WorldWideScience

Sample records for herman eijsackers fred

  1. Holomorphic Dynamics and Herman Rings

    DEFF Research Database (Denmark)

    Henriksen, Christian

    1997-01-01

    Existence theorem for Herman Rings of holomorphic mappings in a certain holomorphic family is given, using quasiconformal mappings. Proofs of topological properties of these Herman rings are given.......Existence theorem for Herman Rings of holomorphic mappings in a certain holomorphic family is given, using quasiconformal mappings. Proofs of topological properties of these Herman rings are given....

  2. Fred Hoyle's Universe

    Science.gov (United States)

    Gregory, Jane

    2005-08-01

    Fred Hoyle was a Yorkshire truant who became the voice of British astronomy. For fifty years, he spoke out for astronomy in the newspapers, on government committees, at scientific meetings, in popular books and on the radio. He devised a never-ending history of the universe, and worked out how the elements were made. He founded a prestigious institute for theoretical astronomy and built a giant telescope, and if it rained on his summer holiday, he sat in his caravan and wrote science fiction novels for his legions of fans around the world. Fred Hoyle also claimed that diseases fall from the sky, that the big bang never happened, and that the Astronomer Royal should be abolished. When the outspoken Fred Hoyle spoke out for astronomy, some astronomers really wished he had kept his mouth shut. This book tells the behind-the-scenes story of Hoyle's widely acclaimed and deeply controversial role in the ideas, organization and public face of astronomy in post-war Britain. It chronicles the triumphs, acrimony, jealousies, rewards and bitter feuds of a field in turmoil, and meets the astronomers, contemplating cosmic questions, keeping secrets, losing their tempers, winkling information out of distant stars and, over tea on the lawn, discussing the finer points of libel law. Fred Hoyle's Universe draws on previously confidential government documents, recently released personal correspondence and interviews with Hoyle's friends, colleagues and critics, as well as with Hoyle himself, to bring you the man, the science, and the scandal behind the genial and genteel facade of the most exciting period in the history of astronomy.

  3. Herman's condition and Siegel disks of polynomials

    CERN Document Server

    Chéritat, Arnaud

    2011-01-01

    Herman proved the presence of critical points on the boundary of Siegel disks of unicritical polynomials under some diophantine condition now called the Herman condition. We extend this result to polynomials with two critical points.

  4. Prof. Dr Herman Johannes Lam

    NARCIS (Netherlands)

    NN,

    1958-01-01

    Since this silver jubilee does not mean the end of a career, let it merely be regarded as a landmark from which we may now look back. Herman Johannes Lam, born at Veendam in 1892, received his grammarschool education at the ‘Gymnasium Erasmianum’ in Rotterdam (1904—1911). He studied natural history

  5. Herman kes? Catherine kuidas? / Jochen Bittner

    Index Scriptorium Estoniae

    Bittner, Jochen

    2009-01-01

    Autor analüüsib, miks valiti Euroopa Parlamendi presidendiks Belgia peaminister Herman Van Rompuy ning välis- ja julgeolekupoliitika kõrgemaks esindajaks Euroopa komisjoni kaubandusvolinik Catherine Ashton

  6. Herman kes? Catherine kuidas? / Jochen Bittner

    Index Scriptorium Estoniae

    Bittner, Jochen

    2009-01-01

    Autor analüüsib, miks valiti Euroopa Parlamendi presidendiks Belgia peaminister Herman Van Rompuy ning välis- ja julgeolekupoliitika kõrgemaks esindajaks Euroopa komisjoni kaubandusvolinik Catherine Ashton

  7. Narcissism in the novels of Herman Melville.

    Science.gov (United States)

    Dyer, S K

    1994-01-01

    The nineteenth-century novels of Herman Melville, in their exploration of the theme of the conflict of man's godlike aspirations with his all-too-human limitations, anticipate the twentieth-century psychoanalytic understanding of narcissism, as developed by Sigmund Freud and Hans Kohut, specifically its psychodynamic model of the ego ideal in conflict with reality and the finiteness of human life. Captain Ahab in Moby-Dick is a vivid portrait of a narcissistic character, while Captain Vere in Billy Budd stands as a model of the "transformations of narcissism" in a mature individual. Melville's imaginative fiction is still capable of giving us valuable insights into the human condition.

  8. Visualizing Data and the Online FRED Database

    Science.gov (United States)

    Méndez-Carbajo, Diego

    2015-01-01

    The author discusses a pedagogical strategy based on data visualization and analysis in the teaching of intermediate macroeconomics and financial economics. In these short projects, students collect and manipulate economic data from the online Federal Reserve Economic Database (FRED) in order to illustrate theoretical relationships discussed in…

  9. Visualizing Data and the Online FRED Database

    Science.gov (United States)

    Méndez-Carbajo, Diego

    2015-01-01

    The author discusses a pedagogical strategy based on data visualization and analysis in the teaching of intermediate macroeconomics and financial economics. In these short projects, students collect and manipulate economic data from the online Federal Reserve Economic Database (FRED) in order to illustrate theoretical relationships discussed in…

  10. FRED, a Front End for Databases.

    Science.gov (United States)

    Crystal, Maurice I.; Jakobson, Gabriel E.

    1982-01-01

    FRED (a Front End for Databases) was conceived to alleviate data access difficulties posed by the heterogeneous nature of online databases. A hardware/software layer interposed between users and databases, it consists of three subsystems: user-interface, database-interface, and knowledge base. Architectural alternatives for this database machine…

  11. Fred P. Ellison and Interamerican Imperatives

    Science.gov (United States)

    Perrone, Charles A.

    2016-01-01

    This article briefly describes Fred P. Ellison's ground breaking contributions in Brazilian literary studies in North America. Further, his key role in the development of Brazilian Portuguese language instruction is highlighted, along with the numerous scholarly connections he made in the the field of Luso-Brazilian Studies.

  12. Klaus Mann: "Rejse til nattens ende. Herman Bang"

    DEFF Research Database (Denmark)

    Heede, Dag

    En udgivelse og oversættelse af ukendt og upubliceret Klaus Mann-essay om Herman Bang affattet på engelsk i 1940. Udgivelsen er tilføjet en fyldig introduktion og et appendiks.......En udgivelse og oversættelse af ukendt og upubliceret Klaus Mann-essay om Herman Bang affattet på engelsk i 1940. Udgivelsen er tilføjet en fyldig introduktion og et appendiks....

  13. Obituary: Fred Lawrence Whipple, 1906-2004

    Science.gov (United States)

    Yeomans, Donald Keith

    2004-12-01

    Fred Whipple, one of the founding fathers of planetary science, died on August 30, 2004 just two months shy of his 98th birthday. The breadth of Fred's published research from 1927 through 2000 is quite extraordinary. Although his collected works were published in two massive volumes in 1972, shortly before his retirement, Fred's research contributions continued for another three decades - and another volume is planned. Fred Lawrence Whipple was born on November 5, 1906 on a farm in Red Oak Iowa. His parents were Harry Lawrence and Celestia (MacFarl) Whipple. At the age of fifteen, the Whipple family moved to California where Fred studied mathematics at Occidental College and the University of California at Los Angeles. As a graduate student at the University of California at Berkeley in 1930, he was one of the first to compute an orbit for the newly discovered planet Pluto. Upon receiving his PhD in 1931, he joined the staff of the Harvard College Observatory. He was Chairman of the Harvard Department of Astronomy (1949 - 1956), Director or the Smithsonian Astrophysical Observatory (1955 - 1973), Phillips Professor of Astronomy (1968 - 1977) and Emeritus Phillips Professor of astronomy (1977 - 2004). In 1928 he married Dorothy Woods and their son, Earle Raymond, survives him. The marriage ended in divorce in 1935. Eleven years later, he married Babette F. Samelson and she too survives him, as do their two daughters Laura and (Dorothy) Sandra. Shortly after arriving at Harvard in the early 1930's, Fred developed a photographic tracking network to determine meteor trajectories from simultaneous observations from two or more stations. The photographic trails, chopped by a rotating shutter, allowed their orbits in space to be determined accurately. With the strong involvement of Richard McCrosky and others, he concluded in the early 1960's that most of these meteors were on comet-like orbits and less than 1% of the naked eye, sporadic meteors could be traced to an

  14. Locally coupled coherent states and Herman-Kluk dynamics

    Science.gov (United States)

    Child, M. S.; Shalashilin, D. V.

    2003-02-01

    An exact analysis of coupled coherent state (CCS) theory in the moving locally quadratic Hamiltonian approximation is shown to reproduce both the linearized coherent state matrix element of the Herman-Kluk propagator and the coherent state overlap with Heller's thawed Gaussian wave function. The derivation is applicable to anharmonic as well as harmonic systems, because the quadratic approximation is taken to apply only in the vicinity of a particular classical trajectory. New compact expressions for the linearized Herman-Kluk coherent state matrix element are given, and improvements for the practical application of CCS theory are discussed.

  15. FRED--a framework for T-cell epitope detection.

    Science.gov (United States)

    Feldhahn, Magdalena; Dönnes, Pierre; Thiel, Philipp; Kohlbacher, Oliver

    2009-10-15

    Over the last decade, immunoinformatics has made significant progress. Computational approaches, in particular the prediction of T-cell epitopes using machine learning methods, are at the core of modern vaccine design. Large-scale analyses and the integration or comparison of different methods become increasingly important. We have developed FRED, an extendable, open source software framework for key tasks in immunoinformatics. In this, its first version, FRED offers easily accessible prediction methods for MHC binding and antigen processing as well as general infrastructure for the handling of antigen sequence data and epitopes. FRED is implemented in Python in a modular way and allows the integration of external methods. FRED is freely available for download at http://www-bs.informatik.uni-tuebingen.de/Software/FRED.

  16. Herman Bavinck en het 'Vrouwenvraagstuk'. Religie als Motivatie en Inspiratie

    NARCIS (Netherlands)

    Verkerk, M.J.; Verkerk-Vegter, C.; van de Streek, H.J.

    2012-01-01

    In this article we analyze the ideas of the `male feminist' Herman Bavinck (1854-1921). Bavinck was professor of theology in Kampen and Amsterdam (The Netherlands). He was one of the leaders of the so-called neo-calvinism that states that the person of Jesus Christ has to leave its mark on all areas

  17. Nathaniel Hawthorne and Herman Melville: A Research Guide.

    Science.gov (United States)

    Van Noate, Judith, Comp.

    This handout is a guide to library resources in the J. Murrey Atkins Library at the University of North Carolina-Charlotte for the study of the 19th-century American authors Nathaniel Hawthorne and Herman Melville. The guide details resources in Atkins library for biographical and critical material on the two authors. The guide is in four…

  18. Using Herman Melville's "Moby-Dick" to Explore Geographic Themes

    Science.gov (United States)

    Gesler, Wil

    2004-01-01

    The classic American novel, Herman Melville's "Moby-Dick", can be used in geography and English classes at the high school and college levels to explore five themes that have a geographic component or are of interest to geography students: (1) the journey, (2) human/environment interactions, (3) social relationships in space, (4) acquiring…

  19. Remembrance of immunology past: conversations with Herman Eisen.

    Science.gov (United States)

    Eisen, Herman N; Schlesinger, Sondra

    2015-01-01

    Herman Eisen and Sondra Schlesinger spent several days together in September 2007 in Woods Hole, Massachusetts, talking about immunology, focusing on his remembrances of the field over the more than 60 years of his involvement. This article is an abridged version of those discussions (the full version is available on the Annual Reviews website). It is both an oral history and a written memory of some important but selected areas of immunology.

  20. PORTRAYAL OF TRIBAL LIFE IN HERMAN MELVILLE’S TYPEE

    Directory of Open Access Journals (Sweden)

    Dr. C. Muralidara Kannan

    2013-07-01

    Full Text Available Herman Melville is one of the greatest novelists in American Literature. He has written several novels like Typee, Omoo, Mardi, Redburn, White-Jacket and Moby Dick of which Typee is known as Typee: A peep at Polynesian Life, during a four months’ residence in a Valley of the Marquesas is the first novel. It reflects his personal experiences in the South Seas. It was published in the year 1846. Melville’s quest for a unique paradise, another Garden of Eden, away from his civilized society is obvious in Typee. Simultaneously, the novel reflects the tribal life of Typee Valley. It is indeed a true account of Herman Melville’s visit to the valley, the experience and observation at this tribal valley had resulted in bringing out his maiden novel, Typee. This paper makes an attempt to study the tribal life of the Typees, their mores and customs, their government and their religion, their marriage practices and their food habits, their rituals and their taboos.

  1. Exploration du territoire identitaire dans les installations de Fred Wilson Exploring Identity Territory in Fred Wilson’s Installations

    Directory of Open Access Journals (Sweden)

    Claudine Armand

    2009-10-01

    Full Text Available This article examines Fred Wilson’s plastic approach and attempts to define what is specific about the work of this conceptual Afro-American artist born in New York City in 1954. Ever since his first installations, Fred Wilson has been exploring various spaces of representation, museums, art galleries, and other alternative spaces. He has created in situ works and has always worked in strategic spaces chosen in relation to their social, historical and political context. Selected to represent the United States at the 2003 Venice Biennale, Fred Wilson, like other artists today, questions history, art, and representation. The construction of identity and ethnic relations underlie his heterogeneous, complex, disturbing, and thought-provoking work endowed with political and aesthetic undertones.

  2. Meenutusi tuntud kultuuritegelasest ja restauraatorist Friedrich Fred Raimond Allikust / Riho Illak, Peeter Tulviste, Indrek Martinson

    Index Scriptorium Estoniae

    Illak, Riho, 1955-

    2006-01-01

    Tartu Ülikooli auliikmest Friedrich Fred Raimond Allikust, kes annetas Tartu Ülikoolile oma kinnistud Tartus ja Elvas. Friedrich Fred Raimond Allik oli Rootsis tegev restauraatori, antikvaari ja eestlaste seltsielu edendajana

  3. Meenutusi tuntud kultuuritegelasest ja restauraatorist Friedrich Fred Raimond Allikust / Riho Illak, Peeter Tulviste, Indrek Martinson

    Index Scriptorium Estoniae

    Illak, Riho, 1955-

    2006-01-01

    Tartu Ülikooli auliikmest Friedrich Fred Raimond Allikust, kes annetas Tartu Ülikoolile oma kinnistud Tartus ja Elvas. Friedrich Fred Raimond Allik oli Rootsis tegev restauraatori, antikvaari ja eestlaste seltsielu edendajana

  4. Twenty years at the margins: the Herman-Chomsky propaganda model, 1988-2008

    OpenAIRE

    Mullen, Andy

    2008-01-01

    2008 marks the 20th anniversary of the publication of Manufacturing Consent: The Political Economy of the Mass Media by Edward S. Herman and Noam Chomsky. This comment briefly assesses how the Herman-Chomsky Propaganda Model (PM) has been received within the field of media and communication studies in the United Kingdom.

  5. Draw and Color Funny Doodles with Uncle Fred.

    Science.gov (United States)

    Martin, Ron

    1994-01-01

    Describes a videodisk called "Draw and Color Funny Doodles with Uncle Fred" on drawing for an elementary school curriculum. Library media skills objectives, art objectives, grade levels, resources, instructional roles, activities/procedures, evaluation, and follow-up are included. (LRW)

  6. Using FRED Data to Teach Price Elasticity of Demand

    Science.gov (United States)

    Méndez-Carbajo, Diego; Asarta, Carlos J.

    2017-01-01

    In this article, the authors discuss the use of Federal Reserve Economic Data (FRED) statistics to teach the concept of price elasticity of demand in an introduction to economics course. By using real data in its computation, they argue that instructors can create a value-adding context for illustrating and applying a foundational concept in…

  7. Minu isa ja ema / Fred Kraav ; intervjueerinud Martin Viirand

    Index Scriptorium Estoniae

    Kraav, Fred, 1923-2010

    2012-01-01

    Vestlus väliseesti meremehe ja kirjaniku Fred Kraaviga tema vanematest, isa tegevusest Esimeses maailmasõjas ja Eesti Vabariigis, elust Petseris ja Türil 20. sajandi algul. Artikkel põhineb Rahvusringhäälingu raadiosaatel "Maailmapilt" (2002)

  8. Working with Fred on action at a distance

    Science.gov (United States)

    Narlikar, J. V.

    2003-07-01

    This paper reviews the work the author carried out with Fred Hoyle on the development of electrodynamics and gravitation as direct particle theories. In this account the author reviews how the work was started, and went through stages of increasing sophistication, e.g., extending the Wheeler-Feynman electrodynamics to curved spacetime, its consequences in different cosmologies, and the issues arising from its quantization. The resolution of ultraviolet divergences in quantum electrodynamics is also briefly discussed. The parallel development of a Machian theory of gravitation followed the lead from electrodynamics. In both theories one sees a strong link between the large scale structure of the universe and local physics, as might be expected from an action-at-a-distance framework. It is recalled why Fred considered this an important aspect of a physical theory.

  9. The 7% Solution - Cleaning Up After Fred Vine's Outstanding Successes

    Science.gov (United States)

    Hey, R. N.

    2013-12-01

    Fred Vine was the first & greatest of the wiggle pickers, founding the marine magnetic anomaly field with his 1963 Vine & Matthews paper. Two of his classic study areas were Juan de Fuca & the Reykjanes Ridge. In Juan de Fuca, he recognized the axial symmetry in the Raff & Mason data that had shown the existence of magnetic stripes on the seafloor, demonstrating the seafloor spreading there that Tuzo Wilson had predicted. Fred's iconic color figure of these anomalies perfectly correlated with the magnetic reversal time scale (after the discovery of the Jaramillo event) became the striking cover illustration of 'The History of the Earth's Crust', the symposium volume of the influential 1966 Goddard meeting that confirmed the reality of seafloor spreading & continental drift. Everything Fred did in Juan de Fuca was correct, but fortunately for me he didn't do everything. Some of the linear magnetic anomaly offsets there became a major puzzle in 1967 when Jason Morgan & Dan McKenzie discovered plate tectonics, because those offsets were oblique to the ridges & transforms & thus were incompatible with simple plate tectonics. Although the oblique anomaly offsets look like faults, they instead turned out to be propagating rift pseudofault wakes with no relative motion along them, an interpretation resulting from my analysis of Galapagos magnetic anomalies. Fred's other iconic color figure was his correlation of the Heirtzler et al. Reykjanes Ridge aeromagnetic data with the reversal timescale. This figure, showing the symmetry predicted by seafloor spreading & field reversals, was another key step in the scientific revolution. At the Goddard Symposium Fred was asked if he'd tested the symmetry statistically & he replied "I never touch statistics. I just deal with the facts'. Fred was trying to have a scientific revolution, & of course on that scale pretty symmetric seafloor spreading is a reality. However, fine-scale asymmetric spreading can be seen in his figure (the

  10. Raamatud ja laevasõidud / Fred Kraav ; intervjueerinud Martin Viirand

    Index Scriptorium Estoniae

    Kraav, Fred, 1923-2010

    2012-01-01

    Vestlus väliseesti meremehe ja kirjaniku Fred Kraaviga tema elust, teenistusest meremehena Teise maailmasõja ajal ja tema raamatutest "The Partisans" (New York, 1952), mis on eestindamata ja "No Other Choice", mille tõlkis käsikirjast E. Järvel ja see ilmus eesti keeles pealkirjaga "Risttules". Artikkel põhineb Rahvusringhäälingu raadiosaatel "Maailmapilt" (1998)

  11. Raamatud ja laevasõidud / Fred Kraav ; intervjueerinud Martin Viirand

    Index Scriptorium Estoniae

    Kraav, Fred, 1923-2010

    2012-01-01

    Vestlus väliseesti meremehe ja kirjaniku Fred Kraaviga tema elust, teenistusest meremehena Teise maailmasõja ajal ja tema raamatutest "The Partisans" (New York, 1952), mis on eestindamata ja "No Other Choice", mille tõlkis käsikirjast E. Järvel ja see ilmus eesti keeles pealkirjaga "Risttules". Artikkel põhineb Rahvusringhäälingu raadiosaatel "Maailmapilt" (1998)

  12. [Herman W. Major--"father" of Norwegian psychiatry].

    Science.gov (United States)

    Retterstøl, N

    2000-11-30

    Herman Wedel Major (1814-54) is clearly the founding father of Norwegian psychiatry. In 1844, he submitted a proposal for an insane asylum in Norway, emphasising that insanity was a curable disease, not possession by spirits. Included with the proposal were drawings by his brother-in-law, the well-known architect Heinrich Ernst Schirmer (1815-87). The proposal was soon supported by a statement from Peter Willers Jessen (1793-1875), professor and head of Europe's first new psychiatric hospital. Gaustad Hospital was opened in 1855. In 1846, Major submitted a report on the plight of the insane in Norway, and he was the driving force in the drafting of modern legislation on insanity in Norway, the "act relating to treatment and care for the insane", passed in 1848. This was the fourth modern insanity act in Europe, following those in France (1838), Switzerland (1838) and England (1842).--A great lifetime achievement, brought to an end in 1854 when Major, then 40, and his family died in a shipwreck.

  13. Tradurre la terminologia scientifica: la teoria linguistica di Herman Paul

    Directory of Open Access Journals (Sweden)

    Francesca Santulli

    2012-11-01

    Full Text Available The paper discusses the fundamental characters of terminologies, with special reference to language science. The theory of language and linguistics put forth by Herman Paul (1846-1921 is then examined, focusing on the classification of sciences illustrated in the seminal theoretical essay of the German philologist, Prinzipien der Sprachgeschichte. The analysis of Paul’s work and of the terms used brings forth the implications of this classification, which aimed to give value to linguistics under a new historical perspective. The paper then considers the English translation of Paul’s Prinzipien, showing the difficulties and the inconsistencies in the terminological choices. Only a comprehensive analysis of the theory and its terms can lead to a deeper understanding of their implications, and thus pave the way to more consistent and effective translation. However, as shown by the analysis of the title of the essay, some terms can challenge the translator to the point that it becomes necessary to privilege one of the components of meaning, and accept solutions that are far form perfect and homogeneous across different languages.

  14. 75 FR 5076 - Fred Coleman; Notice of Preliminary Permit Application Accepted for Filing and Soliciting...

    Science.gov (United States)

    2010-02-01

    ... Energy Regulatory Commission Fred Coleman; Notice of Preliminary Permit Application Accepted for Filing... November 13, 2009, Fred Coleman filed an application for a preliminary permit, pursuant to section 4(f) of the Federal Power Act, proposing to study the feasibility of the Coleman Ranch Hydroelectric...

  15. A Critical Evaluation of Herman and Chomsky’s Propaganda Model /Evaluación crítica del modelo de propaganda de Herman y Chomsky

    OpenAIRE

    Lic. Joan Pedro;

    2009-01-01

    This article reviews the five elements (filters) which compose the Propaganda Model and evaluates its relevance and validity twenty years after its original elaboration by Edward S. Herman and Noam Chomsky. The article also analyzes the applicability of the model to other contexts which were not originally contemplated and reflects on other elements which also have the effect of filtering the information and, therefore, should be taken into account by the model. Finally, it considers the poss...

  16. Rainer Saks : ärgem lohutagem end lootusega, et Herman Simm oli ainus / Rainer Saks ; interv. Rasmus Kagge

    Index Scriptorium Estoniae

    Saks, Rainer

    2008-01-01

    Intervjuu Eesti eriteenistuste endise esikoordinaatori ning praeguse Vabariigi Presidendi kantselei direktoriga, kes vastab küsimustele, mis puudutavad Herman Simmi. Ta möönab, et ei ole põhjust arvata, nagu võiks riigireetmises kahtlustatav Herman Simm olla ainuke, kes riiki petta oskas. Vt. Kes on Rainer Saks?; Kes on Mitrohhin?

  17. A journey with Fred Hoyle. The search for cosmic life

    Science.gov (United States)

    Wickramasinghe, Chandra; Wickramasinghe, Kamala

    2005-01-01

    This is the story of the author's unique scientific journey with one of the most remarkable men of 20th century science. The journey begins in Sri Lanka, the author's native country, with his childhood acquaintance with Fred Hoyle's writings. The action then moves to Cambridge, where the famous Hoyle-Wickramasinghe collaborations begin. A research programme which was started in 1962 on the carbonaceous nature of interstellar dust leads, over the next two decades, to developments that are continued in both Cambridge and Cardiff. These developments prompt Hoyle and the author to postulate the organic theory of cosmic dust (which is now generally accepted), and then to challenge one of the most cherished paradigms of contemporary science - the theory that life originated on Earth in a warm primordial soup.

  18. Het gelijk van de schrijver. Willem Frederik Hermans' fictieve discussie met Jean-Paul Sartre

    NARCIS (Netherlands)

    van Rooden, A.

    2012-01-01

    In discussions on the social impact of literature, literary commitment is often opposed to literary autonomy. Within the field of Dutch literature, Willem Frederik Hermans is generally understood as one of the most important representatives and supporters of literary autonomy. Jean-Paul Sartre, on t

  19. Herman Melville's "Benito Cereno": A Cognitive Approach in Search of Illusions and Allusions.

    Science.gov (United States)

    Khawaja, Mabel

    For one Fulbright lecturer teaching Herman Melville's novel "Benito Cereno" at the University of Tunis (North Africa), the setting appeared to be ideal for a United States novel course. "Benito Cereno", for the most part, takes place on a large ship carrying slaves. Eventually, the slaves revolt against their Spanish masters and demand to be taken…

  20. De ernst van het spel : Willem Frederik Hermans en de ethiek van de persoonlijke mythologie

    NARCIS (Netherlands)

    Rutten, D.

    2016-01-01

    In the ongoing discussion on the societal engagement of modern literature, a bad name was given to a specific group of modernist writers (chapter two). Among them is the Dutch writer that goes by the name of Willem Frederik Hermans. The critique was aimed specifically at the proclaimed ‘unrealistic’

  1. Het gelijk van de schrijver. Willem Frederik Hermans' fictieve discussie met Jean-Paul Sartre

    NARCIS (Netherlands)

    van Rooden, A.

    2012-01-01

    In discussions on the social impact of literature, literary commitment is often opposed to literary autonomy. Within the field of Dutch literature, Willem Frederik Hermans is generally understood as one of the most important representatives and supporters of literary autonomy. Jean-Paul Sartre, on

  2. Herman Simm põhjendab reetmist KGB minevikuga / Risto Berendson, Rasmus Kagge

    Index Scriptorium Estoniae

    Berendson, Risto, 1975-

    2008-01-01

    Riigireetmises uurimise all viibiva Herman Simmi väidetel langes ta KGB šantaaži ohvriks. Vt. samas: Indrek Jürjo. KGB lähiajalugu Eestis püsib ähmasena; Vladimir Jushkin. Agentide nimed jäävad igaveseks saladuseks; Hardo Aasmäe. Agentuuritoimikud viidi Eestist minema

  3. De ernst van het spel : Willem Frederik Hermans en de ethiek van de persoonlijke mythologie

    NARCIS (Netherlands)

    Rutten, Daan

    2016-01-01

    Hoe kwam deze cynische schrijver Willem Frederik Hermans, die vond dat literatuur niet meer mocht zijn dan een amorele ‘persoonlijke mythologie’, tot een ethisch gemotiveerde cultuur- en maatschappijkritiek? Om dit mysterie op te lossen zonder onrecht te doen aan de modernistische paradoxen in Herma

  4. De ernst van het spel : Willem Frederik Hermans en de ethiek van de persoonlijke mythologie

    NARCIS (Netherlands)

    Rutten, D.|info:eu-repo/dai/nl/328235369

    2016-01-01

    In the ongoing discussion on the societal engagement of modern literature, a bad name was given to a specific group of modernist writers (chapter two). Among them is the Dutch writer that goes by the name of Willem Frederik Hermans. The critique was aimed specifically at the proclaimed ‘unrealistic’

  5. Herman Simm põhjendab reetmist KGB minevikuga / Risto Berendson, Rasmus Kagge

    Index Scriptorium Estoniae

    Berendson, Risto, 1975-

    2008-01-01

    Riigireetmises uurimise all viibiva Herman Simmi väidetel langes ta KGB šantaaži ohvriks. Vt. samas: Indrek Jürjo. KGB lähiajalugu Eestis püsib ähmasena; Vladimir Jushkin. Agentide nimed jäävad igaveseks saladuseks; Hardo Aasmäe. Agentuuritoimikud viidi Eestist minema

  6. Herman van Roijen 1905-1991 : Een diplomaat van klasse (A diplomat's diplomat)

    NARCIS (Netherlands)

    van der Maar, Rimko; Meijer, Hans

    2013-01-01

    Dutch possession, a dispute which was threatening to escalate into a major military conflict. This biography partly based on unique familiy archives never researched before is about his personal and Herman van Roijen is counted among the greats of 20th century Dutch diplomacy. His reputation as an g

  7. Herman van Roijen 1905-1991 : Een diplomaat van klasse (A diplomat's diplomat)

    NARCIS (Netherlands)

    van der Maar, Rimko; Meijer, Hans

    2013-01-01

    Dutch possession, a dispute which was threatening to escalate into a major military conflict. This biography partly based on unique familiy archives never researched before is about his personal and Herman van Roijen is counted among the greats of 20th century Dutch diplomacy. His reputation as an

  8. BOOK REVIEW: A Journey with Fred Hoyle (Second Edition)

    Science.gov (United States)

    Wickramasinghe, Chandra; Sterken, Christiaan

    2013-12-01

    I read A Journey with Fred Hoyle: The Search for Cosmic Life shortly after the first edition appeared in 2005. The second expanded edition of this remarkable autobiographical account brings the scientific story up to date. The added Epilogue offers reflections in 2012, and shows that some of Hoyle's and Wickramasinghe's heretical theories have become accepted science today: these scientists were among the forerunners of today's astrobiology. The book is the story - presented as a blend of personal anecdotes, travel stories, references to political and social events, and science writing - of the remarkable 40-year friendship and scientific collaboration between the British astrophysicist Fred Hoyle and the Sri Lankan mathematician and astronomer Chandra Wickramasinghe. The author illuminates the story of his collaboration with Hoyle with interesting aspects of his personal life, such as the description of his educational background in Sri Lanka, and the story of how he, as a PhD student, made his first contact with his supervisor in 1960. The book also offers insights into Hoyle's and Wickramasinghe's family lives. The narrative also contains plenty of interstellar astrophysics along with the stories. Sir Fred Hoyle (1915-2001) was famous for his contribution to the theory of stellar nucleosynthesis, renowned for his coining (on BBC radio) of the term Big Bang and for his later rejection of that theory (coupled to his advocacy of the steady state cosmology), and famed as writer of more than a dozen science-fiction stories. He was the founding director of the Cambridge Institute of Theoretical Astronomy (that later became the Institute of Astronomy). Hoyle was a scientific whistleblower, a radical troublemaker, an unorthodox scientific mind, but also a victim of the system. Hoyle-Wickramasinghe thought was a long-term assault on conventional thinking: especially their notable concept of panspermia (that ever-present life pervades our universe) and their opposition to

  9. Fred Tschopp (1905-1980, Landscape Architecture: New Zealands Forst Modern Practitioner

    Directory of Open Access Journals (Sweden)

    John Adam

    2003-10-01

    Full Text Available Ad Astera Per Aspera With its naturally beautiful and varied topography the Domain calls for nothing less than 'landscape architecture'. This is something more comprehensive than 'landscape gardening'. Fred Tschopp, 1931 (New Zealand Herald

  10. Kust tuleb huvi looduse vastu? / Fred Jüssi, Robert Oetjen, Toomas Jüriado... [jt.

    Index Scriptorium Estoniae

    2010-01-01

    Küsimusele vastasid loodusfotograaf ja publitsist Fred Jüssi, Tartu keskkonnahariduse keskuse juhataja Robert Oetjen, zooloog ja publitsist Aleksei Turovski, Nõo põhikooli bioloogia- ja geograafiaõpetaja Evi Piirsalu, ning loodusajakirjanik Toomas Jüriado

  11. A tighter bound for the self-stabilization time in Hermanʼs algorithm

    DEFF Research Database (Denmark)

    Feng, Yuan; Zhang, Lijun

    2013-01-01

    We study the expected self-stabilization time of Hermanʼs algorithm. For N processors the lower bound is 427N2 (0.148N2), and an upper bound of 0.64N2 is presented in Kiefer et al. (2011) [4]. In this paper we give a tighter upper bound 0.521N2. © 2013 Published by Elsevier B.V.......We study the expected self-stabilization time of Hermanʼs algorithm. For N processors the lower bound is 427N2 (0.148N2), and an upper bound of 0.64N2 is presented in Kiefer et al. (2011) [4]. In this paper we give a tighter upper bound 0.521N2. © 2013 Published by Elsevier B.V....

  12. Marc Chagalli ja Hermann? [Herman] Talviku graafika Pärnus / Feliks Krapp

    Index Scriptorium Estoniae

    Krapp, Feliks

    1999-01-01

    10. okt.-st Pärnu Uue Kunsti Muuseumis avatud näitusel on väljas 25 Marc Chagalli värvilist litograafiat (sari 'Exodus') ja 25 eri tehnikais, aastail 1951-1983 valminud graafilist tööd Herman Talvikult (1906-1984). Piibliteemaline väljapanek tähistab Kristuse sünnipäeva.

  13. Das Individuum und dessen Entwicklung - der Einzelne und das Kollektivum : Eine Analyse von Herman Hesses Demian

    OpenAIRE

    Wilk, Djina

    2008-01-01

    This paper combines two theoretical fields, the psychoanalytical and the political, with regards to the discussion on Herman Hesse’s Demian. Rather than to merely see Demian as a psychological study of one particular, singular person, I consider Demian to be an urgent request to people in general that they should follow their inner voice and develop themselves fully as individuals. Furthermore, the novel conveys the message that the individual should live in coexistence with the collective, i...

  14. Harju maakohus saab Herman Simmi "nimelise" istungitesaali / Holger Roonemaa ; intervjueerinud Jan Jõgis-Laats ; kommenteerinud Andrus Ansip

    Index Scriptorium Estoniae

    Roonemaa, Holger

    2009-01-01

    Tingimustest turvaalale, kus töödeldakse riigisaladusi ja Harju maakohtu istungisaali vastavusest nendele Herman Simmi kohtuasja arutamiseks. Vt. samas lühiinterv.: Ansip: Simm pole meie James Bond

  15. Harju maakohus saab Herman Simmi "nimelise" istungitesaali / Holger Roonemaa ; intervjueerinud Jan Jõgis-Laats ; kommenteerinud Andrus Ansip

    Index Scriptorium Estoniae

    Roonemaa, Holger

    2009-01-01

    Tingimustest turvaalale, kus töödeldakse riigisaladusi ja Harju maakohtu istungisaali vastavusest nendele Herman Simmi kohtuasja arutamiseks. Vt. samas lühiinterv.: Ansip: Simm pole meie James Bond

  16. Fred Tschopp, Landscape Architect: The American Practice 1938 - 1970

    Directory of Open Access Journals (Sweden)

    John P Adam

    2004-06-01

    Full Text Available Fred Tschopp, a Swiss-American landscape architect practised in both New Zealand and America from the 1920s to 1970. While in New Zealand (1929-1932, Tschopp worked in Auckland, Wellington and Rotorua. Tschopp's projects in New Zealand represent a new form of practice, a modernist approach to the practise of landscape architecture. We argue that Tschopp's work is a break from conventional landscape design practice in New Zealand during the 1920s and 1930s. He introduced three important ideas; the first was the idea of the park as a multi-functional space that accommodates a wide range of community needs, sport, education and productive horticulture. The second were ideas of a new discipline, planning, which had developed from the landscape architectural programme at Harvard University. The third idea was a regionalist sensibility, influenced by his earlier projects for the Theodore Payne nursery in Los Angeles. Tschopp insisted on the uses of indigenous New Zealand plants in many of his New Zealand projects, notably his work for Parliament grounds and the Rotorua plan. On Tschopp's return to America he began working for the giant California water and power utility, the Los Angeles Department of Water and Power (LADWP. For over 30 years Tschopp was responsible for the design, implementation, and maintenance of over 30 landscapes; reservoirs, storage tanks, and pumping stations, as part the vast infrastructure of the LADWP. This paper describes and discusses Tschopp's landscape practice at the LADWP and outlines Tschopp's career, examining in detail two particular areas of practice. Our contention is that Tschopp abandons his interest in the regional and, instead, develops one particular aspect of modernist practice, functionalism. We explore some of the ways writers and designers of landscape architecture have engaged with functionalism and finish by framing Tschopp's practice within this somewhat neglected aspect of the modern landscape.

  17. Tunneling in two-dimensional systems using a higher-order Herman-Kluk approximation.

    Science.gov (United States)

    Hochman, Gili; Kay, Kenneth G

    2009-02-14

    A principal weakness of the Herman-Kluk (HK) semiclassical approximation is its failure to provide a reliably accurate description of tunneling between different classically allowed regions. It was previously shown that semiclassical corrections significantly improve the HK treatment of tunneling for the particular case of the one-dimensional Eckart system. Calculations presented here demonstrate that the lowest-order correction also substantially improves the HK description of tunneling across barriers in two-dimensional systems. Numerical convergence issues either do not arise or are easily overcome, so that the calculations require only a moderate number of ordinary, real, classical trajectories.

  18. Dennis Berthold, American Risorgimento: Herman Melville and the Cultural Politics of Italy.

    Directory of Open Access Journals (Sweden)

    Paola Gemme

    2011-10-01

    Full Text Available In his new book, American Risorgimento: Herman Melville and the Cultural Politics of Italy, Dennis Berthold shows how Italy’s political transformation from a collection of small states controlled by foreign powers in the 1840s into a unified, independent nation by 1871 was central to Melville’s writing. Melville clearly saw the parallel between Italy’s struggle for freedom from foreign domination and drive for unification and, on the other hand, the war in the United States to abolish slavery...

  19. Fred Kradolfer.1903-1968. Designer gráfico influenciador e influenciado em Portugal

    OpenAIRE

    Henriques, Ana Rita Luís

    2011-01-01

    Tese de Mestrado em Design de Comunicação Tendo em vista o conhecimento do Design Gráfico em Portugal, estará em foco, como objecto de estudo, Fred Kradolfer (1903-1968) com as infl uências que trouxe para esta disciplina e para o país. Estudaram-se também os outros intervenientes mais próximos envolvidos neste processo, entre 1924 (data da chegada de Fred Kradolfer a Portugal) e o final dos anos 50. Como objectivos primordiais, pretendeu-se com este estudo aprofundar conhecimentos d...

  20. 76 FR 34227 - Fred Meyer Stores, Inc.; Supplemental Notice That Initial Market-Based Rate Filing Includes...

    Science.gov (United States)

    2011-06-13

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF ENERGY Federal Energy Regulatory Commission Docket No. ER11-3615-000 Fred Meyer Stores, Inc.; Supplemental Notice That... supplemental notice in the above-referenced proceeding of Fred Meyer Stores, Inc.'s application for...

  1. A Critical Evaluation of Herman and Chomsky’s Propaganda Model /Evaluación crítica del modelo de propaganda de Herman y Chomsky

    Directory of Open Access Journals (Sweden)

    Lic. Joan Pedro; joan.pedro@estumail.ucm.es

    2009-01-01

    Full Text Available This article reviews the five elements (filters which compose the Propaganda Model and evaluates its relevance and validity twenty years after its original elaboration by Edward S. Herman and Noam Chomsky. The article also analyzes the applicability of the model to other contexts which were not originally contemplated and reflects on other elements which also have the effect of filtering the information and, therefore, should be taken into account by the model. Finally, it considers the possibility of adding two new filters proposed by other authors. The article concludes that the Propaganda Model is even more valid today than it was twenty years ago. It is a very adequate research tool for the analysis of the mass media, but, since it promotes an analysis which is contrary to the interests of the élites, it tends to be institutionally marginalized.Este artículo repasa los cinco elementos (filtros que componen el Modelo de Propaganda y evalúa su relevancia y validez veinte años después de su elaboración original por Edward S. Herman y Noam Chomsky. El artículo analiza después la aplicabilidad del modelo a otros contextos que no fueron originalmente contemplados y reflexiona sobre otros elementos que también tienen el efecto de filtrar la información y que, por tanto, deben tenerse en cuenta por el modelo. Por último, considera la posibilidad de añadir dos nuevos filtros propuestos por otros autores. El artículo concluye que el Modelo de Propaganda es hoy aún más válido que hace veinte años. Es una herramienta de investigación muy adecuada para el análisis de los medios de comunicación de masas, pero que, al promover un análisis contrario a los intereses de las élites, tiende a ser marginado institucionalmente.

