increasing insularity and, strikingly, the scarcity of avian and mammalian predators. On smaller islands with fewer predators, birds exhibited shifts in investment from forelimbs to hindlimbs that were qualitatively similar to anatomical rearrangements observed in flightless birds. These findings suggest that island bird populations tend to evolve on a trajectory toward flightlessness, even if most remain volant. This pattern was consistent across nine families and four orders that vary in lifestyle, foraging behavior, flight style, and body size. These predictable shifts in avian morphology may reduce the physical capacity for escape via flight and diminish the potential for small-island taxa to diversify via dispersal.
Numerical modeling of atoll island hydrogeology.
Bailey, R T; Jenson, J W; Olsen, A E
2009-01-01
We implemented Ayers and Vachers' (1986) inclusive conceptual model for atoll island aquifers in a comprehensive numerical modeling study to evaluate the response of the fresh water lens to selected controlling climatic and geologic variables. Climatic factors include both constant and time-varying recharge rates, with particular attention paid to the effects of El Niño and the associated drought it brings to the western Pacific. Geologic factors include island width; hydraulic conductivity of the uppermost Holocene-age aquifer, which contains the fresh water lens; the depth to the contact with the underlying, and much more conductive, Pleistocene karst aquifer, which transmits tidal signals to the base of the lens; and the presence or absence of a semiconfining reef flat plate on the ocean side. Sensitivity analyses of steady-steady simulations show that lens thickness is most strongly sensitive to the depth to the Holocene-Pleistocene contact and to the hydraulic conductivity of the Holocene aquifer, respectively. Comparisons between modeling results and published observations of atoll island lens thicknesses suggest a hydraulic conductivity of approximately 50 m/d for leeward islands and approximately 400 m/d for windward islands. Results of transient simulations show that lens thickness fluctuations during average seasonal conditions and El Niño events are quite sensitive to island width, recharge rate, and hydraulic conductivity of the Holocene aquifer. In general, the depletion of the lens during drought conditions is most drastic for small, windward islands. Simulation results suggest that recovery from a 6-month drought requires about 1.5 years.
Climate Change in the Pacific Islands
Hamnett, Michael P.
Climate change have been a major concern among Pacific Islanders since the late 1990s. During that period, Time Magazine featured a cover story that read: Say Goodbye to the Marshall Islands, Kiribati, and Tuvalu from sea level rise. Since that time, the South Pacific Regional Environment Programme, UN and government agencies and academic researchers have been assessing the impacts of long-term climate change and seasonal to inter-annual climate variability on the Pacific Islands. The consensus is that long-term climate change will result in more extreme weather and tidal events including droughts, floods, tropical cyclones, coastal erosion, and salt water inundation. Extreme weather events already occur in the Pacific Islands and they are patterned. El Niño Southern Oscillation (ENSO) events impact rainfall, tropical cyclone and tidal patterns. In 2000, the first National Assessment of the Consequences of Climate Variability and Change concluded that long-term climate change will result in more El Niño events or a more El Niño like climate every year. The bad news is that will mean more natural disasters. The good news is that El Niño events can be predicted and people can prepare for them. The reallly bad news is that some Pacific Islands are already becoming uninhabitable because of erosion of land or the loss of fresh water from droughts and salt water intrusion. Many of the most vulnerable countries already overseas populations in New Zealand, the US, or larger Pacific Island countries. For some Pacific Islander abandoning their home countries will be their only option.
Great Lakes Restoration Initiative Great Lakes Mussel Watch(2009-2014)
National Oceanic and Atmospheric Administration, Department of Commerce — Following the inception of the Great Lakes Restoration Initiative (GLRI) to address the significant environmental issues plaguing the Great Lakes region, the...
Professional operation and management of nuclear island installation
International Nuclear Information System (INIS)
Ma Limin
2011-01-01
As an important part of nuclear power plant construction, nuclear island installation mainly involves main equipment installation, pipeline installation, associated procedure examination and other important tasks. However, due to the nuclear island installation management changing from single project to multi-projects, the problems such as professional management of nuclear island installation and the lack of technical staff become more and more prominent and become one of the key restricts to the work of nuclear island installation. Based on analysis of the single project, single-base nuclear island installation management and practice, combined with the current situation that multi-project and multi-base construction of nuclear power are carrying out at the same time, this paper proposes a new management model of nuclear island installation. (author)
Phytoseiid mites of the Canary Islands (Acari, Phytoseiidae. II. Tenerife and La Gomera Islands
Directory of Open Access Journals (Sweden)
Ferragut, F.
2007-12-01
Full Text Available Phytoseiid mites (Acari, Phytoseiidae inhabiting plants in natural ecosystems from Tenerife and La Gomera islands (Canary Islands have been studied. Surveys were conducted from 1997 to 2002. Eleven species were collected, one of them being reported for the first time from the Canary Islands and six of them reported for the first time from Tenerife and La Gomera islands. Euseius machadoi n. sp. collected from woody plants in the Canarian laurisilva is proposed as a new species.
En muestreos realizados desde 1997 hasta 2002 se ha estudiado la fauna de ácaros fitoseidos (Acari, Phytoseiidae asociada a plantas de ecosistemas naturales de las islas de Tenerife y La Gomera (Islas Canarias. Se han recolectado un total de 11 especies, siendo una de ellas citada por vez primera en las islas Canarias y seis de ellas citadas por primera vez en las islas de Tenerife y La Gomera. Euseius machadoi n. sp., recolectado en plantas leñosas de la laurisilva canaria, se propone como una nueva especie.
Decolonizing through integration: Australia's off-shore island territories
Directory of Open Access Journals (Sweden)
Roger Wettenhall
2016-11-01
Full Text Available Australia’s three small off-shore island territories – Norfolk Island in the Pacific Ocean and Christmas Island and the Cocos (Keeling Islands Group in the Indian Ocean – can be seen as monuments to 19th century British-style colonization, though their early paths to development took very different courses. Their transition to the status of external territories of the Australian Commonwealth in the 20th century – early in the case of Norfolk and later in the cases of Christmas and Cocos – put them on a common path in which serious tensions emerged between local populations which sought autonomous governance and the Commonwealth government which wanted to impose governmental systems similar to those applying to mainstream Australians. This article explores the issues involved, and seeks to relate the governmental history of the three island territories to the exploration of island jurisdictions developed in island studies research.
Directory of Open Access Journals (Sweden)
Paracuellos, M.
2003-12-01
Full Text Available Due to the high risk of the global extinction in which Patella ferruginea Gmelin, 1791 is found, it is considered of great interest to describe and quantify its demographic characteristics in those sites where it still persists, as well as to evaluate the reasons which have led this limpet to be one of the most threatened marine species in the Mediterranean Sea. Over the study period (2000-2002, systematic census were made on the perimeter of the Alboran Island (Alboran Sea, westernmost area of the Mediterranean Sea with the object to quantify the abundance of the species in the locality, as well as their external biometry and spatial distribution. As a result, the presence of a probable reproductive population of P. ferruginea was found on the island. The negative effect provoked by the continuous presence of man was proved, prejudicing the population in those zones which were more accessible for their harvesting. For this reason, it is necessary to regulate the use of the natural resources of the island to favour the conservation and spontaneous recolonisation of the zone by P. ferruginea.