  2. Learning from Our Predecessors: The Work of Fred Newton Scott and George Jardine.

    Science.gov (United States)

    Gaillet, Lynee Lewis

    An examination of the work of Fred Newton Scott and George Jardine can help composition scholars and teachers put their contributions into perspective and serve as a guide through present and future transitional periods in the field of composition. Following and composition revolution of the mid 20th century, many theories of composition promoted…

  3. Leadership Match: The Theories of Fred Fiedler. Coombe Lodge Working Paper. Information Bank Number 1453.

    Science.gov (United States)

    Turner, Colin M.

    This working paper examines the theories of Fred Fiedler concerning the effectiveness of different leadership styles in different situations. Discussed first are the distinctions that Fiedler makes between what he terms relationship-motivated leaders and task-motivated leaders. The next section comprises an explanation of Fiedler's view of…

  4. Optimization of enrichment for virtual ligand screening using an established FRED-Surflex approach

    NARCIS (Netherlands)

    Du, J.; Bleylevens, I.W.M.; Bitorina, A.V.; Nicolaes, G.A.F.

    2012-01-01

    Virtual ligand screening (VLS) is an in silico technology used for the productive and cost effective search for novel hit or lead compounds. VLS can be divided into rigid body docking (e.g. FRED) and flexible body docking (e.g. Surflex) procedures. Theoretically, rigid body docking VLS is fast but l

  5. FRAMEWORK FOR ENVIRONMENTAL DECISION-MAKING, FRED: A TOOL FOR ENVIRONMENTALLY-PREFERABLE PURCHASING

    Science.gov (United States)

    In support of the Environmentally Preferable Purchasing Program of the US EPA, the Systems Analysis Branch has developed a decision-making tool based on life cycle assessment. This tool, the Framework for Responsible Environmental Decision-making or FRED streamlines LCA by choosi...

  6. Fire analysis in the eighteenth century: Herman Boerhaave and scepticism about the elements.

    Science.gov (United States)

    Powers, John C

    2014-11-01

    In the eighteenth century, many chemists asserted that chemical operations could not decompose a substance into its natural, constituent elements or principles. One such chemist was Herman Boerhaave (1668-1738), who claimed, following the work of Robert Boyle and Joan Baptista van Helmont, that examples of these alleged analyses were, in fact, not reductions of a body into elements, but rather the rearrangement of its particles by the fire. Since we cannot observe the shape and arrangement of particles directly, he reasoned, any claim regarding the elemental status of a substance was purely speculative and inadmissible in his chemistry. As a result, Boerhaave devised a system of chemistry which, in effect, accepted no elemental substances and which focused on understanding how the chemist's 'instruments,' including fire and chemical menstrua, effected changes in matter. I conclude by showing how Boerhaave's conclusion had ramifications for later developments in chemistry, especially those of the French Stahlians and of Antione Lavoisier.

  7. The fluid mechanics of nutrition: Herman Boerhaave's synthesis of seventeenth-century circulation physiology.

    Science.gov (United States)

    Orland, Barbara

    2012-06-01

    This paper investigates the theory of nutrition of Herman Boerhaave, the famous professor of medicine and chemistry at the university of Leyden. Boerhaave's work, which systematized and synthesized the knowledge of the time, represents a shift from a humoral to a hydraulic model of the body in medicine and culture around 1700. This epistemological reconfiguration of early modern physiological thinking is exemplified with respect to the changing meanings of milk. While over centuries the analogy between blood and milk played an essential role in understanding the hidden workings of the nutritional faculties, following the discovery of the blood circulation the blood-milk analogy was transformed into a chyle-milk analogy. Yet Boerhaave's interpretations show that the use of new knowledge tools did not simply displace the old ways of reasoning. Instead, analogies continued to serve as epistemic instruments. Old theories and new insights overlapped, and contemporary knowledge assimilated past ideas.

  8. Different shades of Newton: Herman Boerhaave on Newton mathematicus, philosophus, and optico-chemicus.

    Science.gov (United States)

    Ducheyne, Steffen

    2017-03-29

    In this paper I will probe into Herman Boerhaave's (1668-1738) appropriation of Isaac Newton's natural philosophy. It will be shown that Newton's work served multiple purposes in Boerhaave's oeuvre, for he appropriated Newton's work differently in different contexts and in different episodes in his career. Three important episodes in, and contexts of, Boerhaave's appropriation of Newton's natural philosophical ideas and methods will be considered: 1710-11, the time of his often neglected lectures on the place of physics in medicine; 1715, when he delivered his most famous rectorial address; and, finally, 1731/2, in publishing his Elementa chemiae. Along the way, I will spell out the implications of Boerhaave's case for our understanding of the reception, or use, of Newton's ideas more generally.

  9. Beyond the Great Divide: New explorations in editing the Complete Works of Dutch Novelist Willem Frederik Hermans

    NARCIS (Netherlands)

    Kegel, P.W.; Nelson, Brent; Cunningham, Richard

    2016-01-01

    Though the publication of the Complete works of Dutch novelist Willem Frederik Hermans (1992-1995) is a challenge in itself, nowadays the aim of the mere publishing of 24 printed volumes is far from enough. Operating within an academic field of literary theory and criticism, in which a detailed and

  10. Picturing valuations in affect space: Comparison of two methods of ordination in Hermans' Self-Confrontation Method

    NARCIS (Netherlands)

    Geel, A.L.M. van; Mey, H.R.A. De; Thissen-Pennings, M.C.E.; Bendermacher, A.N.H.

    2000-01-01

    In this study we aim at developing an adequate representation of grid data gathered with Hermans' Self-Confrontation Method (SCM). For a large sample of grids (N = 127), a Principal Component Algorithm (KUNGRID) and a Multidimensional Scaling Algorithm (ALSCAL) are both applied in order to assess th

  11. Rainer Saks : ärgem lohutagem end lootusega, et Herman Simm oli ainus / Rainer Saks ; interv. Rasmus Kagge

    Index Scriptorium Estoniae

    Saks, Rainer

    2008-01-01

    Intervjuu Eesti eriteenistuste endise esikoordinaatori ning praeguse Vabariigi Presidendi kantselei direktoriga, kes vastab küsimustele riigireetmises kahtlustatava Herman Simmi kohta. Vt. samas: Kes on Rainer Saks? Lühiülevaade elukäigust ja karjäärist

  12. FRAMEWORK FOR RESPONSIBLE ENVIRONMENTAL DECISION-MAKING (FRED): USING LIFE CYCLE ASSESSMENT TO EVALUATE PREFERABILITY OF PRODUCTS

    Science.gov (United States)

    Framework for Responsible Environmental Decision-Making (FRED) demonstrates how the life-cycle concept can be used to quantify competing products' environmental performance so that this information may be integrated with considerations of total ownership cost and technical perfor...

  13. Le roman policier de Fred Vargas : mutations du romanesque et diffusion médiatique dans la France contemporaine

    OpenAIRE

    Chen CHEN

    2015-01-01

    In order to have a better understanding of the impressive success of Fred Vargas' detective novels, this thesis endeavours to place the writer in editorial landscape, analyses her positioning among the sub-categories of crime fiction, and aims to clarify the cathartic function in her literary creation. As a result, the study is about novelistic mutations, about transmedia and transnational spreading of Fred Vargas' works, with a corpus basically relating to the serie of the Three Evangelists ...

  14. Herman Merivale’s black legend: rethinking the intellectual history of free trade imperialism

    Directory of Open Access Journals (Sweden)

    Daniel Rood

    2008-12-01

    Full Text Available Focusses on the lectures and theories of economist and colonial bureaucrat Herman Merivale on the imperial transition of British colonialism from slave labour to free labour, and toward free trade, in 1839. Author specifically shows how Merivale propagated the free trade imperialism of the reformed British Empire by using the "Black Legend" way of thinking, i.e. criticizing Spanish colonialism, to caricaturize the second British Empire, and thus justify imperial policy reforms. Author elaborates on this Black Legend tradition, going back to writings of Las Casas, and how it served as justification for "better" imperialisms of other colonial powers than Spain, and how Merivale's views followed this tradition. He shows how Merivale as part of this criticized the mismanagement, slavery, brutality, mercantilism, and the concentration of power and wealth in Cuba and other Spanish colonies, as negative examples contrasted to the British approach. Author points out, however, how Merivale's views were in part paradoxical and ambiguous, as he favoured a social hierarchy and an imperial authoritarianism limiting free labour.

  15. Herman Paul. (2011. Hayden White: The Historical Imagination. Cambridge: Polity Press [204 pp.

    Directory of Open Access Journals (Sweden)

    Ariel C. Lopez

    2011-12-01

    Full Text Available Ang akdang ito ni Herman Paul ay isang kritikal na pagsasakasaysayan(historicization ng mga ideya ni Hayden White na maibibilang sapinakamahahalagang pilosopo ng kasaysayan ng kontemporaryong panahon.Si White ay tanyag bilang simbolo par excellence ng postmodernistang kasaysayan na reaksyon laban sa noo’y, at hanggang ngayo’y, namamayaning positibistang pananaw (na inuugat sa Alemang historyador ng ika-19 na dantaon na si Leopold von Ranke. Noong Dekada ’50 pa lang, masusulyapan na ang pagsalungat ni White sa tradisyong positibista nang tawagin niya si Ranke bilang “kawawang nilalang na nagkandabulag sa paghahanap ng ‘kung ano ang tunay na nangyari’”(Paul, 2011, p.105. Para kay White, ang nakaraan per se (bilang nakaraan ay isang “walang-kahulugang katotohanan” (meaningless reality lamang. Binibigyang kahulugan ng mga historyador ang nakaraan sa pamamagitan ng mga naratibo na siyang humuhugis at nagtatakda sa kahulugan. Sa magnum opus ni White na pinamagatang Metahistory: The Historical Imagination in Nineteenth-Century Europe (1973, inilalatag niya ang ibat-ibang pagbabanghay (emplotment at tropos (tropesna implisitong sinusundan at sinasandigan ng mga (positibistang historyador upang magkaroon ng makatotohanang naratibo.

  16. FRED fuel behaviour code: Main models and analysis of Halden IFA-503.2 tests

    Energy Technology Data Exchange (ETDEWEB)

    Mikityuk, K., E-mail: konstantin.mikityuk@psi.ch [Paul Scherrer Institute, 5232 Villigen PSI (Switzerland); Shestopalov, A., E-mail: shest@dhtp.kiae.ru [RRC' Kurchatov Institute' , Kurchatov sq, 123182 Moscow (Russian Federation)

    2011-07-15

    Highlights: > We developed a new fuel rod behaviour code named FRED. > Main models and assumptions are described. > The code was checked using the IFA-503.2 tests performed at the Halden reactor. - Abstract: The FRED fuel rod code is being developed for thermal and mechanical simulation of fast breeder reactor (FBR) and light-water reactor (LWR) fuel behaviour under base-irradiation and accident conditions. The current version of the code calculates temperature distribution in fuel rods, stress-strain condition of cladding, fuel deformation, fuel-cladding gap conductance, and fuel rod inner pressure. The code was previously evaluated in the frame of two OECD mixed plutonium-uranium oxide (MOX) fuel performance benchmarks and then integrated into PSI's FAST code system to provide the fuel rod temperatures necessary for the neutron kinetics and thermal-hydraulic modules in transient calculations. This paper briefly overviews basic models and material property database of the FRED code used to assess the fuel behaviour under steady-state conditions. In addition, the code was used to simulate the IFA-503.2 tests, performed at the Halden reactor for two PWR and twelve VVER fuel samples under base-irradiation conditions. This paper presents the results of this simulation for two cases using a code-to-data comparison of fuel centreline temperatures, internal gas pressures, and fuel elongations. This comparison has demonstrated that the code adequately describes the important physical mechanisms of the uranium oxide (UOX) fuel rod thermal performance under steady-state conditions. Future activity should be concentrated on improving the model and extending the validation range, especially to the MOX fuel steady-state and transient behaviour.

  17. FY2000 FRED Test Report - Final Report on the Crossflow Filter Optimization with 5.6M Sodium Salt Solution

    Energy Technology Data Exchange (ETDEWEB)

    Poirier, M.R.

    2001-04-04

    The Filtration Research Engineering Demonstration (FRED) at the University of South Carolina ran a test campaign to confirm the utility of crossflow filtration for use with the MST sorption as a strontium-actinide removal technology that is expected to be coupled with the ion exchange and solvent extraction process alternatives. FRED has a Mott Metallurgical 7 tube filter with individual tubes 10 ft long and 3/4 inch o.d. having a nominal pore size of 0.5 microns. The blend sludge consisted of a 50/50 wt percent mixture of sludge simulants of SRS Tank 40H and Tank 8F simulated sludges previously manufactured at FRED. Monosodium Titanate (MST) was blended with the 50/50 sludge mixture in a proportion of 0.9167 MST-to-Sludge ratio to provide the solids loadings analyzed in this test.

  18. Ransom, Religion, and Red Giants: C.S. Lewis and Fred Hoyle

    Science.gov (United States)

    Larsen, Kristine

    2010-01-01

    Famed fantasy writer C.S. Lewis (1898-1963) was known to friends as a well-read astronomy aficionado. However, this medieval scholar and Christian apologist embraced a pre-Copernican universe (with its astrological overtones) in his Chronicles of Narnia series and defended the beauty and relevance of the geocentric model in his final academic work, "The Discarded Image". In the "Ransom Trilogy” ("Out of the Silent Planet", "Perelandra", and "That Hideous Strength") philologist Ransom (loosely based on Lewis's close friend J.R.R. Tolkien) travels to Lewis's visions of Mars and Venus, where he interacts with intelligent extraterrestrials, battles with evil scientists, and aids in the continuation of extraterrestrial Christian values. In the final book, Ransom is joined by a handful of colleagues in open warfare against the satanic N.I.C.E. (National Institute for Coordinated Experiments). Geneticist and evolutionary biologist J.B.S. Haldane criticized Lewis for his scientifically inaccurate descriptions of the planets, and his disdain for the scientific establishment. Lewis responded to the criticism in essays of his own. Another of Lewis's favorite scientific targets was atheist Fred Hoyle, whom he openly criticized for anti-Christian statements in Hoyle's BBC radio series. Writer and Lewis friend Dorothy L. Sayers voiced her own criticism of Hoyle. In a letter, Lewis dismissed Hoyle as "not a great philosopher (and none of my scientific colleagues think much of him as a scientist.” Given Lewis's lack of respect for Hoyle, and use of creative license in describing the planets, and the flat-earth, "geocentric” Narnia, it is surprising that Lewis very carefully includes an astronomically correct description of red giants in two novels in the Narnia series ("The Magician's Nephew" and "The Last Battle"). This inclusion is even more curious given that Fred Hoyle is well-known as one of the pioneers in the field of stellar death and the properties of red giants.

  19. NASA aircraft technician Don Herman completes placement of the first official U.S. Centennial of Fli

    Science.gov (United States)

    2002-01-01

    NASA aircraft technician Don Herman completes placement of the first official U.S. Centennial of Flight Commission logo on an aircraft. The honored recipient is NASA Dryden Flight Research Center's Active Aeroelastic Wing (AAW) F/A-18 research aircraft, which is poised to begin wing-warping research flights harkening back to the Wright brothers. The Centennial of Flight Commission was created by the U.S.Congress in 1999 to serve as a national and international source of information about activities to commemorate the centennial of the Wright Brothers' first powered flight on the sands of Kitty Hawk, North Carolina, on December 17, 1903. Centennial activities are scheduled for 2003 in both North Carolina and Dayton, Ohio, home of the Wrights. In addition to these celebrations, numerous historical and educational projects are anticipated on the subject of aviation and aeronautics that will be an important legacy of the centennial of powered flight.

  20. Il senso del lavoro e il suo contesto. Una rilettura di Bartleby lo scrivano di Herman Melville

    Directory of Open Access Journals (Sweden)

    Giuseppe Ruvolo

    2015-09-01

    Full Text Available Attraverso una rilettura critica del noto racconto di Herman Melville Bartleby lo scrivano, viene proposta una chiave di comprensione psico-antropologica delle condotte lavorative, delle relazioni nei contesti lavorativi e delle loro ricadute psicopatologiche. In particolare viene avanzata una lettura che connette i comportamenti e le relazioni lavorative quali esiti della difficoltà dei singoli nella mentalizzazione dei modelli ideologico-culturali che li determinano in un dato momento storico. Viene criticata una lettura, tendenzialmente presente in psicologia clinica e in psicologia del lavoro, in chiave riduttivamente individualistica, la quale attribuisce al singolo presunti deficit psichici ricercando le cause, e gli antecedenti delle condotte disadattive delle formazioni psicopatologiche, nella sola storia personale e individuale dei soggetti.

  1. The 'Adat' institutionand the Management of Grand Forest 'Herman Yohannes' in Indonesian Timor: The Role of Design Principles for Sustainable Management of Common Pool Resources

    NARCIS (Netherlands)

    J.A. van Ast (Jacko); A. Widaryati; M. Bal (Mansee)

    2014-01-01

    markdownabstract__Abstract__ Local success stories of sustainable forest management can inspire scientists and decision-makers. This article analyses the traditional ‘Adat’ institution that plays a role in the management of Grand Forest Park ‘Herman Yohannes’, in the Western part of Timor where the

  2. Review: Fred Pearce (2012: Land Grabbing. Der globale Kampf um Grund und Boden

    Directory of Open Access Journals (Sweden)

    Blümel, Lisanne

    2014-08-01

    Full Text Available "Kaufen Sie Land. Es wird keins mehr gemacht.“ (7: Mit diesem Zitat von Mark Twain illustriert der britische Umweltjournalist Fred Pearce gleich zu Beginn seines Buches, dass die Ressourcenknappheit unseres Planeten das auslösende Moment für Problematiken wie Land Grabbing (auf deutsch: ,Landnahme‘ ist. Pearce erläutert in der Einleitung seinen Sprachgebrauch, der legale wie illegale Aneignung gleichermaßen umfasst: „Ich benutze ihn [den Begriff der ,Landnahme‘] in diesem Buch für alle Formen der umstrittenen Aneignung von Landrechten durch Ausländer oder andere ,Außenstehende‘, unabhängig davon, ob die Übertragung auf legalem Weg verläuft oder nicht. Nicht jedes dieser Geschäfte ist schlecht, aber alle verdienen Aufmerksamkeit“ (8. Land wird weltweit – in erster Linie in Afrika aber auch in Asien und Südamerika − von Ausländern oder Außenstehenden gepachtet bzw. gekauft. Den Landnehmern, ganzen Staaten, multinationalen Firmen oder reichen Privatanlegern kann es dabei um Profitmaximierung gehen, aber auch Ernährungssicherung und Naturschutz sind mögliche Motive. Landverkäufer hingegen erhoffen sich zumeist einen wirtschaftlichen Gewinn.

  3. The blot on the landscape: Fred Williams and Australian art history

    Directory of Open Access Journals (Sweden)

    Keith Broadfoot

    2014-12-01

    Full Text Available A defining shift in Australian art historiography occurred with the publishing of Bernard Smith’s 1980 Boyer Lecture series, The Spectre of Truganini. Seeing the exclusion of an Aboriginal presence in Australian art through the ideas of Freud, the history of Australian art, Smith proposed, was a history of repression. After Smith, Ian McLean has developed the most detailed account of the history of Australian art according to this methodology. This essay examines the work of the modern Australian artist Fred Williams in relation to both Smith and McLean’s understanding of the history of Australian art but to expand on their work I argue that, rather than Freud alone, it is Lacan’s refiguring of Freud that offers us the most insight into Williams’s work. Further, insofar as I argue that the history of Australian art is the very subject matter of Williams’s work, his work stands in for a wider project, the understanding of the history of Australian art according to Lacan’s proposal of a foundational split between the eye and the gaze.

  4. W. Ritchie Russell, A.B. Baker, and Fred Plum: Pioneers of ventilatory management in poliomyelitis.

    Science.gov (United States)

    Wijdicks, Eelco F M

    2016-09-13

    Historically, neurologists were not involved in the day-to-day management of critically ill patients with bulbar poliomyelitis, but some were. The major contributions of 3 neurologists-W. Ritchie Russell, A.B. Baker, and Fred Plum-in the respiratory management of poliomyelitis have not been recognized. Russell's work was instrumental in identifying multiple types of poliomyelitis defined by their respiratory needs, and he advised treatment that varied from simple postural drainage to use of respirators. He participated in the development of the Radcliffe respiratory pump. Baker recognized the essential involvement of the vagal nerve in respiratory distress, but also observed that involvement of vital centers without cranial nerve involvement would lead to irregular and shallow respiration in some patients and in others with marked dysautonomic features. A similar finding of central involvement of respiration was noted by Plum, who also stressed the importance of hypercapnia. Plum emphasized measurements of vital capacity and techniques to minimize trauma with suctioning after tracheostomy. These 3 neurologists understood the importance of airway and ventilator management, which is currently one of the many pillars of neurocritical care. © 2016 American Academy of Neurology.

  5. The Impossible Performance of Mass Commodity. George Maciunas, Herman Fine and Robert Watts’ Implosions Inc. (ca. 1967

    Directory of Open Access Journals (Sweden)

    Estella Noriega, Iñaki

    2016-12-01

    Full Text Available In the US context Fluxus is understood as an advance of the ‘60s radicalism. The assumption that Fluxus was opposed to consumption culture, as that embodied by Pop art, is among the interpretations that renew such a view. Examining the example of Implosions Inc., a short-lived but nevertheless interesting commercial enterprise formed by Robert Watts, Herman Fine and George Maciunas in 1967, this essay focuses its attention on the complex relationship between Fluxus and commercial culture. Implosions Inc. was a project in which many Pop artists were asked to participate along with its Fluxus founders, and it was intended as another step forward in the transformation of the artist into a commodity mass-producer. In analyzing this phenomenon, this article questions assumed principles in the Neo-avantgarde theory like the distinction between art production and culture consumption. The essay, however, will try to establish another paradigm that draws the differences between Pop art and Fluxus as the kind of audiences both these tendencies tried to conform. As a conclusion, the article fleshes out some ideas on individualism that were developed by Maciunas, which shed light on the notions surrounding the idea of collectivism as developed in Fluxus.En el contexto de los EE.UU., Fluxus ha sido entendido como avanzadilla del radicalismo de la década de los 60. La asunción de que Fluxus se oponía a la cultura comercial, tal y como era representada por el pop art, es una de las líneas que renueva dicha interpretación. Mediante el análisis de Implosions Inc., una pequeña pero fundamental empresa de Fluxus que formaron en 1967 George Maciunas, Robert Watts y Herman Fine, este ensayo pretende mostrar colaboraciones entre los artistas Fluxus y Pop y que se propuso hacer del artista un productor de mercancía de masas. Al analizar este episodio, el artículo cuestiona principios de la teoría de la neovanguardia, como la distinción entre el arte de la

  6. La estrategia del acoso. Análisis de la novela "Billy Budd", de Herman Melville, en clave de acoso laboral

    Directory of Open Access Journals (Sweden)

    Julián Antonio Paniagua López

    2012-10-01

    Full Text Available The target of this article is to try to show that Herman Melville’s novel Billy Budd can beconsidered a forerunner of what years later will be known as harassment in the workplace, mobbing. Inthe work are described the characteristics of the bully, the limits of the laws to prevent those behaviours,and the responsibility of the organizations’ managements in these cases.

  7. Harold Fred Dorn and the First National Cancer Survey (1937-1939): the founding of modern cancer epidemiology.

    Science.gov (United States)

    Lilienfeld, David E

    2008-12-01

    The development of modern epidemiology, particularly cancer epidemiology, is often seen as a post-World War II phenomenon. However, the First National Cancer Survey, conducted from 1937 to 1939 as part of the newly formed National Cancer Institute's initial activities, provided the first data on the occurrence of cancer in the United States. This project was directed by a young sociologist, Harold Fred Dorn. Through Dorn, many of the methodological innovations in sociology, such as the use of surveys and observational study designs, were incorporated into modern epidemiology. I examine Dorn's training and early career in the context of the First National Cancer Survey as a means of investigating the beginnings of modern epidemiology.

  8. 弗雷德·古德温"天生的银行家"%The Born Banker-Fred Goodwin

    Institute of Scientific and Technical Information of China (English)

    胡霞

    2007-01-01

    @@ 在中国,弗雷德·古德温(Fred Goodwin)这个名字相对来说还比较陌生,一般人只会把它当作一个欧洲人名字的简单代码一扫而过,但如果把这个名字和在欧洲排名第二、世界排名第五的苏格兰皇家银行CEO的职位联系起来,恐怕会一下子抓住人的敏感神经,尤其是在欧洲甚至美国华尔街,这是一个如雷贯耳的名字.

  9. 弗雷格意义理论的社会价值%The Social Worth of Fred's Sense Theory

    Institute of Scientific and Technical Information of China (English)

    李培; 王臻

    2012-01-01

    20世纪以来,意义理论一直是国内外学者潜心研究的重点课题之一,而弗雷格的意义理论作为整个意义理论体系的中流砥柱,更是人们关注的中心议题,尤其是其社会价值更是不容忽视。%Sense theory has been the intensive research on the subject of domestic and international scholars since the twentieth century.Fred's sense theory is visited as the mainstay of the whole sense theoretical system,especially,it's social worth is very vital.

  10. THE BEST LAID PLANS: FRED M. VINSON AND THE DECLINE AND FALL OF THE ROOSEVELT COURT, 1946-1949

    Directory of Open Access Journals (Sweden)

    Harvey Gresham Hudspeth

    2001-01-01

    Full Text Available One of the great ironies in constitutional history is the fact that the Supreme Court that Franklin Roosevelt labored so hard to construct lasted for such a short period of time following his death. Dying early in his fourth term in 1945, FDR’s supporters could at least take solace in the fact that eight of the Court’s nine sitting justices had been appointed by the late president. Within four years of Roosevelt’s death, however, the myth of monolithic-styled unity would be shattered and the so-called “Roosevelt Court” of Harlan Fiske Stone would have given way to the “Truman Court” of Fred M. Vinson. The great irony behind this transformation is that the very same economic issues that initially brought the Roosevelt Court together ultimately helped to likewise drive it apart.

  11. The Hand with the Pen: Martin of Loka, Matjaž Jurčič of Kapela and Herman Talner of Trebnje and their Colophons

    Directory of Open Access Journals (Sweden)

    Nataša Golob

    2014-12-01

    Full Text Available Beginning with expressions such as ideographs, the author’s autograph, and the copyist’s autograph, this paper explains the dilemma of some Late Medieval Manuscripts in Slovenian collections that were mistakenly identified as being the author’s own textual creation. The main part of this paper focuses on three mid-15th-century copyists: Martin of Loka, Matjaž Jurčič of Kapela, and Herman Talner of Trebnje. Because each of them added the name of their hometown to their signature, all three can be recognized as hailing from Slovenian places. Martin of (Škofja Loka was an erudite man, and this is evident from his texts he wrote in German, Slovenian and Latin, as well as from his many forms of scripts. Matjaž Jurčič of Kapela was probably a freelance artist, and the colophon to his copy of an epic poem contains an inscription in Latin, German and Provençal. Working in a remote location, the third, Herman Talner, copied a lengthy politically-oriented poem for Lord Ludvik of Castle Kozjak. At the end of their work all three added colophons which provide valuable information about these individuals and the conditions in which they worked.

  12. Fred: a GPU-accelerated fast-Monte Carlo code for rapid treatment plan recalculation in ion beam therapy

    Science.gov (United States)

    Schiavi, A.; Senzacqua, M.; Pioli, S.; Mairani, A.; Magro, G.; Molinelli, S.; Ciocca, M.; Battistoni, G.; Patera, V.

    2017-09-01

    Ion beam therapy is a rapidly growing technique for tumor radiation therapy. Ions allow for a high dose deposition in the tumor region, while sparing the surrounding healthy tissue. For this reason, the highest possible accuracy in the calculation of dose and its spatial distribution is required in treatment planning. On one hand, commonly used treatment planning software solutions adopt a simplified beam–body interaction model by remapping pre-calculated dose distributions into a 3D water-equivalent representation of the patient morphology. On the other hand, Monte Carlo (MC) simulations, which explicitly take into account all the details in the interaction of particles with human tissues, are considered to be the most reliable tool to address the complexity of mixed field irradiation in a heterogeneous environment. However, full MC calculations are not routinely used in clinical practice because they typically demand substantial computational resources. Therefore MC simulations are usually only used to check treatment plans for a restricted number of difficult cases. The advent of general-purpose programming GPU cards prompted the development of trimmed-down MC-based dose engines which can significantly reduce the time needed to recalculate a treatment plan with respect to standard MC codes in CPU hardware. In this work, we report on the development of fred, a new MC simulation platform for treatment planning in ion beam therapy. The code can transport particles through a 3D voxel grid using a class II MC algorithm. Both primary and secondary particles are tracked and their energy deposition is scored along the trajectory. Effective models for particle–medium interaction have been implemented, balancing accuracy in dose deposition with computational cost. Currently, the most refined module is the transport of proton beams in water: single pencil beam dose–depth distributions obtained with fred agree with those produced by standard MC codes within 1–2% of

  13. Telegramme sent on June 14 1956 from physicists Fred Reines and Clyde Cowan to Wolfgang Pauli announcing the detection, for the first time, of neutrinos. The Physics Nobel Prize in 1995 was awarded to Reines for this discovery.

    CERN Multimedia

    Maximiliem Brice

    2006-01-01

    Telegramme sent on June 14 1956 from physicists Fred Reines and Clyde Cowan to Wolfgang Pauli announcing the detection, for the first time, of neutrinos. The Physics Nobel Prize in 1995 was awarded to Reines for this discovery.

  14. Bacterial Transformation and the Origins of Epidemics in the Interwar Period: The Epidemiological Significance of Fred Griffith's "Transforming Experiment".

    Science.gov (United States)

    Méthot, Pierre-Olivier

    2016-04-01

    Frederick Griffith (1879-1941) was an English bacteriologist at the Pathological Laboratory of the Ministry of Health in London who believed that progress in the epidemiology and control of infectious diseases would come only with more precise knowledge of the identity of the causative microorganisms. Over the years, Griffith developed and expanded a serological technique for identifying pathogenic microorganisms, which allowed the tracing of the sources of infectious disease outbreaks: slide agglutination. Yet Griffith is not remembered for his contributions to the biology and epidemiology of infectious diseases so much as for discovering the phenomenon known as 'transformation'. Griffith's discovery, for many, was a pure case of serendipity whose biological relevance had also largely escaped him. In this paper, I argue that the key to understanding the significance of bacterial transformation - and the scientific legacy of Fred Griffith - rests not only on it initiating a cascade of events leading to molecular genetics but also on its implications for epidemiology based on the biology of host-parasite interactions. Looking at Griffith's entire career, instead of focusing only on the transformation study, we can better appreciate the place of the latter within Griffith's overall contributions. Presented in this way, Griffith's experiment on bacterial transformation also ceases to appear as an anomaly, which in turn leads us to rethink some of the most prevalent historical conceptions about his work.

  15. Audio material as part of the local history collection at the public library – a case study of radio program by Ivan Herman

    Directory of Open Access Journals (Sweden)

    Monika Batur

    2016-07-01

    Full Text Available The paper presents and analyses the laws and other legal documents as well as standards, guidelines and codes of library profession related to the local history collection creation and development at the public library. The Croatian laws on electronic media and copyright are also analysed because the paper describes the case study of audio materials which were created as part of the radio program of the local radio station. Such materials are local in nature and therefore surely belong to the local history library collection. Since this type of material is not directly regulated in legislation, the paper offers a starting point for such cases to be included in public libraries local history collections. The case study shows the destiny of radio program named U četiri ćoška by Ivan Herman which was aired on the Croatian Radio Županja.

  16. Hungry Unlike the Wolf: Ecology, Posthumanism, Narratology in Fred Vargas’s Seeking Whom He May Devour

    Directory of Open Access Journals (Sweden)

    John Parham

    2012-01-01

    Full Text Available This paper examines posthumanism as a philosophical position equipped to inform ecocriticism and the potential of popular fiction to articulate ecological complexity. Posthumanism will be reappraised as a dialectical model that decentres the human in relation to ‘evolutionary, ecological, or technological coordinates’ (Wolfe 2010: xvi while nevertheless retaining a sense of the integrity of, and boundaries between, human and nonhuman species or phenomena. It will be argued that a novelistic emphasis on human being, agency, and action, coupled with devices of genre, plot, atnd narrative – are consistent with the process of human self‐examinaion engendered by posthumanism. The essay will, thereafter, illustrate and examine this approach through the French crime writer Fred Vargas’s1999 novel Seeking Whom He May Devour. Identifying two human protagonists – the Canadian conservationist Johnstone and his girlfriend Camille – an initial decentring of the human subject will be examined in relation to two equivalent, nonhuman protagonists, the French Alps and the wolf. Utilising newspaper interviews that highlight Vargas’s own posthumanist perspective (grounded in her profession as an archaeologist, I will examine a how the novel explores appropriate relationships between human and nonhuman animals; b how Vargas utilises both the generic features of the crime novel – e.g. the resolution of a ‘crime’ – and the subtle narrative manipulations of character focalisation to construct (via the preferred ‘point of iew’ offered by Camille a posthumanist position on human/animal relations which argas explicitly opposes to the inhumanism represented by Johnstone.

  17. Bringing radical behaviorism to revolutionary Brazil and back: Fred Keller's Personalized System of Instruction and Cold War engineering education.

    Science.gov (United States)

    Akera, Atsushi

    2017-09-12

    This article traces the shifting epistemic commitments of Fred S. Keller and his behaviorist colleagues during their application of Skinnerian radical behaviorism to higher education pedagogy. Building on prior work by Alexandra Rutherford and her focus on the successive adaptation of Skinnerian behaviorism during its successive applications, this study utilizes sociologist of science Karin Knorr Cetina's concept of epistemic cultures to more precisely trace the changes in the epistemic commitments of a group of radical behaviorists as they shifted their focus to applied behavioral analysis. The story revolves around a self-paced system of instruction known as the Personalized System of Instruction, or PSI, which utilized behaviorist principles to accelerate learning within the classroom. Unlike Skinner's entry into education, and his focus on educational technologies, Keller developed a mastery-based approach to instruction that utilized generalized reinforcers to cultivate higher-order learning behaviors. As it happens, the story also unfolds across a rather fantastic political terrain: PSI originated in the context of Brazilian revolutionary history, but circulated widely in the U.S. amidst Cold War concerns about an engineering manpower(sic) crisis. This study also presents us with an opportunity to test Knorr Cetina's conjecture about the possible use of a focus on epistemic cultures in addressing a classic problem in the sociology of science, namely unpacking the relationship between knowledge and its social context. Ultimately, however, this study complements another historical case study in applied behavioral analysis, where a difference in outcome helps to lay out the range of possible shifts in the epistemic commitments of radical behaviorists who entered different domains of application. The case study also has some practical implications for those creating distance learning environments today, which are briefly explored in the conclusion. © 2017 Wiley

  18. Investigations on the "Extreme" Microbial Methane Cycle within the Sediments of an Acidic Impoundment of the Inactive Sulfur Bank Mercury Mine: Herman Pit, Clear Lake, California.

    Science.gov (United States)

    Oremland, R. S.; Baesman, S. M.; Miller, L. G.; Wei, J. H. C.; Welander, P. V.

    2014-12-01

    The inactive Sulfur Bank Mercury Mine is located in a volcanic region having geothermal flow and gas inputs into the Herman Pit impoundment. The acidic (pH 2 - 4) waters of the Herman Pit are permeated by hundreds of continuous flow gas seeps that contain CO2, H2S and CH4. We sampled one seep and found it to be composed of 95 % CO2 and 5 % CH4, in agreement with earlier measurements. Only a trace of ethane (10 - 20 ppm) was found and propane was below detection, resulting in a high CH4/C2H6 + C3H8 ratio of > 5,000, while the δ13CH4 and the δ13CO2 were respectively - 24 and - 11 per mil. Collectively, these results suggested a complex origin for the methane, being made up of a thermogenic component resulting from pyrolysis of buried organics, along with an active methanogenic portion. The relatively 12C-enriched value for the CO2 suggested a reworking of the ebullitive methane by methanotrophic bacteria. We found that dissolved methane in the collected water from 2-4 m depth was high (~ 400 µM), which would support methanotrophy in the lake's aerobic biomes. We therefore tested the ability of bottom sediments to consume methane by conducting aerobic incubations of slurried bottom sediments. Methane was removed from the headspace of live slurries, and subsequent additions of methane to the headspace over the course of 2-3 months resulted in faster removal rates suggesting a buildup of the population of methanotrophs. This activity could be transferred to an artificial medium originally devised for the cultivation of acidophilic iron oxidizing bacteria (Silverman and Lundgren, 1959; J. Bacteriol. 77: 642 - 647), suggesting the possibility of future cultivation of acidophilic methanotrophs. A successful extraction of some hopanoid compounds from the sediments was achieved, although the results were too preliminary at the time of this writing to identify any hopanoids specifically linked to methanotrophic bacteria. Further efforts to amplify functional genes for

  19. Den store fred

    DEFF Research Database (Denmark)

    Necef, Mehmet Ümit

    2013-01-01

    Der har de seneste måneder foregået seriøse fredsforhandlinger mellem den tyrkiske stat og PKK (Det kurdiske Arbejderparti) for at løse den 30-årige blo-dige konflikt. Denne artikel diskuterer, hvorfor det netop er en moderat isla-misk regering, der gør en stor indsats for at stoppe krigen med en...

  20. Absolute Intensities Measurements in the nu(4) + nu(5) Band of (12)C(2)H(2): Analysis of Herman-Wallis Effects and Forbidden Transitions.

    Science.gov (United States)

    Vander Auwera J

    2000-05-01

    We measured absolute line intensities in two bands of (12)C(2)H(2) near 7.5 µm, namely the nu(4) + nu(5)(Sigma(+)(u))-0(Sigma(+)(g)) and nu(4) + nu(5)(Delta(u))-0(Sigma(+)(g)) bands, using Fourier transform spectroscopy with an accuracy estimated to be better than 2%. Using theoretical predictions from Watson [J. K. G. Watson, J. Mol. Spectrosc. 188, 78 (1998)], the observation of the forbidden nu(4) + nu(5)(Delta(u))-0(Sigma(+)(g)) band and the Herman-Wallis behavior exhibited by its rotational lines were studied quantitatively in terms of two types of interactions affecting the levels involved by the band: l-type resonance and Coriolis interaction. In the case of the nu(4) + nu(5)(Sigma(+)(u))-0(Sigma(+)(g)) band, the influence of l-type resonance is also confirmed. We also attributed the intensity asymmetry observed between the R and P branches of that latter band to a Coriolis interaction with l = 1 levels. We did not observe the nu(4) + nu(5)(Sigma(-)(u))-0(Sigma(+)(g)) band, consisting only of a Q branch, in agreement with Watson's prediction. Copyright 2000 Academic Press.

  1. 评科萨根的现实主义教师教育理论%Understanding Fred Korthagen's Realistic Teacher Education

    Institute of Scientific and Technical Information of China (English)

    周钧

    2012-01-01

    科萨根用“实践智慧”取代了“理论知识”作为现实主义教师教育的认识论基础,主张师范生的培养以发展实践智慧为目的。借鉴格式塔心理学、认知建构主义和人类学情境学习理论,科萨根提出了“三层次”学习理论作为现实主义教师教育的理论基础。科萨根积极倡导一种新的教师教育学,即帮助师范生在经验与反思中学习教学。%Fred Korthagen distinguished Aristotle's conception of phronesis and Plato's conception of episteme, and took phronesis as the epistemology of realistic teacher education, which made it possible to approach the goal of linking practice and theory. Building on Gestalt psychology, cognitive constructivism and situated learning theory of anthropology, Fred Korthagen proposed a 3-level model of learning which came into being the theoretical base of realistic teacher education. Learning from concrete experience and reflection were identified as the pedagogy of teacher education.

  2. The circumburst environment of a FRED GRB: study of the prompt emission and X-ray/optical afterglow of GRB 051111

    CERN Document Server

    Guidorzi, C; Kobayashi, S; Mundell, C G; Rol, E; Bode, M F; Carter, D; La Parola, V; Melandri, A; Monfardini, A; Mottram, C J; O'Brien, P T; Page, K L; Sakamoto, T; Smith, R J; Steele, I A; Tanvir, N R

    2006-01-01

    We report a multi-wavelength analysis of the prompt emission and early afterglow of GRB051111 and discuss its properties in the context of current fireball models. The detection of GRB051111 by the Burst Alert Telescope on-board Swift triggered early BVRi' observations with the 2-m robotic Faulkes Telescope North in Hawaii, as well as X-ray observations with the Swift X-Ray Telescope. The prompt gamma-ray emission shows a classical FRED profile. The optical afterglow light curves are fitted with a broken power law, with alpha_1=0.35 to alpha_2=1.35 and a break time around 12 minutes after the GRB. Although contemporaneous X-ray observations were not taken, a power law connection between the gamma-ray tail of the FRED temporal profile and the late XRT flux decay is feasible. Alternatively, if the X-ray afterglow tracks the optical decay, this would represent one of the first GRBs for which the canonical steep-shallow-normal decay typical of early X-ray afterglows has been monitored optically. We present a deta...

  3. Modification of the Persian version of Hermans Achievement Motivation Questionnaire to develop an adapted scale for measuring motivation of post-stroke survivors in Iran

    Directory of Open Access Journals (Sweden)

    Seyed Alireza Derakhshanrad

    2016-10-01

    Full Text Available Background: Research has shown that in order for recovery from a stroke to occur, motivation for recovery has been essential component of rehabilitation. Researchers and clinicians have tended to categorize stroke survivors subjectively into two groups: those who have been motivated or unmotivated, perhaps due to the paucity of objective measures that distinguish the groups. Since classification of clients based on subjective inference would be prone to bias, this pilot study aimed to establish a regionally validated scale that was adequately standardized for measuring motivation of adult post-stroke survivors in Iran.Methods: The Persian version of Hermans Achievement Motivation Questionnaire (PHAMQ was identified as the best test for the purposes of this study. A multistep process was undertaken to create an adapted scale from the PHAMQ that focused on functional behaviors, often seen in the process of rehabilitation. Thus, the Adapted Achievement Motivation Questionnaire (AAMQ was examined for reliability and validity. Cronbach’s alpha was used for measuring internal consistency and expert panel opinions were sought to analyze the content validity of AAMQ.Results: A convenience sample of 25 stroke subjects comprised of 10 males and 15 females participated in this study with the mean age [(± standard deviation (SD] 58.3 ± 9.8 years and range of 35-72 years. Expert opinion regarding the relevance of AAMQ items led to provide compelling evidence for a 28-item AAMQ. Cronbach’s alpha of 0.946 showed a perfect internal consistency for test items.Conclusion: This pilot study suggested that AAMQ could be utilized as a regionally validated scale for examining the motivational level of patients who have sustained strokes in Iran. Further research are recommended.

  4. Fred Hoyle, Le Nuage noir ; James Lequeux, « Et si c’était possible »

    OpenAIRE

    Chabot, Hugues

    2014-01-01

    Fred Hoyle (1915-2001), un des plus brillants astronomes du vingtième siècle, est resté célèbre pour ses contributions à l’astrophysique nucléaire et pour avoir défendu toute sa vie une cosmologie alternative à la théorie du Grand Boum (Big Bang), théorie qu’il avait d’ailleurs lui-même baptisée ainsi par dérision. Son nom figure aux côtés de ceux de Francis Crick (1916-2004) ou de Richard Feynman (1918-1988) dans le très sélectif New Dictionary of Scientific Biography publié par Noretta Koer...

  5. Senator Fred Harris's National Social Science Foundation proposal: Reconsidering federal science policy, natural science-social science relations, and American liberalism during the 1960s.

    Science.gov (United States)

    Solovey, Mark

    2012-03-01

    During the 1960s, a growing contingent of left-leaning voices claimed that the social sciences suffered mistreatment and undue constraints within the natural science-dominated federal science establishment. According to these critics, the entrenched scientific pecking order in Washington had an unreasonable commitment to the unity of the sciences, which reinforced unacceptable inequalities between the social and the natural sciences. The most important political figure who advanced this critique, together with a substantial legislative proposal for reform, was the Oklahoma Democratic Senator Fred Harris. Yet histories of science and social science have told us surprisingly little about Harris. Moreover, existing accounts of his effort to create a National Social Science Foundation have misunderstood crucial features of this story. This essay argues that Harris's NSSF proposal developed into a robust, historically unique, and increasingly critical liberal challenge to the post-World War II federal science establishment's treatment of the social sciences as "second-class citizens."

  6. Écrire dans la variante de l’autre : le cas de Sous les vents de Neptune de Fred Vargas

    Directory of Open Access Journals (Sweden)

    Nadine Vincent

    2014-04-01

    Full Text Available Pour tout auteur, choisir d’écrire dans une langue ou dans la variante d’une langue qui n’est pas la sienne représente un défi de taille. Nous nous intéresserons au roman Sous les vents de Neptune, de l’écrivaine française Fred Vargas, qui a situé une partie de son intrigue au Québec, sans maîtriser la notion de variation linguistique. En analysant les réactions des lecteurs européens et québécois, de même que les caractéristiques de la langue québécoise de Vargas, nous aborderons la question de l’impérialisme linguistique et de son anachronisme au xxie siècle.

  7. Fred Forest: o poder da mídia espontânea como elemento de criação artística

    OpenAIRE

    Camargo, Maíra Sanchez Cezaretto [UNESP

    2012-01-01

    Este estudo tem o objetivo de discutir o poder da mídia utilizado para criação artística, mais especificamente a mídia espontânea. A relação entre arte e comunicação é analisada com o apoio na obra denominada Wanted Julia Margareth Cameron, de Fred Forest. São avaliados os aspectos que levam o artista a idealizar e colocar em prática suas estratégias. As ferramentas utilizadas por Forest em suas obras e a articulação delas também são contempladas neste estudo. Além disso, o potencial publicit...

  8. Distress and Fury: The Governor-General Award Winner Fred Wah and the Strategy of Ethnic Hyphenation%困惑和愤怒——评加拿大总督奖作家Fred Wah和少数族裔作家的连接号策略

    Institute of Scientific and Technical Information of China (English)

    赵庆庆

    2006-01-01

    本文探讨了加拿大总督奖作家弗雷德·华(Fred Wah)的获奖传记小说(Diamond Grill),并结合其文论,探讨了自名的困惑、文本的愤怒和少数族裔作家的连接号策略这三大相关论题,得出少数族裔作家必须把多元文化和强势文化的冲突化为自身价值才可生存的结论.

  9. Investigations on the "Extreme" Microbial Arsenic Cycle within the Sediments of an Acidic Impoundment of the Former Sulfur Bank Mercury Mine: Herman Pit, Clear Lake, California.

    Science.gov (United States)

    Blum, J. S.; Hoeft McCann, S. E.; Bennett, S.; Miller, L. G.; Stoneburner, B.; Saltikov, C.; Oremland, R. S.

    2014-12-01

    The involvement of prokaryotes in the redox reactions of arsenic occurring between this element's +5 [arsenate; As(V)] and + 3 [arsenite; As(III)] oxidation states has been well established. Most research has focused upon circum-neutral pH environments, such as freshwater lake and aquifer sediments, and extreme environments like hot springs and hypersaline soda lakes have also been well investigated. In contrast, little work has been conducted on acidic environments. The azure-hued, clear waters of the Herman Pit are acidic (pH 2-4), and overlie oxidized sediments that have a distinctive red/orange coloration indicative of the presence of ferrihydrites and other Fe(III) minerals. There is extensive ebullitive release of geothermal gases from the lake bottom in the form of numerous continuous-flow seeps which are composed primarily of mixtures of CO2, CH4, and H2S. We collected near-shore surface sediments with an Eckman grab, and stored the "soupy" material in filled mason jars kept at 4˚C. Initial experiments were conducted using 3:1 mixtures of lake water: sediment so as to generate dilute slurries which were amended with mM levels of electron acceptors (arsenate, nitrate, oxygen), electron donors (arsenite, acetate, lactate, hydrogen), and incubated under N2, air, or H2. Owing to the large adsorptive capacity of the Fe(III)-rich slurries, we were unable to detect As(V) or As(III) in the aqueous phase of either live or autoclaved controls, although the former consumed lactate, acetate, nitrate, or hydrogen, while the latter did not. This prompted us to conduct a series of further diluted slurry experiments using the live materials from the first as a 10 % addition to lakewater. In these experiments we observed reduction of As(V) to As(III) in anoxic slurries and that rates were enhanced by addition of electron donors (H2, acetate, or lactate). We also observed oxidation of As(III) to As(V) in oxic slurries and in anoxic slurries amended with nitrate. These

  10. En camino hacia el Moby Dick de Herman Melville, encontré… Algunas notas preliminares de un libro sin escribir On My Way to Herman Melville’s Moby Dick, I Found … Some Preliminary Remarks from an Unwritten Book

    Directory of Open Access Journals (Sweden)

    Burkard Sievers

    2009-06-01

    Full Text Available Propósito: El autor está revisitando el cuerpo de sus manuscritos sobre el Moby Dick de Herman Melville, que comenzó a escribir hace unos 15 años. Aunque estos escritos siguen constituyendo un “libro sin escribir”, las obras de Melville tuvieron un impacto duradero sobre su pensamiento - abrieron nuevo caminos de inspiración- y escritura hasta el presente. El objetivo del documento es revelar algunas experiencias, estímulos, dificultades y emociones concomitantes con la escritura académica que siguen estando en su mayoría, escondidas del lector. Diseño/ metodología/acercamiento: Este artículo es una reminiscencia personal sobre la experiencia de la escritura académica de unas cuatro décadas. Es una historia de cómo un académico se familiariza con, y luego es influenciado/inspirado por una obra literaria, y descubre cuántos tópicos organizacionales pueden ser iluminados por trabajos literarios. Descubrimientos: Ni siquiera un libro sin escribir lleva necesariamente a descuidar completamente lo que había sido escrito. Esto podría ser un alivio y un estímulo para otros, quienes se dan cuenta de que no están solos en este sentido. Originalidad/valor: el artículo aporta un poco más de entendimiento sobre la experiencia no-tan-obvia y generalmente escondida, del “proceso de producción” de la escritura académica, e ilustra la relevancia e importancia de la literatura para pensar más allá, tópicos tales como la Administración y la organización.Purpose: The author is revisiting the body of his manuscripts on Herman Melville’s Moby Dick, which he began writing some 15 years ago. Though these writings have remained an ‘unwritten book’, Melville’s works had a lasting impact on his thinking and writing up to the present. He reveals some of the experiences and emotions concomitant with academic writing that remain more often than not hidden from the reader. Design/methodology/approach: This paper is a personal

  11. Unnatural Narratology. Basic Concepts and Recent Work [Jan Alber / Rüdiger Heinze: Unnatural Narratives – Unnatural Narratology. Berlin 2011. Per Krogh Hansen / Stefan Iversen / Henrik Skov Nielsen / Rolf Reitan (Eds.: Strange Voices in Narrative Fiction. Berlin 2011. David Herman / James Phelan / Peter Rabinowitz / Brian Richardson / Robyn Warhol: Narrative Theory: Core Concepts and Critical Debates. Columbus 2012

    Directory of Open Access Journals (Sweden)

    Brian Richardson

    2012-12-01

    Full Text Available Rezension zu / Review of:Jan Alber / Rüdiger Heinze: Unnatural Narratives – Unnatural Narratology. Berlin 2011. Per Krogh Hansen / Stefan Iversen / Henrik Skov Nielsen / Rolf Reitan (Eds.: Strange Voices in Narrative Fiction. Berlin  2011. David Herman / James Phelan / Peter Rabinowitz / Brian Richardson / Robyn Warhol: Narrative Theory: Core Concepts and Critical Debates. Columbus 2012.

  12. Olie skaber fred i Sudan

    DEFF Research Database (Denmark)

    Laugesen, Henrik

    Sydsudan forventes formelt at erklære sin uafhængighed den 9. juli 2011. Men hvad sker der, når Sudan nu deles i Nordsudan og Sydsudan? Oliekilderne ligger i Sydsudan, men den helt nødvendige infrastruktur der skal transformere olie til dollars har man i nord. Da op imod 90% af Sydsudans indtægter...

  13. The ′Adat′ institution and the Management of Grand Forest ′Herman Yohannes′ in Indonesian Timor: The Role of Design Principles for Sustainable Management of Common Pool Resources

    Directory of Open Access Journals (Sweden)

    Jacko A van Ast

    2014-01-01

    Full Text Available Local success stories of sustainable forest management can inspire scientists and decision-makers. This article analyses the traditional ′Adat′ institution that plays a role in the management of Grand Forest Park ′Herman Yohannes′, in the Western part of Timor where the Adat forest management regulation has been formally restored. The original set of design principles for sustainable management of common pool resources of Elinor Ostrom (1990 has been used in this study as an analytical framework for understanding the role of the Adat institution in respect to the forest. In the park, the local community applies Adat for protection and management of the forest that has been its home for centuries. It appears that Ostrom′s design principles can be identified in the current Adat institution and play a role in the sustainable management of the forest. Although many other variables can lead to success or failure of institutions, the original (internal design principles are still valuable as a practical tool for building institutions that are - under certain conditions - able to sustain common pool resources. The findings confirm the importance of traditional institutions in successful forest management. The study recommends that decision-makers take into account existing traditional management systems that have shown long term functionality.

  14. “万有”之路——读黑塞《玻璃球游戏》%The Way to "Wan You" --reading Das Glasperlenspiel by Herman Hesse

    Institute of Scientific and Technical Information of China (English)

    郑海娟

    2012-01-01

    《玻璃球游戏》是德国作家黑塞一生中创作的最后一部长篇小说,把这部小说放在黑塞本人的作品谱系当中,并与德国浪漫派、托马斯.曼、卡夫卡等德语作家的文学作品比较,探讨了《玻璃球游戏》一书独具的特色。通过分析作者对精神王国与世俗世界的不同呈现方式,指出黑塞在这部作品中扬弃了浪漫主义的表现手法,打破了传统成长小说的模式,目的是试图超越精神与自然的二元对立,探寻更高层次的统一与和谐。%As his last novel, Das Glasperlenspiel is quite distinguished among all Herman Hesse's works, and this characteristic remains even if we compare it with literary works by German writers such as the German Romanists, Thomas Mann, and Kafka. This article tries to analyze how Hesse sublated the traditional romantic representations and threw away the general pattern of Novel of Initiation for the purpose of transcending the repeated dualism occurring in his early works: Geist vs Seele, and seeking for unification and harmony in a much higher level.

  15. Herman Melville and the Art of Leadership.

    Science.gov (United States)

    1979-01-01

    democracy; while Melville’s protagonists 211n a letter to Nathaniel Hawthorne in June, 1851, Melville says, "When you see or hear of my ruthless... Nathaniel Hawthorne (June 1851) Melville de- clares: "I stand for the heart. To the dogs with the head." This extreme position changes after he writes Pierre...1968), p. 380. The "head"-’heart" dichotomy was fairly standard in Melville’s day. When Sophia Hawthorne wrote to her mother about Melville’s review

  16. Majandustarkvara Microsoft Business Solutionsilt / Fred Viidul

    Index Scriptorium Estoniae

    Viidul, Fred

    2003-01-01

    Microsoft Business Solutions pakub Eesti turul kolme lokaliseeritud (tõlgitud ja Eesti seadustele kohandatud) toodet: Navision Standard (väikefirmadele), Navision (keskmise suurusega ettevõtetele) ja Axapta Enterprise (suuremale firmale). Tabelid

  17. Hydrographic and Impairment Statistics Database: FRED

    Data.gov (United States)

    National Park Service, Department of the Interior — Hydrographic and Impairment Statistics (HIS) is a National Park Service (NPS) Water Resources Division (WRD) project established to track certain goals created in...

  18. Fred P. Ellison and Portuguese Program Development

    Science.gov (United States)

    Milleret, Margo

    2016-01-01

    The written record of Ellison's involvement in Portuguese program development begins in 1964 when he became chairman of the Portuguese Language Development Group that met at several Modern Language Association meetings before being accepted by the American Association of Teachers of Spanish and Portuguese (AATSP) in 1967. The record ends in the…

  19. Unistuste maa / Fred Jüssi

    Index Scriptorium Estoniae

    Jüssi, Fred, 1935-

    2010-01-01

    Rahvusvahelise dokumentaalfilmi festivali DocPoint avafilmina Kumu Auditooriumis 29. ja 31. jaanuaril linastuvast Islandi režissööride Thorfinnur Gudnasoni ja Andri Snær Magnasoni filmist "Unistuste maa"

  20. Fred P. Ellison and Portuguese Program Development

    Science.gov (United States)

    Milleret, Margo

    2016-01-01

    The written record of Ellison's involvement in Portuguese program development begins in 1964 when he became chairman of the Portuguese Language Development Group that met at several Modern Language Association meetings before being accepted by the American Association of Teachers of Spanish and Portuguese (AATSP) in 1967. The record ends in the…

  1. Majandustarkvara Microsoft Business Solutionsilt / Fred Viidul

    Index Scriptorium Estoniae

    Viidul, Fred

    2003-01-01

    Microsoft Business Solutions pakub Eesti turul kolme lokaliseeritud (tõlgitud ja Eesti seadustele kohandatud) toodet: Navision Standard (väikefirmadele), Navision (keskmise suurusega ettevõtetele) ja Axapta Enterprise (suuremale firmale). Tabelid

  2. 平行结构中的“墙”之意象:《抄写员巴特比》评析%Image of "Wall" within Parallel Structure: An Analysis of Herman Melville's “Bartleby, the Scrivener: A Story of Wall Street”

    Institute of Scientific and Technical Information of China (English)

    左金梅; 吴欣欣

    2012-01-01

    In “Bartleby, the Scrivener: A Story of Wall Street”, a short story by Herman Melville, the image of wall manifests itseff throughout the whole parallel structure of value, characters, plots and so on. Tbis image provides two layers of func- tion-confinement and indulgence, resolving the conflicts between assumptions and preferences. The wall reveals how human beings are isolated for failure of communication; how they are alienated for restraint by material; and how they are lingering be- tween life and death in a world where material is held to be primary. Bartleby's gradual deviation from others can be attributed to Melville's quests for humanity and his anxieties about the condition of human existence.%赫曼·麦尔维尔的短篇小说《抄写员巴特比:一个华尔街的故事》中,“墙”这一意象贯穿始终,内嵌于其价值观、人物以及情节等诸多平行结构之中,呈现出束缚和放纵的双重功用。置于物质至上的叙述框架中,“墙”揭示了在严酷的经济竞争浪潮冲击下,人如何难以沟通,日趋孤立;如何为物质所囿,怠于思考,逐渐异化:如何苟延残喘,在生死之间游走。巴特比逐步背离常人的生活方式,显示出麦尔维尔对人性的探寻,以及他对人类生存状态的焦虑。

  3. Assessing Saudi Arabia: A Review of Leading American and European Analysts (1982-1995),

    Science.gov (United States)

    1983-03-01

    Campbell Michael Field Raymond Close *Christine Helms Anthony Cordesman *David Holden * Herman Eilts *Richard Johns Fred Halliday *J.B. Kelly Parker Hart...Military Balance, i98o-i8t (London: IISS, 1980), p. 47; and Abdul Kasim Mansur (pseud.), "The American Threat to Saudi Arabia," Armed Forces Journal

  4. The Applicability of Herman's and Chomsky's Propaganda Model Today

    Science.gov (United States)

    Model, David

    2005-01-01

    Since the early twentieth century, there have been numerous warnings about the dangers of the growing concentration of corporate ownership of the mass media. As early as 1920, Walter Lippmann claimed that propaganda was already "...a regular organ of popular government." He referred to the propaganda in the media as the…

  5. Klas puts imprint on 'signature piece' / Herman Trotter

    Index Scriptorium Estoniae

    Trotter, Herman

    1996-01-01

    Kontserdiarvustus. Buffalo Philharmonic Orchestra, külalisdirigent Eri Klas, solist Arie Lipsky (tšello). Kavas: D. Šostakovitš, Sümfoonia nr. 5; E. Dohnanyi, Konzertstück tšellole ja orkestrile ja W. A. Mozart, Divertisment keelpilliorkestrile, KV 136, D-duur

  6. Arthur de Gobineau ja tõupessimism / Arthur Herman

    Index Scriptorium Estoniae

    Herman, Arthur

    1998-01-01

    Järg nov nr. 11 lk. 1715-1723. 19. sajandi Pariisist, kodanlaste ja kunstnike vastandumisest, 1848. aasta rassiidee algusaegadest. Gobineau rassilisest ettemääratusest ja tsivilisatsioonide hävimisest

  7. Arthur de Gobineau ja tõupessimism / Arthur Herman

    Index Scriptorium Estoniae

    Herman, Arthur

    1998-01-01

    Järg nov nr. 11 lk. 1715-1723. 19. sajandi Pariisist, kodanlaste ja kunstnike vastandumisest, 1848. aasta rassiidee algusaegadest. Gobineau rassilisest ettemääratusest ja tsivilisatsioonide hävimisest

  8. Herman Melville’s Nature Views in Moby Dick

    Institute of Scientific and Technical Information of China (English)

    Sun Gengmei; Yao Kun

    2015-01-01

    In Moby Dick, Melvil e presents his basic idea of nature view. Human beings are capable of improving their living environment, but can not overcome nature. Man lives under the mercy of nature, and is destined to doom.

  9. Klas puts imprint on 'signature piece' / Herman Trotter

    Index Scriptorium Estoniae

    Trotter, Herman

    1996-01-01

    Kontserdiarvustus. Buffalo Philharmonic Orchestra, külalisdirigent Eri Klas, solist Arie Lipsky (tšello). Kavas: D. Šostakovitš, Sümfoonia nr. 5; E. Dohnanyi, Konzertstück tšellole ja orkestrile ja W. A. Mozart, Divertisment keelpilliorkestrile, KV 136, D-duur

  10. US Army Order of Battle 1919-1941. Volume 2. The Arms: Calvary, Field Artillery, and Coast Artillery, 1919-41

    Science.gov (United States)

    2010-01-01

    1941 Col. Samual F. Dallam 22 September 1928–15 July 1931 Lt. Col. Harrison Herman ao November 1941–December 1941 Col. Lucian K. Truscott...May 1933 Col. Fred J. Herman 3 January 1918–18 March 1919 Maj. Arthur H. Truxes 22 May 1933–31 May 1933 Col. Edward Anderson 19 March 1919–24...Brig. Events: 330 Commanders, Provisional Field Artillery Brigade Col. John T. Kennedy August 1941–20 November 1941 Col. Walter W. Hess Jr. 20

  11. Uuendamise rituaal = The ritual of renewal / Fred Thomson

    Index Scriptorium Estoniae

    Thomson, Fred

    2004-01-01

    Tartu Jaani kiriku restaureerimise käigus planeeritakse skelettide eemaldamist kiriku põranda alt - see oleks räigelt ignoreeriv restaureerimine, vaimse osa kõrvaldamine materiaalse mälestusmärgi küljest

  12. Uuendamise rituaal = The ritual of renewal / Fred Thomson

    Index Scriptorium Estoniae

    Thomson, Fred

    2004-01-01

    Tartu Jaani kiriku restaureerimise käigus planeeritakse skelettide eemaldamist kiriku põranda alt - see oleks räigelt ignoreeriv restaureerimine, vaimse osa kõrvaldamine materiaalse mälestusmärgi küljest

  13. Den store fred på vej i Tyrkiet

    DEFF Research Database (Denmark)

    Necef, Mehmet Ümit

    2013-01-01

    Der har de seneste måneder foregået seriøse fredsforhandlinger mellem den tyrkiske stat og PKK (Det kurdiske Arbejderparti) for at løse den 30-årige blo-dige konflikt. Denne artikel diskuterer, hvorfor det netop er en moderat isla-misk regering, der gør en stor indsats for at stoppe krigen med en...

  14. Mathematically Talented Women in Hollywood: Fred in "Angel"

    Science.gov (United States)

    Greenwald, Sarah J.; Thomley, Jill E.

    2007-01-01

    Given the increase in the number of fictional women mathematicians and scientists on television and in the movies, educators who wish to incorporate pop culture into their classrooms need tools with which to evaluate these portrayals. In this article we summarize studies related to the impact of Hollywood representations on girls and then we…

  15. A soviet memorial - and mind-set / Fred Hiatt

    Index Scriptorium Estoniae

    Hiatt, Fred

    2007-01-01

    Eesti ja Venemaa vahelistest suhetest, Tõnismäe pronkssõduri erinevast tähendusest eestlaste ja venelaste jaoks. President Toomas Hendrik Ilvese sõnul tundub, nagu ei suudaks Venemaa taluda demokraatiat oma naaberriikides

  16. Baltimore Eesti Selts - 75 / Vilve Ladon ; fotod: Fred Ise

    Index Scriptorium Estoniae

    Ladon, Vilve

    2010-01-01

    Baltimore Eesti Majas tähistati 2. okt. 2010 Baltimore Eesti Seltsi aastapäeva. Eesti suursaatkonna esimene sekretär poliitilistes küsimustes Aap Neljas edastas president Toomas Hendrik Ilvese tervituse

  17. Methods for Choosing Buffer Size in Tandem Production Operations

    Science.gov (United States)

    1983-08-01

    DRSMC Craig Colledge -IRP George Cowan -IRD Mohan Devaraju -IRI-M Bob Gunnare -IRI Jim Kilar -IRI Matt Craighead -PP Don Eckman -6AS Fred...Northey -SAS Jim Wasson -SAS Herman Michels -SAL Norm Trier -SAL Byron White -SAA Don Wahlgren -ASM Brian Walters -ASA Dennis Winegar -LEM Paul ...Woodhouse -OPP Dick Heider -OPI Sandi Paul -LEP-L 39 ANNEXES COMPUTER SOURCE PROGRAMS The program listings in these annexes are written in

  18. Amor vicit omnia. Profan ikonografisk ansats = Amor vincit omnia. Secular medieval art in Skandinavia / Herman Bengtsson

    Index Scriptorium Estoniae

    Bengtsson, Herman

    2006-01-01

    12.-15. sajandi ilmalikust kunstist Skandinaaviamaades, mille ikonograafia on tihedalt seotud kohaliku eluga - erinevatel esemetel näeme vappe, pistrikukütte, muusikuid, tantsijaid, jahimehi, armunud paare ja ka kummalisi loomi

  19. Determinants of educational systems of Bophuthatswana and Botswana / Jacob Herman Kgosi Malao

    OpenAIRE

    Malao, Jacob Herman Kgosi

    1985-01-01

    In the opening chapter the following matters are looked into: * PROBLEM OF RESEARCH The problem of research is: - to determine whether the influences of the Republic of South Africa on the Bophuthatswana system of education and that of England on Botswana are responsible for differences of the educational systems of Bophuthatswana and Botswana; - to determine whether there are other determinants of the systems in question; and - a comparison of the determinants of the education...

  20. Amor vicit omnia. Profan ikonografisk ansats = Amor vincit omnia. Secular medieval art in Skandinavia / Herman Bengtsson

    Index Scriptorium Estoniae

    Bengtsson, Herman

    2006-01-01

    12.-15. sajandi ilmalikust kunstist Skandinaaviamaades, mille ikonograafia on tihedalt seotud kohaliku eluga - erinevatel esemetel näeme vappe, pistrikukütte, muusikuid, tantsijaid, jahimehi, armunud paare ja ka kummalisi loomi

  1. Perceived service delivery and productivity in the food and beverage sector in Potchefstroom / Adam Herman Viljoen

    OpenAIRE

    Viljoen, Adam Herman

    2012-01-01

    The importance of management in the food and beverage sector as well as managing food and beverage service employees are crucial aspects that influence quality service delivery. The food and beverage sector is a large service orientated segment of the greater tourism industry, and effective management of employees is therefore necessary since employees are regarded as the primary resource through which establishments deliver services. One might further argue that an employee is...

  2. Measuring Proximity Among Affect Profiles in Hermans' Self-Confrontation Method

    NARCIS (Netherlands)

    Geel, A.L.M. van; Mey, H.R.A. de

    2009-01-01

    In the Self-Confrontation Method (SCM), proximity relations among affect profiles of valuations are traditionally represented by means of Pearson's correlation coefficient. In this article, we address a variety of technical and practical problems when using a correlational measure as a means for

  3. The Propaganda Model after 20 Years: Interview with Edward S. Herman and Noam Chomsky

    OpenAIRE

    Mullen, Andrew

    2009-01-01

    Andrew Mullen (AM) – Question 1: The first of the three hypotheses put forward in the Propaganda Model is that, where there is elite consensus, the media will serve elite interests uncompromisingly. Do you have any observations, or are there any general rules, concerning the existence (or not) of consensus among the elite (i.e. are particular issues prone to consensus/dissensus) or should media analysts approach the question on an issue-by-issue basis through empirical investigation?

  4. The exploration of in-service training needs of psychiatric nurses / Herman Rankele Letlape

    OpenAIRE

    Letlape, Herman Rankele

    2012-01-01

    New research findings, changes in legislation and the use of information technology in nursing, requires continuous in-service training of psychiatric nurses (Booyens, 2004:381; Muller, 2004:294) to cope with, reflect on, evaluate and modify their clinical practice based on emerging knowledge (Cowen et al.,2009:2; Polit & Beck, 2006:4). Many studies have been conducted on the importance of in-service training, and authors agree that in-service training improves the quality of n...

  5. Measuring Proximity Among Affect Profiles in Hermans' Self-Confrontation Method

    NARCIS (Netherlands)

    Geel, A.L.M. van; Mey, H.R.A. de

    2009-01-01

    In the Self-Confrontation Method (SCM), proximity relations among affect profiles of valuations are traditionally represented by means of Pearson's correlation coefficient. In this article, we address a variety of technical and practical problems when using a correlational measure as a means for stu

  6. CSR - fashion word or strategic approach? / Katrin Vernik, Fred Nahkur ; interv. Evelyn Ojamets

    Index Scriptorium Estoniae

    Vernik, Katrin, 1975-

    2006-01-01

    A. Le Coq Tartu Õlletehase turundusjuht ja Procter & Gamble'i Balti regiooni avalike ja välissuhete juht selgitavad, kuidas on ettevõtte sotsiaalse vastutuse kontseptsioon leidnud rakendust nende organisatsioonides

  7. Einstein on Race and Racism, presented by Fred Jerome and Rodger Taylor

    Science.gov (United States)

    Jerome, Fred; Taylor, Rodger

    2007-10-01

    It is little-known that physicist Albert Einstein strongly held the view that ``Racism is America's worst disease.'' Einstein was active in the fight against racism from the 1930's until his death in 1955. Included among his friends were a number of important Afro-American figures, including the educator W.E.B. DuBois, the actor and basso profundo singer Paul Robeson, and the soprano Marian Anderson. Based on the authors' work ``Einstein on Race and Racism.''

  8. Fred Clarke's Ideals of Liberal Democracy: State and Community in Education

    Science.gov (United States)

    Ku, Hsiao-Yuh

    2013-01-01

    This paper examines the continuity and changes in Clarke's ideas about the State and community in education, especially in relation to a rapidly changing political situation in England in the 1930s and 1940s. His ideas evolved in the intellectual context of British idealism. Moreover, in response to the threat to democracy arising from Fascism or…

  9. Techniek moet rijtaak ondersteunen : interview met Fred Wegman, directeur SWOV, over verkeersveiligheid.

    NARCIS (Netherlands)

    Ohm, R.

    2010-01-01

    Het gaat nog steeds goed, maar het kan altijd beter. Helaas is de problematiek ingewikkelder geworden en zijn er geen snelle oplossingen met veel effect meer voorhanden. Daarom moet het karakter van de aanpak van verkeersonveiligheid veranderen. (Author/publisher)

  10. Existencialismo e Fenomenologia em Farias Brito sob a perspectiva de Fred G. Sturm

    Directory of Open Access Journals (Sweden)

    Elton Moreira Quadros

    2010-05-01

    Full Text Available

    O americano F. G. Sturm propõe uma interpretação interessante para a compreensão do pensamento de Farias Brito. Ele acredita que a leitura das obras do filósofo brasileiro deve levar em consideração as aproximações entre o método utilizado pela Fenomenologia e as inquietações apresentadas pelo Existencialismo. Neste sentido, Farias Brito apresenta uma amplitude filosófica ainda pouco conhecida.

  11. Tell Me about Fred's Fat Foot Again: Four Tips for Successful PA Lessons

    Science.gov (United States)

    Murray, Bruce A.

    2012-01-01

    This teaching tip applies research on phoneme awareness (PA) to propose an instructional model for teaching PA. Research suggests children need to learn the identifying features of phonemes to recognize them in spoken words. In the model, teachers focus on one phoneme at a time; make it memorable to children through sound analogies supported by…

  12. Sowing the seeds of forest conservation: Fred Besley and the Maryland Story, 1906-1923

    Science.gov (United States)

    J. Morgan Grove; Geoffrey L. Buckley

    2001-01-01

    During the first decade of the twentieth century, Maryland began in earnest to deal with a problem that government officials and conservationists were increasingly coming to view as a serious one. For more than 250 years, changes brought about by settlement, agricultural expansion, and industrialization had reduced forest cover across the state dramatically, altering...

  13. Fred Clarke's Ideals of Liberal Democracy: State and Community in Education

    Science.gov (United States)

    Ku, Hsiao-Yuh

    2013-01-01

    This paper examines the continuity and changes in Clarke's ideas about the State and community in education, especially in relation to a rapidly changing political situation in England in the 1930s and 1940s. His ideas evolved in the intellectual context of British idealism. Moreover, in response to the threat to democracy arising from Fascism or…

  14. CSR - fashion word or strategic approach? / Katrin Vernik, Fred Nahkur ; interv. Evelyn Ojamets

    Index Scriptorium Estoniae

    Vernik, Katrin, 1975-

    2006-01-01

    A. Le Coq Tartu Õlletehase turundusjuht ja Procter & Gamble'i Balti regiooni avalike ja välissuhete juht selgitavad, kuidas on ettevõtte sotsiaalse vastutuse kontseptsioon leidnud rakendust nende organisatsioonides

  15. Ülemaailmne õpetajate päev aastal 2001 / Fred van Leeuwen

    Index Scriptorium Estoniae

    Leeuwen, Fred van

    2001-01-01

    Õpetajate maailmaorganisatsiooni peasekretäri läkitus õpetajatele. Education International ühendab üle 24 miljoni õpetaja 155 riigis. Sinna kuulub ka Eesti. 5. oktoobril tähistavad Education International ja UNESCO ühiselt 8. ülemaailmset õpetajate päeva

  16. 'Hvis vi bare ku' få fred til at passe vores arbejde...'

    DEFF Research Database (Denmark)

    Olsén, Peter

    2008-01-01

    Artiklen handler om mening og meningsskabelse i arbejdet - som forudsætning for de ansattes deltagelse og engagement i at forandre og forbedre deres arbejde. Resultater fra forskningsprojektet VISS præsenteres. 14 virksomheder arbejdede med at forbedre deres psykiske arbejdsmiljø, men mange...... mislykkedes. Ikke desto mindre gav de ansatte alle steder udtryk for et (ønske om) engagement i arbejdet - omend ofte frustreret og konfliktfyldt. Det peger på et potentiale for forbedring af arbejde og arbejdsforhold. - Teoretisk præsenteres en model om arbejdsopgaven og mening i arbejdet - af særlig...

  17. WAC at Century's End: Haunted by the Ghost of Fred Newton Scott.

    Science.gov (United States)

    McLeod, Susan H.

    1997-01-01

    Discusses two danger signs for writing across the curriculum (WAC) program survival, dealing with their cross-curricular structure, and their heavy dependence on just one person for their health and continuation. Outlines two cases from the history of writing instruction at the University of Michigan providing a precautionary tale for both kinds…

  18. Kriteria vir die opvoedkundige beplanning en benutting van fisiese fasiliteite in primêre skole / Johannes Hermanes Sagaria van Niekerk

    OpenAIRE

    Van Niekerk, Johannes Hermanes Sagaria

    1986-01-01

    The comprehensive objective of the study in hand, is to demonstrate that various new concepts must govern the educational planning and utilization of physical facilities at primary schools, if of course the educational system is to utilize global reforms in education. In this context, it is a requisite to examine the forces and events that are now initiating one of the most restive periods in the history of educational practice and to analize the present prospects as well as...

  19. Review: Hanns-Fred Rathenow & Norbert H. Weber (Hrsg.) (2005). Nationalsozialismus und Holocaust. Historisch-politisches Lernen in der Lehrerbildung

    OpenAIRE

    Schwendemann, Wilhelm

    2008-01-01

    Das Buch vereint zahlreiche Aufsätze zu Themen, die sich mit der Bedeutung von Erinnerungslernen zu Nationalsozialismus und Holocaust im Rahmen der Bildungsarbeit in und außerhalb der Schule beschäftigen und ist in vier Themenbereiche eingeteilt: a) Erziehung nach Auschwitz – Annäherungen an das Thema, b) Lehrerausbildung an Universität und Schule – Konzepte und Erfahrungen, c) Lehrerfortbildung – Erfahrungen und Reflexionen, d) Internationale Ansätze. Die Aufsätze selbst umspannen die Bandbr...

  20. Spreading of Exhaust Jet from 16 Inch Ream Jet at Mach Number 2.0 / Fred Wilcox, Donald Pennington

    Science.gov (United States)

    Wilcox, Fred; Pennington, Donald

    1952-01-01

    An investigation of the jet-spreading characteristics of a 16 inch ram-jet engine was conducted in the 8 by 6 foot supersonic tunnel at a Mach number of 2.0; both a converging nozzle having a contraction ratio of 0.71 and a cylindrical extension to the combustion chamber were used. The jet boundaries determined by means of pitot pressure surveys were compared with boundaries calculated from one-dimensional continuity and momentum relations. For the cylindrical nozzle, the jet reaches its maximum diameter, 4 percent greater than calculated, about 0.6 nozzle-exit diameter downstream of the nozzle exit. The maximum diameter for the converging nozzle was 7 percent greater than calculated from one dimensional relations and occurred from 1 to 1.5 nozzle-exit diameters downstream of the exit. Non dimensional maximum jet diameters agreed closely with results of an investigation by Rousso and Baughman; these data were obtained with low-temperature jets exhausting into a stream at a Mach number of 1.91 from nozzles having exit diameters of 0.75 inch.

  1. 'The Relation of Biology to Astronomy' and Theology: Panspermia and Panentheism; Revolutionary Convergences Advanced by Fred Hoyle and Chandra Wickramasinghe

    Science.gov (United States)

    Walker, Theodore, Jr.

    2012-06-01

    In contrast to the Copernican revolution in astro-geometry, the Hoyle-Wickramasinghe contribution to the recent and continuing revolution in astrobiology - "cometary panspermia" - features astronomy and biology converging toward theology. They employed astro-biotic reasoning (often labeled "anthropic" reasoning) to demonstrate that life is made possible by the deliberate controlling influence of the living all-embracing "intelligent universe." This is consistent with panentheism [pan-en-theos-ism, not pantheism]. As advanced by Hoyle and Wickramasinghe, cometary panspermia is panentheistic. Also, neoclassical panentheism requires generic panspermia, and favors cometary panspermia.