Stock, Jan H.
1988-01-01
Pseudoniphargus was known from inland stygohabitats in the Iberian peninsula, the Azores, Madeira, N.W. Africa, and Bermuda, but not from the Canary Islands. Systematic sampling in six of the seven larger islands of the latter archipelago has revealed the presence of the genus in Tenerife (4
Reconstructed Marine Fisheries Catches at a Remote Island Group: Pitcairn Islands (1950–2014
Directory of Open Access Journals (Sweden)
Amy R. Coghlan
2017-09-01
Full Text Available The remote Pitcairn Island Group in the South Pacific was designated one of the world's largest marine reserves in 2016, encompassing some of the few remaining near-pristine areas within EEZ boundaries. Pitcairn's domestic fisheries are small-scale, and consist mainly of subsistence (non-commercial and limited artisanal (commercial catches. There is no locally-based industrial (large-scale commercial fishery and the level of foreign industrial activity in recent times has been minimal, due in part to the low biomass of commercially valuable species, along with economic constraints of the EEZ's geographic isolation. Using a catch reconstruction method we estimated the total domestic marine catches for the Pitcairn Islands from 1950 to 2014. We show that overall the Pitcairn Islands' small-scale fisheries catches were almost 2.5 times higher than the data reported by the Food and Agriculture Organization (FAO of the United Nations on behalf of the Pitcairn Islands, however, this primarily reflects discrepancies prior to the 1980s. Overall, catches for the subsistence and artisanal sectors started with around 12 t·year−1 in 1950, but declined to 4 t·year−1 by 2014. Domestic reconstructed subsistence catch levels were entirely driven by changes in the human population on the island, with reconstructed artisanal catches only occurring in recent years (2000 onwards. Industrial fishing is entirely executed by foreign vessels, this catch is considerably variable throughout the years and ceases entirely in 2006. The implementation of one of the world's largest marine reserves surrounding the offshore waters of Pitcairn Island has been specifically designed not to affect the rates of subsistence and artisanal fishing conducted by the resident population. Although there is no industrial fishing in the Pitcairn EEZ at present, climate change is predicted to influence the routes of migrating commercially-targeted species, potentially altering fishing
2010-07-01
... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Pacific Ocean off Orote Point, Apra Harbor, Island of Guam, Marianas Islands; small arms firing range. 334.1420 Section 334.1420... AND RESTRICTED AREA REGULATIONS § 334.1420 Pacific Ocean off Orote Point, Apra Harbor, Island of Guam...
Energy Technology Data Exchange (ETDEWEB)
Cao, Jinjia; Gong, Xueyu, E-mail: gongxueyu-usc@163.com; Xiang, Dong; Huang, Qianhong [School of Nuclear Science and Technology, University of South China, Hengyang 421001 (China); Yu, Jun [School of Mathematics and Physics, University of South China, Hengyang 421001 (China)
2016-08-15
The structure of the drift-island surface of passing fast ions (PFIs) is investigated in the presence of the resonant interaction with a magnetic island. Two overlapping regions of the drift-island surface and the magnetic island surface are found, one corresponding to local overlapping region and the other to non-local one. Here, the word “nonlocal” denotes that the resonances in the core plasma can have effects on the PFIs near the plasma boundary, while the “local” represents that the PFIs just near the resonant location are influenced. The nonlocal overlapping constructs a transport path along which the PFIs can become losses. There are three kinds of drift-island surfaces to join in forming the transport paths. A pitch angle region, which is called pitch angle gap, is found near the plasma boundary, where the drift-island surface cannot be formed and few PFIs are lost. The pitch-angle selective features of PFI losses are obtained by analyzing the three kinds of drift-island surfaces. The coupling between the crowd drift island surfaces and the collision can induce the prompt losses of PFIs and rapidly slowing down of PFI energy. The time of the prompt losses and the slowing down rate are calculated. Qualitatively, the theoretical results are in well agreement with the experimental observations in ASDEX Upgrade [M. García-Muñoz et al., Nucl. Fusion 47, L10 (2007)].
Non-Gaussianity in island cosmology
International Nuclear Information System (INIS)
Piao Yunsong
2009-01-01
In this paper we fully calculate the non-Gaussianity of primordial curvature perturbation of the island universe by using the second order perturbation equation. We find that for the spectral index n s ≅0.96, which is favored by current observations, the non-Gaussianity level f NL seen in an island will generally lie between 30 and 60, which may be tested by the coming observations. In the landscape, the island universe is one of anthropically acceptable cosmological histories. Thus the results obtained in some sense mean the coming observations, especially the measurement of non-Gaussianity, will be significant to clarify how our position in the landscape is populated.
The CpG island searcher: a new WWW resource.
Takai, Daiya; Jones, Peter A
2003-01-01
Clusters of CpG dinucleotides in GC rich regions of the genome called "CpG islands" frequently occur in the 5' ends of genes. Methylation of CpG islands plays a role in transcriptional silencing in higher organisms in certain situations. We have established a CpG-island-extraction algorithm, which we previously developed [Takai and Jones, 2002], on a web site which has a simple user interface to identify CpG islands from submitted sequences of up to 50kb. The web site determines the locations of CpG islands using parameters (lower limit of %GC, ObsCpG/ExpCpG, length) set by the user, to display the value of parameters on each CpG island, and provides a graphical map of CpG dinucleotide distribution and borders of CpG islands. A command-line version of the CpG islands searcher has also been developed for larger sequences. The CpG Island Searcher was applied to the latest sequence and mapping information of human chromosomes 20, 21 and 22, and a total of 2345 CpG islands were extracted and 534 (23%) of them contained first coding exons and 650 (28%) contained other exons. The CpG Island Searcher is available on the World Wide Web at http://www.cpgislands.com or http://www.uscnorris.com/cpgislands/cpg.cgi.
Aguiar, António M F; Pombo, Dora Aguin; Gonçalves, Ysabel M
2014-04-10
Two species of stick insects are currently known to be present in the Macaronesian archipelagos: Clonopsis gallica (Charpentier) (Phasmatodea: Bacillidae) on the Canary Islands and in the Azores and Carausius morosus (Sinéty) (Phasmatidae) in the Azores. Here, we provide the first reliable records of the presence and distribution of C. gallica and C. morosus on Madeira Island. Egg and adult stages are briefly described along with some notes on the life history of these species in captivity. Data on islandwide distribution are based on specimens donated by the public in response to an article published in a daily newspaper. This method of data collection raised great popular interest in stick insects. The role of newspapers as a means of communicating awareness in biodiversity issues is discussed. This is an open access paper. We use the Creative Commons Attribution 3.0 license that permits unrestricted use, provided that the paper is properly attributed.
Mandal, S.; Satpati, L. N.; Choudhury, B. U.; Sadhu, S.
2018-04-01
The present study assessed climate change vulnerability in agricultural sector of low-lying Sagar Island of Bay of Bengal. Vulnerability indices were estimated using spatially aggregated biophysical and socio-economic parameters by applying principal component analysis and equal weight method. The similarities and differences of outputs of these two methods were analysed across the island. From the integration of outputs and based on the severity of vulnerability, explicit vulnerable zones were demarcated spatially. Results revealed that life subsistence agriculture in 11.8% geographical area (2829 ha) of the island along the western coast falls under very high vulnerable zone (VHVZ VI of 84-99%) to climate change. Comparatively higher values of exposure (0.53 ± 0.26) and sensitivity (0.78 ± 0.14) subindices affirmed that the VHV zone is highly exposed to climate stressor with very low adaptive capacity (ADI= 0.24 ± 0.16) to combat vulnerability to climate change. Hence, food security for a population of >22 thousands comprising >3.7 thousand agrarian households are highly exposed to climate change. Another 17% area comprising 17.5% population covering 20% villages in north-western and eastern parts of the island also falls under high vulnerable (VI= 61%-77%) zone. Findings revealed large spatial heterogeneity in the degree of vulnerability across the island and thus, demands devising area specific planning (adaptation and mitigation strategies) to address the climate change impact implications both at macro and micro levels.
Diet patterns of island foxes on San Nicolas Island relative to feral cat removal
Cypher, Brian L.; Kelly, Erica C.; Ferrara, Francesca J.; Drost, Charles A.; Westall, Tory L.; Hudgens, Brian
2017-01-01
Island foxes (Urocyon littoralis) are a species of conservation concern that occur on six of the Channel Islands off the coast of southern California. We analysed island fox diet on San Nicolas Island during 2006–12 to assess the influence of the removal of feral cats (Felis catus) on the food use by foxes. Our objective was to determine whether fox diet patterns shifted in response to the cat removal conducted during 2009–10, thus indicating that cats were competing with foxes for food items. We also examined the influence of annual precipitation patterns and fox abundance on fox diet. On the basis of an analysis of 1975 fox scats, use of vertebrate prey – deer mice (Peromyscus maniculatus), birds, and lizards – increased significantly during and after the complete removal of cats (n = 66) from the island. Deer mouse abundance increased markedly during and after cat removal and use of mice by foxes was significantly related to mouse abundance. The increase in mice and shift in item use by the foxes was consistent with a reduction in exploitative competition associated with the cat removal. However, fox abundance declined markedly coincident with the removal of cats and deer mouse abundance was negatively related to fox numbers. Also, annual precipitation increased markedly during and after cat removal and deer mouse abundance closely tracked precipitation. Thus, our results indicate that other confounding factors, particularly precipitation, may have had a greater influence on fox diet patterns.
Li, Mao-Fen; Luo, Wei; Li, Hailiang; Liu, Enping; Li, Yuping
2018-04-01
Frequent occurrences of extreme precipitation events have significant impacts on agricultural production. Tropical agriculture has been playing an important role in national economy in China. A precise understanding of variability in extreme precipitation indices and their impacts on crop yields are of great value for farmers and policy makers at county level, particularly in tropical China where almost all agriculture is rainfed. This research has studied observed trends in extreme precipitation indices (a total of 10) during 1988-2013 over Hainan island, tropical China. Mann-Kendall nonparametric test was adopted for trend detection and the results showed that most of precipitation indices showed increasing trend. Since rice is the most important staple food in Hainan island, the impacts of extreme precipitation indices on rice yields were also analyzed through simple correlations. In general, the rainy days and rain intensity in late rice growing season showed increasing trend over Hainan island. The rice yield presented ninth-degree polynomial technological trend at all stations and increasing trend for early rice yield. Late rice yield showed a decreasing trend in some parts of Hainan island. Spearman rank correlation coefficient indicated that the correlation was more pronounced between extreme precipitation indices and yields at Haikou site for early rice, and Haikou, Sanya, and Qionghai stations for late rice, respectively. Further results also indicated that there were statistically significant positive trends of R10 and R20 (number of days with precipitation ≥10 mm and precipitation ≥20 mm, respectively) from July to November at Haikou (located in north of Hainan island), and this positive trend may be a disadvantage for late rice yield. The cut-off value of extreme precipitation indices and its correlation with rice yield anomaly indices for Hainan island provided a foundation for vulnerability assessment as well as a contribution to set up
Updating Rhode Island's strategic highway safety plan (SHSP).
2012-05-01
This report summarizes the peer exchange sponsored by the Rhode Island : Department of Transportation (RIDOT) that focused on Rhode Islands SHSP : update. : Rhode Islands goals for the peer exchange included learning from other States : expe...
Island Movements: Thinking with the Archipelago
Jonathan Pugh
2013-01-01
Whether in Homer or Plato, Shakespeare or Huxley, throughout history, thinking about islands has shaped how we think about human nature and our place in the world. However, to date archipelagos have received far less attention. This is problematic because we live, increasingly, in a world of island-island movements and not static forms. Not only in the more obvious cases of the Caribbean, Hawaii or the Philippines but, as Stratford et al (2011) say, many ‘continental forms’ like Canada and Au...
FOLK TRADITION OF THE ISLAND OF KRK IN THE WORK OF ANTUN BONIFAČIĆ
Directory of Open Access Journals (Sweden)
Ruža Bonifačić
1995-01-01
Full Text Available The article deals with the influence of the folk tradition of Croatia and of the Island of Krk on the literary and editorial work of Antun Bonifačić. Great attention is given to the musical aspects of folk tradition, and to the literal or consciously changed citations of the Krk traditional songs. The professional concepts connected with the folk music of Istrian-Adriatic area are discussed together with the selected traditional terms. From the opus of Antun Bonifačić is emerging, up to now unknown, field of his interest - folkloristics.
Obesity and Native Hawaiians/Pacific Islanders
... Population Profiles > Native Hawaiian/Other Pacific Islander > Obesity Obesity and Native Hawaiians/Pacific Islanders Native Hawaiians/Pacific ... youthonline . [Accessed 08/18/2017] HEALTH IMPACT OF OBESITY People who are overweight are more likely to ...
Asthma and Native Hawaiians/Pacific Islanders
... Population Profiles > Native Hawaiian/Other Pacific Islander > Asthma Asthma and Native Hawaiians/Pacific Islanders National data for ... very limited. While all of the causes of asthma remain unclear, children exposed to secondhand tobacco smoke ...
Immunizations and Asians and Pacific Islanders
... and Data > Minority Population Profiles > Asian American > Immunizations Immunizations and Asians and Pacific Islanders Asian/Pacific Islander ... 35 months reached the Healthy People goal for immunizations for hepatitis B, MMR (measles-mumps-rubella), polio ...
Control of paleoshorelines by trench forebulge uplift, Loyalty Islands
Dickinson, William R.
2013-07-01
Unlike most tropical Pacific islands, which lie along island arcs or hotspot chains, the Loyalty Islands between New Caledonia and Vanuatu owe their existence and morphology to the uplift of pre-existing atolls on the flexural forebulge of the New Hebrides Trench. The configuration and topography of each island is a function of distance from the crest of the uplifted forebulge. Both Maré and Lifou are fully emergent paleoatolls upon which ancient barrier reefs form highstanding annular ridges that enclose interior plateaus representing paleolagoon floors, whereas the partially emergent Ouvea paleoatoll rim flanks a drowned remnant lagoon. Emergent paleoshoreline features exposed by island uplift include paleoreef flats constructed as ancient fringing reefs built to past low tide levels and emergent tidal notches incised at past high tide levels. Present paleoshoreline elevations record uplift rates of the islands since last-interglacial and mid-Holocene highstands in global and regional sea levels, respectively, and paleoreef stratigraphy reflects net Quaternary island emergence. The empirical uplift rates vary in harmony with theoretical uplift rates inferred from the different positions of the islands in transit across the trench forebulge at the trench subduction rate. The Loyalty Islands provide a case study of island environments controlled primarily by neotectonics.