  2. Review: Hanns-Fred Rathenow & Norbert H. Weber (Hrsg.) (2005). Nationalsozialismus und Holocaust. Historisch-politisches Lernen in der Lehrerbildung

    OpenAIRE

    Schwendemann, Wilhelm

    2008-01-01

    Das Buch vereint zahlreiche Aufsätze zu Themen, die sich mit der Bedeutung von Erinnerungslernen zu Nationalsozialismus und Holocaust im Rahmen der Bildungsarbeit in und außerhalb der Schule beschäftigen und ist in vier Themenbereiche eingeteilt: a) Erziehung nach Auschwitz – Annäherungen an das Thema, b) Lehrerausbildung an Universität und Schule – Konzepte und Erfahrungen, c) Lehrerfortbildung – Erfahrungen und Reflexionen, d) Internationale Ansätze. Die Aufsätze selbst umspannen die Bandbr...

  3. A Comparative Analysis of the CABAS Model of Education at the Fred S. Keller School: A Twenty-Year Review

    Science.gov (United States)

    Singer-Dudek, Jessica; Speckman, JeanneMarie; Nuzzolo, Robin

    2010-01-01

    The Comprehensive Application of Behavior Analysis to Schooling or CABAS[R] model is characterized by an organizational system of teacher training and mentoring by those with more expertise in the science of behavior analytic teaching. At the center of the system are the students, whose data drive the system. Decades of research support the…

  4. A Temporal View of Soft Tissue Quantitative Ultrasound

    Science.gov (United States)

    O'Brien, William D.

    The objective of soft tissue quantitative ultrasound (QUS) is to improve diagnostic ultrasound imaging capabilities via quantitative outcomes. Over the past three or so decades, there have been an increasing number of QUS successes. A temporal view moves us back in history almost six decades when techniques and theoretical developments were in their earliest stages that impacted modern QUS successes. The earliest theoretical developments and techniques some six decades ago can be attributed to Lev Chernov, Philip Morse, Herman Feshbach, Uno Ingard, John Wild and Jack Reid. Later, Floyd Dunn developed important views as to how connective tissue affected the interaction between ultrasound and soft tissue. Then, as the theory of wave propagation in soft tissues with random inhomogeneities was extended and applied by Fred Lizzi, Jim Zagzebski and Mike Insana (and their colleagues), contemporary QUS successes started to emerge.

  5. Herman Salton, Arctic Host, Icy Visit: China and Falun Gong Face Off in Iceland (Saarbrücken: LAP Lambert Academic Publishing, 2010

    Directory of Open Access Journals (Sweden)

    Aníta Einarsdóttir

    2012-03-01

    Full Text Available Due to the controversial nature of the book reviewed, Nordicum-Mediterraneum is taking the unusual step of seeking two reviews from contrasting perspectives. The first is a review by an Icelandic citizen and the second by a Chinese citizen who is resident in Iceland.

  6. Prime Contract Awards Alphabetically by Contractor, By State or Country, and Place, FY 84. Part 8. (Miller Herman, Inc. - Poten & Partners, Inc).

    Science.gov (United States)

    1984-01-01

    Cww ( I < < 0 z 0 ID 0 0 12-(l j e- -1 0< 0 0 0C 0< L 0 0(, LO1 00 Co0r LOmC L< ()0 LO1 M - N XN IXNNNNNNNN .jNC~ -N C\\1 jN X N xNC JN ev( NNliciN _j...N NNNNNNNNNN N N :C. ---- --- --- --- -- N NN X - * Z Z * 00 Z a z M-0) ’CC))CCCC)’ ILC (C) Cl) 0 00( lomC )C) >-’) < M-NiN N N N N N N JN <N D N l

  7. Influences of Chinese Taoist Thoughts on Herman Hesse%中国道家思想对赫尔曼·黑塞的影响

    Institute of Scientific and Technical Information of China (English)

    邵志华

    2014-01-01

    黑塞一生深受中国文化浸染,尤其偏爱老庄.以老庄为代表的中国道家思想不仅影响其生活和思维方式,并广泛浸润其文学创作,成为他构建自身文学审美观的重要精神依据.如万物源道的人生悟境,对立统一的辩证思维,上善若水的处世态度,循环齐一的生死之道等.黑塞垂青中国文化精神,并非出于逃逸西方文化之初衷,而是希望经由东方这个“他者”来更好地反观自身、找寻自我.

  8. József Herman, Vulgar Latin, translated by Roger Wright, The Pennsylvania State University Press, University Park, Pennsylvania, XIV+ 130 p.

    Directory of Open Access Journals (Sweden)

    Witold Manczak

    2001-12-01

    Full Text Available Selon l'auteur (p. 1, "the kind of language that must be taken to be the common origin for related words and similar phonetic and grammatical features in the Romance languages is often noticeably different from Classical Latin, as reflected in the works of Cicero or Virgil". Mais l'auteur passe sous silence le fait qu'en réalité, au sujet de l' origine des langues romanes, deux thèses s' affrontent, qui peuvent être représentées par les schémas suivants.

  9. El noble checo Herman Jakub Cernín de Chudenice y su encuentro con el arte en España 1681/1682

    Directory of Open Access Journals (Sweden)

    Hajná, Milena

    2008-06-01

    Full Text Available The Czech noble Heřman Jakub Černín of Chudenice (1659-1710 was the eldest son of Count Humprecht Jan Černín de Chudenice (1628-1682, an important diplomat and politician at the Court of Emperor Leopold I. His journey throughout Spain (1681-1682 formed part of his European “grand tour” (1679-1682. Before setting off on this trip, Count Humprecht instructed his son to write a diary in the languages of the lands he visited. Thanks to satisfying his father’s wishes, Heřman Jakub became the author of an exceptional diary, which not only records his entire European itinerary, but is also an interesting linguistic document. The young Černín dedicated most of the space in his diary to describing his meetings with important figures, festivities and historical monuments. Although some erudition can be observed in his knowledge of art, he cannot be considered a specialist or an art expert. What most attracted his attention were works of art and architecture whose significance was already well known, and which he had heard about through his father, his tutor or occasionally through local guides and travel books. The whole of Černín’s Spanish journey was marked by his special interest in architecture. While he was able to recognise the value and quality of paintings and sculptures, he noted specific works and names of artists only sporadically in his diary.

    El noble checo Heřman Jakub Černín de Chudenice (1659-1710, primogénito del conde Humprecht Jan Černín de Chudenice (1628-1682, fue un importante diplomático y político en la Corte del emperador Leopoldo I. Su recorrido por España (1681-1682 formaba parte de su viaje de estudios por Europa que hizo durante los años 1679-1682. En una instrucción escrita antes de empezar este viaje, el padre Černín ordenó a su hijo que escribiera un diario en el idioma de cada país por el que estuviera viajando. Gracias al cumplimiento de este deseo de su padre, el joven aristócrata se convirtió en el autor de un diario especial, que, no sólo marca casi todo su camino europeo, sino que también sirve como un interesante documento lingüístico. El conde Černín dedicó el espacio más amplio de su diario a la descripción de los encuentros con las personas importantes, de las fiestas y de los monumentos históricos. Le llamaban la atención ante todo las obras arquitectónicas o de arte, cuya importancia ya estaba públicamente confirmada y que conocía por medio del padre, el preceptor, sus guías ocasionales o los libros de viajes. Todo el viaje español está marcado por el interés especial de Černín por la arquitectura. Aunque sabía bién apreciar la calidad de pinturas y de esculturas, las obras concretas y los nombres de sus autores, los apuntó en el diario sólo esporádicamente. Se nota, que los conocimientos de Černín no carecen de cierta erudición, pero no es posible ver en este joven a un experto en arte.

  10. In Search of Vitality. Herman Bang’s Hopeless Generations in the Context of Contemporary Bio-political Movements

    DEFF Research Database (Denmark)

    Nielsen, Louise Ebbesen; Jørgensen, Jens Lohfert

    2010-01-01

    concepts such as vitalism (Hans Driesch) and degeneration (Max Nordau) can be conceived as different reactions to Charles Darwin’s On the Origin of the Species in the light of bio-power. Even though both Driesch and Nordau use Darwin’s theories to produce positive ideas about respectively the strong...

  11. In Search of Vitality. Herman Bang’s Hopeless Generations in the Context of Contemporary Bio-political Movements

    DEFF Research Database (Denmark)

    Nielsen, Louise Ebbesen; Jørgensen, Jens Lohfert

    2010-01-01

    concepts such as vitalism (Hans Driesch) and degeneration (Max Nordau) can be conceived as different reactions to Charles Darwin’s On the Origin of the Species in the light of bio-power. Even though both Driesch and Nordau use Darwin’s theories to produce positive ideas about respectively the strong......This article draws attention to the paradigmatic shift in the use of the concept of ‘life’, which can be observed at the end of the nineteenth century. With Michel Foucault’s notion of bio-power as a foil, the article aims firstly to discuss how influential aesthetic, biological and political...

  12. PROSES PEMAKNAAN KELOMPOK TERHADAP BRAND SEBAGAI IDENTITAS KELOMPOK (Studi Deskriptif Kualitatif pada Kelompok Skinhead di Yogyakarta terhadap Brand Dr. Martens, Fred Perry, Ben Sherman, Levi’s.)

    OpenAIRE

    Renaldo, Bernadus

    2014-01-01

    Sebagai makhluk sosial kita tidak terlepas pada kelompok-kelompok masyarkat. Pada hal ini individu-individu membentuk satu kelompok dengan memiliki tujuan yang sama. Skinhead merupakan kelompok anak muda kelas pekerja “Working Class” yang telah ada pada tahun 1960an di Inggris. Skinhead juga merupakan “Way of Life”, sehingga semua orang bisa menjadi skinhead. Berkepala gundul merupakan ciri fisik skinhead. Kemeja kotak-kota, kaus berkerah, jaket harrington, jaket jeans, celana jeans, sepatu b...

  13. Professor Sir Fred Hoyle astronomer who propounded the 'steady state' theory of the universe and defended it energetically in defiance of orthodox cosmology

    CERN Multimedia

    Ward, M

    2001-01-01

    Professor Hoyle was internationally acclaimed for his original work on stars, galaxies, gravity and the origin of atoms. He will always be associated with the 'steady state' theory of the universe, which he first proposed in 1948. Born on June 24 1915 he died on August 20th 2001, aged 86 (2 pages).

  14. Hope, optimism, and other business assets: Why “psychological capital” is so valuable to your company

    OpenAIRE

    GMJ; Luthans, Fred

    2007-01-01

    Entrevista com Fred Luthans,1 coauthor of Psychological Capital: Developing the Human Competitive Edge Interview with Fred Luthans,1 coauthor of Psychological Capital: Developing the Human Competitive Edge

  15. The evidence base for diabetes care

    National Research Council Canada - National Science Library

    Williams, D. R. R. (David Robert Rhys)

    2002-01-01

    ... . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .ix 1. The Evidence Base for Diabetes Care . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Rhys Williams, William Herman, Ann-Louise Kinmonth...

  16. Herman Feshbach Prize in Theoretical Nuclear Physics Xiangdong Ji, University of Maryland PandaX-III: high-pressure gas TPC for Xe136 neutrinoless double beta decay at CJPL

    Science.gov (United States)

    Ji, Xiangdong; PandaX-III Collaboration

    2016-03-01

    The PandaX-III in China's Jinping Underground Lab is a new neutrinoless double beta decay experiment using Xe136 high-pressure gas TPC. The first phase of the experiment uses a 4 m3 gas detector with symmetric Micromegas charge readout planes. The gas TPC allows full reconstruction of the event topology, capable of distinguishing the two electron events from gamma background with high confidence level. The energy resolution can reach about 3% FWHM at the beta decay Q-value. The detector construction and the experimental lab is currently under active development. In this talk, the current status and future plan are reported.

  17. Semi Automated Ferrous Material Scouring System (SAFMSS)

    Science.gov (United States)

    2016-03-14

    FINAL REPORT Semi-Automated Ferrous Material Scouring System (SAFMSS) ESTCP Project MR-201102 MARCH 2016 Dr. Herman Herman Mr. Chris Fromme...Include area code) 03/14/2016 Final Report July 2011 - March 2016 Semi-Automated Ferrous Material Scouring System (SAFMSS) Chris Fromme Herman Herman... Ferrous Material Scouring System (SAFMSS) March 14, 2016 ii Approved for public release; distribution is unlimited TABLE OF CONTENTS TABLE OF

  18. Gclust Server: 71468 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 71468 DME_CG31774_28574712 Cluster Sequences - 1193 fred: friend of echinoid CG3177...o cluster sequences Cluster Sequences Link to related sequences - Sequence length 1193 Representative annotation fred: friend

  19. Obituary: Ralph Asher Alpher, 1921-2007

    Science.gov (United States)

    Koopman, Rebecca A.

    2007-12-01

    conditions in the early Universe prior to nucleosynthesis. Early on, Alpher and Herman realized that if the expanding Universe began in a hot phase, relic radiation from the era when radiation and matter decoupled should fill the Universe. They published this result in Nature in 1948, predicting that the current temperature should be 5K. In talk after talk, and in a series of papers, they publicized their work and urged observers to start looking for this radiation, but without result. At the time, the model of the hot, expanding Universe, scornfully christened "Big Bang" by Fred Hoyle in 1950, was far from accepted by the cosmology community, especially since the measured value of the Hubble constant produced a very small evolutionary age. Even if the Big Bang model was correct, the consensus was that the relic radiation would be much too faint to detect. Dismayed by the lack of interest in their results, both Alpher and Herman decided in 1955 to give up academia, turning down positions offered at the University of Iowa with James van Allen, and instead accepting jobs at General Electric (GE) and General Motors. Both had families by that time. Ralph had met his wife, Louise Ellen Simons, in 1940. They married January 28, 1942, and had two children, Harriet and Victor. Ralph worked for 32 years at GE Research and Development Center in Niskayuna, New York, on a variety of projects including high-speed aerodynamics, theoretical problems involving the physics of television projection systems, magnetohydrodynamic methods, and, eventually, strategic planning and technology forecasting. The papers about the relic radiation languished in the literature, but Alpher and Herman kept up with developments in cosmology. One can imagine their excitement and gratification when they learned of the serendipitous detection of the cosmic microwave background by Arno Penzias and Robert Wilson in 1965 and found that their model temperature (with updated values of cosmological parameters) was in

  20. "The Other"and the Wall of Ideology--Herman Melville's"Bartleby, the Scrivener: A Story of Wall Street"%"异者"与意识形态之墙——评赫曼·麦尔维尔的《抄写员巴特比:一个华尔街的故事》

    Institute of Scientific and Technical Information of China (English)

    陈榕

    2002-01-01

    在中作为美国19世纪中产阶级代表的老律师对抄写员巴特比这个充满不确定性的人物进行了失败的阐释.他的失败揭示出资本主义宗教观、物质观和理性观的局限性.作品中"墙"的意象代表的是人和人之间交流的阻隔.这种阻隔恰恰是由无形的意识形态的高墙造成的.作品讽刺了资产阶级在对待"异者"时的狭隘态度.

  1. Analysis of the 323rd Flying Training Wing Using Organizational Development and the Action Research Model: A Communications Audit.

    Science.gov (United States)

    1979-05-15

    nvironmcnt Questionnaires and Army UnitEffectivenoss and S;atisfaction 1Moasurc , Boston: Mclierand Company. [19773. Csoka, Louis S. and Fiedler , Fred E...34 Organizational Dynamics (’Jinter 1974):15-29. Fiedler , Fred T . A Theory of Leadership Effectiveness. Vow York: cicGra.-IIill, 1967. Fiodler, Fred E. "The...were developed, one by Fiedler and the other by Vroom, and finally the action research model proposed by French and Bell. All three have a different

  2. The Lead Free Electronics Manhattan Project - Phase I

    Science.gov (United States)

    2009-07-30

    Anthony Rafanelli Raytheon SME Dr. Polina Snugovsky Celestica SME Fred Verdi ACI Technologies, Inc. SME Dr. Paul Vianco Sandia National Labs SME...Outstanding Technical Achievement Awards, including two from Celestica. Appendix C 307 Fred W. Verdi Fred W. Verdi , is a Senior Manufacturing...Pennsylvania and his BSME at the New Jersey Institute of Technology at Newark, New Jersey. Mr. Verdi has over 31 years of experience from Lucent

  3. A calf is born : a reconstruction of the public debate on animal biotechnology

    NARCIS (Netherlands)

    Theune, E.

    2001-01-01

    'How should public debates be understood?' is the central question of this study. And it is answered by reconstructing a single public debate, namely the debate about the transgenic bull Herman. Herman the bull was created by Gene Pharming in 1989. An extra gene has been inserted in his genome as to

  4. Heuristics for Cooperative Problem Solving

    Science.gov (United States)

    1989-02-01

    private statements of intentions, J. Soc. Psycl 125. 277-278 (1985). 16. R. Buskirk, Sociality in arachnida . In H. Herman, (ed.) Social Insects, pp. 282-369...R. 1981. Sociality in arachnida . pp. 282-369. In Herman, H. (ed.) Social insects. Academic Press, NY. value = low-moderate Caraco, T. and Wolf, L. L

  5. Ved vejen

    DEFF Research Database (Denmark)

    Dahl, Per; Dalsgaard, Birgitte

    2012-01-01

    iBogs-udgave af Herman Bang: Ved Vejen, inkl. 646 ordforklaringer, 4 introduktioner, 4 anmeldelser, opgaver, 4 videoklip, 1 lydfil, 48 illustrationer, 3 stilesæt, litteraturliste......iBogs-udgave af Herman Bang: Ved Vejen, inkl. 646 ordforklaringer, 4 introduktioner, 4 anmeldelser, opgaver, 4 videoklip, 1 lydfil, 48 illustrationer, 3 stilesæt, litteraturliste...

  6. Past, present and future of the speech transmission index

    NARCIS (Netherlands)

    Houtgast, T.; Steeneken, H.J.M.; Wijngaarden, S.J. van

    2002-01-01

    Table of contents Tammo's and Herman's Index. An introduction by Manfred R. Schroeder Chapter 1. The roots of the STI approach. Tammo Houtgast and Herman J.M. Steeneken: Introduction - Our first effort - Introduction of STI - Speech envelope spectrum and MTF - Further developments - Envelope modulat

  7. Versija Hermana Simma : menja shantazhirovali / Risto Berendson, Rasmus Kagge

    Index Scriptorium Estoniae

    Berendson, Risto, 1975-

    2008-01-01

    Riigireetmises uurimise all viibiva Herman Simmi väidetel langes ta KGB šantaaži ohvriks. Vt. samas: Indrek Jürjo. KGB lähiajalugu Eestis püsib ähmasena; Vladimir Jushkin. Agentide nimed jäävad igaveseks saladuseks; Hardo Aasmäe. Agentuuritoimikud viidi Eestist minema; Herman Simmi arreteerimine

  8. A calf is born : a reconstruction of the public debate on animal biotechnology

    NARCIS (Netherlands)

    Theune, E.

    2001-01-01

    'How should public debates be understood?' is the central question of this study. And it is answered by reconstructing a single public debate, namely the debate about the transgenic bull Herman. Herman the bull was created by Gene Pharming in 1989. An extra gene has been inserted in his genome as to

  9. Exploring Acculturation Experiences and Cultural Dialogues among Iranian Refugees in the Netherlands by Means of the Self-Confrontation Method

    NARCIS (Netherlands)

    Lindert, A. te; Korzilius, H.P.L.M.

    2008-01-01

    In this study we explored the most important topics of acculturation experiences among Iranian refugees in the Netherlands, using the Self-Confrontation Method (Hermans & Hermans-Jansen, 1995). We discussed the Dialogical Self Theory reffering to the multiple selves of people who have to deal

  10. Versija Hermana Simma : menja shantazhirovali / Risto Berendson, Rasmus Kagge

    Index Scriptorium Estoniae

    Berendson, Risto, 1975-

    2008-01-01

    Riigireetmises uurimise all viibiva Herman Simmi väidetel langes ta KGB šantaaži ohvriks. Vt. samas: Indrek Jürjo. KGB lähiajalugu Eestis püsib ähmasena; Vladimir Jushkin. Agentide nimed jäävad igaveseks saladuseks; Hardo Aasmäe. Agentuuritoimikud viidi Eestist minema; Herman Simmi arreteerimine

  11. Exploring Acculturation Experiences and Cultural Dialogues among Iranian Refugees in the Netherlands by Means of the Self-Confrontation Method

    NARCIS (Netherlands)

    Lindert, A. te; Korzilius, H.P.L.M.

    2008-01-01

    In this study we explored the most important topics of acculturation experiences among Iranian refugees in the Netherlands, using the Self-Confrontation Method (Hermans & Hermans-Jansen, 1995). We discussed the Dialogical Self Theory reffering to the multiple selves of people who have to deal with d

  12. Past, present and future of the speech transmission index

    NARCIS (Netherlands)

    Houtgast, T.; Steeneken, H.J.M.; Wijngaarden, S.J. van

    2002-01-01

    Table of contents Tammo's and Herman's Index. An introduction by Manfred R. Schroeder Chapter 1. The roots of the STI approach. Tammo Houtgast and Herman J.M. Steeneken: Introduction - Our first effort - Introduction of STI - Speech envelope spectrum and MTF - Further developments - Envelope modulat

  13. Fundamental Capability Portfolio Management: A Study of Developing Systems with Implications for Army Research and Development Strategy

    Science.gov (United States)

    2013-01-01

    Federal News Radio. June 7, 2010. http://www.federalnewsradio.com/?sid=1974633&nid=17 (accessed March 2011). Drezner, J.A., J.M. Jarvaise, R.W. Hess ...pdf (accessed November 30, 2012). Few, Doug, Roelof Versteeg, and Herman Herman . Semi Autonomous Mine Detection System. Idaho Falls, ID: Idaho

  14. AcEST: BP920054 [AcEST

    Lifescience Database Archive (English)

    Full Text Available its) Value sp|Q9P246|STIM2_HUMAN Stromal interaction molecule 2 OS=Homo sap... 33 0.85 sp|P59438|HPS5_MOUSE Herman...LHDNH 246 +++R I SP P+R +A + P SHP H +H Sbjct: 514 RSRRSIVPSSPQPQRAQLAPHAPHPSHPRHPHH 546 >sp|P59438|HPS5_MOUSE Herman

  15. Role of Macrophage-induced Inflammation in Mesothelioma

    Science.gov (United States)

    2012-07-01

    Indiana University, Herman B. Wells Center for Pediatric Research and Clinical Cancer Center, Indianapolis IN, USA 2004 Immunology Graduate Program...Cancer Center Research Building Annual Retreat 2001 Member, ‘Star Performance Award’ selection committee 2001 Presentation, Evelyn Herman Reception... Hess KR, Anderson K, Symmans WF, Valero V, Ibrahim N, Mejia JA, et al. Pharmacogenomic predictor of sensitivity to preoperative chemotherapy with

  16. 76 FR 35007 - Notice of Issuance of Final Determination Concerning the Country of Origin of Certain Office Chairs

    Science.gov (United States)

    2011-06-15

    ...) and is entitled to request this final determination. FACTS: Herman Miller is a U.S. supplier of... lower back comfort. Three arm choices are also available--fixed, height-adjustable and fully- adjustable... Herman Miller receiving a sheet of Chinese-origin TPU mesh from its supplier in the exact size and...

  17. New angiosperm genera from cretaceous sections of northern Asia

    Science.gov (United States)

    Alekseev, P. I.; Herman, A. B.; Shchepetov, S. V.

    2014-11-01

    The Cretaceous floras of northern Asia represented by the Antibes flora of the Chulym-Yenisei area of West Siberia, Kaivayam flora of northwestern Kamchatka, and Grebenka flora of the Anadyr River basin in Chukotka are reviewed. These floras characterize the Late Cretaceous Siberian-Canadian Paleofloristic Region, where they developed in humid warm temperate climatic environments. Two new angiosperm genera are described: genus Chachlovia P. Alekseev et Herman with species C. kiyensis P. Alekseev, sp. nov. and C. dombeyopsoida (Herman) Herman, comb. nov. and genus Soninia Herman et Shczepetov with species S. asiatica P. Alekseev, sp. nov. and S. integerrima Herman et Shczepetov, sp. nov. The species Chachlovia kiyensis and Soninia asiatica were characteristic components of the Antibes flora. Chachlovia dombeyopsoida and Soninia integerrima were constituents of the Kaivayam and Grebenka floras, respectively.

  18. Current direction and bathythermograph (xbt) data from moored current meter casts and other instruments in the Gulf of Mexico, Northwest Atlantic Ocean, and North American Coastline-South as part the North Carolina Frontal Eddy Dynamics Experiment (FRED) project, 1985-01-23 to 1987-01-31 (NCEI Accession 8900214)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Current direction and bathythermograph (xbt) data were collected using moored current meter casts and other instruments in the Gulf of Mexico, Northwest Atlantic...

  19. Investigation and modelling of the alkaline release and transport during coal combustion at elevated pressures. Final report; Untersuchung und Modellierung der Freisetzungs- und Transportvorgaenge von Alkalien bei der Kohleverbrennung unter hohen Druecken. Untersuchungen mit der Hochdruck-Hochtemperatur-Thermowaage, Alkalienanalysen in Rohkohlen und Feuerungsversuche in der Druckwirbelschichtanlage FRED (DMT). Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Bonn, B.; Steffin, C.; Busch, U.; Mayer, M.

    2000-07-01

    In this joint research project DMT investigated the release (and incorporation) of alkalis of the coal mineral matter to clear up the affecting mechanisms during combustion at elevated pressure. In the experiments parameter like the ambient gas and the ash composition, pressure and heating rate were varied. The experiments were conducted in DMT's high-temperature and high-pressure Thermogravimetric-Analyser (TGA) and the DMT Pressurised Fluidised Bed Combustor (PFBC). TGA-Experiments: A model compounds for the alkali sodium chloride and for the mineral matter metakaoline were used. The chemical properties (basicity) of metakaoline was modified by adding CaO. The commonly accepted physical volatilization process of the alkali from the ash was not confirmed by TGA experiments. The alkali release must be regarded as a desorption mechanism of the sodium chloride from the metakaoline surface. The desorption of the alkali is not affected by chemical composition of the mineral matter but is strongly influenced by gas phase oxygen species and pressure. PFBC-Experiments: The rig was operated with a fluidised bed temperature of 920 C and a pressure of 7 bar. The online/in-situ alkali detection was based on the excimer laser induced fragmentation fluorescence ELIF. The alkali content of the coal was varied by addition of sodium acetate and sodium chloride. Kaoline was used as gettermaterial for mitigation of alkali emissions. Furthermore, the influence of limestone on the alkali release was investigated. Among other results, the experiments showed that the alkali emissions of the lignite are 50-100 times higher than those of the bituminous coal and if limestone for capturing SO{sub 2} is added to the combustor the alkali chloride emissions increase rapidly. (orig.) [German] Im Rahmen des o.g. Gemeinschaftsprojekts untersuchte die DMT die Freisetzung (und Einbindung) der Alkalien aus der Mineralsubstanz von Kohlen zur Aufklaerung der beeinflussenden Mechanismen bei der Verbrennung unter Druck. Variiert wurden hierzu die Einflussparameter umgebende Gasatmosphaere und Aschezusammensetzung sowie Druck und Aufheizrate. Die Versuche wurden in der DMT Hochdruck-Hochtemperatur-Thermowaage (TGA) und der DMT Druckwirbelschichtfeuerung (DWSF) durchgefuehrt. TGA-Versuche: Als Modelsubstanz fuer Alkalien wurde Natriumchlorid und fuer die Mineralsubstanz der Kohle Metakaolin eingesetzt. Die chemische Eigenschaft (Basizitaet) von Metakaolin wurde durch Zugabe von CaO veraendert. Die allgemein akzeptierte Annahme eines physikalischen Verdampfungsprozesses der Alkalien aus den Kohleaschen konnte in den TGA-Versuchen nicht bestaetigt werden. Vielmehr muss von einer Desorptionsreaktion des Natriumchlorids von der Metakaolin-Oberflaeche ausgegangen werden. Die Desorption von Alkalien wird nicht durch die chemische Zusammensetzung der Mineralsubstanz beeinflusst, dagegen besitzen die Sauerstoffverbindungen in der Gasphase und der Druck einen starken Einfluss. DWSF-Versuche: Die Versuchsanlage wurde betrieben bei einer Wirbelschichttemperatur von 920 C und einem Druck von 7 bar. Die online/in-situ Alkali-Messung beruht auf der Excimer Laser Induced Fragmentation Fluorescence ELIF. Die Alkali-Konzentration wurde variiert durch die Zugabe von Natriumacetat und Natriumchlorid. Als Adsorber von Alkaliemissionen wurde Kaolin eingesetzt. Darueber hinaus wurde der Einfluss der Kalksteinzugabe auf die Alkali-Emissionen untersucht. Die Versuche zeigten u.a., dass die Alkali-Emissionen von Braunkohlen um einen Faktor 50-100 ueber den Alkali-Emissionen von Steinkohlen liegen, und dass die Zugabe von Kalkstein (der zur SO{sub 2}-Minderung eingesetzt wird) zu stark ansteigenden Alkalichlorid-Emissionen fuehrt. (orig.)

  20. Current direction, bathythermograph (xbt), CTD, and other data from moored current meter casts and other instruments in the Northwest Atlantic Ocean (limit-40 W) and North American Coastline-South as part of the North Carolina FRontal Eddy Dynamics Experiment (FRED) project, 1987-05-07 to 1987-11-01 (NCEI Accession 8900181)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Current direction, bathythermograph (xbt), CTD, and other data were collected using moored current meter casts and other instruments in the Northwest Atlantic Ocean...

  1. Iwo Jima: The Unnecessary Battle

    Science.gov (United States)

    2011-03-25

    Fred, Samurai ! (New York: Nelson Doubleday Inc. 1957). Schmidt, Harry Schmidt, Lieutenant General, U.S. Marine Corps, IWO JIMA, Commanding...191-202. 21 Alexander 14. 22 Alexander 14. 23 Saburo Sakai, Martin Caidan, and Fred Saito, Samurai ! (New York: Nelson Doubleday Inc. 1957), 276

  2. Mida mõtlevad tippjuhid? / interv. John A. Byrne

    Index Scriptorium Estoniae

    2008-01-01

    USA majandusliku olukorra ja tulevikuprognooside üle arutlevad FedExi juht Fred Smith, Chrysleri tegevjuht Robert Nardell, endine General Electric'u aseesimees Dennis Dammerman, Caritas Christi Health Care tegevjuht Ralph de la Torre, Abbott Labs tegevjuht Miles White, FPL Group tegevjuht Lewis Hay, BorgWarneri tegevjuht Timothy Manganello ning Schering-Plough tegevjuht Fred Hassan

  3. The Development of PIPA: An Integrated and Automated Pipeline for Genome-Wide Protein Function Annotation

    Science.gov (United States)

    2008-01-25

    protein function annotation Chenggang Yu1, Nela Zavaljevski1, Valmik Desai1, Seth Johnson2, Fred J Stevens3 and Jaques Reifman*1 Address: 1Biotechnology...cyu@bioanalysis.org; Nela Zavaljevski - nelaz@bioanalysis.org; Valmik Desai - valmik@bioanalysis.org; Seth Johnson - sjohnson@exonhit-usa.com; Fred J

  4. 78 FR 6154 - Self-Regulatory Organizations; The NASDAQ Stock Market LLC; Notice of Designation of Longer...

    Science.gov (United States)

    2013-01-29

    ... Lovell, Victor E. Stewart, and Fred T. Isquith, Lovell Stewart Halebian Jacobson LLP, Jacob H. Zamansky and Edward H. Glenn, Zamansky & Associates LLC, dated August 22, 2012 (``Thompson Letter I''); James J..., Finkelstein Thompson LLP, Christopher Lovell, Victor E. Stewart, and Fred T. Isquith, Lovell Stewart...

  5. Using Color to Separate Reflection Components.

    Science.gov (United States)

    1984-04-02

    irvestigated. 5.1 Acknowledgements The author would like to thank Fred Billmeyer , of Rensselaer Polytechnic Institute, and David MacAdam, of the Optics...from Rough Surfaces. MacMillan, 1963. Pages 1-33,70-98. S[3] Billmeyer , Fred W. Jr. Private communication. [4] Blinn, J. F. Models of Light Reflection

  6. Stemcell Information: SKIP000875 [SKIP Stemcell Database[Archive

    Lifescience Database Archive (English)

    Full Text Available CR ... Jerome Mertens--Fred H. Gage Jerome Mertens--Fred H. Gage Jiangsu Collaborative Innovation Center for...tudies, Laboratory of Genetics Jiangsu Collaborative Innovation Center for Language Ability, Jiangsu Normal ...University--The Salk Institute for Biological Studies, Laboratory of Genetics Jiangsu Collaborative Innovati... Biological Studies, Laboratory of Genetics Jiangsu Collaborative Innovation Center for Language Ability, Ji

  7. Gordon Research Conference on Chronobiology, 1991

    Science.gov (United States)

    1992-07-31

    Bromage (Univ. of Stirling) Elena Thomas (Berkeley) Fred Karsch (Ann Arbor) Gordon Conference on Chronobiology 1991 Irsee, Germany/September 29...Berkeley) Fred Karsch (Ann Arbor) Acee’.sin For ; D Iqt. C Dilst S 7o;;a I~ : Ijj I

  8. The Developmental Gap in Army Officer’s Education and Training for the Future Force

    Science.gov (United States)

    2007-11-02

    are we Now?”, in “Naturalistic Decision Making” eds., Caroline Zsambok and Gary Klein, (New Jersey: Earlbaum Associates 1997):3-16. 83 Fred Fiedler ...Wrong and What Can We Do to Make Them Right. New York: Metropolitan Books, 1996. Fiedler , Fred . “The Role and Meaning of Leadership Experience.” In

  9. Tordos and twisters

    NARCIS (Netherlands)

    De Boo, M.

    2005-01-01

    The Ginger and Fred office building of the Nationale Nederlanden Insurance Company in Prague, Czech Republic (1996) by the American architect Frank O. Gehry. The nickname, referring to the dancing couple Ginger Rogers and Fred Astaire, was inspired by the two elegantly curved intimate volumes in the

  10. Tordos and twisters

    NARCIS (Netherlands)

    De Boo, M.

    2005-01-01

    The Ginger and Fred office building of the Nationale Nederlanden Insurance Company in Prague, Czech Republic (1996) by the American architect Frank O. Gehry. The nickname, referring to the dancing couple Ginger Rogers and Fred Astaire, was inspired by the two elegantly curved intimate volumes in the

  11. An Analysis of Corporate Organizational Development Experience and its Implications for the Future of the Army’s Organizational Effectiveness Program

    Science.gov (United States)

    1978-06-01

    Main Body. 2. Ramon A. Nadal, William E. Duey, Roy Ray, and Fred W. Schaum , Organizational Effectiveness in the US Army (Final Report), July 1977. 3...Ramon A; Duey, William E.; Ray, Roy; and Schaum , Fred W. Or~a~nizationxal Effectiveness in the US Aiwy. (Final Report) Office of the Chief of Staff

  12. Erratum for “Simulation of Wave-Plus-Current Scour beneath Submarine Pipelines” by Bjarke Eltard Larsen, DavidR. Fuhrman, and B. Mutlu Sumer

    DEFF Research Database (Denmark)

    Eltard-Larsen, Bjarke; Fuhrman, David R.; Sumer, B. Mutlu

    2016-01-01

    Errors in reference citations introduced during composition by ASCE are being clarified in this erratum. The citations corresponding to the reference Fredsøe et al. (1992) were inadvertently changed to Fredsøe and Deigaard (1992) in four locations. The citations are being corrected in this paper,...

  13. Mida mõtlevad tippjuhid? / interv. John A. Byrne

    Index Scriptorium Estoniae

    2008-01-01

    USA majandusliku olukorra ja tulevikuprognooside üle arutlevad FedExi juht Fred Smith, Chrysleri tegevjuht Robert Nardell, endine General Electric'u aseesimees Dennis Dammerman, Caritas Christi Health Care tegevjuht Ralph de la Torre, Abbott Labs tegevjuht Miles White, FPL Group tegevjuht Lewis Hay, BorgWarneri tegevjuht Timothy Manganello ning Schering-Plough tegevjuht Fred Hassan

  14. Comparison of a Gas Chromatograph and a Cavity Ringdown Spectrometer for Flux Quantification of Nitrous Oxide, Carbon Dioxide and Methane in Closed Soil Chambers Derek Fleck1, Yonggang He1, Donald Herman2, Serena Moseman-Valtierra3, Gloria Jacobson1 1 Picarro Inc, 3105 Patrick Henry Drive, Santa Clara, CA 95054 2 College of Natural Resource, UC Berkeley, 130 Mulford Hall, University of California, Berkeley, CA, 94720-3114 3 University of Rhode Island, CBLS 489, Kingston, RI 02881

    Science.gov (United States)

    Fleck, D.; He, Y.; Herman, D.; Moseman-valtierra, S.; Jacobson, G. A.

    2013-12-01

    The study of the three predominant greenhouse gasses effecting global climate change, CO2, CH4 and N2O, has become increasingly important in ecological and agricultural soil research. It is essential for current and future atmospheric greenhouse gas budgets to reduce the uncertainty of greenhouse gas soil fluxes in a variety of environments and climates. Traditional soil flux experiments using the closed chamber and discrete sampling for Gas Chromatograph ('GC') analysis cannot sufficiently capture the large temporal variation in soil gas fluxes, which can lead to large errors in ecosystem flux models. Real-time, simultaneous measurement of these gases should provide easier and more comprehensive and precise chamber flux measurements. We provide a comparison of the GC sampling method to a closed loop, continuous flow system coupled with a Picarro G2508 Cavity Ringdown Spectrometer to quantify the flux of CO2, CH4 and N2O. The Picarro analyzer has a data rate of approximately 6 seconds for all three gases, which gives a much higher temporal resolution than discrete sampling (performed every 8-15 minutes). This work will compare GC and Picarro G2508 soil flux measurement results from two independent researchers and will cover fluxes for three different soil environments. Details on the system configuration and sampling methodology effects on flux errors will also be discussed. We will show that by reducing the systematic error due to sample preparation for the GC, the continuous flow measurement of the Picarro G2508 field deployable analyzer can significantly increase the measurement precision of respiration rates of N2O, CH4 and CO2. It is noteworthy that the Picarro analyzer also simultaneously measures the concentration of ammonia (NH3) and water, and these results will also be discussed.

  15. Pallas näitab teed Tartu skulptuurile / Ahti Seppet

    Index Scriptorium Estoniae

    Seppet, Ahti, 1953-

    2006-01-01

    Näitus "Pallase skulptuur" Tartu Kunstimuuseumis. Eksponeeritakse Ferdi Sannamehe, Eduard Wiiralti, Johannes Hirve, August Vommi, Martin Saksa, Roman Timotheuse, Herman Halliste, Lydia Laasi, Alfred Leiuse, Enn Roosi jt. kunstnike töid

  16. Genetics Home Reference: X-linked chondrodysplasia punctata 2

    Science.gov (United States)

    ... This Page Aughton DJ, Kelley RI, Metzenberg A, Pureza V, Pauli RM. X-linked dominant chondrodysplasia punctata ( ... Punctata 2, X-Linked Herman GE, Kelley RI, Pureza V, Smith D, Kopacz K, Pitt J, Sutphen ...