76 FR 27253 - Safety Zone; Catawba Island Club Fireworks, Catawba Island Club, Port Clinton, OH
2011-05-11
... environmental risk to health or risk to safety that may disproportionately affect children. Indian Tribal...-AA00 Safety Zone; Catawba Island Club Fireworks, Catawba Island Club, Port Clinton, OH AGENCY: Coast... zone in the Captain of the Port Detroit Zone on Lake Erie, Port Clinton, Ohio. This zone is intended to...
Susan M. Stein; Mary A. Carr; Greg C. Liknes; Sara J. Comas
2014-01-01
This report provides an overview of expected housing density changes and related impacts to private forests on America's islands in the Pacific and Caribbean, specifically Hawaii, Guam, American Samoa, the Commonwealth of the Northern Mariana Islands, Puerto Rico, and the U.S. Virgin Islands. We discuss the vulnerability of island forests to conversion for housing...
Estimating the Ground Water Resources of Atoll Islands
Directory of Open Access Journals (Sweden)
Arne E. Olsen
2010-01-01
Full Text Available Ground water resources of atolls, already minimal due to the small surface area and low elevation of the islands, are also subject to recurring, and sometimes devastating, droughts. As ground water resources become the sole fresh water source when rain catchment supplies are exhausted, it is critical to assess current groundwater resources and predict their depletion during drought conditions. Several published models, both analytical and empirical, are available to estimate the steady-state freshwater lens thickness of small oceanic islands. None fully incorporates unique shallow geologic characteristics of atoll islands, and none incorporates time-dependent processes. In this paper, we provide a review of these models, and then present a simple algebraic model, derived from results of a comprehensive numerical modeling study of steady-state atoll island aquifer dynamics, to predict the ground water response to changes in recharge on atoll islands. The model provides an estimate thickness of the freshwater lens as a function of annual rainfall rate, island width, Thurber Discontinuity depth, upper aquifer hydraulic conductivity, presence or absence of a confining reef flat plate, and in the case of drought, time. Results compare favorably with published atoll island lens thickness observations. The algebraic model is incorporated into a spreadsheet interface for use by island water resources managers.
National Oceanic and Atmospheric Administration, Department of Commerce — Gridded (40 m cell size) bathymetry of the shelf and slope environments of Howland Island, Pacific Remote Island Areas, Central Pacific. Almost complete bottom...
National Oceanic and Atmospheric Administration, Department of Commerce — Gridded (5 m cell size) bathymetry of the shelf and slope environments of Jarvis Island, Pacific Remote Island Areas, Central Pacific. Almost complete bottom...
National Oceanic and Atmospheric Administration, Department of Commerce — Gridded (40 m cell size) bathymetry of the shelf and slope environments of Baker Island, Pacific Remote Island Areas, Central Pacific. Almost complete bottom...
Decay process of a magnetic island by forced reconnection
International Nuclear Information System (INIS)
Nagasaki, K.; Itoh, K.
1991-03-01
Time evolution of a magnetic island by forced reconnection, especially the decay process is analyzed. A simple slab model is used and the magnetic island is considered to have a single helicity. The plasma is assumed to be incompressible. The evolution time is affected by the presence of an original magnetic island. In the decay process, a current flows along the separatrix of the magnetic island, and the current layer width depends on the magnetic island width, when the island is relatively wide compared to the current layer. In the presence of a magnetic island, even if the magnetic Reynolds number S increases, the current layer does not become narrower. This leads to the slow evolution of the magnetic island. It is found that the time scale S 1 τ A is required to reach the last equilibrium regardless of the nonlinear terms. This is slower than that of the growth process, S 3/5 τ A . (author)
Examples of storm impacts on barrier islands: Chapter 4
Plant, Nathaniel G.; Doran, Kara; Stockdon, Hilary F.
2017-01-01
This chapter focuses on the morphologic variability of barrier islands and on the differences in storm response. It describes different types of barrier island response to individual storms, as well as the integrated response of barrier islands to many storms. The chapter considers case study on the Chandeleur Island chain, where a decadal time series of island elevation measurements have documented a wide range of barrier island responses to storms and long-term processes that are representative of barrier island behaviour at many other locations. These islands are low elevation, extremely vulnerable to storms and exhibit a diversity of storm responses. Additionally, this location experiences a moderately high rate of relative sea-level rise, increasing its vulnerability to the combined impacts of storms and long-term erosional processes. Understanding how natural processes, including storm impacts and intervening recovery periods interact with man-made restoration processes is also broadly relevant to understand the natural and human response to future storms.
Researching Pacific island livelihoods: mobility, natural resource management and nissology.
Christensen, Andreas E; Mertz, Ole
2010-01-01
Small island literature is vast in focus and aim, and is rooted in many different disciplines. The challenge is to find common grounds for researching small islands conceptually and theoretically. The aim of this article is to comment on how to research small islands, including a discussion on contemporary theories of nissology and conceptual analytical frameworks for island research. Through a review of selected case-study-based island literature on changing livelihoods coming out of the South Pacific, we wish to illustrate and discuss advantages of finding common grounds for small island studies. The focus is on two dimensions of island livelihood, migration and natural resource management, both of which are significant contributors in making island livelihoods and shaping Pacific seascapes. We argue that there is still a substantial lack of studies targeting small island dynamics that are empirical and interdisciplinary in focus and link socio-economic and ecological processes of small island societies at temporal and analytical scales.
Energy Technology Data Exchange (ETDEWEB)
Herrera, Christian, E-mail: cherrera@ucn.cl [Universidad Católica del Norte, Av. Angamos 0610, Antofagasta (Chile); Custodio, Emilio [Department of Geo-Engineering, Technical University of Catalonia (UPC), Barcelona (Spain)
2014-10-15
The island of Fuerteventura is the oldest of the Canary Islands' volcanic archipelago. It is constituted by volcanic submarine and subaerial activity and intrusive Miocene events, with some residual later volcanism and Quaternary volcanic deposits that have favored groundwater recharge. The climate is arid, with an average rainfall that barely attains 60 mm/year in the coast and up to 200 mm/year in the highlands. The aquifer recharge is small but significant; it is brackish due to large airborne atmospheric salinity, between 7 and 15 g m{sup −2} year{sup −1} of chloride deposition, and high evapo-concentration in the soil. The average recharge is estimated to be less than about 5 mm/year at low altitude and up to 10 mm/year in the highlands, and up to 20 mm/year associated to recent lava fields. Hydrochemical and water isotopic studies, supported by water table data and well and borehole descriptions, contribute a preliminary conceptual model of groundwater flow and water origin in the Betancuria area, the central area of the island. In general, water from springs and shallow wells tends to be naturally brackish and of recent origin. Deep saline groundwater is found and is explained as remnants of very old marine water trapped in isolated features in the very low permeability intrusive rocks. Preliminary radiocarbon dating indicates that this deep groundwater has an apparent age of less than 5000 years BP but it is the result of mixing recent water recharge with very old deep groundwater. Most of the groundwater flow occurs through the old raised volcanic shield of submarine and subaerial formations and later Miocene subaerial basalts. Groundwater transit time through the unsaturated zone is of a few decades, which allows the consideration of long-term quasi-steady state recharge. Transit times are up to a few centuries through the saturated old volcanics and up to several millennia in the intrusive formations, where isolated pockets of very old water may
Past, Present, Future Erosion at Locke Island
Energy Technology Data Exchange (ETDEWEB)
Bjornstad, Bruce N.