  17. Van Rompuy ja Ashton - kes need veel on? / Aadu Hiietamm

    Index Scriptorium Estoniae

    Hiietamm, Aadu, 1954-

    2009-01-01

    Euroopa Liidu 27 liikmesriigi juhid valisid ühenduse presidendiks ehk täpsemalt Euroopa Ülemkogu alaliseks eesistujaks senise Belgia peaministri Herman Van Rompuy ja välisministriks Euroopa Komisjoni kaubandusvoliniku paruness Catherine Ashtoni Suurbritanniast

  18. Institutions Struggling with Web 2.0

    NARCIS (Netherlands)

    Drachsler, Hendrik; Hermans, Henry

    2008-01-01

    Drachsler, H., & Hermans, H. (2008). Institutions Struggling with Web 2.0 - Moving Between Personal and Managed Learning Environments. Presentation at Online Educa 2008. December, 4, 2008, Berlin, Germany.

  19. Towards a methodology for educational modelling: a case in educational assessment

    NARCIS (Netherlands)

    Giesbers, Bas; Van Bruggen, Jan; Hermans, Henry; Joosten-ten Brinke, Desirée; Burgers, Jan; Koper, Rob; Latour, Ignace

    2005-01-01

    Giesbers, B., van Bruggen, J., Hermans, H., Joosten-ten Brinke, D., Burgers, J., Koper, R., & Latour, I. (2007). Towards a methodology for educational modelling: a case in educational assessment. Educational Technology & Society, 10 (1), 237-247.

  20. Chagalli näitust pikendati / Mark Soosaar

    Index Scriptorium Estoniae

    Soosaar, Mark, 1946-

    2000-01-01

    Tänu Pärnu Uue kunsti muuseumi ja Sprengeli muuseumi vahel saavutatud kokkuleppele jääb Marc Chagalli litograafiate sari 'Exodus', mida eksponeeritakse koos Herman Talviku graafikaga, Pärnusse 23. jaanuarini.

  1. Well done, mister Evanoff!

    Index Scriptorium Estoniae

    2011-01-01

    Michael Turner Evanoff pälvis Eesti-NATO suhete edendamise eest president Toomas Hendrik Ilveselt Maarjamaa Risti III klassi teenetemärgi. NATO julgeolekudirektor Evanoffi osalusel toimus ka vastuluureoperatsioon Herman Simmi paljastamiseks

  2. Disease: H00268 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available Nicita F, Pizzardi G, Del Balzo F, Iannetti P Neuronal migration disorders: clinical, neuroradiologic and genetics...linked lissencephaly. Neurogenetics. 9:277-85 (2008) PMID:18379572 Herman TE, Siegel MJ Miller--Dieker syndr

  3. Leugens in het lieglicht

    NARCIS (Netherlands)

    Kegel, P.W.

    2011-01-01

    Dichters liegen de waarheid. Sommige dichters liegen bij iedere herdruk of bundeling weer een andere waarheid. Voor Hermans gold alleen de laatst gelogen waarheid. Een beetje poëzielezer trekt zich daar echter niets van aan.

  4. Vaste draadspalken tegen (her)optreden van gedrongen stand hebben meer nadelen dan voordelen - ja

    NARCIS (Netherlands)

    van Beek, H.

    2012-01-01

    Voorstander, Herman van Beek, afdeling Orthodontie, Academisch Centrum voor Tandheelkunde: Mijns inziens zijn de nadelen van draadspalken groter dan de voordelen. Zo retineren draadspalken achter de gebitselementen in het onderfront alleen het front en toename van de overjet wordt niet

  5. Institutions Struggling with Web 2.0

    NARCIS (Netherlands)

    Drachsler, Hendrik; Hermans, Henry

    2008-01-01

    Drachsler, H., & Hermans, H. (2008). Institutions Struggling with Web 2.0 - Moving Between Personal and Managed Learning Environments. Presentation at Online Educa 2008. December, 4, 2008, Berlin, Germany.

  6. Importing into the EU - Council Regulation (EEC) No 1991/2006

    OpenAIRE

    van Boxem, Herman

    2008-01-01

    Report on the presentation held at BioFach, 23.02.2008, by Herman Van Boxem (European Commission, Agriculture and rural development Directorate-General Unit F5 - Organic farming) compiled by Beate Huber, FiBL

  7. Ükskõik kus - see tähendab siin / Ille Rohtlaan

    Index Scriptorium Estoniae

    Rohtlaan, Ille

    2009-01-01

    Karl Ristikivi romaani"Hingede öö" lavastus Endla teatri Küünis, milles on Herman Hesse "Stepihundi" tugevaid mõjutusi, lavastaja ja dramatiseerija Margus Kasterpalu, kunstnik Aime Unt. Esietendus 14. märtsil

  8. Seasonal sea level variability and anomalies in the Singapore Strait

    Digital Repository Service at National Institute of Oceanography (India)

    Tkalich, P.; Vethamony, P.; Babu, M.T.; Pokratath, P.

    Environmental Agency and Maritime Port Authority. Discussions with NUS and Deltares colleagues, Vladan BABOVIC and Herman GERRITSEN, have been most fruitful. REFERENCES Cabanes, C., Cazenzve, A., Le Provost, C., 2001. Sea level rise during past 40...

  9. Inductive reasoning in description logics

    CSIR Research Space (South Africa)

    Halland, K

    2008-11-01

    Full Text Available publication List of reviewers: Asheer Bachoo Etienne Barnard Niko Brummer Hanno Coetzer Marelie Davel Gerhard de Jager Alta de Waal Herman Engelbrecht Gordon Forbes Keith Forbes Kenneth Halland Ben Herbst Karin Hunter Brain Leke Aby Louw...

  10. Re-evaluation of ‘paradox of mesozooplankton’ in the eastern Arabian Sea based on ship and satellite observations

    Digital Repository Service at National Institute of Oceanography (India)

    Jyothibabu, R.; Madhu, N.V.; Habeebrehman, H.; Jayalakshmy, K.V.; Nair, K.K.C.; Achuthankutty, C.T.

    that MSP grazing and vertical biomass accumulations are positively related to the phytoplankton growth rate (Kiorbe, 1989; Herman, 1983). Dilution experiments by Landry et al. (1998) in the WAS also supported the above contention, in that phytoplankton...

  11. Disease: H00319 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available MeSH: D014917 MedlinePlus: 001561 PMID:21204863 (description) de Gouw D, Diavatopoulos DA, Bootsma HJ, Her...mans PW, Mooi FR Pertussis: a matter of immune modulation. FEMS Microbiol Rev 35:44

  12. Ükskõik kus - see tähendab siin / Ille Rohtlaan

    Index Scriptorium Estoniae

    Rohtlaan, Ille

    2009-01-01

    Karl Ristikivi romaani"Hingede öö" lavastus Endla teatri Küünis, milles on Herman Hesse "Stepihundi" tugevaid mõjutusi, lavastaja ja dramatiseerija Margus Kasterpalu, kunstnik Aime Unt. Esietendus 14. märtsil

  13. The Edubox Learning Design Player

    NARCIS (Netherlands)

    Tattersall, Colin; Vogten, Hubert; Hermans, Henry

    2005-01-01

    Tattersall, C., Vogten, H. & Hermans, H. (2005). The Edubox Learning Design Player. In: Koper, R. & Tattersall, C., Learning Design: A Handbook on Modelling and Delivering Networked Education and Training (pp. 303-310). Berlin-Heidelberg: Springer Verlag.

  14. The Edubox Learning Design Player

    NARCIS (Netherlands)

    Tattersall, Colin; Vogten, Hubert; Hermans, Henry

    2005-01-01

    Tattersall, C., Vogten, H. & Hermans, H. (2005). The Edubox Learning Design Player. In: Koper, R. & Tattersall, C., Learning Design: A Handbook on Modelling and Delivering Networked Education and Training (pp. 303-310). Berlin-Heidelberg: Springer Verlag.

  15. Chagalli näitust pikendati / Mark Soosaar

    Index Scriptorium Estoniae

    Soosaar, Mark, 1946-

    2000-01-01

    Tänu Pärnu Uue kunsti muuseumi ja Sprengeli muuseumi vahel saavutatud kokkuleppele jääb Marc Chagalli litograafiate sari 'Exodus', mida eksponeeritakse koos Herman Talviku graafikaga, Pärnusse 23. jaanuarini.

  16. Irregular Enemies and the Essence of Strategy: Can the American Way of War Adapt?

    Science.gov (United States)

    2006-03-01

    consequence was Herman Kahn, On Escalation: Metaphors and Scenarios, New York: Praeger, 1965. 63. Huntington, American Military Strategy, p. 16. 64...sacrifice mandated by a public culture of unpreparedness is well told in Charles E. Heller and William A. Stofft, eds., America’s First Battles, 1776... Herman Hattaway and Archer Jones, How the North Won: A Military History of the Civil War, Urbana, IL: University of Illinois Press, 1983, p. 720, for

  17. Research Investigation Directed Toward Extending the Useful Range of the Electromagnetic Spectrum

    Science.gov (United States)

    1989-12-31

    20 B. NEW OPTICAL MATERIALS AND SOURCES Irving P. Herman. Principal Investigator~Resarch Area I1. Work Unit 2. 1. Optical Studies of Il-VI...SOURCES Irving P. Herman, Principal Investigator (212) 854-4950 Research Area I, Work Unit 2 3 The main objective of this JSEP work unit is to...F. Noxon, J. Chem. Phy., S2. 1852 (1970). Vibrational, Rotational, and Translational Excitation of 3 R. L Donovan. D. Husain, L. Kirsch . Trans

  18. Operatsioon "Simm-litz" / Janar Filippov, Raul Ranne

    Index Scriptorium Estoniae

    Filippov, Janar, 1976-

    2008-01-01

    Riigireetmises kahtlustatava Herman Simmi karjäärist, endise kaitseministri Andrus Ööveli ja kaitseministeeriumi endise kantsleri Indrek Kanniku, endise kaitseministri Jüri Luige hinnanguid. Vt. samas: Sulev Vedler. Herman Simm viis saladusi salapärasele Jesusele. Katke Vilja Laanaru mälestustest "Mul on ainult üks elu" (1996). Lisa: "Mutt" istus sügaval Eesti julgeolekusüsteemi südames

  19. Deciding Who’s News: A Content Analysis of Disaster, National and International News in Two Elite Newspapers from 1885 through 1989

    Science.gov (United States)

    1990-05-01

    news. In their analysis and application of the propaganda model , Herman and Chomsky perceive a relationship between the political position of the...People Tame the Information Tide, 2d Edition. Longman, New York. Herman, Edward S. and Chomsky , Noam , 1988. Manufacturing Consent: The Political Economy...analysis model to analyze print journalism coverage, the author examines the characteristics of foreign news going out to readers of the New York Times and

  20. Infrared Radiation of Flames

    Science.gov (United States)

    1961-10-01

    March 1960. 4. S. Silverman, G. A. Hornbeck, and R. C. Herman , J. Chem. Phys. 16 155 (1947). The Infrared Emission and Absorption or-the Carbon Monoxide...by Infrared Radiation. 9. S. Silverman and R. C. Herman , J. Opt. Soc. Am. 32, 216 (1949). The Infrared Emission Spectra of the Oxy- Hydrogen and Oxy...Press, 1961). 35. W. J, Pearce, Conference on Extremely High Temperatures, Fischer and Mansur , eds. (John Wiley & Sons, New York, 1958), p. 123. 36. M. P

  1. The Honoraria Ban: Congressional Coup -- Workers’ Burden

    Science.gov (United States)

    1996-04-01

    128 Id. 48 * Nathaniel Hawthorne , Herman Melville, Brett Harte, Washington Irving, and William Dean Howells all supported their writing efforts as...done when arguing for his amendment to § 501(b).188 It listed many great figures of American literature who worked for the government: Nathaniel ... Hawthorne , Herman Melville, Washington Irving, Bret Harte, Walt Whitman, and Lewis Puller, Jr., the latter being a Pulitzer prize-wining writer who had

  2. Center for Advanced Bioengineering for Soldier Survivability

    Science.gov (United States)

    2012-06-01

    10. Herman CD, Lawrence K, Olivares-Navarrete R, Williams, JK, Schwartz Z, Boyan BD: Time course and gene expression analysis of juvenile mouse re...41 15. Herman CD, Lawrence K, Wilson S, Xinghai N, Olivares-Navarrete R, Guldbert RE, Murthy N, Williams, JK, Schwartz Z, Boyan BD: Click...Guldberg, Robert Christy, COL Michael Yaszemski (webinar), Michael Romanko, Kelvin Brockbank, Tim Patrick, Harold Shlevin, Dennis Hess , Rene Olivares

  3. Ku Klux Rising: Toward an Understanding of American Right Wing Terrorist Campaigns

    Science.gov (United States)

    2011-09-01

    Chomsky and Herman , for instance, claimed that “Washington has become the torture and political murder capital of the world.”125 This line was...32. 125 Noam Chomsky and Edward S. Herman , The Washington Connection and Third World Fascism, 1st ed., Their the Political Economy of Human Rights V...Context. Gregory Hess S. Brock Blomberg, Akila Weerapana, “Economic Conditions and Terrorism,” European Journal of Political Economy 20(April 2004). 534

  4. 2010 Defense Logistics Agency Enterprise Supplier Conference and Exhibition

    Science.gov (United States)

    2010-08-25

    DLA Contracting Services Office SB Dayton, OH 45459-4157 Hess Corporation DLA Energy LB Woodbridge...James McClaugherty Mr. Milton Lewis Batteries & Tires Dan McGrath Hardware Ruth Herman Land - Columbus COL Ryan Kivett Ben Roberts Land and Maritime...Customer Sales Orders: 61K / month • Annual Sales: $150M Ruth Herman Division Chief Harry MacCord Diversified Hardware I Andrea Wicker Diversified

  5. Development of a Compact & Easy-to-Use 3-D Camera for High Speed Turbulent Flow Fields

    Science.gov (United States)

    2013-12-05

    reconstruction methods (see Herman and Lent [32]) are well-suited for reconstruction given the above constraints. These methods form a linear system of...stereo particle image velocimetry. Experiments in Fluids, 2000. 29(7): p. S70-S77. 3. Brucker, C., D. Hess , and J. Kitzhofer, Single-view...in Aerospace Engineering2011, Auburn University. 32. Herman , G.T. and A. Lent, Iterative reconstruction algorithms. Comput Biol Med, 1976. 6(4): p

  6. Project on National Security Reform: Vision Working Group Report and Scenarios

    Science.gov (United States)

    2010-07-01

    Bridges Martin Buoncristiani King-Thom Chung vi Michael Freeling Dr. C. T. Hess Christopher T. Hill E. Leonard Jossem William Kemperer V. Ramanathan...assumptions, problems, causes, and consequences. Scenario-Based Planning. Originally developed by Herman Kahn at the RAND Corporation in Santa...relation to policy and planning) was coined by Herman Kahn at the RAND Corporation in the 1950s as part of the strategic and military work he was

  7. Oxygen minimum seafloor ecological (mal) functioning

    Digital Repository Service at National Institute of Oceanography (India)

    Moodley, L.; Nigam, R.; Ingole, B.S.; PrakashBabu, C.; Panchang, R.; Nanajkar, M.; Sivadas, S.; van Breugel, P.; van Ijzerloo, L.; Rutgers, R.; Heip, C.H.R.; Soetaert, K.; Middelburg, J.J.

    preparation of experimental setups employed during this project. Thanks to Suzan Verdegaal (Faculty of Earth and Life Sciences, Vrije University, Amsterdam) for sediment bulk carbonate carbon isotope measurements. Peter Herman is acknowledged for valuable...., Matheson, H., McKenzie, R., 2009. Carbon and nitrogen elemental and stable isotopic compositions of surficial sediments from the Pakistan margin of the Arabian Sea. Deep Sea Research Part II, 56, 271-282. Dauwe, B., Middelburg, J.J., Herman, P.M.J., 2001...

  8. Determine the Role of Canonical Wnt Signaling in Ovarian Tumorigenesis

    Science.gov (United States)

    2015-12-01

    transcriptome at damaged telomeres. Nat Commun 5:5379. 46. Caslini C, Connelly JA, Serna A, Broccoli D, Hess JL (2009) MLL associates with telo- meres and... Herman JG, Graff JR, Vertino PM, Issa JP. Alterations in DNAmethylation: a fundamental aspect of neoplasia. Adv Cancer Res 1998;72:141–96. 34...1710–5. 28. Baylin SB, Herman JG, Graff JR, Vertino PM, Issa JP. Alterations in DNAmethylation: a fundamental aspect of neoplasia. Adv Cancer Res

  9. Sources, distribution and preservation of organic matter in a tropical estuary (Godavari, India)

    Digital Repository Service at National Institute of Oceanography (India)

    Krishna, M.S.; Naidu, S.A.; Subbaiah, Ch.V.; Gawade, L.; Sarma, V.V.S.S.; Reddy, N.P.C.

    to be relatively enriched up to 23‰ (Mariotti et al. 1984; Owens 1985; Cifuentes et al. 1988; Middelburg and Herman 2007) due to assimilation by estuarine phytoplankton of isotopically enriched residual ammonium resulted from nitrification or extensive algal... and Herman 2007) due to assimilation by freshwater phytoplankton of isotopically depleted inorganic C (Middelburg and Nieuwenhuize 1998; Bontes et al. 2006). Since the main aim of this study is the source apportionment of organic matter and to understand...

  10. Molecular Dynamics Analysis of Lysozyme Protein in Ethanol- Water Mixed Solvent

    Science.gov (United States)

    2012-01-01

    Hermans , 1981; Levitt & Warshel, 1975). The idea for molecular dynamic simulation was born out of the quest to solve and understand the following  To...GROMACS is the MD analysis code employed in the present work. Groningen machine for chemical simulations( GROMACS)(Lindahl, Hess , & Van Der Spoel...Physical Chemistry B, 106(14), 3668-3672. Berendsen, H., Postma, J., Van Gunsteren, W., & Hermans , J. (1981). Interaction models for water in

  11. Optical closure of apparent optical properties in coastal waters off Goa

    Digital Repository Service at National Institute of Oceanography (India)

    Talaulikar, M.; Suresh, T.; Desa, E.S.; Inamdar, A.

    . (2012). Empirical algorithm to estimate the average cosine of underwater light field at 490 nm. Remote sensing letters, 3(7), 585 – 593. Tzortziou, M., Herman, J. R., Gallegos, C. L., Neale, P. J., Subramaniam, A., Harding, L. W., & Ahmad, Z. (2006...). Bio-optics of the Chesapeake Bay from measurements and radiative transfer closure. Estuarine, Coastal and Shelf Science, 68(1-2), 348–362. Tzortziou, M., Subramaniam, A., Herman, J., Gallegos, C., Neale, P., Harding, L. (2007). Remote sensing...

  12. The Effects of Explosive Blast as Compared to Post-traumatic Stress Disorder on Brain Function and Structure

    Science.gov (United States)

    2013-04-01

    assessment (Gervais et al., 2008; Gervais, Ben-Porath, Wygant, & Green, 2009; Whitney, Davis, Shepard, & Herman , 2008; Wygant et al., 2010). Cut scores...TBI litigants tested for effort. The Clinical Neuropsychologist, 23, 1067–1084. Whitney, K. A., Davis, J. J., Shepard, P. H., & Herman , S. M. (2008...Veterans Research Institute (MVRI) to Nathaniel W. Nelson, PhD. References 1. McCrea M, Pliskin N, Barth J, Cox D, Fink J, French L, Hammeke T, Hess D

  13. Seasonal shift in net ecosystem production in a tropical estuary

    Digital Repository Service at National Institute of Oceanography (India)

    Ram, A.S.P.; Nair, S.; Chandramohan, D.

    the monsoon season. Low productivity due to high turbidity was reported in the Schelde estuary (Soetaert and Herman 1995). During sediment resuspension events in Lake Michigan, Cotner et al. (2000) found that primary produc- tivity was reduced due to high... heterotrophy at the land-sea interface. Estuar. Coast. Shelf Sci. 33: 223–257. SOETAERT, K., AND P. M. J. HERMAN. 1995. Nitrogen dynamics in the Westerschelde estuary (SW Netherlands) estimated by means of the ecosystem model MOSES. Hydrobiologia 311: 225...

  14. North American Clinical Trials Network (NACTN) for Treatment of Spinal Cord Injury: A Consortium of Military, Veterans Administration and Civilian Hospitals

    Science.gov (United States)

    2012-03-01

    Health Sci Ctr School of Public Health Division: Street 1: 1200 Herman Pressler St Street 2: RAS Bldg E803D City: Houston County: State: TX: Texas...Public Health Division: Street 1: 1200 Herman Presler Street 2: Data Management Center City: Houston County: State: TX: Texas Province: Country: USA...Anal Environ Epidemiology 8:231-252. Hoque A, Sigurdson AJ, Burau KD, Humphrey HB, Hess KR, Sweeney AM, 1998. Cancer among a Michigan cohort

  15. Arrival of the ATLAS solenoid from Japan

    CERN Document Server

    Patrice Loïez

    2001-01-01

    Photo 01: L. to r.: Photo 01: L. to r.: Herman ten Kate (Magnet Project Leader), Takahiko Kondo (KEK, Solenoid Project Leader), Peter Jenni (Spokesperson). Photo 02: (truck on the right side) with the LAr barrel calorimeter cryostat (also built in Japan) on the left side. From left to right are the following ATLAS people: Herman ten Kate (Magnet Project Leader), Marzio Nessi (Technical Coordinator), Takahiko Kondo (KEK, Solenoid Project Leader), Peter Jenni (Spokesperson)

  16. Stemcell Information: SKIP000867 [SKIP Stemcell Database[Archive

    Lifescience Database Archive (English)

    Full Text Available Jerome Mertens--Fred H. Gage Jiangsu Collaborative Innovation Center for Language Ability, Jiangsu Normal U...niversity--The Salk Institute for Biological Studies, Laboratory of Genetics Jiangsu Collaborative Innovatio...Biological Studies, Laboratory of Genetics Jiangsu Collaborative Innovation Center for Language Ability, Jia...ngsu Normal University--The Salk Institute for Biological Studies, Laboratory of Genetics Jiangsu Collaborat...nstitute for Biological Studies, Laboratory of Genetics Jun Yao--Fred H. Gage Jun Yao--Fred H. Gage Information Only Jiangsu Collabor

  17. Stemcell Information: SKIP000868 [SKIP Stemcell Database[Archive

    Lifescience Database Archive (English)

    Full Text Available Jerome Mertens--Fred H. Gage Jiangsu Collaborative Innovation Center for Language Ability, Jiangsu Normal U...niversity--The Salk Institute for Biological Studies, Laboratory of Genetics Jiangsu Collaborative Innovatio...Biological Studies, Laboratory of Genetics Jiangsu Collaborative Innovation Center for Language Ability, Jia...ngsu Normal University--The Salk Institute for Biological Studies, Laboratory of Genetics Jiangsu Collaborat...nstitute for Biological Studies, Laboratory of Genetics Jun Yao--Fred H. Gage Jun Yao--Fred H. Gage Information Only Jiangsu Collabor

  18. Stemcell Information: SKIP000866 [SKIP Stemcell Database[Archive

    Lifescience Database Archive (English)

    Full Text Available Jerome Mertens--Fred H. Gage Jiangsu Collaborative Innovation Center for Language Ability, Jiangsu Normal U...niversity--The Salk Institute for Biological Studies, Laboratory of Genetics Jiangsu Collaborative Innovatio...Biological Studies, Laboratory of Genetics Jiangsu Collaborative Innovation Center for Language Ability, Jia...ngsu Normal University--The Salk Institute for Biological Studies, Laboratory of Genetics Jiangsu Collaborat...nstitute for Biological Studies, Laboratory of Genetics Jun Yao--Fred H. Gage Jun Yao--Fred H. Gage Information Only Jiangsu Collabor

  19. Stemcell Information: SKIP000869 [SKIP Stemcell Database[Archive

    Lifescience Database Archive (English)

    Full Text Available Jerome Mertens--Fred H. Gage Jiangsu Collaborative Innovation Center for Language Ability, Jiangsu Normal U...niversity--The Salk Institute for Biological Studies, Laboratory of Genetics Jiangsu Collaborative Innovatio...Biological Studies, Laboratory of Genetics Jiangsu Collaborative Innovation Center for Language Ability, Jia...ngsu Normal University--The Salk Institute for Biological Studies, Laboratory of Genetics Jiangsu Collaborat...nstitute for Biological Studies, Laboratory of Genetics Jun Yao--Fred H. Gage Jun Yao--Fred H. Gage Information Only Jiangsu Collabor

  20. Meaning and Function of Military Experience

    Science.gov (United States)

    1986-07-01

    ARI Research Note 86-75 NMEANING AND FUNCTION OF MILITARY EXPERIENCE 0 Fred E. Fiedler Va’s University of Washington r*% YE for Contracting Officer’s...Military Experience Final Report March 83-May 85 6. PERFORMING ORG. REPORT NUMBER 7. AUT4OR(a) •. CONTRACT OR GRANT NUMBER(*) Fred E. Fiedler M DA 903-83...Contract #: MDA 903 83-M-3668 Principal Investigator: Fred E. Fiedler University of Washington Seattle, WA 98195 MEANING AND FUNCTION OF MILITARY

  1. The First 75 Years: History of Hydraulics Engineering at the Waterways Experiment Station

    Science.gov (United States)

    2004-01-01

    Rita Robison, "Taming the Red River," Civil Engineering 65 (1995) 6: 64-66. More detail is provided in C. Fred Pinkard , Jr., "Red River Waterway...Engineers. August 14-18, 1995 (New York: American Society of Civil Engineers, 1996), 31-35. 17. See C. Fred Pinkard , Jr. , "Red River Waterway: A...Works for Niagara Falls." In Transactions of the American Society of Civil Engineers 124 (1959): 336-51. Pinkard , C. Fred, Jr. "Red River Waterway

  2. Learning Organizations. Developing Cultures for Tomorrow's Workplace.

    Science.gov (United States)

    Chawla, Sarita, Ed.; Renesch, John, Ed.

    This anthology contains 32 essays: "Beginner's Mind" (Sarita Chawla);"Communities of Commitment: The Heart of Learning Organizations" (Fred Kofman, Peter Senge); "Managing the Dream" (Charles Handy); "Ahead of the Wave: Valuing Gender Perspective in Learning Cultures" (Marilynne Anderson); "Mastering…

  3. 77 FR 71741 - Guides for Advertising Allowances and Other Merchandising Payments and Services

    Science.gov (United States)

    2012-12-04

    ... CFR Part 240 Guides for Advertising Allowances and Other Merchandising Payments and Services AGENCY... Guides for Advertising Allowances and Other Merchandising Payments and Services (``the Fred Meyer Guides... make advertising and promotional allowances or services available to all competing customers...

  4. Tappev kuulsus viib Chicago lavale / Andres Laasik

    Index Scriptorium Estoniae

    Laasik, Andres, 1960-2016

    2003-01-01

    Muusikafilm "Chicago", mille aluseks John Kanderi - Fred Ebb'i muusikal : režissöör Rob Marshall : Ameerika Ühendriigid 2002. 1975.a. selle muusikali Broadwayl lavale toonud Bob Fosse mõjust filmi stiilile

  5. PÖFF-i publikulemmikud läbi aastate / Maria Ulfsak-Šeripova

    Index Scriptorium Estoniae

    Ulfsak-Šeripova, Maria, 1981-

    2011-01-01

    1998-2010: "Must kass, valge kass", "Kummituskoer: Samurai tee", "Tantsija pimeduses", "Amelie", "Räägi temaga", "Tõusuvesi", "Tühi maja", "Vibu", "Elsa ja Fred", "Külmutatud", "Maadleja", "Merehädaline kuul" ja "Tualett"

  6. Binge eating disorder

    Science.gov (United States)

    ... chap 37. Read More Anorexia Appetite - increased Bulimia Depression - overview Electrolytes Esophagitis Foreign object - inhaled or swallowed Gas - flatulence Hemorrhoids Pharyngitis - sore throat Review Date 2/2/2016 Updated by: Fred K. ...

  7. A Curious Case of Caveats and Causes

    DEFF Research Database (Denmark)

    Blyth, Mark

    2014-01-01

    Review symposium contribution. Banking Across Boundaries: Placing Finance in Capitalism / Brett Christophers. Wiley-Blackwell, Chichester, Sussex, 2013, 302 pages. Participants: Jamie Peck; Fred Block; Mark Blyth; Ewald Engelen; Brett Christophers....

  8. 43 CFR Appendix A to Part 10 - Sample Summary

    Science.gov (United States)

    2010-10-01

    ... of your Indian tribe's aboriginal territory. Please feel free to contact Fred Poe at (012) 345-6789..., relevant studies or other pertinent data for the purpose of determining the geographic origin,...

  9. Insomnia

    Science.gov (United States)

    ... Jankovic J, Mazziotta JC, Pomeroy SL, eds. Bradley's Neurology in Clinical Practice . 7th ed. Philadelphia, PA: Elsevier; ... 2/2016 Updated by: Fred K. Berger, MD, addiction and forensic psychiatrist, Scripps Memorial Hospital, La Jolla, ...

  10. Kolm raamistikku Mäetamme unenäole / Katrin Kivimaa

    Index Scriptorium Estoniae

    Kivimaa, Katrin, 1969-

    2007-01-01

    Marko Mäetamme teosest "Kaotaja paradiis" Veneetsia biennaalil 2007. aastal. Kuraator Mika Hannula. S. Freudi unenägude käsitlusest. Inglise kunstiajaloolane Fred Orton ameerika kunstniku Jasper Johnsi tööst "Lipp"

  11. Community-based Natural Resource Management of the Jozani ...

    African Journals Online (AJOL)

    ... and Fred Saunders. School of Life Sciences, Södertörn University, 141 89 Huddinge, Sweden. ... CBNRM projects have difficulty gaining traction unless they both address existing ..... mapping, focus groups, SWOT-analysis and problem ...

  12. PÖFF-i publikulemmikud läbi aastate / Maria Ulfsak-Šeripova

    Index Scriptorium Estoniae

    Ulfsak-Šeripova, Maria, 1981-

    2011-01-01

    1998-2010: "Must kass, valge kass", "Kummituskoer: Samurai tee", "Tantsija pimeduses", "Amelie", "Räägi temaga", "Tõusuvesi", "Tühi maja", "Vibu", "Elsa ja Fred", "Külmutatud", "Maadleja", "Merehädaline kuul" ja "Tualett"

  13. Reliability of Multiple Component Systems

    Science.gov (United States)

    1975-07-15

    Armament Command Rock Island, Illinois 61201 William S. Agee White Sands Missile Range White Sands, New Mexico 88002 Dr. Roger Brauer ...Diana L. Frederich Frankford Arsenal Philadelphia, Pennsylvania 19137 Dr. Fred Frishman USA Research Office Duiham, North Carolina 27706

  14. Uut ja vana Tänapäevalt / Krista Kumberg

    Index Scriptorium Estoniae

    Kumberg, Krista

    2003-01-01

    Kirjastuselt "Tänapäev" 2002. a. ilmunud eesti lastekirjandust: Arder, Ott. Metsapoolne : [luuletused]; Tanner, Oskar, pseud. Kati, päkapikk ja Prominent : [jutustus]; Salu, Kristel. Verdi ja Fred, ehk, Sullerite juhtumised : [jutustus

  15. Tappev kuulsus viib Chicago lavale / Andres Laasik

    Index Scriptorium Estoniae

    Laasik, Andres, 1960-2016

    2003-01-01

    Muusikafilm "Chicago", mille aluseks John Kanderi - Fred Ebb'i muusikal : režissöör Rob Marshall : Ameerika Ühendriigid 2002. 1975.a. selle muusikali Broadwayl lavale toonud Bob Fosse mõjust filmi stiilile

  16. Juridica; Bos, bouw en gemeenten

    NARCIS (Netherlands)

    Kistenkas, F.H.

    2011-01-01

    Bouwen in het bos van de ecologische hoofdstructuur. Geen probleem als niemand bezwaar maakt.... Uiteindelijk is de gemeente vergunningverlener aan zichzelf, is wetgever in eigen zaak en maakt voor zichzelf een lucratief bestemmingsplan. Aldus de analyse van wetskenner Fred Kistenkas

  17. Armastusfilmid Tartus / Margus Paju

    Index Scriptorium Estoniae

    Paju, Margus

    2007-01-01

    Pimedate Ööde filmifestivali ja Tartu linna eestvõttel toimuva Tartu vabaõhu filmifestivali "Tartuff - armastuse mitu nägu" filme ("Ükskord", "Harold ja Maude", "Veenus", "Elsa ja Fred", "Emma õnn")

  18. Hallucinations

    Science.gov (United States)

    ... or coming down from such drugs like marijuana , LSD , cocaine (including crack), PCP, amphetamines, heroin, ketamine, and ... 2/2016 Updated by: Fred K. Berger, MD, addiction and forensic psychiatrist, Scripps Memorial Hospital, La Jolla, ...

  19. Kolm raamistikku Mäetamme unenäole / Katrin Kivimaa

    Index Scriptorium Estoniae

    Kivimaa, Katrin, 1969-

    2007-01-01

    Marko Mäetamme teosest "Kaotaja paradiis" Veneetsia biennaalil 2007. aastal. Kuraator Mika Hannula. S. Freudi unenägude käsitlusest. Inglise kunstiajaloolane Fred Orton ameerika kunstniku Jasper Johnsi tööst "Lipp"

  20. DEVELOPING A TOOL FOR ENVIRONMENTALLY PREFERABLE PURCHASING

    Science.gov (United States)

    LCA-based guidance was developed by EPA under the Framework for Responsible Environmental Decision Making (FRED) effort to demonstrate how to conduct a relative comparison between product types to determine environmental preferability. It identifies data collection needs and iss...

  1. Kirken og afvigerne

    DEFF Research Database (Denmark)

    Lausten, Martin Schwarz

    2006-01-01

    Anklagerne modTycho Brahe af religiøs art ses på baggrund af reformationskongerne Chr.d.3.´s og Fred. d. 2.´s strenge lutherske linje overfor afvigere.......Anklagerne modTycho Brahe af religiøs art ses på baggrund af reformationskongerne Chr.d.3.´s og Fred. d. 2.´s strenge lutherske linje overfor afvigere....

  2. NLO 󈨞. Nonlinear Optics: Materials, Phenomena and Devices Digest. Internation Meeting on Nonlinear Optics (1st) Held in Kauai, Hawaii on 16-20 July 1990

    Science.gov (United States)

    1991-03-13

    endearing personal traits that need not be recounted for those who knew him, Fred became known as Captain Chaos. Throughout this time Fred was...listening to. He was stimulating and thought provoking. One colleague recounts the following. "I fondly remember sitting on a cactus and quickly assuming an...150 pum thick glass platelet positioned directly ih front of the sample. The platelet was rotated to provide a variable phase shift between the two

  3. 1月艺事

    Institute of Scientific and Technical Information of China (English)

    2013-01-01

    01比利时艺术家Fred Eerdekens上海个展时间:2012年12月8日至2013年1月26日地点:上海Magda Danysz画廊比利时艺术家Fred Eerdekens以雕塑和装置作品闻名于世。他运用金属、纸张甚至是合成的云朵制造出创意光

  4. Stemcell Information: SKIP000872 [SKIP Stemcell Database[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Jerome Mertens--Fred H. Gage Jerome Mertens--Fred H. Gage Jiangsu Collaborative Innovation Center for Lang...s, Laboratory of Genetics Jiangsu Collaborative Innovation Center for Language Ability, Jiangsu Normal Unive...rsity--The Salk Institute for Biological Studies, Laboratory of Genetics Jiangsu Collaborative Innovation Ce...ogical Studies, Laboratory of Genetics Jiangsu Collaborative Innovation Center for Language Ability, Jiangsu

  5. Stemcell Information: SKIP000870 [SKIP Stemcell Database[Archive

    Lifescience Database Archive (English)

    Full Text Available RT-PCR Yes qRT-PCR ... Yes ... Yes RT-PCR ... Jerome Mertens--Fred H. Gage Jerome Mertens--Fred H. Gage Jiangsu Collabor...ity--The Salk Institute for Biological Studies, Laboratory of Genetics Jiangsu Collaborative Innovation Cent...er for Language Ability, Jiangsu Normal University--The Salk Institute for Biological Studies, Laboratory of Genetics Jiangsu Collabo...ormal University--The Salk Institute for Biological Studies, Laboratory of Genetics Jiangsu Collaborative In

  6. Stemcell Information: SKIP000873 [SKIP Stemcell Database[Archive

    Lifescience Database Archive (English)

    Full Text Available ing, RT-PCR Yes qRT-PCR ... Yes ... Yes RT-PCR ... Jerome Mertens--Fred H. Gage Jerome Mertens--Fred H. Gage Jiangsu Collabor...iversity--The Salk Institute for Biological Studies, Laboratory of Genetics Jiangsu Collaborative Innovation...ry of Genetics Jiangsu Collaborative Innovation Center for Language Ability, Jian...gsu Normal University--The Salk Institute for Biological Studies, Laboratory of Genetics Jiangsu Collaborati

  7. Stemcell Information: SKIP000871 [SKIP Stemcell Database[Archive

    Lifescience Database Archive (English)

    Full Text Available ens--Fred H. Gage Jerome Mertens--Fred H. Gage Jiangsu Collaborative Innovation C...lk Institute for Biological Studies, Laboratory of Genetics Jiangsu Collaborative...s, Laboratory of Genetics Jiangsu Collaborative Innovation Center for Language Ability, Jiangsu Normal Unive... of Genetics Jiangsu Collaborative Innovation Center for Language Ability, Jiangsu Normal University--The Sa...enter for Language Ability, Jiangsu Normal University--The Salk Institute for Biological Studies, Laboratory

  8. Defending Against LDoS Attacks Using Fair AQM

    Directory of Open Access Journals (Sweden)

    Bianqin Wang

    2011-12-01

    Full Text Available According to the instant high rate and high intensity of LDoS attacks, this paper explores using fair queue management mechanism to mitigate their effect. We perform simulation experiments to evaluate the performance of fair AQM FRED and CHOKe under LDoS attacks. The simulation results show that they are able to reduce the impact of the attacks in various degrees. FRED outperforms CHOKe in throttling the attacks, but it is slightly inferior to CHOKe in time performance.