2006-08-08
This report describes and documents the erosion that has occurred along the northeast side of Locke Island over the last 10 to 20 years. The principal cause of this erosion is the massive Locke Island landslide complex opposite the Columbia River along the White Bluffs, which constricts the flow of the river and deflects the river's thalweg southward against the island.
Benthic substrate classification map: Gulf Islands National Seashore
Lavoie, Dawn; Flocks, James; Twichell, Dave; Rose, Kate
2013-01-01
The 2005 hurricane season was devastating for the Mississippi Gulf Coast. Hurricane Katrina caused significant degradation of the barrier islands that compose the Gulf Islands National Seashore (GUIS). Because of the ability of coastal barrier islands to help mitigate hurricane damage to the mainland, restoring these habitats prior to the onset of future storms will help protect the islands themselves and the surrounding habitats. During Hurricane Katrina, coastal barrier islands reduced storm surge by approximately 10 percent and moderated wave heights (Wamsley and others, 2009). Islands protected the mainland by preventing ocean waves from maintaining their size as they approached the mainland. In addition to storm protection, it is advantageous to restore these islands to preserve the cultural heritage present there (for example, Fort Massachusetts) and because of the influence that these islands have on marine ecology. For example, these islands help maintain a salinity regime favorable to oysters in the Mississippi Sound and provide critical habitats for many migratory birds and endangered species such as sea turtles (Chelonia mydas, Caretta caretta, and Dermochelys coriacea), Gulf sturgeon (Acipenser oxyrinchus desotoi), and piping plovers (Charadrius melodus) (U.S. Army Corps of Engineers, 2009a). As land manager for the GUIS, the National Park Service (NPS) has been working with the State of Mississippi and the Mobile District of the U.S. Army Corps of Engineers to provide a set of recommendations to the Mississippi Coastal Improvements Program (MsCIP) that will guide restoration planning. The final set of recommendations includes directly renourishing both West Ship Island (to protect Fort Massachusetts) and East Ship Island (to restore the French Warehouse archaeological site); filling Camille Cut to recreate a continuous Ship Island; and restoring natural regional sediment transport processes by placing sand in the littoral zone just east of Petit Bois
Fryer, G. J.; Tryon, M. D.
2005-12-01
Paleotsunami studies can extend the record of great earthquakes back into prehistory, but what if the historical record itself is ambiguous? There is growing controversy about whether great earthquakes really occur along the Shumagin and Unimak segments of the Alaska-Aleutian system. The last great tsunami there was April 1, 1946, initiated by an earthquake whose magnitude has variously been reported from 7.1 to 8.5. Okal et al (BSSA, 2003) surveyed the near-field runup and concluded there were two sources: a magnitude 8.5 earthquake, which generated a Pacific-wide tsunami but which produced near-field runups no more than 18 m, and an earthquake-triggered slump whose tsunami reached 42 m at Scotch Cap Light near the western end of Unimak Island, but with runup rapidly decaying eastwards. An M8.5 earthquake, however, is incompatible with GPS strain measurements, which indicate that the maximum earthquake size off Unimak is M7.5. We have long contended that near- and far-field tsunamis were the result of a single earthquake-triggered debris avalanche down the Aleutian slope. In 2004 we were part of an expedition to map and explore the landslide, whose location seemed to be very tightly constrained by the known tsunami travel time to Scotch Cap Light. We found that neither our giant landslide nor Okal et al's smaller slump exist within 100 km of the presumed location. The explanation is obvious in retrospect: the tsunami was so large that it crossed the shallow Aleutian shelf as a bore travelling faster than the theoretical long-wave speed (which we had used to fix the location). Any landslide could only have occurred in an unsurveyed area farther east, off Unimak Bight, the central coast of Unimak Island. That location, however, conflicts with Okal et al's measurements of smaller runup along the Bight. We are now convinced that Okal et al confused the 1946 debris line with the lower line left by the 1957 tsunami. They were apparently unaware that the 1946 tsunami
Bailey, Merryll M.
1963-01-01
The round whitefish has been of some commercial importance in the upper Great Lakes but production in Lake Superior has generally been small; the United States average was 26,600 pounds for 1929-59. This study is based on 1,173 fish collected in the Apostle Islands in 1958-60 and 103 collected at Isle Royale in 1958 and 1960. The average age of 6.0 years at Isle Royale was concluded to be significantly higher than the mean of 4.2 years in the Apostle Islands. The body-scale relation is a straight line with an intercept of 1.1 inches on the length axis. Weight of Apostle Islands round whitefish captured in several months increased as the 3.22 power of the length. Growth in length was relatively slow; nearly or fully 7 years were required to reach an acceptable commercial length of 14 inches in both the Apostle Islands and at Isle Royale. The calculated weights at the end of the seventh year were 12.6 ounces in the Apostle Islands and 13.8 ounces at Isle Royale. Minimum length at maturity of male round whitefish (7.0-7.4 inches) was less than that of females (8.5-8.9 inches). At age-group II, 11.1 percent of male round whitefish, but only 1.5 percent of the females were mature. All males were mature as age-group V and all females as age-group VI. Males dominated the younger age groups but females were more numerous in the older ones. Estimates of the number of eggs in 37 round whitefish ovaries yielded an average of 5,330 eggs for fish 10.5-17.4 inches long.
Alternative Fuels Data Center: Rhode Island Transportation Data for
stations in Rhode Island with alternative fuels Fuel Public Private Biodiesel (B20 and above) 3 3 More Rhode Island Videos on YouTube Video thumbnail for Cooking Oil Powers Biodiesel Vehicles in Rhode Island Cooking Oil Powers Biodiesel Vehicles in Rhode Island July 14, 2017 https://www.youtube.com/embed
Islands for nuclear power stations
International Nuclear Information System (INIS)
Usher, E.F.F.W.; Fraser, A.P.
1981-01-01
The safety principles, design criteria and types of artificial island for an offshore nuclear power station are discussed with particular reference to siting adjacent to an industrial island. The paper concludes that the engineering problems are soluble and that offshore nuclear power stations will eventually be built but that much fundamental work is still required. (author)
Monitoring developments in island waters
International Nuclear Information System (INIS)
Crellin, L.V.
1995-01-01
The environmental effects of islands in the Irish Sea of the offshore oil and gas industry are discussed in this paper, in particular on sand and gravel resources. This information is considered by the Department of Trade and Industry when granting prospecting, exploration and production licenses. Consultation between industry and islanders forms part of the license granting process. (UK)
Demographic history of Canary Islands male gene-pool: replacement of native lineages by European
Directory of Open Access Journals (Sweden)
Amorim António
2009-08-01
Full Text Available Abstract Background The origin and prevalence of the prehispanic settlers of the Canary Islands has attracted great multidisciplinary interest. However, direct ancient DNA genetic studies on indigenous and historical 17th–18th century remains, using mitochondrial DNA as a female marker, have only recently been possible. In the present work, the analysis of Y-chromosome polymorphisms in the same samples, has shed light on the way the European colonization affected male and female Canary Island indigenous genetic pools, from the conquest to present-day times. Results Autochthonous (E-M81 and prominent (E-M78 and J-M267 Berber Y-chromosome lineages were detected in the indigenous remains, confirming a North West African origin for their ancestors which confirms previous mitochondrial DNA results. However, in contrast with their female lineages, which have survived in the present-day population since the conquest with only a moderate decline, the male indigenous lineages have dropped constantly being substituted by European lineages. Male and female sub-Saharan African genetic inputs were also detected in the Canary population, but their frequencies were higher during the 17th–18th centuries than today. Conclusion The European colonization of the Canary Islands introduced a strong sex-biased change in the indigenous population in such a way that indigenous female lineages survived in the extant population in a significantly higher proportion than their male counterparts.
Runaway electrons and magnetic island confinement
International Nuclear Information System (INIS)
Boozer, Allen H.
2016-01-01
The breakup of magnetic surfaces is a central feature of ITER planning for the avoidance of damage due to runaway electrons. Rapid thermal quenches, which lead to large accelerating voltages, are thought to be due to magnetic surface breakup. Impurity injection to avoid and to mitigate both halo and runaway electron currents utilizes massive gas injection or shattered pellets. The actual deposition is away from the plasma center, and the breakup of magnetic surfaces is thought to spread the effects of the impurities across the plasma cross section. The breakup of magnetic surfaces would prevent runaway electrons from reaching relativistic energies were it not for the persistence of non-intercepting flux tubes. These are tubes of magnetic field lines that do not intercept the walls. In simulations and in magnetic field models, non-intercepting flux tubes are found to persist near the magnetic axis and in the cores of magnetic islands even when a large scale magnetic surface breakup occurs. As long as a few magnetic surfaces reform before all of the non-intercepting flux tubes dissipate, energetic electrons confined and accelerated in these flux tubes can serve as the seed electrons for a transfer of the overall plasma current from thermal to relativistic carriers. The acceleration of electrons is particularly strong because of the sudden changes in the poloidal flux that naturally occur in a rapid magnetic relaxation. The physics of magnetic islands as non-intercepting flux tubes is studied. Expressions are derived for (1) the size of islands required to confine energetic runaway electrons, (2) the accelerating electric field in an island, (3) the increase or reduction in the size of an island by the runaway electron current, (4) the approximate magnitude of the runaway current in an island, and (5) the time scale for the evolution of an island.
Runaway electrons and magnetic island confinement
Energy Technology Data Exchange (ETDEWEB)
Boozer, Allen H., E-mail: ahb17@columbia.edu [Columbia University, New York, New York 10027 (United States)
2016-08-15
The breakup of magnetic surfaces is a central feature of ITER planning for the avoidance of damage due to runaway electrons. Rapid thermal quenches, which lead to large accelerating voltages, are thought to be due to magnetic surface breakup. Impurity injection to avoid and to mitigate both halo and runaway electron currents utilizes massive gas injection or shattered pellets. The actual deposition is away from the plasma center, and the breakup of magnetic surfaces is thought to spread the effects of the impurities across the plasma cross section. The breakup of magnetic surfaces would prevent runaway electrons from reaching relativistic energies were it not for the persistence of non-intercepting flux tubes. These are tubes of magnetic field lines that do not intercept the walls. In simulations and in magnetic field models, non-intercepting flux tubes are found to persist near the magnetic axis and in the cores of magnetic islands even when a large scale magnetic surface breakup occurs. As long as a few magnetic surfaces reform before all of the non-intercepting flux tubes dissipate, energetic electrons confined and accelerated in these flux tubes can serve as the seed electrons for a transfer of the overall plasma current from thermal to relativistic carriers. The acceleration of electrons is particularly strong because of the sudden changes in the poloidal flux that naturally occur in a rapid magnetic relaxation. The physics of magnetic islands as non-intercepting flux tubes is studied. Expressions are derived for (1) the size of islands required to confine energetic runaway electrons, (2) the accelerating electric field in an island, (3) the increase or reduction in the size of an island by the runaway electron current, (4) the approximate magnitude of the runaway current in an island, and (5) the time scale for the evolution of an island.
Streamlined islands and the English Channel megaflood hypothesis
Collier, J. S.; Oggioni, F.; Gupta, S.; García-Moreno, D.; Trentesaux, A.; De Batist, M.
2015-12-01
Recognising ice-age catastrophic megafloods is important because they had significant impact on large-scale drainage evolution and patterns of water and sediment movement to the oceans, and likely induced very rapid, short-term effects on climate. It has been previously proposed that a drainage system on the floor of the English Channel was initiated by catastrophic flooding in the Pleistocene but this suggestion has remained controversial. Here we examine this hypothesis through an analysis of key landform features. We use a new compilation of multi- and single-beam bathymetry together with sub-bottom profiler data to establish the internal structure, planform geometry and hence origin of a set of 36 mid-channel islands. Whilst there is evidence of modern-day surficial sediment processes, the majority of the islands can be clearly demonstrated to be formed of bedrock, and are hence erosional remnants rather than depositional features. The islands display classic lemniscate or tear-drop outlines, with elongated tips pointing downstream, typical of streamlined islands formed during high-magnitude water flow. The length-to-width ratio for the entire island population is 3.4 ± 1.3 and the degree-of-elongation or k-value is 3.7 ± 1.4. These values are comparable to streamlined islands in other proven Pleistocene catastrophic flood terrains and are distinctly different to values found in modern-day rivers. The island geometries show a correlation with bedrock type: with those carved from Upper Cretaceous chalk having larger length-to-width ratios (3.2 ± 1.3) than those carved into more mixed Paleogene terrigenous sandstones, siltstones and mudstones (3.0 ± 1.5). We attribute these differences to the former rock unit having a lower skin friction which allowed longer island growth to achieve minimum drag. The Paleogene islands, although less numerous than the Chalk islands, also assume more perfect lemniscate shapes. These lithologies therefore reached island
Youth lead youth in Marshall Islands.
Johnson, G
1988-01-01
The promotion of family planning and birth control in Pacific countries is often frustrated by traditional and religious beliefs, if not deterred by tremendous funding and logistics problems. In the central Pacific republic of the Marshall Islands, however, youthful health workers are taking a unique approach to health promotion that has spurred acceptance of the once controversial subjects of family planning and birth control. A group known as Youth to Youth in Health is spearheading a family planning outreach drive in the schools and community in the Marshall Islands. Coupling health presentations with traditional island music and dance to produce lively health shows, the group's programs on family planning, birth control, nutrition, and cancer have struck a responsive chord in a culture known for its religious and traditional conservatism. The group makes creative use of puppet shows, skits, health songs, and pantomimes, interspersed with contemporary renditions of Marshall Islands music and traditional dances. These have rekindled pride in their culture among the group and sparked a sense of urgency about the need to improve health conditions in the islands. As evidence of the group's impact, family planning staff point to a nearly 4-fold rise in the number of youth clients under 19 years since the Youth to Youth started in mid-1986. Their combination of traditional custom with family planning and other health information has proved to be an innovative and needed program for the islands.