  9. Attribution of Base Civil Engineering Leadership by Wing and Base Commanders

    Science.gov (United States)

    1984-09-01

    1983. 7. Fiedler , Fred E. "Leadership Effectiveness," American Behavioral Scientist, 24: 619-632 (May/June 1981). 8. Fleishman, E. A. "Twenty Years of...factors in moderating leadership behavior has been studied by several other researchers.i Fiedler (7:624) notes that situational control, expressed... Fred Gibson, (512)650-5811. FOR THE COMMANDER . Maj, USAF 1 Atch Ac ing Chief, seearch & Revised Questionnaire Measuremen Division cc: lLt Jerry P

  10. RF Breakdown Prevention in Spacecraft Components Product Overview

    Science.gov (United States)

    2014-05-08

    harris.com James Farrell Boeing james.t.farrell@boeing.com Tracy Fiedler Raytheon tracy.m.fiedler@raytheon.com Brad Fields Orbital fields.brad@orbital.com...avnet.com Fred Schipp MDA - Navy frederick.schipp@navy.mil Jim Schultz Boeing james.w.schultz@boeing.com Gerald Schumann NASA gerald.d.schumann...Grumman william.toth@ngc.com Ghislain Turgeon SSL ghislain.turgeon@sslmda.com Deborah Valley MIT deborah.valley@ll.mit.edu Fred Van Milligen JDSU

  11. Army Communicator. Volume 31, Number 2, Spring 2006

    Science.gov (United States)

    2006-01-01

    see Army Commu- nicator article titled HF Combat Net Radio Lesson Learned Again, by David M. Fiedler , Spring 2004). Integrating more communications...year- round,” said Drew. According to Fred Porzio, project leader for this effort with PM DCATS’ Product Manager, Defense Wide Transmission Systems, the...Army Communicator 49 singling out Fred Porzio, the project lead for PM DWTS; Greg Parks, who designed the system for prime contractor Eaton/Powerware

  12. 2005 Tri-Service Infrastructure Systems Conference and Exhibition. Volume 1, Track 1

    Science.gov (United States)

    2005-08-04

    for FEMA Map Moderniation Program , by John Hunter Flood Fighting Structures Demonstration and Evaluation Program (FFSD), by Fred Pinkard Integrating...Eddie Brauer Bank Erosion and Morphology of the Kaskaskia River, by Michael T. Rodgers Degradation of the Kansas City Reach of the Missouri River, by...Harris SEEP2D & GMS: Simple Tools for Solving a Variety of Seepage Problems, by Clarissa Hansen, Fred Tracy, Eileen Glynn, Cary Talbot and Earl Edris

  13. 2005 Tri-Service Infrastructure Systems Conference and Exhibition. Volume 10, Track 12

    Science.gov (United States)

    2005-08-04

    for FEMA Map Moderniation Program , by John Hunter Flood Fighting Structures Demonstration and Evaluation Program (FFSD), by Fred Pinkard Integrating...Eddie Brauer Bank Erosion and Morphology of the Kaskaskia River, by Michael T. Rodgers Degradation of the Kansas City Reach of the Missouri River, by...Harris SEEP2D & GMS: Simple Tools for Solving a Variety of Seepage Problems, by Clarissa Hansen, Fred Tracy, Eileen Glynn, Cary Talbot and Earl Edris

  14. NDI (Nondestructive Inspection) Oriented Corrosion Control for Army Aircraft. Phase 1. Inspection Methods

    Science.gov (United States)

    1989-07-01

    Classification System" by Robert Summitt and Fred T. Fink, August 1980, and publication AFWAL-TR-86-4074, "Corrosion Maintenance and Experimental Design" by Robert...effort, and Fred H. Meyer of the Air Force Wright Aeronautical Laboratories Materials Laboratory. Based on a consideration of existing literature on...the program manager was Dr. Daniel Henry and the principal investigator was Mr. Douglas C. Brauer . Dr. Frank A. Iddings was SwRI’s tecnnical monitor

  15. 2005 Tri-Service Infrastructure Systems Conference and Exhibition. Volume 3, Track 3

    Science.gov (United States)

    2005-08-04

    FEMA Map Moderniation Program , by John Hunter Flood Fighting Structures Demonstration and Evaluation Program (FFSD), by Fred Pinkard Integrating... Brauer Bank Erosion and Morphology of the Kaskaskia River, by Michael T. Rodgers Degradation of the Kansas City Reach of the Missouri River, by Alan...Harris SEEP2D & GMS: Simple Tools for Solving a Variety of Seepage Problems, by Clarissa Hansen, Fred Tracy, Eileen Glynn, Cary Talbot and Earl Edris

  16. 2005 Tri-Service Infrastructure Systems Conference and Exhibition. Volume 2, Track 2

    Science.gov (United States)

    2005-08-04

    for FEMA Map Moderniation Program , by John Hunter Flood Fighting Structures Demonstration and Evaluation Program (FFSD), by Fred Pinkard Integrating...Eddie Brauer Bank Erosion and Morphology of the Kaskaskia River, by Michael T. Rodgers Degradation of the Kansas City Reach of the Missouri River, by...Harris SEEP2D & GMS: Simple Tools for Solving a Variety of Seepage Problems, by Clarissa Hansen, Fred Tracy, Eileen Glynn, Cary Talbot and Earl Edris

  17. 2005 Tri-Service Infrastructure Systems Conference and Exhibition. Volume 7, Tracks 7 and 8

    Science.gov (United States)

    2005-08-04

    FEMA Map Moderniation Program , by John Hunter Flood Fighting Structures Demonstration and Evaluation Program (FFSD), by Fred Pinkard Integrating... Brauer Bank Erosion and Morphology of the Kaskaskia River, by Michael T. Rodgers Degradation of the Kansas City Reach of the Missouri River, by Alan...Harris SEEP2D & GMS: Simple Tools for Solving a Variety of Seepage Problems, by Clarissa Hansen, Fred Tracy, Eileen Glynn, Cary Talbot and Earl Edris

  18. United States Air Force Summer Faculty Research Program (1986). Program Technical Report. Volume 2

    Science.gov (United States)

    1986-12-01

    and Lt. Col. Michael Lacev for involving me in the TCS project. Fred Rexroad has been very heloful with showing me how to use the various computer...1979) Glover, Fred , Randy Glover and Darwin Klingman, "Computational Study of an Improved Shortest Path Algorithm," Networks, Vol. 14, pp. 25-36, (1984...Western States," Western Association of State Highways and Transportation Officials, May (1984). 9. Brauer , Michael G., "An Evaluation of the Shell

  19. 2005 Tri-Service Infrastructure Systems Conference and Exhibition. Volume 6, Track 6

    Science.gov (United States)

    2005-08-04

    for FEMA Map Moderniation Program , by John Hunter Flood Fighting Structures Demonstration and Evaluation Program (FFSD), by Fred Pinkard Integrating...Eddie Brauer Bank Erosion and Morphology of the Kaskaskia River, by Michael T. Rodgers Degradation of the Kansas City Reach of the Missouri River, by...Harris SEEP2D & GMS: Simple Tools for Solving a Variety of Seepage Problems, by Clarissa Hansen, Fred Tracy, Eileen Glynn, Cary Talbot and Earl Edris

  20. Is the Department of State Accountability Review Board Process adequate

    Science.gov (United States)

    2017-05-25

    Advanced Military Studies James C. Markert, COL Accepted this 25th day of May 2017 by: ___________________________________, Director, Graduate...https:diplopundit.net/tag/arb/page/3/; Fred Burton and Scott Stewart , “Threats and Accountability,” Stratfor Security Weekly, August 8, 2013, accessed October 20...lesson/. 57 Fred Burton and Scott Stewart , “Counterterrorism Funding: Old Fears and Cyclical Lulls,” Stratfor Security Weekly, March 18, 2009, accessed

  1. Treatment of Intracranial Aneurysms with Flow Re-direction Endoluminal Device - A Single Centre Experience with Short-term Follow-up Results

    Science.gov (United States)

    Chong, Wing Ho; Lam, Samuel Siu Kei; Siu, Jimmy Chi Wai; Tan, Chong Boon; Wong, Yiu Chung

    2017-01-01

    Purpose A flow diverter (FD) is an effective treatment option for intracranial aneurysms. The Flow Re-direction Endoluminal Device (FRED) is a relatively new flow diverter with a unique dual-layer design. We report our experience and short-term results with the FRED. Materials and Methods We did a retrospective review of all consecutive cases in which the FRED was used to treat intracranial aneurysms at a single institution from March 2014 till December 2015. Clinical parameters, aneurysm characteristics, technical results and short-term outcomes were reviewed. Results Eleven intracranial aneurysms were treated with the FRED in 11 patients. The technical device deployment success rate was 100%. Immediate reduction in intra-aneurysmal flow after deployment was noted in 10 cases. The aneurysm occlusion rate at 6 months was 75%. There was 1 complication of in-stent thrombosis immediately after deployment. There was no side branch occlusion, delayed aneurysm rupture, stroke, or intraparenchymal haemorrhage. There was no neurological deficit, morbidity, or mortality. Conclusion The FRED is a new FD. It has shown to be safe and effective in our series. The unique dual-layer design of the device renders it to have technical advantages over other FDs. The 6-month aneurysm occlusion rate and complication profile of FRED are similar to other FDs. PMID:28316865

  2. Intrinsic viscosities of polyelectrolytes: determination and modeling of the effects of extra salt.

    Science.gov (United States)

    Eich, Andreas; Wolf, Bernhard A

    2011-10-24

    Based on early measurements of J. J. Hermans and co-workers (D. T. F. Pals, J. J. Hermans, Recl. Trav. Chim. Pays-Bas 1952, 71, 513-520; D. T. F. Pals, J. J. Hermans, J. Polym. Sci. 1950, 5, 733-734; D. T. F. Pals, J. J. Hermans, J. Polym. Sci. 1948, 3, 897-898), the present contribution demonstrates how primary data should be evaluated in order to obtain reliable intrinsic viscosities. This procedure yields detailed information on the changes of the intrinsic viscosities and of the corresponding viscometric interaction parameters caused by an increasing salinity of water. Both quantities decline from a maximum value in the pure solvent to a minimum value, which is approached in the limit of sufficiently high salt concentrations, and can be modeled quantitatively by means of a Boltzmann sigmoid. Particular attention is paid to the significance of results obtained by means of the method of isoionic dilution, proposed by J. J. Hermans and co-workers. Copyright © 2011 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  3. Stress Potentiates Early and Attenuates Late Stages of Visual Processing

    Science.gov (United States)

    2011-01-19

    A.J.S.). We thank K. Berling, S. Blume, D. Cole, I. Dolski, L. Friedman, J. Koger, J. Nichols, and A. Teche for assistance; and A. Fox, A. Heller , J...monkey. J Neurosci 9:81–93. Qin S, Hermans EJ, van Marle HJ, Luo J, Fernández G (2009) Acute psycho- logical stress reduces working memory-related...Neurosci 11:843– 850. van Marle HJ, Hermans EJ, Qin S, Fernández G (2009) From specificity to sensitivity: how acute stress affects amygdala processing of

  4. Analyse og relevans

    DEFF Research Database (Denmark)

    Lützen, Peter Heller

    Undervisningsbog i litterær tekstanalyse til dansk i professions- og gymnasiale ungdomsuddannelser. Værket tager udgangspunkt i eksempelteksterne: "Irene Holm" af Herman Bang, "Vesterbro" af Johannes Jørgensen, "Vesterbrogade" af Emil Bønnelycke og "Livet i Istedgade" af Dan Turèll.......Undervisningsbog i litterær tekstanalyse til dansk i professions- og gymnasiale ungdomsuddannelser. Værket tager udgangspunkt i eksempelteksterne: "Irene Holm" af Herman Bang, "Vesterbro" af Johannes Jørgensen, "Vesterbrogade" af Emil Bønnelycke og "Livet i Istedgade" af Dan Turèll....

  5. Development of Novel Technetium-99m-Labeled Steroids as Estrogen-Responsive Breast Cancer Imaging Agents

    Science.gov (United States)

    2007-06-01

    Herman , L. W.; Hanson, R. N. Synthesis and estrogen receptor binding of (17alpha,20E)- and (17alpha,20Z)-21-phenylthio- and 21-phenylseleno-19-norpregna...1,3,5(10),20- tetraene-3,17beta-diols. Steroids 1996, 61, 384-389. 18. Hanson, R. N.; Herman , L. W.; Fiaschi, R.; Napolitano, E. Stereochemical...Soc., Dalton Trans: Inorg. Chem. 1994, 3545- 52. 11. (a) Schubert, U. S.; Eschbaumer, C.; Heller , M. Org. Lett. 2000, 2, 3373-3376. (b

  6. The Mechanism of the Reaction CH(+4) + CH4 = CH(+5) + CH3 as a Function of Energy: Rate Constants and Product Distributions for the Reactions of CH(+4) + CD4 and CD(+4) + CH4 at 80 and 300K

    Science.gov (United States)

    1989-01-01

    OF CII + CD, AND CD* + CI AT KO AND 300 K 12. PERSONAL AUTHOR(S) Micheal Henchman, David Smith, Nigel G. Adams, John F. Paulson, Zdnek Herman * 13a...For a summary, see Z. Herman and I. Koyano, J. Chem. Soc.. Faraday Trans. 2. 83 (1987) 127. 8 C.E. Klots, in P. Ausloos (Ed.), Kinetics of Ion...Henchman and J.F. Paulson. Radiat. Phys. Chem.. 32 (1988) 417: P.M. Hierl, A.F. Ahrens, M.J. Henchman, A.A. Viggiano and J.F. Paulson. Faraday Discuss

  7. Electroacoustic Tissue Imaging

    Science.gov (United States)

    2007-03-01

    cm−3 ◦C−1), I is the ultrasound intensity in W cm−2 and t is the application time (15 µs) (Herman and Harris 2002). The maximum intensity can be...elastic properties of tissue—a review Ultrasound Med. Biol. 22 959–77 Herman B A and Harris G R 2002 Models and regulatory considerations for... Alpert Medical School, Brown University, Providence, RI, USA, 02912 A Fresnel-Kirchhoff integral can be used to calculate x-ray phase contrast images

  8. Uncooled Infrared Microbolometers and Silicon Germanium Oxide (SixGe1-xOy) Infrared Sensitive Material for Long Wavelength Detection

    Science.gov (United States)

    2014-10-10

    120 Micro IR camera: operational performance," Proc. SPIE, vol. 4393, pp. 89-98, 2001. [12] C. Li, C. J. Han, G. D. Skidmore, and C. Hess , "DRS...1996. [49] S. Sedky, P. Fiorini, K. Baert, L. Hermans , and R. Mertens, "Characterization and optimization of infrared poly SiGe bolometers," IEEE...Transaction on Electron Devices, vol. 46(4), pp. 675-682, 1999. [50] S. Sedky, P. Fiorini, M. Caymax, C. Baert, L. Hermans , and R. Mertens

  9. Atmospheric deposition and surface stratification as controls of contrasting chlorophyll abundance in the North Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Patra, P.K.; DileepKumar, M.; Mahowald, N.; Sarma, V.V.S.S.

    . The absorbing aerosol index (AAI) [Herman et al., 1997], representing the column abundance of dust, smoke etc., is obtained from the Earth Probe/Total Ozone Mapping Spectrometer (EP/TOMS) as monthly means (source: http://toms.gsfc.nasa.gov, version 8, positive.... Subramaniam, I. Fung (2004), Estimates of soluble iron from observations and a global mineral aerosol model: Biogeochemical implications., J. Geophys. Res., 109(D17), D17205. Herman, J. R., P. K. Bhartia, O. Torres, C. Hsu, C. Seftor, and E. Celarier (1997...

  10. Chemotherapeutic Targeting of Fibulin-5 to Suppress Breast Cancer Invasion and Metastasis Stimulated by Transforming Growth Factor-Beta

    Science.gov (United States)

    2012-10-22

    lung cancer invasion, metastasis, and prognosis. Lung Cancer 2002;36:115–124. [PubMed: 11955645] 107. Graff JR, Greenberg VE, Herman JG, et al...2002;62:4478–4483. [PubMed: 12154058] 21. Payne SL, Fogelgren B, Hess AR, et al. Lysyl oxidase regulates breast cancer cell migration and adhesion...methylation in human carcinomas. Proc Natl Acad Sci USA. 1995;92(16):7416–9. 224. Herman JG, Baylin SB. Gene silencing in cancer in association with

  11. AcEST: DK958409 [AcEST

    Lifescience Database Archive (English)

    Full Text Available .9) Link to BlastX Result : Swiss-Prot sp_hit_id Q99KG7 Definition sp|Q99KG7|HPS4_MOUSE Hermansky-Pudlak syn...............done Score E Sequences producing significant alignments: (bits) Value sp|Q99KG7|HPS4_MOUSE Herman..... 30 7.7 sp|P32323|AGA1_YEAST A-agglutinin anchorage subunit OS=Saccharom... 30 7.7 >sp|Q99KG7|HPS4_MOUSE Herman

  12. United States Air Force F-35A Operational Basing Environmental Impact Statement. Appendix E: Final EIS Public Comments and Responses

    Science.gov (United States)

    2013-09-01

    Westchazy NY R-PCS-7786 Herman Brown Grand Isle VT R-PCS-6534 Gail Merlo Westford VT R-PCS-7946 Rollin Brown South Burlington VT R-PCS-6535 Charles Merlo...PCS-4720 Charles Utter St. George VT R-PCS-7692 Elihu Herd Essex Junction VT R-PCS-5592 Rollande Utter Colchester VT R-PCS-9469 Christopher Herman ...PCS-1975 Robert Vallie Williston VT R-PCS-8358 Peter Hess Essex VT R-PCS-1813 Jeremiah Vallieres Colchester VT R-PCS-2512 Geoffrey Hesslink Shelburne

  13. Limno-tolerant bacteria govern nitrate concentration in Mandovi estuary, India

    Digital Repository Service at National Institute of Oceanography (India)

    Divya, B.; Fernandes, S.O.; Sheelu, G.; Nair, S.; LokaBharathi, P.A.; Chandramohan, D.

    turbidity during the monsoon as reported for Schelde estuary (Soetaert and Herman, 1995). However, the nitrate and nitrite concentrations in these waters are generally high due to enrichment caused by the discharge from extraneous sources like the iron ore...–3622. Soetaert, K., Herman, P.M.J.,1995. Nitrogen dynamics in the Westerschedule estuary (SW Netherlands) estimated by means of the ecosystem model MOSES. Hydrobiologia 311, 225–246. Strickland, J.D.H., Parsons, T.R., 1968. A Practical Handbook of Sea Water...

  14. Seasonal dimethylsulfoniopropionate (DMSP) variability in Dona Paula Bay

    Digital Repository Service at National Institute of Oceanography (India)

    Kumar, S.S.; Chinchkar, U.; Nair, S.; LokaBharathi, P.A.; Chandramohan, D.

    turbidity during the monsoon as reported for Schelde estuary (Soetaert and Herman, 1995). However, the nitrate and nitrite concentrations in these waters are generally high due to enrichment caused by the discharge from extraneous sources like the iron ore...–3622. Soetaert, K., Herman, P.M.J.,1995. Nitrogen dynamics in the Westerschedule estuary (SW Netherlands) estimated by means of the ecosystem model MOSES. Hydrobiologia 311, 225–246. Strickland, J.D.H., Parsons, T.R., 1968. A Practical Handbook of Sea Water...

  15. Dissecting the Molecular Mechanism of RhoC GTPase Expression in the Normal and Malignant Breast

    Science.gov (United States)

    2010-09-01

    Diversity of TMPRSS2–ERG fusion transcripts in the human prostate, Oncogene 26 (2007) 2667–2673. [138] K.G. Hermans , R. van Marion, H. van Dekken, G. Jenster... Hermans , A.A. Bressers, H.A. van der Korput, N.F. Dits, G. Jenster, J. Trapman, Two unique novel prostate-specific and androgen-regulated fusion partners of...T.A.Milne,M.E. Martin, H.W. Brock, R.K. Slany, J.L. Hess , LeukemogenicMLL fusion proteins bind across a broad region of the Hox a9 locus, promoting

  16. Targeting Histone Abnormality in Triple-Negative Breast Cancer

    Science.gov (United States)

    2015-08-01

    Altomonte V, Huelskamp AM, Hess A, and Davidson NE. Phase I trial of interferon-gamma to potentiate cyclosporine A-induced graft-versus-host disease in...human breast cancer cells by an unsymmetrically alkylated polyamine analogue. Cancer Res. 55:3233-6, 1995. PMID 7614453 58. Herman JG, Merlo A, Mao L...methylation in all common human cancers. Cancer Res.55:4525-30, 1995. PMID 7553621 59. Graff JR, Herman JG, Lapidus RG, Chopra H, Xu R, Jarrard DF

  17. Preclinical Studies of Signaling Pathways in a Mutant Mouse Model of Hormone-Refractory Prostate Cancer

    Science.gov (United States)

    2011-02-01

    Boormans JL, Hermans KG, van Leenders GJ, Trapman J, Verhagen PC. 2008. An activating mutation in AKT1 in human prostate cancer. Int J Cancer 123...p110b in cell growth, metabolism and tumorigenesis. Nature 454: 776–779. Jia L, Landan G, Pomerantz M, Jaschek R, Herman P, Reich D, Yan C, Khalid O...stable blood-based markers for cancer detection. Proc Natl Acad Sci 105: 10513–10518. Montgomery RB, Mostaghel EA, Vessella R, Hess DL, Kalhorn TF, Higano

  18. BATTLE (Biomarker-based Approach of Targeted Therapy for Lung Cancer Elimination)

    Science.gov (United States)

    2012-04-01

    non-small cell lung cancers. Clin. Cancer Res. 1995; 1: 687–90. 56 Merlo A, Herman JG, Mao L et al. 5′CpG island methylation is associated with...Cancer Res 2006;66:2391–402. 37. Clark C, Shah S, Herman -Ferdinandez L, Ekshyyan O, Abreo F, Rong X, et al. Teasing out the best molecular marker in...using classification and regres- sion tree analysis. J Clin Oncol 2005;23:4322–9. 24. Hess KR, Abbruzzese MC, Lenzi R, Raber MN, Abbruzzese JL

  19. Pathological Fingerprints, Systems Biology and Biomarkers of Blast Brain Injury

    Science.gov (United States)

    2010-06-01

    895–920. King, N.S. (2008). PTSD and traumatic brain injury: folklore and fact? Brain Inj. 22, 1–5. Kleindienst, A., Hesse , F., Bullock, M.R., and...to traumatic brain injury in nonhuman primates. J. Trauma 62, 199–206. Vinores, S.A., Herman , M.M., Rubinstein, L.J., and Marangos, P.J. (1984...trauma in children. Neurology. 2009;72:609–616. 23. Vinores SA, Herman MM, Rubinstein LJ, Marangos PJ. Electron mi- croscopic localization of neuron

  20. Exploring Alkaline Stable Organic Cations for Polymer Hydroxide Exchange Membranes

    Science.gov (United States)

    2015-04-29

    2012, 219, 272- 279. [82] C. Chen, A. R. Hess , A. R. Jones, X. Liu, G. D. Barber, T. E. Mallouk, H. R. Allcock, Macromolecules 2012, 45, 1182-1189... Herman , J. R. Varcoe, Energy & Environmental Science 2012, 5, 8584-8597. [176] M. A. Hossain, Y. Lim, S. Lee, H. Jang, S. Choi, Y. Jeon, S. Lee, H. Ju, W...Catalysis a-Chemical 2007, 270, 123-126. [241] H. Herman , R. C. T. Slade, J. R. Varcoe, Journal of Membrane Science 2003, 218, 147-163. [242] G. G

  1. AcEST: DK959896 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ... 116 1e-25 sp|P19158|IRA2_YEAST Inhibitory regulator protein IRA2 OS=Saccha... 33 0.93 sp|Q9VHN9|HPS5_DROME Herman...sky-Pudlak syndrome 5 protein homolog... 32 2.1 sp|Q297N8|HPS5_DROPS Herman...bjct: 2776 RHPIIFEGALLFVSNCIRRLYMAQFENESETSLISTLLKGRKFAHTFLS 2824 >sp|Q9VHN9|HPS5_DROME Hermansky-Pudlak syn...L K Sbjct: 668 CQYHELGAVLLRYFWSRGEQLKCFDVVQSVPALLDVLAKFYLAEQNLTK 716 >sp|Q297N8|HPS5_DROPS Hermansky-Pudlak

  2. Distribution and sources of particulate organic matter in the Indian monsoonal estuaries during monsoon

    Digital Repository Service at National Institute of Oceanography (India)

    Sarma, V.V.S.S.; Krishna, M.S.; Prasad, V.R.; Kumar, B.S.K.; Naidu, S.A.; Rao, G.D.; Viswanadham, R.; Sridevi, T.; Kumar, P.P.; Reddy, N.P.C.

    and Herman 2007]. In addition to this, δ13C of dissolved inorganic carbon (DIC) of the freshwater end member for all Indian estuaries varied between -4.8 and -7.3‰ (mean of -6.7±0.8‰) (our unpublished data), except in Narmada and Mahisagar, suggesting... versa suggesting that turbidity is the major controlling factor for growth of phytoplankton than nutrients. The concentrations of SPM in the Indian estuaries were similar to those found in the European estuaries [Middelburg and Herman, 2007]. 3...

  3. Democratization of Nanoscale Imaging and Sensing Tools Using Photonics

    Science.gov (United States)

    2015-06-12

    Galarreta, B. C.; Huang, M.; Herman , D.; Ozcan, A.; Altug, H. Light Sci. Appl. 2014, 3, e122 (ref 105). Copyright 2014 Nature Publishing Group. Panel (g...Bonifacino, J. S.; Davidson, M. W.; Lippincott-Schwartz, J.; Hess , H. F. Science 2006, 313, 1642−1645. (22) Rust, M. J.; Bates, M.; Zhuang, X. Nat...B. C.; Huang, M.; Herman , D.; Ozcan, A.; Altug, H. Light Sci. Appl. 2014, 3, No. e122. (106) Coskun, A. F.; Cetin, A. E.; Galarreta, B. C.; Alvarez

  4. Rearming for the Cold War, 1945-1960 (History of Acquisition in the Department of Defense. Volume 1)

    Science.gov (United States)

    2012-01-01

    quotation), copy in NDU Library; interview of Wilfred J. McNeil by Jerry N. Hess , 19 September 1972, New York, N.Y., 2-7 (sees. 1-17, McNeil quotation sec...Forces, Fort Lesley J. McNair, Washington, D.C., 29 January 248 REARMING FOR THE COLD WAR 1947, 1, NDU Library. 7. Herman S. Wölk, The Struggle...Schlight, "Elwood R. Quesada: Tac Air Comes of Age," in Makers of the United States Air Force, ed. John L. Frisbee, 199-203. 196. Herman S. Wölk

  5. Targeting Histone Abnormality in Triple Negative Breast Cancer

    Science.gov (United States)

    2016-08-01

    Vogelsang GB, Jones RJ, Farmer ER, Altomonte V, Huelskamp AM, Hess A, and Davidson NE. Phase I trial of interferon-gamma to potentiate cyclosporine A...polyamine analogue. Cancer Res. 55:3233-6, 1995. PMID 7614453 58. Herman JG, Merlo A, Mao L, Lapidus RG, Issa J-P J, Davidson NE, Sidransky D and...4525-30, 1995. PMID 7553621 59. Graff JR, Herman JG, Lapidus RG, Chopra H, Xu R, Jarrard DF, Isaacs WB, Pitha PM, Davidson NE and Baylin SB. E

  6. BESCT (Biology, Education, Screening, Chemoprevention and Treatment) Program

    Science.gov (United States)

    2010-10-01

    Qian T, Trost LC, Elmore SP, Nishimura Y, Crowe RA, Cascio WE, Bradham CA, Brenner DA and Herman B. (1998). Biochim. Biophys. Acta., 1366, 177–196...82. 46. Qiu RG, Chen J, Kirn D, McCormick F, Symons M. An essential role for Rac in Ras transformation. Nature 1995;374:457^9. 47. Hess P, Pihan G...by Herman et al. (15). Briefly, DNA was denatured with 2 M NaOH, followed by treatment with 10 mM hydroqui- none and 3 M sodium bisulfite (Sigma

  7. Benthic macroinvertebrate community structure and distribution in the Ayeyarwady continental shelf, Andaman Sea

    Digital Repository Service at National Institute of Oceanography (India)

    Ansari Z.A.; Furtado, R.; Badesab, S.; Mehta, P.; Thwin, S.

    of the Ayeyarwady continental shelf, Andaman Sea. Mar. Geol., 216 ,(2005), 239-247. 5 Heip C, Basford D, Craeymeerch J A, Dewarumez J M, Dorjes J, Wilde P, de Duineveld G, Eleftheriou, A., Herman, P M J, Nierman U P, Kingston P, Kunitzer, A, Rachor E, Rumohr H..., Dorjes J, Duineveld, G C A, Eleftheriou A, Heip C, Herman P, Kingston P, Niermann U, Rachor E, Rumohr H & P.A.J. de Wilde,The benthic infauna of the Norh Sea. ICES J. Mar. Sci., 49 (1992) : 127-144. 16 Parulekar A H, Z.A. Ansari, Benthic macrofauna...

  8. Organic carbon mass accumulation rate regulates the flux of reduced substances from the sediments of deep lakes

    Science.gov (United States)

    Steinsberger, Thomas; Schmid, Martin; Wüest, Alfred; Schwefel, Robert; Wehrli, Bernhard; Müller, Beat

    2017-07-01

    The flux of reduced substances, such as methane and ammonium, from the sediment to the bottom water (Fred) is one of the major factors contributing to the consumption of oxygen in the hypolimnia of lakes and thus crucial for lake oxygen management. This study presents fluxes based on sediment porewater measurements from different water depths of five deep lakes of differing trophic states. In meso- to eutrophic lakes Fred was directly proportional to the total organic carbon mass accumulation rate (TOC-MAR) of the sediments. TOC-MAR and thus Fred in eutrophic lakes decreased systematically with increasing mean hypolimnion depth (zH), suggesting that high oxygen concentrations in the deep waters of lakes were essential for the extent of organic matter mineralization leaving a smaller fraction for anaerobic degradation and thus formation of reduced compounds. Consequently, Fred was low in the 310 m deep meso-eutrophic Lake Geneva, with high O2 concentrations in the hypolimnion. By contrast, seasonal anoxic conditions enhanced Fred in the deep basin of oligotrophic Lake Aegeri. As TOC-MAR and zH are based on more readily available data, these relationships allow estimating the areal O2 consumption rate by reduced compounds from the sediments where no direct flux measurements are available.

  9. Quantification and Negation in Event Semantics

    Directory of Open Access Journals (Sweden)

    Lucas Champollion

    2010-12-01

    Jager & Katrin Schulz (eds. ‘Logic, Language and Meaning’, Lecture Notes in Computer Science, vol. 6042, 274–283. Springer Berlin / Heidelberg.http://dx.doi.org/10.1007/978-3-642-14287-1_28Giannakidou, Anastasia. 2002. ‘UNTIL, aspect and negation: A novel argument for two untils’. In ‘Semantics and linguistic theory (SALT’, vol. 12, 84–103.Groenendijk, Jeroen & Stokhof, Martin. 1990. ‘Dynamic Montague grammar’. In Lászlo Kálman & Lászlo Polos (eds. ‘Papers from the Second Symposium on Logic and Language’, Budapest, Hungary: Akadémiai Kiadó.Heim, Irene & Kratzer, Angelika. 1998. Semantics in Generative Grammar. Oxford, UK: Blackwell Publishing.Hendriks, Herman. 1993. Studied flexibility. Ph.D. thesis, University of Amsterdam, Amsterdam, Netherlands.Jacobson, Pauline. 1999. ‘Towards a variable-free semantics’. Linguistics and Philosophy 117–184.http://dx.doi.org/10.1023/A:1005464228727Krifka, Manfred. 1989. ‘Nominal reference, temporal constitution and quantification in event semantics’. In Renate Bartsch, Johan van Benthem & P. van Emde Boas (eds. ‘Semantics and contextual expression’, 75–115. Dordrecht, Netherlands: Foris.Krifka, Manfred. 1998. ‘The origins of telicity’. In Susan Rothstein (ed. ‘Events and grammar’, 197–235. Dordrecht, Netherlands: Kluwer.Krifka, Manfred. 1999. ‘At Least Some Determiners Aren’t Determiners’. In K. Turner (ed. ‘The Semantics/Pragmatics Interface from Different Points of View’, 257–291. Amsterdam, Netherlands: Elsevier.Landman, Fred. 1996. ‘Plurality’. In Shalom Lappin (ed. ‘Handbook of Contemporary Semantics’, 425–457. Oxford, UK: Blackwell Publishing.Landman, Fred. 2000. Events and plurality: The Jerusalem lectures. Dordrecht, Netherlands: Kluwer.May, Robert. 1985. Logical form: Its structure and derivation. Cambridge, MA: MIT Press.Parsons, Terence. 1990. Events in the semantics of English. Cambridge, MA: MIT Press.Partee, Barbara H. 1973. ‘Some structural

  10. The cell adhesion molecules Echinoid and Friend of Echinoid coordinate cell adhesion and cell signaling to regulate the fidelity of ommatidial rotation in the Drosophila eye.

    Science.gov (United States)

    Fetting, Jennifer L; Spencer, Susan A; Wolff, Tanya

    2009-10-01

    Directed cellular movements are a universal feature of morphogenesis in multicellular organisms. Differential adhesion between the stationary and motile cells promotes these cellular movements to effect spatial patterning of cells. A prominent feature of Drosophila eye development is the 90 degrees rotational movement of the multicellular ommatidial precursors within a matrix of stationary cells. We demonstrate that the cell adhesion molecules Echinoid (Ed) and Friend of Echinoid (Fred) act throughout ommatidial rotation to modulate the degree of ommatidial precursor movement. We propose that differential levels of Ed and Fred between stationary and rotating cells at the initiation of rotation create a permissive environment for cell movement, and that uniform levels in these two populations later contribute to stopping the movement. Based on genetic data, we propose that ed and fred impart a second, independent, ;brake-like' contribution to this process via Egfr signaling. Ed and Fred are localized in largely distinct and dynamic patterns throughout rotation. However, ed and fred are required in only a subset of cells - photoreceptors R1, R7 and R6 - for normal rotation, cells that have only recently been linked to a role in planar cell polarity (PCP). This work also provides the first demonstration of a requirement for cone cells in the ommatidial rotation aspect of PCP. ed and fred also genetically interact with the PCP genes, but affect only the degree-of-rotation aspect of the PCP phenotype. Significantly, we demonstrate that at least one PCP protein, Stbm, is required in R7 to control the degree of ommatidial rotation.

  11. Radon metrology

    Energy Technology Data Exchange (ETDEWEB)

    Naismith, S.; Howarth, C. [National Radiological Protection Board, Chilton (United Kingdom)

    1996-09-01

    NRPB carries out calibrations of various types of radon and radon decay product measurement systems for its own purposes and for laboratories throughout Europe. There are currently two radon calibration facilities at NRPB: a 43 m{sup 3} radon chamber and the Fast Radon Exposure Device (FRED), a sealed steel drum. The radon chamber is used for active radon detection systems and the calibration of large numbers of passive detectors. Fred has a high radon concentration and is used to calibrate small numbers of passive radon gas detectors in a short period. (Author).

  12. Summary the race to reinvent energy and stop global warming

    CERN Document Server

    2013-01-01

    Complete summary of Fred Krupp and Miriam Horn's book: ""Earth: The Sequel: The Race to Reinvent Energy and Stop Global Warming"". This summary of the ideas from Fred Krupp and Miriam Horn's book ""Earth: The Sequel"" explains how capitalism, as the most powerful economic force in the world, is the only engine of change that has the strength to stop global warming. In their book, the authors demonstrate how this can be achieved by installing a cap-and-trade initiative, providing genuine economic incentives for companies and reducing their carbon footprint. This summary explains their theory in

  13. Standard/Handbook for Multipactor Breakdown Prevention in Spacecraft Components

    Science.gov (United States)

    2014-05-28

    Tracy Fiedler tracy.m.fiedler@raytheon.co m Raytheon Brad Fields fields.brad@orbital.com Orbital Sherri Fike sfike@ball.com Ball Richard Fink...Rocket Michael Sampson michael.j.sampson@nasa.gov NASA Victor Sank victor.j.sank@nasa.gov NASA Don Sawyer don.sawyer@avnet.com AVNET Fred Schipp...Grumman Ghislain Turgeon ghislain.turgeon@sslmda.co m SSL Deborah Valley deborah.valley@ll.mit.edu MIT Fred Van Milligen fvanmilligen@jdsu.com JDSU Marvin

  14. Technical Risk Identification at Program Inception Product Overview

    Science.gov (United States)

    2014-05-08

    james.t.farrell@boeing.com Boeing Tracy Fiedler tracy.m.fiedler@raytheon.com Raytheon Brad Fields fields.brad@orbital.com Orbital Sherri Fike sfike...rocket.com Rocket Michael Sampson michael.j.sampson@nasa.gov NASA Victor Sank victor.j.sank@nasa.gov NASA Don Sawyer don.sawyer@avnet.com AVNET Fred ...Grumman Ghislain Turgeon ghislain.turgeon@sslmda.com SSL Deborah Valley deborah.valley@ll.mit.edu MIT Fred Van Milligen fvanmilligen@jdsu.com JDSU

  15. Proceedings of the DOD (Department of Defense) Standardization and Data Management Conference Supporting the Acquisition Process Held in Linthicum, Maryland on August 22-24, 1988

    Science.gov (United States)

    1988-01-01

    Chairman] ASD/ENSI - DEFENSE LOGISTICS AGENCY -- Mr Don Atkinson DLA-0L -- Mr Fred Harris DLA-SE -- Mr Bob Schmitt DLA-Q S 3 IX-46 4. KEY ACTIVITIES...Mr. Fred Kohout, OASD/DASD(P) * ’CL XI-2 Summary for Rights in Technical Data Panel Discussion The rights in technical data panel was co-chaired by...RICHAtRD L. &RAWLEY MR. JOSEPH B BRAUER DLA. DE-ENSE FUEL SUPPLY CENTER ROME AIR DEVELOF ,iENT CENTER DFSC-CSS RBR CAIMIERON STAT ION GRIFFISS AFE NY 1

  16. Cultural Resources Survey, Harry S. Truman Dam and Reservoir Project, Missouri. Volume 2. Historical Resources: Historical Gazetteer and Mitigation Recommendations.

    Science.gov (United States)

    1983-02-01

    Brauersville (Benton) P.O. 1886-97 and small village in Union T. named for Frederick Brauer (born about 1826) who served as postmaster for 8 years. PG Brickley...1894 for Fred Harvey, owner of the 0 Harvey restaurants. Town called Garland. Harviell (Henry) 10 m. NW of Clinton, 4 m. SE of Church. S WW, 399...Writsburg (Bates) Filling station on Highway 71 established about 1930 by Fred Wright. RJ Wright School (Cedar) 4 Family name. SSR Wright’s Creek (St

  17. Planning Considerations for the Combat Employment of Air Power in Peacetime Contingency Operations. CLIC Papers

    Science.gov (United States)

    1988-05-01

    Letter for commanders." Washington, DC, f the secretary of the Air Force, April 1986, p. 2. 2. Brauer , Richard F., Jr., Lieutenant Colonel, USAF. Essavs...AFM 2-XX /Draft) Tactical DeceDtion. 11. Hiatt, Fred . "U.S. Attack on Libya: A Raid That Went Right ’These Bombs Are for You, Colonel’ . Ig...Washinston Post. 20 April 1986. 12. Iklb, Fred C., et al. Discriminate Deterrence. Report of The Commission On Inteqrated Long-Term Stratesy. washington

  18. Functional Role for Humoral Antibodies in Leishmaniasis in Laboratory Animal.

    Science.gov (United States)

    1982-12-01

    M. leprae (Godal et al., 1971) and Rickettsia tsutsugamushi (Nacy and Meltzer, 1979) have all been demonstrated after infected cells, in vitro, were...vitro; inhibition of growth of intracellular Mycobacterium leprae with lymphokines. Clin. Exp. Immunol. 8:625-637. Herman, R. 1980. Cytophilic and

  19. Moving Experience. Complexities of acculturation

    NARCIS (Netherlands)

    König, J.R. drs.