Benthic Mapping in Long Island Sound
National Oceanic and Atmospheric Administration, Department of Commerce — QTCView is used with an incorporated depthfinder to create a sonar map of the bottom to the west of the Charles Island, in Long Island Sound in Connecticut waters....
Avian species differences in the intestinal absorption of xenobiotics (PCB, dieldrin, Hg2+)
Serafin, J.A.
1984-01-01
1. Intestinal absorption of a polychlorinated biphenyl, dieldrin, and mercury (from HgCl2) was measured in adult Northern bobwhites, Eastern screech owls, American kestrels, black-crowned night-herons and mallards in vivo by an in situ luminal perfusion technique.2. Bobwhites, screech owls and kestrels absorbed much more of each xenobiotic than black-crowned night-herons and mallards.3. Mallards absorbed less dieldrin and mercury than black-crowned night-herons.4. Mercury absorption by kestrels was more than twice that in screech owls and eight times that observed in mallards.5. Pronounced differences in xenobiotic absorption rates between bobwhites, screech owls and kestrels on the one hand, and black-crowned night-herons and mallards on the other, raise the possibility that absorptive ability may be associated with the phylogenetic classification of birds.
Bathymetry 1M Grid of St. Croix (Buck Island), US Virgin Islands 2005, UTM 20 NAD83
National Oceanic and Atmospheric Administration, Department of Commerce — This dataset contains an ESRI Grid with 1 meter cell size representing the bathymetry of the north shore of St. Croix (Buck Island), US Virgin Islands. NOAA's...
NOAA TIFF Graphic- 0.5m Backscatter Mosaic of St. Croix (Buck Island), US Virgin Islands, 2004
National Oceanic and Atmospheric Administration, Department of Commerce — This geotiff represents a 0.5 meter resolution backscatter mosaic of the north shore of Buck Island, St. Croix, US Virgin Islands.NOAA's NOS/NCCOS/CCMA Biogeography...
Bathymetry 1M GRID of St. Croix (Buck Island), US Virgin Islands, 2004, UTM 20 WGS84
National Oceanic and Atmospheric Administration, Department of Commerce — This dataset contains an ESRI Grid with 1 meter cell size representing the bathymetry of the north shore of Buck Island St. Croix, US Virgin Islands. NOAA's...
NOAA TIFF Graphic- 0.5m Backscatter Mosaic of St. Croix (Buck Island), US Virgin Islands, 2004
National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 1 meter resolution backscatter mosaic of the north shore of Buck Island, St. Croix, US Virgin Islands.NOAA's NOS/NCCOS/CCMA Biogeography Team...
Epidemiologic characteristics of scrub typhus on Jeju Island
Lee, Sung Uk
2017-01-01
OBJECTIVES Scrub typhus is the most common febrile disease in Korea during the autumn. Jeju Island is the largest island in South Korea and has a distinctive oceanic climate. This study aimed to identify epidemiologic characteristics of scrub typhus on Jeju Island. METHODS From January 2011 to December 2016, 446 patients were diagnosed with scrub typhus on Jeju Island. The patients’ personal data and the environmental factors that might be related to scrub typhus were investigated and retrosp...
International Nuclear Information System (INIS)
Carpintero, P.; Garcia-Frasquet, A.; Tarradas, E.; Logrono, C.; Carrascal, A.; Carreto, A.
1998-01-01
Objective. To determine the incidence of bone islands in leprosy patients. Design. X-rays of feet and hands of patients with Hansen's disease (leprosy) were reviewed retrospectively. A second group of related age- and sex-matched patients who did not have Hansen's disease was used for control purposes. Controls had undergone hand or foot X-rays during diagnosis of other pathologies. The patients with Hansen's disease were compared with the control group, and were also analyzed as subgroups with different types of leprosy. The results were subjected to statistical analysis. Patients. Ninety patients with Hansen's disease were randomly selected for this study. Patients who had had ulcers on hands or feet were excluded from the study. Results and conclusions. Bone islands were demonstrated in 20 patients with Hansen's disease; no bone islands were observed in the controls. This was statistically significant (P<0.01). Bone islands were only seen in patients with lepromatous leprosy and borderline types but were not demonstrated in patients with tuberculoid leprosy. There was also a statistically significant relationship for a disease duration of 15 years or more. The cause of this raised incidence of enostosis in leprosy patients is not clear, but there may be a genetic predisposition in patients with leprosy, or it may be a side effect of leprosy, especially the lepromatous form. (orig.)
Reyes-Batlle, María; Wagner, Carolina; Zamora-Herrera, Jonadab; Vargas-Mesa, Alejandro; Sifaoui, Ines; González, Ana C; López-Arencibia, Atteneri; Valladares, Basilio; Martínez-Carretero, Enrique; Piñero, José E; Lorenzo-Morales, Jacob
2016-09-01
In this study, twenty water samples were collected in the island of Lanzarote, Canary Islands, Spain in order to check for the presence of V. vermiformis strains in these samples. Water samples were cultured on 2% Non-Nutrient Agar (NNA) plates covered with a thin layer of heat killed E. coli and checked daily for the presence of Vermamoeba. After a week, V. vermiformis amoebae were observed in 2 of the 20 processed samples (10%) incubated at room temperature and 37°C. Molecular characterization was carried out by amplifying the 18S rDNA gene and DNA sequencing in order to confirm the identity of the isolated amoebic strains. To the best of our knowledge, this is the first report on the presence of FLA in environmental sources in Lanzarote Island and the first report of Vermamoeba vermiformis in water sources in this island. Furthermore, the two strains isolated in this study were collected in recreational areas with close contact with humans and thus awareness should be raised.
Marine Bioinorganic Chemistry Workshop Held in Heron Island on 28 June - 2nd July 1989
1990-02-09
Vilter, H. Phytochemistry, 1984, 23, 1387-1390. 2. Vilter, H. Botanica Marina, 1983, 26, 451-455. 3. Wever, R., Plat, H. and De Boer, E., Biochim. Biophys...and DSc (1977) Vf degrees from the University of Melbourne, where he held teaching and research positions. His major research interests involve the
Hofmann, Harald; Newborn, Dean; Cartwright, Ian
2017-04-01
Freshwater lenses underneath barrier islands are dynamic systems affected by changing sea levels and groundwater use. They are vulnerable to contamination and over-abstraction. Residence times of fresh groundwater in barrier islands are poorly understood and have mostly been assessed by modelling approaches and estimates without fundamental validation with geochronological data. Assessing residence time and recharge rates will improve significantly our understanding of hydrological processes of coastal environments that will in turn allow us to make informed decisions on groundwater use and environmental protection. This project focused on groundwater recharge rates and residence times of the fresh water aquifer system of North Stradbroke Island, south-east Queensland, Australia. Groundwater bores, wetlands and submarine groundwater discharge points in the tidal areas (wonky holes) were sampled along a transect across the island and were analysed for major ion chemistry and stable isotopes (δ2H, δ18O, δ13C) in combination with 3H and 14C analysis. Calculated 3H using a 95% exponential-piston flow model and 14C ages range from 12 to >100 years and modern to 3770 years, respectively, indicating a highly heterogeneous aquifer system with mixing from low and high conductive areas. The major ion chemistry in combination with stable and radiogenic isotopes suggests that a significant groundwater component derives from the fractured rock basement and older sedimentary formations underlying the sand dunes of the island. The results help refining the conceptual and numerical groundwater flow model for North Stradbroke island in this particular case but also demonstrate the possible complexity of barrier island hydrogeology.