    2012-01-01

    In this thesis the theory of the dialogical self (Hermans) is explored in the context of global mobility and hybrid identities. A group of global nomads were asked whether they recognise different cultural identities within themselves and whether a dialogue between two personal cultural voices

  20. Air & Space Power Journal. Volume 27, Number 4, July-August 2013

    Science.gov (United States)

    2013-08-01

    Princeton University Press, 1989), 485. 33. Amir Mizroch, “Nano Drones, Ethical Algorithms: Inside Israel’s Secret Plan for Its Future Air Force,” WIRED...Mindell, Iron Coffin, 48. 40. Ibid., 1. 41. Ibid., 2. 42. “A Utilitarian View of the Monitor’s Fight,” in Herman Melville, Battle-pieces and As- pects of

  1. Defense Acquisition Performance Assessment Report

    Science.gov (United States)

    2006-01-01

    Incorporated – “Changing the System” HeLLeR , TRiCiA A., Deputy Director of Congressional Support, Technical and Analytical Support, USAF A-Team...Interview Recorder” HeLLieR, RiCHARD, Director of Air Force Programs, United Technologies – “Joint Stars System” HeRMAN , DR. ROBeRT, Member, Defense

  2. Beyond Pain: Coercing Violent Non-State Actors

    Science.gov (United States)

    2010-01-01

    Monica, CA: RAND Corporation, 2001). 34 Aron Heller , “Israel: Commandos seize huge Iranian arms shipment,” Associated Press, 4 November 2009. 35 For a...Schaerf (London: Croom Helm, 1975), 16. 43 The era‟s most prominent theorists include George Kennan, Thomas Schelling, Herman Kahn, and Bernard

  3. The Future Role and Need for Nuclear Weapons in the 21st Century

    Science.gov (United States)

    2007-01-01

    United States and the Soviet Union. According to Herman Kahn, Cold War nuclear theorist, three types of nuclear deterrence existed: Type I—use of...Age (Lexington: The University Press of Kentucky, 1996), 17. 87 Arnie Heller , ―Tracking the Global Spread of Advanced Technologies,‖ Science and

  4. Hierarchical Topological Network Analysis of Anatomical Human Brain Connectivity and Differences Related to Sex and Kinship

    Science.gov (United States)

    2011-10-01

    gain? Neuroimage 34 (1), 144–55.1361 Benjamini, Y., Heller , R., Yekutieli, D., 2009. Selective inference in complex1362 research. Philos. Trans. R. Soc...Hayashi, K. M., de Zubiricaray, G., Janke, A. L., Rose,1531 S. E., Semple, J., Herman , D., Hong, M. S., Dittmer, S., Doddrell, D. M.,1532 Toga, A

  5. Millennium Cohort: The 2001-2003 Baseline Prevalence of Mental Disorders in the U.S. Military

    Science.gov (United States)

    2007-01-01

    1998;11(4):611e25. [10] Dlugosz LJ, Hocter WJ, Kaiser KS, Knoke JD, Heller JM, Hamid NA, et al. Risk factors for mental disorder hospitalization af- ter...Questionnaire Obstetrics-Gynecology Study. Am J Obstet Gynecol 2000;183(3):759e69. [20] Weathers FW, Litz BT, Herman DS, Huska JA, Keane TM. The PTSD

  6. Synthesis of Freestanding HfO2 Nanostructures

    Science.gov (United States)

    2011-04-05

    Tang J, Fabbri J, Robinson RD, Zhu Y, Herman IP, Steigerwald ML, Brus LE: Solid-solution nanoparticles:use of a nonhydrolytic sol-gel synthesis to...colloidal HfO2 nanorods. Adv Mater 2007, 19:2608-2612. Page 21 5. Qiu X, Howe JY, Cardoso MB, Polat O, Heller W: Size control of highly ordered HfO2

  7. Regulation of Brain Glucose Metabolic Patterns by Protein Phosphorlyation and Drug Therapy

    Science.gov (United States)

    2007-03-30

    Suppl3 (2006) SI49-55. 64 15 Hoffmann, P.C., Toon, R., Kleinman, J. and Heller , A., The association of lesion- induced reductions in brain monoamines with...Lipska, B.K., Deep-Soboslay, A, Weickert, C.S., Hyde, TM., Martin, e.E., Herman , M.M. and Kleinman, IE., Critical factors in gene expression in

  8. Measuring Neuromuscular Fatigue in Cervical Spinal Musculature of Military Helicopter Aircrew

    Science.gov (United States)

    2009-11-01

    Reseaali and Materiel Command. UW7 Mari-h. Report no, |tW7()722-{W6. 4. Thomae MK. Porlens Hi. Brock JR. Alien OD. Heller RF: Back pain in Australian...of low back pain in military hehcopter aviators: prevention and treatment. Work 2005; 24: 10l-(0. 11. Sommerich CM, Joines SMB. Hermans V. Moon SD: Use

  9. Impact of eigenvalues on the pseudopotential calculation of superconducting parameters of metals Ga, Cd and In

    Science.gov (United States)

    Yadav, Jayprakash; Rafique, S. M.; Kumari, Shanti

    2009-10-01

    In the present paper some superconducting (SC) state parameters of metals Ga, Cd and In have been studied through Harrison's First Principle [HFP] pseudopotential technique using McMillan's formalism. The impact of choosing two different sets of core energy eigenvalues viz. Herman-Skillman and Clementi (or Experimental) has been studied.

  10. El lenguaje de la publicidad (The Language of Advertising).

    Science.gov (United States)

    Blanco Lazaro, Enrique T.

    1981-01-01

    Analyzes the language of advertising and the expressive devices it uses to capture the attention of the consumer and arouse his/her interest. Condemns the artificiality of this language and the social values it reflects, quoting profusely from the works of Herman Glaser and other contemporary authors. (MES)

  11. Lõputa meediakunst Berliinis / Piibe Piirma

    Index Scriptorium Estoniae

    Piirma, Piibe

    2007-01-01

    Meediakunsti festival "Transmediale" alapealkirjaga "Unfinished" Berliini kunstiakadeemias ja linnaruumis 31. I-4. II. Konverentsidest, võidutöödest (Herman Asselberghsi "Proof of Life", Antoine Schmitti "Still Living", Tim Shore'i "Cabinet"), Stelarci etendusest "Fractal Flesh", David Rokeby, Herwig Turki ja Günter Stögeri töödest

  12. A route to uniaxially oriented ribbons of bacterial cellulose nanocrystals based on isomalt spun sacrificial template

    OpenAIRE

    2014-01-01

    We have carried out orientation of bacterial cellulose nanocrystals (BCNC) by implementing a process based on mechanical shearing BCNC dispersed in a viscous temporary isomalt glass. After the orientation, the isomalt matrix was selectively solubilized to afford uniaxially highly oriented BCNC ribbons as demonstrated by SEM and X-Ray studies. The 2D WAXS determined Herman's order parameter reached 0.85.

  13. Maalehe Raamatu aiaabi

    Index Scriptorium Estoniae

    2007-01-01

    Tallinnas 2006. a. ilmunud raamatust "Praktiline aiarajaja käsiraamat" (toimetaja Deborah Parker, peatoimetaja Christopher Brickell), Herman Hacksteini ja Wota Wehmeyeri "Kiviktaimlaleksikonist" (toimetaja Riina Tammsaar), 2007. a. ilmunud Börje Erikssoni ja Pär Schyllanderi raamatust "Veekogud aias" (toimetajad R. Tammsaar ja Signe Siim, fotod: Bertil K. Johanson), Bertil K. Johansoni raamatust "Aialilled" (toimetaja R. Tammsaar)

  14. Geloofszekerheid : Teksten ingeleid en geannoteerd door Henk van den Belt

    NARCIS (Netherlands)

    Bavinck, Herman; van den Belt, Hendrik

    2016-01-01

    In 1901 publiceerde Herman Bavinck De zekerheid des geloofs. Het boek typeert zijn theologie. De weg naar de geloofszekerheid begint bij de boodschap van het evangelie dat zich richt tot het hart van de mens. Het geloof, dat als werk van de Geest een mysterie blijft, verbindt de gelovige aan de

  15. Alates 13. XII on Vaala galeriis avatud "Talvesalong"

    Index Scriptorium Estoniae

    2004-01-01

    Väljas on Ellinor Aiki, Valdur Ohaka, Herman Talviku, Jaak Arro, Raoul Kurvitza, Andres Toltsi, Laurentsiuse, Lembit Saartsi, Rait Rosina, Merike Estna, Maarit Murka ning Aleksandr Breneri ja Barbara Schurzi tööd. 17. XII Anna Litvinova, Ilmar Kruusamäe ja Lembit Sarapuu ühised maaliseansid

  16. Evidence from the Wider Use of the BSL Receptive Skills Test

    Science.gov (United States)

    Herman, Ros; Roy, Penny

    2006-01-01

    Following the development and standardization of the British Sign Language (BSL) Receptive Skills Test (Herman et al., 1999), the test was made widely available to professionals working with deaf children. Test users were asked to return completed score-sheets on individual children they had tested in order to compare a selection of children from…

  17. Psychodiagnostic Properties of the Piotr Oles´ "Internal Dialogical Activity Scale"

    Science.gov (United States)

    Astretsov, D. A.; Leontiev, D. A.

    2016-01-01

    The article discusses the concept of internal dialogue and how it is understood in various schools of psychological research, including both Russia and abroad. The authors briefly investigate how the concept was understood by Mikhail Bakhtin, Lev Vygotsky, G.M. Kuchinskii, and Hubert Hermans. The "Internal Dialogical Activity Scale"…

  18. El lenguaje de la publicidad (The Language of Advertising).

    Science.gov (United States)

    Blanco Lazaro, Enrique T.

    1981-01-01

    Analyzes the language of advertising and the expressive devices it uses to capture the attention of the consumer and arouse his/her interest. Condemns the artificiality of this language and the social values it reflects, quoting profusely from the works of Herman Glaser and other contemporary authors. (MES)

  19. Reliability of Professional Judgments in Forensic Child Sexual Abuse Evaluations: Unsettled or Unsettling Science?

    Science.gov (United States)

    Everson, Mark D.; Sandoval, Jose Miguel; Berson, Nancy; Crowson, Mary; Robinson, Harriet

    2012-01-01

    In the absence of photographic or DNA evidence, a credible eyewitness, or perpetrator confession, forensic evaluators in cases of alleged child sexual abuse must rely on psychosocial or "soft" evidence, often requiring substantial professional judgment for case determination. This article offers a three-part rebuttal to Herman's (2009) argument…

  20. 76 FR 34135 - Qualification of Drivers; Exemption Applications; Vision

    Science.gov (United States)

    2011-06-10

    .... Leonard, John W. Locke, Herman G. Lovell, Ronald L. Maynard, Donald G. Meyer, William A. Moore, Jr... on January 17, 2008 (73 FR 3316), or you may visit http://edocket.access.gpo.gov/2008/pdf/E8-785.pdf... exemption from the vision requirements (63 FR 66226; 65 FR 20245; 65 FR 45817; 65 FR 57230; 65 FR 77066;...

  1. Rovibrational intensities for the Delta V = 1 bands of the X 3Sigma(-) NH radical - Experiment and theory

    Science.gov (United States)

    Chackerian, C., Jr.; Guelachvili, G.; Lopez-Pineiro, A.; Tipping, R. H.

    1989-01-01

    The vibrational transition dipole moment for the highly reactive radical species NH in its ground electronic state is obtained via the Herman-Wallis effect manifest in emission spectra produced in a plasma reactor. The results of these experiments on the five lowest Delta V = 1 bands are in good agreement with high quality ab initio calculations of the electric dipole moment function.

  2. Dedication

    NARCIS (Netherlands)

    NN,

    1972-01-01

    The completion of the seventh volume of this Flora gives me the occasion to dedicate this volume to HERMAN JOHANNES LAM, who from the beginning was intimately connected with the taxonomical study of the flora of the Malesian region, adopted the working team, provided for it a permanent niche in his

  3. NACA Conference on Aircraft Loads, Flutter, and Structures: A compilation of Papers Presented.

    Science.gov (United States)

    1953-03-04

    BAKER, John E. NACA - Langley Laboratory BANK , Herman Jet Propulsion Laboratory - C.I.T. BECK, Edgar NACA Headquarters BECKER, John V. NACA - Langley... deMoraes , Carlos A.: Correlation of Supersonic Convective Heat-Transfer Coefficients From Measurements of the Skin Temperature of a Parabolic Body of

  4. BIBLIOGRAPHY OF PAPERS PUBLISHED, UNPUBLISHED AND PRESENTED AT CONFERENCES.

    Science.gov (United States)

    Mobilization for Youth, Inc., New York, NY.

    IN RESPONSE TO REQUESTS FOR AGENCY MATERIAL, THE BIBLIOGRAPHY OF PAPERS FROM MOBILIZATION FOR YOUTH EXPERIENCE AND THE TRAINING DEPARTMENT WAS PRESENTED. THE BIBLIOGRAPHY WAS DIVIDED INTO PAPERS PUBLISHED, UNPUBLISHED AND PRESENTED AT CONFERENCES. UNDER PAPERS PUBLISHED WERE THOSE BY SHERMAN BARR, BERTRAM BECK, AND MELVIN HERMAN. UNDER PUBLISHED…

  5. Mark Soosaar toob Marc Chagalli tööd Pärnusse / Tõnis Erilaid

    Index Scriptorium Estoniae

    Erilaid, Tõnis, 1943-

    1999-01-01

    10. okt. avatakse Chaplini kunstikeskuses Marc Chagalli tööde näitus. Samaaegselt pannakse välja eesti päritolu kunstniku Herman Talviku tööd. Näituse üldnimeks on 'Testament'. Mõlema kunstniku eksponeeritavad tööd on religioosse sisuga.

  6. Kunstnike auavaldus klassikalisele graafikale / Krista Piirimäe

    Index Scriptorium Estoniae

    Piirimäe, Krista, 1946-

    2006-01-01

    Graafikanäitusest "Ekstaas" Tartu Kunstimajas, koostaja Mai Levin. Näitus on pühendatud Herman Talviku sajandale sünniaastapäevale. Eksponeeritakse Maria-Kristiina Ulase, Reti Saksa, Enno Ootsingu, Naima Neidre, Peeter Alliku, Peeter Lauritsa, Urmas Viigi jt. töid

  7. Boerhaave: Author and Editor *

    Science.gov (United States)

    Lindeboom, G. A.

    1974-01-01

    The many facets of Herman Boerhaave's life are presented. He was a renowned teacher, physician, author, and editor. Discussed here are his activities as cataloger of the Vossius Collection, author of books on chemistry, botany, and medicine, and as editor of works by Vesalius and early Greek medical writers. Printing and bookselling in Leiden during Boerhaave's era are described. Images PMID:4596962

  8. Dutch Architecture with Landscape Methods

    NARCIS (Netherlands)

    Jauslin, D.

    2009-01-01

    14 Project Documentations and Analysis of Dutch Architecture with Landscape Methods. MVRDV Villa VPRO, Powerhouse Company Villa 1, Herman Herzberger Coda Museum, NL Architects Basket Ba, SeARCH Posbank Pavillion, Wiel Arets Hedge House, OMA Kunsthal and Educatorium, Maaskant Johnson Wax, Diller & Sc

  9. Experiencing Success: Some Strategies for Planning the Program

    Science.gov (United States)

    Donovan, Timothy; Porter, Richard; Stellar, James

    2010-01-01

    The concept of experiential learning, in one form or another, has been around a long time, some would say going back to Confucius. More recently, however, within the United States it was put into practice in a very aggressive form, cooperative education, created by Herman Schneider and initiated at the University of Cincinnati (UC) in 1906.…

  10. [The fossil record of the Eurasian Neogene insectivores (Erinaceomorpha, Soricomorpha, Mammalia) : Part I / L.W. van den Hoek Ostende, C.S. Doukas and J.W.F. Reumer (editors)]: Germany

    NARCIS (Netherlands)

    Ziegler, R.; Dahlmann, Th.; Reumer, J.W.F.; Storch, G.

    2005-01-01

    Introduction Research of Miocene and Pliocene insectivores has a long history in Germany. Already in the middle of the 19th century Miocene insectivore species have been described from South German localities. Most of these were authored by Herman von Meyer, who deserves to be named a pioneer of Ger

  11. LALIGENS

    African Journals Online (AJOL)

    ESSOH GRACE

    2015-05-10

    May 10, 2015 ... that involves Rob Nixon's Theory of Slow Violence, Herman and Chomsky's. Propaganda ..... provincial terms and regularized speech behavior in the Niger Delta, Ifowodo also ... ascribe animal or inanimate properties to human beings, and underlie the degradation ..... “praying for good game” (Oil, p.12).

  12. Influence of Hole Surface Finish, Cyclic Frequency and Spectrum Severity on the Fatigue Behaviour of Thick Section Aluminium Alloy Pin Joints

    Science.gov (United States)

    1987-12-01

    copies) Qantas Airways Limited SEC of Vic. Herman Research Laboratory, Library Ansett Airlines of Australia, Library BHP, Melbourne Research...11 4.1 Fatigue data ........................................ 11 4 2 Fracture surface analysis ............................. 14...4, while the constant-amplitude data are also presented in the S/N diagrams shown in Fig. 7. Using a least-squares analysis a third-order polynomial

  13. Moving to the Next Generation of Standards for Science: Building on Recent Practices. CRESST Report 762

    Science.gov (United States)

    Herman, Joan L.

    2009-01-01

    In this report, Joan Herman, director for the National Center for Research, on Evaluation, Standards, & Student Testing (CRESST) recommends that the new generation of science standards be based on lessons learned from current practice and on recent examples of standards-development methodology. In support of this, recent, promising efforts to…

  14. New Assessments, New Rigor

    Science.gov (United States)

    Joan Herman; Robert Linn

    2014-01-01

    Researching. Synthesizing. Reasoning with evidence. The PARCC and Smarter Balanced assessments are clearly setting their sights on complex thinking skills. Researchers Joan Herman and Robert Linn look at the new assessments to see how they stack up against Norman Webb's depth of knowledge framework as well as against current state tests. The…

  15. Ontwikkeling van een conceptueel model voor assessment

    NARCIS (Netherlands)

    Joosten-ten Brinke, Desirée; Hermans, Henry; Latour, Ignace

    2005-01-01

    Joosten - ten Brinke, D., Hermans, H. & Latour, I. (2004) Ontwikkeling van een conceptueel model voor assessment. In: Gorissen, P., Manderveld, J., Benneker, F. & Cordewener, B. Leertechnologie in de Lage Landen (pp. 40-42). Utrecht, Stichting Surf. Ook beschikbaar in dspace: http://hdl.handle.net/1

  16. Gezamenlijke ontwikkeling van digitale leermaterialen

    NARCIS (Netherlands)

    Hermans, Henry; De Vries, Fred

    2005-01-01

    Hermans, H. & de Vries, F. (2004). Gezamenlijke ontwikkeling van digitale leermaterialen. In: Van Geloven, M., Koper, R. & Van der Veen, J., E-learning trends (pp. 19-21). Utrecht, Stichting Digitale Universiteit.
    Ook beschikbaar in dspace: http://hdl.han

  17. The Pentagon's Military Analyst Program

    Science.gov (United States)

    Valeri, Andy

    2014-01-01

    This article provides an investigatory overview of the Pentagon's military analyst program, what it is, how it was implemented, and how it constitutes a form of propaganda. A technical analysis of the program is applied using the theoretical framework of the propaganda model first developed by Noam Chomsky and Edward S. Herman. Definitions…

  18. Verleden bloeitijd van het referendum in de Franse grondwet

    NARCIS (Netherlands)

    Reestman, J.H.

    2008-01-01

    Jan-Herman Reestman elaborates national referendums. They have served the Fifth French Republic well in not only helping to introduce and to anchor its system of government, but also in giving it its seemingly definite shape (cf. 1962: introduction of the principle of direct election of the Presiden

  19. Verleden bloeitijd van het referendum in de Franse grondwet

    NARCIS (Netherlands)

    Reestman, J.H.

    2008-01-01

    Jan-Herman Reestman elaborates national referendums. They have served the Fifth French Republic well in not only helping to introduce and to anchor its system of government, but also in giving it its seemingly definite shape (cf. 1962: introduction of the principle of direct election of the

  20. Avignoni totaalne teatrifestival / Andres Keil

    Index Scriptorium Estoniae

    Keil, Andres, 1974-

    2007-01-01

    Avignoni teatrifestivalil nähtust. Lähemalt Marc Wolters'i ühemeheteater "Colt Warmers", Chapelle Sainte Claire (Alfred Jarry) "Kuningas Ubu", Herman Hesse "Sidharta" mängituna India teatritrupi poolt, "Movin' Melvin Brown : Me, Ray Charles and Sammy D. Jr" ning Virgine Mirabeau koreograafial tantsuetendus "Shoult I Stay Or..." Art's Fusion esituses

  1. Network Horizon and the Dynamics of Network Positions: A Multi-Method Multi-Level Longitudinal Study of Interfirm Networks

    NARCIS (Netherlands)

    D.W. van Liere (Diederik)

    2007-01-01

    textabstractDiederik van Liere was born in Kortenhoef, the Netherlands, on February 18, 1978. He attended Herman Jordan Lyceum in Zeist, from which he received his Atheneum diploma in 1996. After high school, Diederik went on to study Business Administration at the Erasmus University Rotterdam, the

  2. Application of a Genetic Algorithm and Multi Agent System to Explore Emergent Patterns of Social Rationality and a Distress-Based Model for Deceit in the Workplace

    Science.gov (United States)

    2008-06-01

    examples of businesses such as Enron and WorldCom, whose deceitful practices “helped to fuel a massive loss of confidence in the integrity of American...T. L. (2003). Some Lessons of the Recent Corporate Scandals [Abstract]. Journal of Business Ethics, 43(4) 389. Chandler, R. E., Herman, R

  3. Mürgised sojaoad : mmmm, kui halb! / Silvia Lotman

    Index Scriptorium Estoniae

    Lotman, Silvia, 1980-

    2007-01-01

    Sojaoa kasvatamisest Lõuna-Ameerikas ja Paraguays, kus on suures osas erastatud maad maha müüdud välismaistele suurkorporatsioonidele, mis kasutavad maad põllumajandustööstuseks. Pestitsiidide kasutamisest, mürgitamisjuhtudest ja kohtuotsusest, kus Paraguay ülemkohus mõistis süüdi Herman Schlenderi ja Alfredo Lautenschlageri

  4. H : disainialfabeet / Kai Lobjakas

    Index Scriptorium Estoniae

    Lobjakas, Kai, 1975-

    2006-01-01

    Tutvustatakse taani disainerit, arhitekti ja kriitikut Poul Henningseni (1894-1967), austria arhitekti ja disainerit Josef Hoffmanni (1870-1956), belgia arhitekti Victor Hortat (1861-1947), argentiina päritolu disainerit Alfredo Häberlit (sünd. 1964, Buenos Aires), Herman Milleri nimelist mööblitootmisettevõtet (asutatud 1923) USA-s, high-tech stiili

  5. Network Horizon and the Dynamics of Network Positions: A Multi-Method Multi-Level Longitudinal Study of Interfirm Networks

    NARCIS (Netherlands)

    D.W. van Liere (Diederik)

    2007-01-01

    textabstractDiederik van Liere was born in Kortenhoef, the Netherlands, on February 18, 1978. He attended Herman Jordan Lyceum in Zeist, from which he received his Atheneum diploma in 1996. After high school, Diederik went on to study Business Administration at the Erasmus University Rotterdam, the

  6. Eesti graafika rahvusvahelisel areenil / Benjamin Vasserman

    Index Scriptorium Estoniae

    Vasserman, Benjamin

    1999-01-01

    26. VIII-28. XI Fredrikstadis Hebleri-nim. rahvusvahelises graafikakeskuses avatud XII Norra rahvusvahelisel graafikatriennaalil esindavad Eestit Anu Kalm, Avo Keerend, Vive Tolli, Benjamin Vasserman, Mare Vint. Peapreemia ئ Anthony Hill. Triennaali president - Herman Hebler (s. 1911). 24. VI-15. IX Poolas toimunud X Lodzi rahvusvahelisel väikegraafika triennaalil osalesid Eestist Virge Jõekalda, Benjamin Vasserman.

  7. Boiling Blood : Chemistry of Vital Fluids 
in Dutch Enlightenment Culture

    NARCIS (Netherlands)

    Verwaal, Ruben

    2015-01-01

    What is blood? Despite William Harvey’s discovery of the circulation of blood, many questions about blood itself unanswered. This paper asks how and why Dutch medical men in the eighteenth century initiated studies to understand the properties of blood. Some professor such as Herman Boerhaave and Je

  8. Reviews of recent publications

    Directory of Open Access Journals (Sweden)

    1998-06-01

    Full Text Available Johnson, Roberta. Crossfire: Philosophy and the Novel in Spain 1900-1934 by Nina L. Molinaro Lucey, Michael. Gide 's Bent: Sexuality, Politics, Writing by Jocelyn Van Tuyl Morris, Alan. Patrick Modiano by David Herman Sartiliot, Claudette. Citation and Modernity: Derrida, Joyce, and Brecht by Siegfried Mews

  9. An Introduction to American Literature.

    Science.gov (United States)

    Borges, Jorge Luis

    Offered in this book is an Argentinian's view of the literary achievement of the United States. The beginning chapters discuss Mather, Edwards, and Freneau; Franklin, Cooper, and the historians; Hawthorne and Poe; and Whitman and Herman Melville. Other chapters are given to a discussion of three poets of the nineteenth century (Lanier, Whittier,…

  10. Developing a sustainable, student centred VLE: the OUNL case

    NARCIS (Netherlands)

    Hermans, Henry; Verjans, Steven

    2009-01-01

    Hermans, H., & Verjans, S. (2009). Developing a sustainable, student centred VLE: the OUNL case. Paper presented at the 23rd ICDE World Conference on Open Learning and Distance Education including the 2009 EADTU Annual Conference (M-2009). June, 7-10, 2009, Maastricht, The Netherlands.

  11. Scandinavian neuroscience during the Nazi era

    DEFF Research Database (Denmark)

    Kondziella, Daniel; Hansen, Klaus; Zeidman, Lawrence A

    2013-01-01

    deportation by fleeing from Copenhagen to Sweden. In contrast, Carl Værnet (Denmark) became a collaborator, conducting inhuman experiments in Buchenwald concentration camp, and Herman Lundborg (Sweden) and Thorleif Østrem (Norway) advanced racial hygiene in order to maintain the "superior genetic pool...

  12. Melville and the Tradition of Primitive Utopia.

    Science.gov (United States)

    Beauchamp, Gorman

    1981-01-01

    Discusses the relationships among the myth of the Golden Age, the concept of the Noble Savage, and the dream of Utopia. Uses Lewis Mumford's division of utopias into two basic types, i.e., reconstruction and escape utopias, to examine Herman Melville's "Typee" as an example of the primitive escapist utopia. (Editor/DMM)

  13. Eesti graafika rahvusvahelisel areenil / Benjamin Vasserman

    Index Scriptorium Estoniae

    Vasserman, Benjamin

    1999-01-01

    26. VIII-28. XI Fredrikstadis Hebleri-nim. rahvusvahelises graafikakeskuses avatud XII Norra rahvusvahelisel graafikatriennaalil esindavad Eestit Anu Kalm, Avo Keerend, Vive Tolli, Benjamin Vasserman, Mare Vint. Peapreemia ئ Anthony Hill. Triennaali president - Herman Hebler (s. 1911). 24. VI-15. IX Poolas toimunud X Lodzi rahvusvahelisel väikegraafika triennaalil osalesid Eestist Virge Jõekalda, Benjamin Vasserman.

  14. Species Profiles: Life Histories and Environmental Requirements of Coastal Fishes and Invertebrates (Mid-Atlantic): Atlantic Menhaden

    Science.gov (United States)

    1989-08-01

    eggs and larvae (Reintjes descriptions of Atlantic menhaden 1961, 1968; Herman 1963; Kendall and larvae and juveniles . Reintjes 1975; Ferraro 1980a,b...function and community 12 dynamics have received little ENVIRONMENTAL REQUIREMENTS attention. Larvae and juveniles are seasonally important

  15. 解读《书记员巴特比:华尔街的故事》中的生存危机

    Institute of Scientific and Technical Information of China (English)

    陈梦

    2014-01-01

    In American writer Herman Melville`s work Bartleby, the Scrivener:A Story of Wall Street, the character of Bartleby can be read in a variety of ways. In this essay, the writer attempts to interpret this elusive figure in terms of exis-tence and confusion of human beings in modern society.

  16. A Dooyeweerd-based approach to regional economic development

    NARCIS (Netherlands)

    Aay, H; Van Langevelde, A

    2005-01-01

    Within regional science there is a need for a general theory of regional economic development, one that evaluates and integrates existing approaches. In this paper, the philosophy of Herman Dooyeweerd is used as a basis for conceptualising the contours of such a theory. Contributions of this philoso

  17. Field Dependence Research: A Historical Analysis of a Psychological Construct.

    Science.gov (United States)

    Haaken, Janice

    1988-01-01

    Cultural and political biases in social science research contribute to bias in study methodology, as well as interpretations and conclusions. The work of Herman Witkin and Solomon Asch are discussed and used to demonstrate the effects and limitations of the environment versus ego on male and female perceptions. (AO)

  18. Thirty-Five Years of Studying Work and Family

    Science.gov (United States)

    Brett, Jeanne M.

    2011-01-01

    The author and Karen Gyllstrom began working on the study that resulted in the highly cited article entitled, "Working Men and Women: Inter-and Intra-role Conflict" (Herman & Gyllstrom, "Psychology of Women Quarterly" 1977) probably more for personal than professional reasons. The study was based on Gyllstrom's master's thesis. The focus of…

  19. Celebrity Authorship and Afterlives in English and American Literature

    NARCIS (Netherlands)

    Franssen, G.; Honings, R.

    2016-01-01

    This book maps the history of literary celebrity from the early nineteenth century to the present, paying special attention to the authors’ crafting of their writerly self as well as the afterlife of their public image. Case studies are John Keats, Edgar Allan Poe, Eliza Cook, Herman Melville, Oscar

  20. Mürgised sojaoad : mmmm, kui halb! / Silvia Lotman

    Index Scriptorium Estoniae

    Lotman, Silvia, 1980-

    2007-01-01

    Sojaoa kasvatamisest Lõuna-Ameerikas ja Paraguays, kus on suures osas erastatud maad maha müüdud välismaistele suurkorporatsioonidele, mis kasutavad maad põllumajandustööstuseks. Pestitsiidide kasutamisest, mürgitamisjuhtudest ja kohtuotsusest, kus Paraguay ülemkohus mõistis süüdi Herman Schlenderi ja Alfredo Lautenschlageri

  1. Het roer moet om

    NARCIS (Netherlands)

    Wiegman, H.

    2013-01-01

    De recente gebeurtenissen rond de invoering en afschaffing van vrije tarieven in de mondzorg nopen tot bezinning. Een in deze donkere dagen actuele bezigheid. De dagen lengen overigens en wellicht gloort er ook voor de tandheelkunde licht aan de horizon. Maar dan moet het roer wel om, bepleit Herman

  2. Language Recognition via Sparse Coding

    Science.gov (United States)

    2016-09-08

    target language lT ) from the two pipelines. We can also think of more sophis- ticated fusion schemes on logistic regression and neural net - works. Table...vol. 16, no. 5, pp. 980–988, July 2008. [6] G. Sivaram, S. K. Nemala, M. Elhilali, T. D. Tran, and H. Herman- sky , “Sparse Coding for Speech

  3. The Pentagon's Military Analyst Program

    Science.gov (United States)

    Valeri, Andy

    2014-01-01

    This article provides an investigatory overview of the Pentagon's military analyst program, what it is, how it was implemented, and how it constitutes a form of propaganda. A technical analysis of the program is applied using the theoretical framework of the propaganda model first developed by Noam Chomsky and Edward S. Herman. Definitions…

  4. The DREP (Defense Research Establishment Pacific) Internal Wave Normal Mode Model-Theoretical Background

    Science.gov (United States)

    1988-04-01

    1967. 15. Philip M. Morse and Herman Feshbach, "Methods of Theoretical Physics", MCGraw-Hill Book Company, Inc., New York, 1953. 16. William E. Boyce and...Richard C. DiPrima , "Elementary Differential Equations and Boundary Value Problems", John Wiley & Sons,Inc., New York, 1969. 17. Allan D. Pierce

  5. Similarities between Restrained Eaters and Bulimics.

    Science.gov (United States)

    Ruderman, Audrey J.

    Little is known about the etiology of bulimia. However Polivy and Herman have hypothesized that dieting causes bulimia and that differences between dieters and bulimics are quantitative rather than qualitative. The purpose of this study was to examine these hypotheses and further examine the parallels between bulimics and dieters. Female college…

  6. Gezamenlijke ontwikkeling van digitale leermaterialen

    NARCIS (Netherlands)

    Hermans, Henry; De Vries, Fred

    2005-01-01

    Hermans, H. & de Vries, F. (2004). Gezamenlijke ontwikkeling van digitale leermaterialen. In: Van Geloven, M., Koper, R. & Van der Veen, J., E-learning trends (pp. 19-21). Utrecht, Stichting Digitale Universiteit.
    Ook beschikbaar in dspace: http://hdl.han

  7. 75 FR 31435 - Notice of Public Information Collection(s) Being Reviewed by the Federal Communications...

    Science.gov (United States)

    2010-06-03

    ...(i), 303(g), 303(r) and 332(c)(7). Total Annual Burden: 5,215 hours. Total Annual Cost: $508,200... judith-b.herman@fcc.gov . SUPPLEMENTARY INFORMATION: OMB Control Number: 3060-0799. Title: FCC Ownership... rules regarding: 1) persons or entities holding a 10 percent or greater direct or indirect ownership...

  8. Pursuing "Moby-Dick" in the Classroom, the Museum, Back in the Classroom, and Beyond.

    Science.gov (United States)

    Wallace, Robert K.; Zlatkin, Aaron; Hixson, Lindsay; Kallmeyer, Robert J.; Sekowski, Kristen; Brock, Gina R.; Gallagher, Michael; Fletcher, William Ryan

    1997-01-01

    Describes a university course that explored the novel "Moby Dick" by Herman Melville and its relation to art highlighting the two student initiatives. Provides the opening statements from each of the 12 students at the National Association for Humanities Education Convention from their presentation on the course where they each related their…

  9. Counseling, Guidance, and the Morality of Help-Giving

    Science.gov (United States)

    Patton, Michael J.

    1971-01-01

    A review of: (1) The Counseling Center in Higher Education, Phillip J. Gallagher and George D. Demos, (2) The Guidance Process, Herman J. Peters, (3) Counseling and Guidance in the Twentieth Century: Reflections and Reformulations, William H. Van Hoose and John J. Pietrofesa, and (4) Value Orientations in Counseling and Psychotherapy: The Meanings…

  10. H : disainialfabeet / Kai Lobjakas

    Index Scriptorium Estoniae

    Lobjakas, Kai, 1975-

    2006-01-01

    Tutvustatakse taani disainerit, arhitekti ja kriitikut Poul Henningseni (1894-1967), austria arhitekti ja disainerit Josef Hoffmanni (1870-1956), belgia arhitekti Victor Hortat (1861-1947), argentiina päritolu disainerit Alfredo Häberlit (sünd. 1964, Buenos Aires), Herman Milleri nimelist mööblitootmisettevõtet (asutatud 1923) USA-s, high-tech stiili

  11. Lõputa meediakunst Berliinis / Piibe Piirma

    Index Scriptorium Estoniae

    Piirma, Piibe

    2007-01-01

    Meediakunsti festival "Transmediale" alapealkirjaga "Unfinished" Berliini kunstiakadeemias ja linnaruumis 31. I-4. II. Konverentsidest, võidutöödest (Herman Asselberghsi "Proof of Life", Antoine Schmitti "Still Living", Tim Shore'i "Cabinet"), Stelarci etendusest "Fractal Flesh", David Rokeby, Herwig Turki ja Günter Stögeri töödest

  12. 9. XI toimub Tallinnas Mustpeade majas E-kunstisalongi 15. kunstioksjon "Meistri puudutus"

    Index Scriptorium Estoniae

    2005-01-01

    Esmakordselt tutvustatakse Gustav Mägi, Herman Aunapuu, Eduard Maaseri, Peeter Mudisti, Lepo Mikko ja Johannes Saali loomingut. Haruldasteks võib pidada Julie Hagen-Schwarzi loodud portreed ning Hugo Lepiku ja Karin Lutsu Rootsis valminud töid. Oksjonikollektsioon on kuni 8. XI väljas E-kunstisalongi galeriis Rocca al Mare kaubanduskeskuses

  13. New Assessments, New Rigor

    Science.gov (United States)

    Joan Herman; Robert Linn

    2014-01-01

    Researching. Synthesizing. Reasoning with evidence. The PARCC and Smarter Balanced assessments are clearly setting their sights on complex thinking skills. Researchers Joan Herman and Robert Linn look at the new assessments to see how they stack up against Norman Webb's depth of knowledge framework as well as against current state tests. The…

  14. 完形填空训练

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    (A)It was winter, and Mrs Herman wanted to do a lot of________,so she waited until it was Saturday. When her husband was_____,he went to shops with her to pay _______everything and to carry the parcels(包裹)

  15. Visualization and Analysis of Impact Damage in Sapphire

    Science.gov (United States)

    2011-11-01

    ORGANIZATION 6 GDLS W BURKE MZ436 21 24 G CAMPBELL MZ436 30 44 D DEBUSSCHER MZ436 20 29 J ERIDON MZ436 21 24 W HERMAN MZ435 01 24 S...PENTESCU MZ436 21 24 38500 MOUND RD STERLING HTS MI 48310-3200 3 OGARA HESS & EISENHARDT G ALLEN D MALONE T RUSSELL 9113 LE SAINT

  16. Using Plasticity Values Determined From Systematic Hardness Indentation Measurements for Predicting Impact Behavior in Structural Ceramics: A New, Simple Screening Technique

    Science.gov (United States)

    2009-09-01

    92083 6 GDLS W BURKE MZ436 21 24 G CAMPBELL MZ436 30 44 D DEBUSSCHER MZ436 20 29 J ERIDON MZ436 21 24 W HERMAN MZ435 01 24 S...JET PROPULSION LAB IMPACT PHYSICS GROUP M ADAMS 4800 OAK GROVE DR PASADENA CA 91109-8099 3 OGARA HESS & EISENHARDT G ALLEN D

  17. An Individualized Library Skills Program.

    Science.gov (United States)

    Chappas, Bess

    This individualized program developed for students in grades 4-6 at Herman Hesse Elementary School in Georgia, is designed to provide the students with the basic library skills needed to make them independent learners in the media center. Activity sheets for student use comprise the major portion of the document. (Author/AWP)

  18. Un acompañamiento nómade en psicoterapias y psicoanálisis

    OpenAIRE

    Eva Giberti

    1999-01-01

    Debemos ir alegres por la tierra sin aferrarnos nunca como a una patria; el espíritu no quiere encadenarse. Grado a grado, nos eleva y ensancha. Apenas se acomoda nuestra vida y nos confiamos, todo se disuelve; sólo quien está pronto para irse puede escapar del hábito que mata.Grados, Herman Hesse

  19. Mechanisms of Superplastic Deformation of Nanocrystalline Silicon Carbide Ceramics

    Science.gov (United States)

    2012-08-01

    CAMPBELL MZ436 30 44 D DEBUSSCHER MZ436 20 29 J ERIDON MZ436 21 24 W HERMAN MZ435 01 24 S PENTESCU MZ436 21 24 38500 MOUND RD... HESS & EISENHARDT G ALLEN D MALONE T RUSSELL 9113 LE SAINT DR FAIRFIELD OH 45014 NO. OF NO. OF COPIES ORGANIZATION COPIES

  20. First Principles Calculation of Stress Induced Amorphization in Armor Ceramics

    Science.gov (United States)

    2011-05-01

    29 JERIDONMZ436 21 24 W HERMAN MZ435 01 24 SPENTESCUMZ436 21 24 38500 MOUND RD STERLING HTS MI 48310-3200 INTERNATL RSRCH ASSN DORPHAL 4450...PASADENA CA 91109-8099 OGARA HESS & EISENHARDT G ALLEN D MALONE T RUSSELL 9113 LE SAINT DR FAIRFIELD OH 45014 15 NO. OF COPIES ORGANIZATION

  1. In Search of High J States in the HF(v, J) System

    Science.gov (United States)

    2011-07-15

    published only for the exchange and stimulation of ideas. bcotrt W Levinson, 2nd Lt, USAF Jos Hess -, Gc-15, Director, West Coast Project Officer Office...Yardley, IEEE J. Quan. Elec. QE-6, 113 (1970). 4. N. Skribanovitz, 1. P. Herman , Ro M. Osgood, Jr., M. S. Feld, and A. Javan, Appl. Phys. Lett. 20

  2. Assessing the Learning Path Specification: a Pragmatic Quality Approach

    NARCIS (Netherlands)

    Janssen, José; Berlanga, Adriana; Heyenrath, Stef; Martens, Harrie; Vogten, Hubert; Finders, Anton; Herder, Eelco; Hermans, Henry; Melero, Javier; Schaeps, Leon; Koper, Rob

    2010-01-01

    Janssen, J., Berlanga, A. J., Heyenrath, S., Martens, H., Vogten, H., Finders, A., Herder, E., Hermans, H., Melero Gallardo, J., Schaeps, L., & Koper, R. (2010). Assessing the Learning Path Specification: a Pragmatic Quality Approach. Journal of Universal Computer Science, 16(21), 3191-3209.