Human impacts quantification on the coastal landforms of Gran Canaria Island (Canary Islands)
Ferrer-Valero, Nicolás; Hernández-Calvento, Luis; Hernández-Cordero, Antonio I.
2017-06-01
The coastal areas of the Canary Islands are particularly sensitive to changes, both from a natural perspective and for their potential socio-economic implications. In this paper, the state of conservation of an insular coast is approached from a geomorphological point of view, considering recent changes induced by urban and tourism development. The analysis is applied to the coast of Gran Canaria, a small Atlantic island of volcanic origin, subject to a high degree of human pressure on its coastal areas, especially in recent decades. Currently, much of the economic activity of Gran Canaria is linked to mass tourism, associated with climatic and geomorphological features of the coast. This work is addressed through detailed mapping of coastal landforms across the island (256 km perimeter), corresponding to the period before the urban and tourism development (late 19th century for the island's capital, mid-20th century for the rest of the island) and today. The comparison between the coastal geomorphology before and after the urban and tourism development was established through four categories of human impacts, related to their conservation state: unaltered, altered, semi-destroyed and extinct. The results indicate that 43% of coastal landforms have been affected by human impacts, while 57% remain unaltered. The most affected are sedimentary landforms, namely coastal dunes, palaeo-dunes, beaches and wetlands. Geodiversity loss was also evaluated by applying two diversity indices. The coastal geodiversity loss by total or partial destruction of landforms is estimated at - 15.2%, according to Shannon index (H‧), while it increases to - 32.1% according to an index proposed in this paper. We conclude that the transformations of the coast of Gran Canaria induced by urban and tourism development have heavily affected the most singular coastal landforms (dunes, palaeo-dunes and wetlands), reducing significantly its geodiversity.
The Solomon Islands Tsunami of 6 February 2013 in the Santa Cruz Islands: Field Survey and Modeling
Fritz, Hermann M.; Papantoniou, Antonios; Biukoto, Litea; Albert, Gilly; Wei, Yong
2014-05-01
On February 6, 2013 at 01:12:27 UTC (local time: UTC+11), a magnitude Mw 8.0 earthquake occurred 70 km to the west of Ndendo Island (Santa Cruz Island) in the Solomon Islands. The under-thrusting earthquake near a 90° bend, where the Australian plate subducts beneath the Pacific plate generated a locally focused tsunami in the Coral Sea and the South Pacific Ocean. The tsunami claimed the lives of 10 people and injured 15, destroyed 588 houses and partially damaged 478 houses, affecting 4,509 people in 1,066 households corresponding to an estimated 37% of the population of Santa Cruz Island. A multi-disciplinary international tsunami survey team (ITST) was deployed within days of the event to document flow depths, runup heights, inundation distances, sediment and coral boulder depositions, land level changes, damage patterns at various scales, performance of the man-made infrastructure and impact on the natural environment. The 19 to 23 February 2013 ITST covered 30 locations on 4 Islands: Ndendo (Santa Cruz), Tomotu Noi (Lord Howe), Nea Tomotu (Trevanion, Malo) and Tinakula. The reconnaissance completely circling Ndendo and Tinakula logged 240 km by small boat and additionally covered 20 km of Ndendo's hard hit western coastline by vehicle. The collected survey data includes more than 80 tsunami runup and flow depth measurements. The tsunami impact peaked at Manoputi on Ndendo's densely populated west coast with maximum tsunami height exceeding 11 m and local flow depths above ground exceeding 7 m. A fast tide-like positive amplitude of 1 m was recorded at Lata wharf inside Graciosa Bay on Ndendo Island and misleadingly reported in the media as representative tsunami height. The stark contrast between the field observations on exposed coastlines and the Lata tide gauge recording highlights the importance of rapid tsunami reconnaissance surveys. Inundation distance and damage more than 500 m inland were recorded at Lata airport on Ndendo Island. Landslides were
Komdeur, Jan; Bullock, Ian D.; Rands, Michael R.W.
1991-01-01
The Seychelles Warbler was once a highly threatened single-island endemic species with a population of 26 individuals confined to Cousin Island in the inner Seychelles. Following long-term management of Cousin, the population steadily recovered to around 300-360 birds. Given the vulnerability of one
Kinetic theory of magnetic island stability in tokamaks
International Nuclear Information System (INIS)
Zabiego, M.; Garbet, X.
1993-10-01
The non linear behavior of low and large wave number tearing modes is studied. The emphasis is layed on diamagnetic effects. A kinetic equation, including transport processes associated with a background of microturbulence, is used to describe the electron component. Such transport processes are shown to play a significant role in the adjustment of density and temperature profile and also in the calculation of the island rotation frequency. The fluctuating electric potential is calculated self-consistently, using the differential response of electrons and ions. Four regimes are considered, related to island width (smaller or larger than an ion Larmor radius) and transport regime (electron-ion collisions or electro-viscosity dominated). It is shown that diamagnetism does not influence the island stability for small island width in the viscous regime, as long as the constant A constraint is maintained. It turns out that the release of this constraint may strongly modify the previously calculated stability thresholds. Finally, it is found that diamagnetism is destabilizing (stabilizing) for island width smaller (larger) than an ion Larmor radius, in both resistive and viscous regimes. A typical island evolution scenario is studied which shows that even large scale tearing modes with positive Δ ' could saturate to island width of order of a few ion Larmor radii. Illustrative Δ ' threshold and island saturation size are calculated. (authors). 31 refs., 5 figs., 3 tabs
Tree island pattern formation in the Florida Everglades
Carr, Joel; D'Odorico, P.; Engel, Victor C.; Redwine, Jed
2016-01-01
The Florida Everglades freshwater landscape exhibits a distribution of islands covered by woody vegetation and bordered by marshes and wet prairies. Known as “tree islands”, these ecogeomorphic features can be found in few other low gradient, nutrient limited freshwater wetlands. In the last few decades, however, a large percentage of tree islands have either shrank or disappeared in apparent response to altered water depths and other stressors associated with human impacts on the Everglades. Because the processes determining the formation and spatial organization of tree islands remain poorly understood, it is still unclear what controls the sensitivity of these landscapes to altered conditions. We hypothesize that positive feedbacks between woody plants and soil accretion are crucial to emergence and decline of tree islands. Likewise, positive feedbacks between phosphorus (P) accumulation and trees explain the P enrichment commonly observed in tree island soils. Here, we develop a spatially-explicit model of tree island formation and evolution, which accounts for these positive feedbacks (facilitation) as well as for long range competition and fire dynamics. It is found that tree island patterns form within a range of parameter values consistent with field data. Simulated impacts of reduced water levels, increased intensity of drought, and increased frequency of dry season/soil consuming fires on these feedback mechanisms result in the decline and disappearance of tree islands on the landscape.