  3. Celebrity Authorship and Afterlives in English and American Literature

    NARCIS (Netherlands)

    Franssen, G.; Honings, R.

    2016-01-01

    This book maps the history of literary celebrity from the early nineteenth century to the present, paying special attention to the authors’ crafting of their writerly self as well as the afterlife of their public image. Case studies are John Keats, Edgar Allan Poe, Eliza Cook, Herman Melville, Oscar

  4. Maailmakuulsa Marc Chagalli litograafiad jõudsid Pärnusse / Ants Juske

    Index Scriptorium Estoniae

    Juske, Ants, 1956-

    1999-01-01

    60. aastatel tehtud litograafiad on pärit Hannoveri Sprengeli muuseumist. Pärnu Uue Kunsti Muuseumis näitusel 'Testament' on need eksponeeritud koos Herman Talviku graafikaga, mis on pärit Rootsis elava Harald Keilandi (Ilmar Malini vend) kogust

  5. ICT in Information Services; Use and deployment of ICT in the Dutch securities trade 1860-1970

    NARCIS (Netherlands)

    J.M. Hermans

    2004-01-01

    textabstractJanneke Hermans (1973) studied history at the University of Nijmegen. She graduated in 1998. In 1999, she started as a Ph. d. candidate at the Rotterdam School of Management of the Erasmus University Rotterdam. She has conducted research on the role of information- and communication tech

  6. Alates 13. XII on Vaala galeriis avatud "Talvesalong"

    Index Scriptorium Estoniae

    2004-01-01

    Väljas on Ellinor Aiki, Valdur Ohaka, Herman Talviku, Jaak Arro, Raoul Kurvitza, Andres Toltsi, Laurentsiuse, Lembit Saartsi, Rait Rosina, Merike Estna, Maarit Murka ning Aleksandr Breneri ja Barbara Schurzi tööd. 17. XII Anna Litvinova, Ilmar Kruusamäe ja Lembit Sarapuu ühised maaliseansid

  7. Kanon i dansk 7

    DEFF Research Database (Denmark)

    Gyldendals læsebog i kanonlitteratur for 7. klasse. Med bl.a.: folkeviser, folkeeventyr, folkesagn, ordsprog samt tekster af Daniel Defoe, Ludvig Holberg, Hans Adolph Brorson, Johan Herman Wessel, Adam Oehlenschläger, N.F.S. Grundtvig, H.C. Andersen, Charles Dickens, St.St. Blicher, Holger...

  8. From Continental Discourse to "A Breath from a Better World"

    DEFF Research Database (Denmark)

    Østermark-Johansen, Lene

    2010-01-01

    Artiklen diskuterer Oscar Wildes tidlige reception i Danmark fra 1890'erne til 2. Verdenskrig. Den fokuserer bl.a. på Herman Bangs komplekse dialog med Wilde, på teaterhistorie og opsættelsespraksis af Wildes stykker i Danmark i første halvdel af 1900-tallet og på Wildes status som en kontroversi...

  9. Army Science Board 1991 Summer Study - Army Simulation Strategy

    Science.gov (United States)

    1991-12-01

    May 91, Mr. C. Hatfield, Lawrence Livermore Labor atory JANUS-Technology, 29 May 91, Mr. Paul Herman , Lawrence Livermore Laboratory Aviation...Development, 30 May 91, Mr. Mansur , US Army, Aviation Systems Command Crew Station Research and Development Facility Briefing and Demonstration, 30 May

  10. Project Clean Sweep: A Study of the U.S. Air Force International Logistics Center’s Role in the Termination of Iran’s FMS Program

    Science.gov (United States)

    1982-09-01

    October 1959-July 1960), pp. 132-139. Mansur , Abul Kasim. "The Crisis in Iran: Why the U.S. Ignored a Quarter Century of Warning," Armed Forces...and the Intelligence Gap," National Secur- ity Record, No. 17 (January 1980). Nickel, Herman , "The U.S. Failure in Iran," Fortune, 12 March 1979

  11. Psychotic symptoms in post traumatic stress disorder: a case ...

    African Journals Online (AJOL)

    QuickSilver

    2003-05-07

    May 7, 2003 ... Posttraumatic stress disorder (PTSD) is a psychiatric illness for- mally recognized with the .... addition, he received individual and group supportive psycho- therapy similar to .... is needed in this area to clarify which factors contribute to the development of ... Herman,J. Trauma & Recovery. Basic Books:New ...

  12. Leaf anatomy and photosynthesis

    NARCIS (Netherlands)

    Berghuijs, H.N.C.

    2016-01-01

    Keywords: CO2 diffusion, C3 photosynthesis, mesophyll conductance, mesophyll resistance, re-assimilation, photorespiration, respiration, tomato Herman Nicolaas Cornelis Berghuijs (2016). Leaf anatomy and photosynthesis; unravelling the CO2 diffusion pathway in C3 leaves. PhD thesis. Wageningen Unive

  13. 77 FR 68202 - Qualification of Drivers; Exemption Applications; Vision

    Science.gov (United States)

    2012-11-15

    ...) Delbert R. Bays (KY) Larry D. Brown (MD) Donald O. Clopton (AL) Stephen R. Daugherty (IN) Ronald W. Garner (WA) Paul A. Gregerson (IA) Herman Hicks (GA) Nelson V. Jaramillo (MA) Larry D. Johnson (IL) James A.... Paul (LA) Stephen P. Preslopsky (FL) Kevin L. Quastad (IA) Melinda V. Salas (CA) Patrick W. Shea...

  14. The Shock and Vibration Digest. Volume 16, Number 2

    Science.gov (United States)

    1984-02-01

    an Otto engine have been traced to the fuel mixture prepara- tion [7]. Proper modelingof propeller-induced vibra- tions has been studied [15]. An...Speed Variations in the Otto Engine ," VDI Z., 6.(63) (1979) (in German). 8. Barsch, H. and Hermans, E., "Torsional Vibra- tion Measurement of

  15. Visible-Near Infrared (VNIR) and Shortwave Infrared (SWIR) Spectral Variability of Urban Materials

    Science.gov (United States)

    2013-03-01

    classified with Hermann Hall endmembers. Herman Hall’s wings (Figure 34c) are even more geometrically complicated than the main building and have a...Sensing, IEEE Transactions on, 35(5), 1277–1285. Powell, R. L., Roberts, D. A., Dennison, P. E., & Hess , L. L. (2007). Sub-pixel mapping of urban

  16. A Retrospective Chart Review Examination of Demographic, Military, and Psychiatric Differences among Psychiatric Inpatients Admitted for Suicide-Ideation versus Suicide Attempt with an Emphasis on Gender

    Science.gov (United States)

    2014-04-30

    867-74 92. Hess DR. 2004. Retrospective Studies and Chart Reviews. Respiratory Care 49 1171-4 93. Hirsch JK, Duberstein PR, Unützer J. 2009. Chronic...maltreated and at risk: findings from the LONGSCAN studies. Child Maltreat 10:26-36 182. van der Kolk BA, Perry JC, Herman JL. 1991. Childhood origins of

  17. Maximizing PTH Anabolic Osteoporosis Therapy. Revision

    Science.gov (United States)

    2016-09-01

    of Pediatrics (Y.H., F.-C.Y.), Indiana University School of Medicine; Herman B Wells Center for Pediatric Research (Y.H., F.-C.Y.); Cellular and...2011;7:647–656. 2. Baron R, Hesse E. Update on bone anabolics in osteoporosis treat- ment: rationale, current status, and perspectives. J Clin

  18. Amino acid biogeochemistry and bacterial contribution to sediment organic matter along the western margin of the Bay of Bengal

    Digital Repository Service at National Institute of Oceanography (India)

    Fernandes, L.; Garg, A.; Borole, D.V.

    .J., 1998. Amino acids and hexosamines as indicators of organic matter degradation state in North Sea sediments. Limnol. Oceanogr. 43, 782–798. Dauwe, B., Middelburg, J.J., Herman, P.M.J., Heip, C.H.R., 1999. Linking diagenetic alteration of amino...

  19. A Counterregulatory Mechanism Impacting Androgen Suppression Therapy

    Science.gov (United States)

    2016-08-01

    Chromosomes Cancer 51, 949e960. Fu, B., Guo, M., Wang, S., Campagna, D., Luo, M., Herman , J.G., et al., 2007. Evaluation of GATA-4 and GATA-5 methylation...Parvinen M, de Rooij DG, Hess MW, Raatikainen-Ahokas A, Sainio K, Rauvala H, Lakso M, Pichel JG, Westphal H, Saarma M, Sariola H. Regulation of cell fate

  20. 12th Annual Science and Engineering Technology Conference/DoD TECH Exposition

    Science.gov (United States)

    2011-06-23

    SPAWAR CDR Will Hesse , USN (Ret) Scott Health & Safety Dr. Ed Hibsman SPAWAR Mr. Larry Hill CAS, Inc. Mrs. Cheryl Holbrook U.S. Army Space and Missile... Herman Rediess Science & Technology Directorate, DHS CAPT Brett Reissener, USN (Ret) Concurrent Technologies Corporation Ms. Denise Rhea-McKenzie Mission

  1. Avignoni totaalne teatrifestival / Andres Keil

    Index Scriptorium Estoniae

    Keil, Andres, 1974-

    2007-01-01

    Avignoni teatrifestivalil nähtust. Lähemalt Marc Wolters'i ühemeheteater "Colt Warmers", Chapelle Sainte Claire (Alfred Jarry) "Kuningas Ubu", Herman Hesse "Sidharta" mängituna India teatritrupi poolt, "Movin' Melvin Brown : Me, Ray Charles and Sammy D. Jr" ning Virgine Mirabeau koreograafial tantsuetendus "Shoult I Stay Or..." Art's Fusion esituses

  2. Humanized Androgen Receptor Mice: A Genetic Model for Differential Response to Prostate Cancer Therapy

    Science.gov (United States)

    2012-07-01

    E.A., Vessella, R., Hess , D.L., Kalhorn, T.F., Higano, C.S., True, L.D., Nelson, P.S., 2008. Maintenance of intratumoral androgens in metastatic...androgen receptor-regulated TMPRSS2:ERG gene expression in castration-resistant prostate cancer. Cancer Res 2009;69(15):6027-32. [44] Hermans KG

  3. Attentional Retraining Administered to Cigarette Smokers in the Field: Effects on Attentional Bias, Craving, and Smoking

    Science.gov (United States)

    2013-08-30

    Addiction, 108(7): 1241-1249 81. Rosse R, Miller M, Hess A, Alim T, & Deutsch S. 1993. Measures of visual scanning as a predictor of cocaine cravings...2013. Cognitive enhancement as a treatment for drug addictions. Neuropharmacology, 64: 452- 463 96. Sofuoglu M, Herman Al, Li Y, & Waters AJ. 2012

  4. Examining the Effectiveness of Mindfulness Meditation for Chronic Pain Management in Combat Veterans with Traumatic Brain Injury

    Science.gov (United States)

    2013-01-01

    Hudson, J. I., Hess , E. V., Ware, A. E., Fritz, D. A., Auchenbach, M. B., et al. (2004). Family study of fibromyalgia. Arthritis Rheum, 50(3), 944...analysis of the effect on pain and disability. Arthritis Rheum, 48(8), 2207-2213. Weathers FW, Litz BT, Herman DS, Huska JA, Keane TM. (1993). The

  5. Military NGO Interaction: The Value of Cultural Competence

    Science.gov (United States)

    2013-04-08

    see the other and honor him for what he is.”17 -- Herman Hesse Military forces are organized, trained, and equipped primarily for war fighting...17 Hesse , Hermann, and Ursule Molinaro. 2003. Narcissus and Goldmund. New York: Picador, 43. 18 Churchill, Winston. 1996. My early life, 1874-1904

  6. Cyclin D1-AR Crosstalk: Potential Implications for Therapeutic Response in Prostate Cancer

    Science.gov (United States)

    2013-06-01

    N, Esteller M, Herman JG, Jen J, Isaacs WB, Bova GS & Sidransky D 1997 Frequent inactivation of PTEN/MMAC1 in primary prostate cancer. Cancer...estimation of the cell doubling time on the basis of cell culture monitoring data. Biocybernet Biomed Engineer 2008; 28: 75–82. 65 Wetherill YB, Hess

  7. Cost Effectiveness Analysis of Hygiene-Based Strategies Aimed Toward Prevention of SSTI and MRSA-Associated SSTI Among U.S. Active Duty Army Trainees

    Science.gov (United States)

    2015-03-25

    60 93. Herman RA, Kee VR, Moores KG, Ross MB. 2008. Etiology and treatment of community-associated methicillin-resistant Staphylococcus aureus. Am J...claims. Curr Med Res Opin 24:2821-8 130. Master D, Hess Longe SH, Dickson H. 1997. Scheduled hand washing in an elementary school population. Fam Med 29

  8. Mechanisms of Dynamic Deformation and Dynamic Failure in Aluminum Nitride

    Science.gov (United States)

    2012-06-01

    D DEBUSSCHER MZ436 20 29 J ERIDON MZ436 21 24 W HERMAN MZ435 01 24 S PENTESCU MZ436 21 24 38500 MOUND RD STERLING HTS MI 48310...3200 1 JET PROPULSION LAB IMPACT PHYSICS GROUP M ADAMS 4800 OAK GROVE DR PASADENA CA 91109-8099 3 OGARA HESS & EISENHARDT

  9. The Compressive Failure of Aluminum Nitride Considered as a Model Advanced Ceramic

    Science.gov (United States)

    2012-06-01

    WAY VISTA CA 92083 6 GDLS W BURKE MZ436 21 24 G CAMPBELL MZ436 30 44 D DEBUSSCHER MZ436 20 29 J ERIDON MZ436 21 24 W HERMAN ...ADAMS 4800 OAK GROVE DR PASADENA CA 91109-8099 3 OGARA HESS & EISENHARDT G ALLEN D MALONE T RUSSELL 9113 LE SAINT DR

  10. Advanced Chemical Measurements of Smoke from DoD-prescribed Burns

    Science.gov (United States)

    2014-04-01

    Coeckerberghs, H., Compernolle, F., Peeters, J., Vereecken, L., Fantechi, G., Hermans , I., Coeck, C., Nguyen, T.L., Jacobs, P., Arijs, E., Amelynck, C...database for the 9 µm region of the formic acid spectrum,” J. Quant. Spectrosc. Rad. Transfer, 108, 363-370, (2007). Pfister, G.G., Emmons, L.K., Hess

  11. Recovery of deep-sea meiofauna after artificial disturbance in the Central Indian Basin

    Digital Repository Service at National Institute of Oceanography (India)

    Ingole, B.S.; Goltekar, N.R.; Gonsalves, S.; Ansari, Z.A.

    ., Vanaverbeke, J., Heip, C., Herman, P.M.J., Middelburg, J.J., Sandee, A., Duineveld, G., 1997. Nematode distribution in ocean margin sediments of the Goban Spur (Northeast Atlantic) in relation to sediment geochemistry. Deep-Sea Research I,44...

  12. Interspecies Scaling in Blast Neurotrauma

    Science.gov (United States)

    2015-08-27

    Body." American Journal of Physiology -- Legacy Content 184, 1: 119-26. Clifford, C, Jaeger, J, Moe, J and Hess , J. 1984. "Gastrointestinal lesions...Emergency Care 10, 2: 165-72. Savage, VM, Allen, AP, Brown, JH, Gillooly, JF, Herman , AB, Woodruff, WH and West, GB. 2007. "Scaling of number, size

  13. Quantifying Bulk Plasticity and Predicting Transition Velocities for Armor Ceramics Using Hardness Indentation Tests

    Science.gov (United States)

    2012-07-01

    ORGANIZATION COPIES ORGANIZATION 22 1 GLDS MZ436 01 24 W HERMAN 38500 MOUND RD STERLING HEIGHTS MI 48310-3200 3 GLDS MZ436 21 24...LAB IMPACT PHYSICS GROUP M ADAMS 4800 OAK GROVE DR PASADENA CA 91109-8099 3 OGARA HESS & EISENHARDT G ALLEN D MALONE T RUSSELL

  14. AcEST: BP918775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available telium di... 31 3.6 sp|Q9MUR3|TILS_MESVI tRNA(Ile)-lysidine synthase, chloroplastic ... 30 8.1 sp|Q9VHN9|HPS5_DROME Herman...YQIVTCHQ 91 >sp|Q9VHN9|HPS5_DROME Hermansky-Pudlak syndrome 5 protein homolog OS=Drosophila melanogaster GN=

  15. Modeling Relevant to Safe Operations of U.S. Navy Vessels in Arctic Conditions: Physical Modeling of Ice Loads

    Science.gov (United States)

    2016-06-01

    Modeling Relevant to Safe Operations of U.S. Navy Vessels in Arctic Conditions.” The program manager was Dr. Paul Hess in Code 331, Structural...of Ice–Structure Interaction. Engineering Fracture Mechanics 68:1923–60. Jordaan, I. J., M. A. Maes, P. W. Brown, and I. P. Hermans . 1993

  16. Un acompañamiento nómade en psicoterapias y psicoanálisis

    OpenAIRE

    Eva Giberti

    1999-01-01

    Debemos ir alegres por la tierra sin aferrarnos nunca como a una patria; el espíritu no quiere encadenarse. Grado a grado, nos eleva y ensancha. Apenas se acomoda nuestra vida y nos confiamos, todo se disuelve; sólo quien está pronto para irse puede escapar del hábito que mata.Grados, Herman Hesse

  17. Environmental Impact Statement for the Modernization and Enhancement of Ranges, Airspace, and Training Areas in the Joint Pacific Alaska Range Complex in Alaska. Volume 2 - Appendices A through L

    Science.gov (United States)

    2013-06-01

    river at Paxson 136 C-3 Hayes Range 17 B-2 Healy 59 A-2 Hess Mountain 270 B-2 Isabel Pass 234 C-3 Jarvis Creek area 47 C-2 JCALF area 190 B-1...2007. Personal communication with Herman Griese, Biological Resources Manager, 3 CES/CEVP, Elmendorf AFB, Alaska. Hottman, S.D., J.J. Fittipaldi

  18. The Role of YY1 in Prostate Cancer

    Science.gov (United States)

    2010-03-01

    cancer cells. J Biol Chem, 2005; 280(26):24428-24434. 5. Erkeland SJ, Valkhof M, Heijmans-Antonissen C, Delwel R, Valk PJ, Hermans MH and Touw IP...7260-74. 174. Alvarez-Salas LM, Benitez- Hess ML, Dipaolo JA. YY- 1 and c-Jun transcription factors participate in the repression of the human

  19. Impacts of Enhanced Reductive Bioremediation on Post-Remediation Groundwater Quality

    Science.gov (United States)

    2015-11-15

    Surface Soils. J. Environ. Qual. 4: 1173-1181. Cozzarelli, I. M., Herman , J. S., Baedecker, M. J. and Fischer, J. M., 1999. Geochemical heterogeneity...denitrification. Nature 440(7086): 918-921. Repert, D.A., Barber, L.B., Hess , K.M., Keefe, S.H., Kent, D.B., Leblanc, D.R., Smith, R.L., 2006

  20. First War Syndrome: Military Culture, Professionalization, and Counterinsurgency Doctrine

    Science.gov (United States)

    2010-02-01

    sources and scouts; the program was named the "Kit Carson Scouts" by Major General Herman Nickerson, commander of the 1 ’t Marine Division.575 For the...See Pamela Hess , "Building Security in Barwanah," a two part article from United Press International Security and Terrorism, February 27 and March 2

  1. Stress Wave and Damage Propagation in Transparent Laminates at Elevated Temperatures

    Science.gov (United States)

    2010-03-01

    DEBUSSCHER MZ436 20 29 J ERIDON MZ436 21 24 W HERMAN MZ435 01 24 S PENTESCU MZ436 21 24 38500 MOUND RD STERLING HTS MI 48310-3200...GROVE DR PASADENA CA 91109-8099 3 OGARA HESS & EISENHARDT G ALLEN D MALONE T RUSSELL 9113 LE SAINT DR FAIRFIELD OH 45014 2

  2. An Individualized Library Skills Program.

    Science.gov (United States)

    Chappas, Bess

    This individualized program developed for students in grades 4-6 at Herman Hesse Elementary School in Georgia, is designed to provide the students with the basic library skills needed to make them independent learners in the media center. Activity sheets for student use comprise the major portion of the document. (Author/AWP)

  3. The Effects of Explosive Blast as Compared to Post-Traumatic Stress Disorder on Brain Function and Stucture

    Science.gov (United States)

    2011-04-01

    Hammeke T, Hess D, Hopewell A, Orme D, et al. Official position of the Military TBI Task Force on the role of neuro- psychology and rehabilitation...Whitney, K. A., Davis, J. J., Shepard, P. H., & Herman , S. M. (2008). Utility of the Response Bias Scale (RBS) and other MMPI-2 validity scales

  4. 77 FR 42728 - Information Collection(s) Being Reviewed by the Federal Communications Commission, Comments...

    Science.gov (United States)

    2012-07-20

    ... have practical utility; the accuracy of the Commission's burden estimate; ways to enhance the quality... send them to: PRA@fcc.gov . FOR FURTHER INFORMATION CONTACT: Judith B. Herman, Office of Managing... universal service support programs (High-Cost, Low-Income, Rural Health Care and Schools and Libraries)....

  5. 75 FR 39016 - Notice of Public Information Collection(s) Being Reviewed by the Federal Communications...

    Science.gov (United States)

    2010-07-07

    ...; (b) the accuracy of the Commission's burden estimate; (c) ways to enhance the quality, utility, and... CONTACT: Judith B. Herman, Office of Managing Director, (202) 418-0214. For additional information... program (formerly known as the schools and libraries universal support program), eligible...

  6. 75 FR 18206 - Notice of Public Information Collection(s) Being Reviewed by the Federal Communications...

    Science.gov (United States)

    2010-04-09

    ...; (b) the accuracy of the Commission's burden estimate; (c) ways to enhance the quality, utility, and...: Judith B. Herman, Office of Managing Director, (202) 418-0214. For additional information, contact Judith...: 3060-1062. Title: Schools and Libraries Universal Service Support (E-Rate) Program, Notification...

  7. 75 FR 28806 - Notice of Public Information Collection(s) Being Reviewed by the Federal Communications...

    Science.gov (United States)

    2010-05-24

    ... estimate; (c) ways to enhance the quality, utility, and clarity of the information collected; (d) ways to... via email to PRA@fcc.gov . FOR FURTHER INFORMATION CONTACT: Judith B. Herman, Office of Managing... Service - Schools and Libraries Universal Service Program. Form Nos.: FCC Forms 470 and 471. Type...

  8. 75 FR 33618 - Notice of Public Information Collection(s) Being Submitted for Review and Approval to the Office...

    Science.gov (United States)

    2010-06-14

    ... accuracy of the Commission's burden estimate; (c) ways to enhance the quality, utility, and clarity of the... INFORMATION CONTACT: Judith B. Herman, Office of Managing Director, (202) 418-0214. For additional information... Libraries Universal Service Support Program (``E-rate'') Broadband Survey. Form Number: N/A. Type of...

  9. 75 FR 34738 - Notice of Public Information Collection(s) Being Reviewed by the Federal Communications...

    Science.gov (United States)

    2010-06-18

    ... estimate; (c) ways to enhance the quality, utility, and clarity of the information collected; (d) ways to... via email to PRA@fcc.gov . FOR FURTHER INFORMATION CONTACT: Judith B. Herman, Office of Managing... libraries that are eligible to receive discounted Internet ] access and internal connections have in...

  10. 75 FR 60457 - Notice of Public Information Collection(s) Being Reviewed by the Federal Communications...

    Science.gov (United States)

    2010-09-30

    ...; (b) the accuracy of the Commission's burden estimate; (c) ways to enhance the quality, utility, and... CONTACT: Judith B. Herman, Office of Managing Director, (202) 418-0214. For additional information..., Administration, and Oversight; Federal-State Joint Board on Universal Service; Schools and Libraries...

  11. 75 FR 45113 - Notice of Public Information Collection(s) Being Submitted for Review and Approval to the Office...

    Science.gov (United States)

    2010-08-02

    ... accuracy of the Commission's burden estimate; (c) ways to enhance the quality, utility, and clarity of the... INFORMATION CONTACT: Judith B. Herman, Office of Managing Director, (202) 418-0214. For additional information... Service - Schools and Libraries Universal Service Program. Form Numbers: FCC Forms 470 and 471. Type...

  12. 75 FR 22592 - Notice of Public Information Collection(s) Being Submitted for Review and Approval to the Office...

    Science.gov (United States)

    2010-04-29

    ...; (b) the accuracy of the Commission's burden estimate; (c) ways to enhance the quality, utility, and... INFORMATION CONTACT: Judith B. Herman, Office of Managing Director, (202) 418-0214. For additional information... Libraries Universal Service Support Program (``E-Rate'') Broadband Survey. Form Number: N/A. Type of...

  13. 78 FR 40475 - Information Collection(s) Being Reviewed by the Federal Communications Commission, Comments...

    Science.gov (United States)

    2013-07-05

    ... have practical utility; the accuracy of the Commission's burden estimate; ways to enhance the quality... FURTHER INFORMATION CONTACT: Judith B. Herman, Office of Managing Director, (202) 418-0214. SUPPLEMENTARY INFORMATION: OMB Control Number: 3060-0806. Title: Universal Service--Schools and Libraries Universal...

  14. 78 FR 34096 - Information Collection Being Submitted for Review and Approval to the Office of Management and...

    Science.gov (United States)

    2013-06-06

    ... have practical utility; the accuracy of the Commission's burden estimates; ways to enhance the quality... INFORMATION CONTACT: Judith B. Herman, Office of Managing Director, FCC, at 202-418-0214. SUPPLEMENTARY INFORMATION: OMB Control Number: 3060-0856. Title: Universal Service--Schools and Libraries Universal...

  15. Ahab——The main Character in Moby-dick

    Institute of Scientific and Technical Information of China (English)

    佟玉平

    2007-01-01

    Herman Melville is not only a great Romanticist in the American literary history but also an influential figure in the world.Moby--dick,which was published in 1851,is his representative work..This thesis focus on the analysis of the character of the hero--the captain Ahab from three aspects:his pride,his madness,his humanity.

  16. Moby-Dick. [Lesson Plan].

    Science.gov (United States)

    Soderquist, Alisa

    Based on Herman Melville's novel "Moby-Dick," this lesson plan presents activities designed to help students understand that the novel is grounded in facts that Melville acquired in his own experiences at sea; New England was the center of a prospering whaling industry in the 19th century; and journal keeping was not uncommon among 19th-century…

  17. 77 FR 26278 - Information Collection Being Reviewed by the Federal Communications Commission

    Science.gov (United States)

    2012-05-03

    ... Security Bureau (PSHSB) which maintains an Internet Web site portal for the electronic submission of the... the Internet at Judith-b.herman@fcc.gov . To submit your PRA comments by email send them to: PRA@fcc...- profit Institutions. Number of Respondents: 118 respondents; 15,444 responses. Estimated Time...

  18. 77 FR 8256 - Information Collection Being Reviewed by the Federal Communications Commission

    Science.gov (United States)

    2012-02-14

    ... the Internet at Judith-b.herman@fcc.gov . To submit your PRA comments by email send them to: PRA@fcc...: Business or other for-profit entities, not-for-profit institutions, Federal Government, and state, local or... contact information. The Commission's Public Safety and Homeland Security Bureau (PSHSB) updated...

  19. Reliability of Professional Judgments in Forensic Child Sexual Abuse Evaluations: Unsettled or Unsettling Science?

    Science.gov (United States)

    Everson, Mark D.; Sandoval, Jose Miguel; Berson, Nancy; Crowson, Mary; Robinson, Harriet

    2012-01-01

    In the absence of photographic or DNA evidence, a credible eyewitness, or perpetrator confession, forensic evaluators in cases of alleged child sexual abuse must rely on psychosocial or "soft" evidence, often requiring substantial professional judgment for case determination. This article offers a three-part rebuttal to Herman's (2009) argument…

  20. Learning from Demonstration for Autonomous Navigation in Complex Unstructured Terrain

    Science.gov (United States)

    2010-06-24

    Hap- pold , M., Herman, H., Mandelbaum, R., Pilarski, T., Rander, P., Thayer, S., Vallidis, N., and 30 Warner, R. (2006). Toward reliable off road au...Ollis et al., 2007] Ollis, M., Huang, W. H., and Hap- pold , M. (2007). A bayesian approach to imitation learning for robot navigation. In

  1. The Army and Team Learning

    Science.gov (United States)

    2008-05-01

    Fishkill) 5 1 2 1 1 COL Saul Mentorship Article 1 Letter USMA app request 4 1 1 1 1 1LT letter on NG AFATDS fielding 1 Letter response to Chief...Leaders Learn. San Francisco: Jossey Bass /Pfeiffer, 2000. Herman, Ellen. Team Learning: Literature Review. Boston: Boston University School of

  2. Pallas kuuvalgel ehk Lõpetamata peatükk eesti kunstis / Enn Lillemets

    Index Scriptorium Estoniae

    Lillemets, Enn, 1958-

    2009-01-01

    Pallase kunstikooli 90. aastapäeva tähistav näitus "Lõpetamata Pallas" Tartu Linnamuuseumis 31. oktoobrini. Loetletud 19 osalejat. Väljapaneku autoritel jäi Pallase kool lõpetamata, näituse aines on valitud peamiselt Teise maailmasõja aastaist 1940-1945. Pikemalt Varmo Pirgi ja Herman Aunapuu töödest

  3. Learning Problems and the TS Child [and] Specific Classroom Strategies and Techniques for Students with Tourette Syndrome [and] Techniques To Aid Students with TS in Completing Written Assignments.

    Science.gov (United States)

    Davidovicz, Herman; And Others

    Three fact sheets provide parents and educators with basic information on Tourette Syndrome (TS). The first sheet is titled "Learning Problems and the TS Child" and is by Herman Davidovicz, a neuropsychologist. It notes the high frequency of attention deficit disorders and learning problems in children with TS and provides information…

  4. How to Integrate Learning Design into Existing Practice

    NARCIS (Netherlands)

    Janssen, José; Hermans, Henry

    2005-01-01

    This chapter is provided as full text at Springer online (also available here). Janssen, J. & Hermans, H. (2005). How to Integrate Learning Design into Existing Practice. In: Koper, R. & Tattersall, C., Learning Design: A Handbook on Modelling and Delivering Networked Education and Training (pp.

  5. Generalization of the coherent-state path integrals and systematic derivation of semiclassical propagators

    Science.gov (United States)

    Koda, Shin-Ichi; Takatsuka, Kazuo

    2011-03-01

    The coherent path integral is generalized such that the identity operator represented in a complete (actually overcomplete) set of the coherent states with the “time-variable” exponents are inserted between two consecutive short-time propagators. Since such a complete set of any given exponent can constitute the identity operator, the exponent may be varied from time to time without loss of generality as long as it is set common to all the Gaussians. However, a finite truncation of the coherent state expansion should result in different values of the propagator depending on the choice of the exponents. Furthermore, approximation methodology to treat with the exact propagator can also depend on this choice, and thereby many different semiclassical propagators may emerge from these combinations. Indeed, we show that the well-known semiclassical propagators such as those of Van Vleck, Herman-Kluk, Heller’s thawed Gaussian, and many others can be derived in a systematic manner, which enables one to comprehend these semiclassical propagators from a unified point of view. We are particularly interested in our generalized form of the Herman-Kluk propagator, since the relative accuracy of this propagator has been well established by Kay, and since, nevertheless, its derivation was not necessarily clear. Thus our generalized Herman-Kluk propagator replaces the classical Hamiltonian with a Gaussian averaged quantum Hamiltonian, generating non-Newtonian trajectories. We perform a numerical test to assess the quality of such a family of generalized Herman-Kluk propagators and find that the original Herman-Kluk gives an accurate result. The reason why this has come about is also discussed.

  6. Speaking My Mind: Stop Reading Shakespeare!

    Science.gov (United States)

    Spangler, Susan

    2009-01-01

    Reading skills are vital to student success, and those skills could be practiced with Shakespeare "if students are taught reading skills in the classroom." The problem is that many teachers of English do not consider themselves reading specialists and do not teach reading skills to their students. Fred L. Hamel notes that teachers in a recent…

  7. Query Optimization by Semantic Reasoning.

    Science.gov (United States)

    1981-05-01

    Haas, Doug Hofstadter, Elaine Kant, Peggy Karp , Fred Lakin, Ruth Andrea Levinson, Paul Martin, Larry Masinter, Thorne McCarty, Brian McCune, Charles...design. McGraw-Hill, New York, 1977. [Wilson80) Wilson, Gerald A. A conceptual model for semantic integrity checking. In Proc. Sixth Itl. Conference on

  8. The recognition unit of FIBCD1 organizes into a noncovalently linked tetrameric structure and uses a hydrophobic funnel (S1) for acetyl group recognition

    DEFF Research Database (Denmark)

    Thomsen, Theresa; Moeller, Jesper B; Schlosser, Anders

    2010-01-01

    We have recently identified FIBCD1 (Fibrinogen C domain containing 1) as a type II transmembrane endocytic receptor located primarily in the intestinal brush border. The ectodomain of FIBCD1 comprises a coiled coil, a polycationic region, and a C-terminal FReD (fibrinogen-related domain) that ass......We have recently identified FIBCD1 (Fibrinogen C domain containing 1) as a type II transmembrane endocytic receptor located primarily in the intestinal brush border. The ectodomain of FIBCD1 comprises a coiled coil, a polycationic region, and a C-terminal FReD (fibrinogen-related domain......) that assembles into disulfide-linked homotetramers. The FIBCD1-FReD binds Ca(2+) dependently to acetylated structures like chitin, N-acetylated carbohydrates, and amino acids. FReDs are present in diverse innate immune pattern recognition proteins including the ficolins and horseshoe crab TL5A. Here, we use...... combined with site-directed mutagenesis to define the binding site involved in the interaction of FIBCD1 with acetylated structures. We show that mutations of central residues (A432V and H415G) in the hydrophobic funnel (S1) abolish the binding of FIBCD1 to acetylated bovine serum albumin and chitin...

  9. Interaction between Seabed Soil and Offshore Wind Turbine Foundations

    DEFF Research Database (Denmark)

    Hansen, Nilas Mandrup

    velocity given by Darcy’s law (Sumer and Fredsøe, 2002, chap. 10). The constitutive equation for the soil considered in the model is the familiar stress-strain relationship for linear poro-elastic soils. The so-called no-slip boundary condition is adopted on the surface of the rocking pile. The numerical...

  10. A Good Story: A Commentary on "Contextualizing the Intermediate Financial Accounting Courses in the Global Financial Crisis"

    Science.gov (United States)

    Phillips, Fred; Johnstone, Nathalie; Mackintosh, Brandy

    2011-01-01

    Bloom and Webinger (2011) present an intuitively agreeable proposition: embedding topics within an engaging and meaningful context can promote many desirable learning behaviours and outcomes. As instructors, Fred Phillips, Nathalie Johnstone, and Brandy Mackintosh have seen this play out many times in their classrooms. Thus, in a sense, they were…

  11. Using Text Documents from American Memory.

    Science.gov (United States)

    Singleton, Laurel R., Ed.

    2002-01-01

    This publication contains classroom-tested teaching ideas. For grades K-4, "'Blessed Ted-fred': Famous Fathers Write to Their Children" uses American Memory for primary source letters written by Theodore Roosevelt and Alexander Graham Bell to their children. For grades 5-8, "Found Poetry and the American Life Histories…

  12. Kool mahutab end Barbie ja Super Mario kõrvale / Eva Kübar

    Index Scriptorium Estoniae

    Kübar, Eva

    2006-01-01

    Täna alustavad oma esimest koolipäeva Harjumaal Kiili gümnaasiumi 1. klassis Annaliisa Mals ja Fred Rohi, kes rääkisid oma mõtetest ja tunnetest sama kooli abiturientidele Heleri Kivilile ja Kaile Kullamaale

  13. The Use of Fuzzy Set Classification for Pattern Recognition of the Polygraph

    Science.gov (United States)

    1993-12-01

    and David C. Raskin, "Human versus computerized evaluations of polygraph data in a laboratory setting, "Journal of Applied Psycology , Vol.73, 1988 No2...of Applied Psycology , Vol.73, 1988 No 2, pp. 291-308 [3] John E. Reid and Fred E. Inbau, Truth and Deception: The Polygraph ( Lie Detector

  14. A Public Relations Model for the Department of Defense During Combat Contingencies

    Science.gov (United States)

    1990-11-01

    Under orders from an American infantry platoon leader, Lieutenant William L. Calley, Jr., 109 men, women and children of the My Lai Village were...Jan 31, 1990: 7. 152 Fred Francis. "An Evaluation of the DOD Media Pool," United States Southern Command Public Affairs After Action Report Suplement

  15. Rotary jagas stipendiume

    Index Scriptorium Estoniae

    2009-01-01

    Pärnu Rotary klubi aastapäevapeol 11. mail Ammende villas anti stipendium viiele Pärnumaa noorele, teiste seas pälvis preemia Pärnu Ülejõe Gümnaasiumi muusikaõpetaja Fred Rõigas ja Pärnu Muusikakoolis trompetit õppiv Chris Sommer

  16. 77 FR 64483 - Circular Welded Carbon-Quality Steel Pipe from the Socialist Republic of Vietnam: Notice of Final...

    Science.gov (United States)

    2012-10-22

    ...: Fred Baker or Robert James, AD/CVD Operations, Office 7, Import Administration, International Trade..., Deputy Assistant Secretary for Antidumping and Countervailing Duty Operations, to Paul Piquado, Assistant...), Room 7046 of the Main Department of Commerce building. In addition, a complete version of the Issues...

  17. 78 FR 79665 - Welded Carbon Steel Standard Pipe and Tube Products From Turkey: Final Results of Antidumping...

    Science.gov (United States)

    2013-12-31

    ...: Victoria Cho, Fred Baker, or Robert James, AD/CVD Operations, Office VI, Enforcement and Compliance... Christian Marsh, Deputy Assistant Secretary for Antidumping and Countervailing Duty Operations, to Paul... parties in the Central Records Unit, room 7046 of the main Department of Commerce building. In addition, a...

  18. Driving down the road toll : videos of lectures given as Adelaide Thinker in Residence 2011-2012.

    NARCIS (Netherlands)

    Wegman, F.C.M.

    2013-01-01

    Professor Fred Wegman is one of the world’s most respected road safety experts. Fred’s residency has focused on making our roads safer, looking at our roads, the vehicles, road users and travel speeds. This record contains his final lecture, completing his third and final visit to South Australia an

  19. U.S. Nuclear Cooperation with India: Issues for Congress

    Science.gov (United States)

    2010-10-28

    adopted the legislation August 25; the Rajya Sabha adopted it August 30. 7 Natalie Obiko Pearson, “India Risks Nuclear Isolation with Break From...id=19697&prog=zgp&proj=znpp,zsa, and Daryl G. Kimball and Fred McGoldrick “U.S.-Indian Nuclear Agreement: A Bad Deal Gets Worse,” August 3, 2007, at

  20. Perspectives on Interlanguage Phonetics and Phonology.

    Science.gov (United States)

    Monroy, Rafael, Ed.; Gutierrez, Francisco, Ed.

    2001-01-01

    Articles in this special issue include the following: "Allophonic Splits in L2 Phonology: The Questions of Learnability" (Fred R. Eckman, Abdullah Elreyes, Gregory K. Iverson); "Native Language Influence in Learners' Assessment of English Focus" (M. L. Garcia Lecumberri); "Obstruent Voicing in English and Polish. A…