Henri Becquerel and the discovery of natural radioactivity
International Nuclear Information System (INIS)
Barquins, M.
2003-01-01
This article presents the life and achievements of Henri Becquerel particularly in the domain of natural radioactivity which he discovered. In 1903 H.Becquerel was awarded the Nobel prize of physics (jointly with the Curies). The author highlights the importance of his talent but also the influence of his family background: his grand-father and father were both renowned scientists
Henri Becquerel: the discovery of radioactivity
International Nuclear Information System (INIS)
Allisy, A.
1996-01-01
This paper recalls the history of the Becquerel family, the fascinating time of the discovery of radioactivity as well as some important related research published before the radium age. Henri Becquerel was the third in the line of a family of scientists which extended over more than a hundred years. Following in the footsteps of his father and grandfather gave him a thorough grounding in scientific research methods. Science at the turn of the century was very exciting, the discovery of X rays had just been announced and scientists everywhere were hoping to discover new phenomena. (author)
Why it was natural for Henri Becquerel to discover natural radioactivity
International Nuclear Information System (INIS)
Barquins, M.
2002-01-01
This article presents the scientific saga of the Becquerel family. 4 generations of Becquerel Antoine-Cesar (1788-1878), Edmond (1820-1891), Henri (1852-1906) and Jean (1878-1953) were involved in scientific activities at the highest level. Henri was awarded the Nobel prize of physics (shared with Pierre and Marie Curie) in 1903 for the discovery of radioactivity. The author shows that the discovery of radioactivity was due to talent, family emulation, genetics and chance. (A.C.)
The discovery of uranic rays: a short step for Henri Becquerel but a giant step for science
International Nuclear Information System (INIS)
Genet, M.
1995-01-01
In March 1896, Antoine Henri Becquerel discovered radioactivity. This success is largely due to a tradition of high-level scientific research which prevailed over three generations in the Becquerel family. The circumstances of the discovery and the controversies which followed are reviewed within the framework of their scientific and historical context. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Fournier, J.; Niepce, J.C.
2009-09-15
Abel Niepce was rarely mentioned during the celebration of the centenary of the radioactivity discovery.This discovery, supposed due to chance alone, is entirely attributed to Henri Becquerel. But Abel Niepce who made the first observation of radiation from uranium with the impression of a photographic plate, but without giving it meaning. This is a slow process which in forty years, from an observation misunderstood by Abel Niepce to its interpretation by Frederick Soddy, through the experiments of Henri Becquerel and thanks to developments in other knowledge (electron, X-rays) has led to a scientific progress known under the term of radioactivity, name given by Marie Slodowska-Curie. (N.C.)
Development of low-energy X-ray spectrometry at the Laboratoire National Henri Becquerel
International Nuclear Information System (INIS)
Lepy, M.C.; Plagnard, J.
2007-01-01
In the frame of the French Metrology Institute, the Laboratoire National Henri Becquerel performs accurate characterization of semiconductor detectors that are in use in a number of applications. Their efficiency calibration, energy resolution and the detailed shape of their response function are parameters of interest for accurate processing of low-energy X-ray spectra to be applied to elements identification and fundamental research studies. The tools specifically developed for low-energy detectors calibration and characterization are described, from the use of radioactivity standard to the development of a tunable monochromatic X-ray source. (Author)
The discovery of uranic rays: short step for Henri Becquerel but a giant step for science
International Nuclear Information System (INIS)
Genet, M.
1998-01-01
In March 1896, Antoine Becquerel discovered radioactivity. This success is largely due to a tradition of high-level scientific research which prevailed over three generations in the Becquerel family. The circumstances of the discovery and the controversies which followed are reviewed within the framework of their scientific and historical context. (author)
Energy Technology Data Exchange (ETDEWEB)
Newbold, B T [Moncton Univ., NB (Canada). Dept. of Chemistry and Biochemistry
1996-09-01
The year 1996 marks the 100th anniversary of the discovery of natural radioactivity by the French physicist Antoine Henri Becquerel while studying the behaviour of a fluorescent uranium salt on exposure to sunlight. The great importance of this development has been underlined by Bagnall who stated that `The scientific scene at the dawn of the 20th century was dominated by the excitement generated from Becquerel`s discovery ... ` [1]. However, the discovery of radioactivity did not attract much attention initially when compared with that accorded to the more penetrating X rays found by the German physicist Wilhelm Konrad Roentgen in 1895. Roentgen received the 1901 Nobel Prize for physics for his outstanding discovery. Fortunately, the significance of Becquerel`s contribution was quickly realized and in 1903 he was also awarded the Nobel Prize for physics, which he shared with Pierre Curie and Marie Skoldowska Curie, who were honoured for their research on the radiation phenomenon reported by Becquerel. 9 refs., 1 tab.
International Nuclear Information System (INIS)
Newbold, B.T.
1996-01-01
The year 1996 marks the 100th anniversary of the discovery of natural radioactivity by the French physicist Antoine Henri Becquerel while studying the behaviour of a fluorescent uranium salt on exposure to sunlight. The great importance of this development has been underlined by Bagnall who stated that 'The scientific scene at the dawn of the 20th century was dominated by the excitement generated from Becquerel's discovery ... ' [1]. However, the discovery of radioactivity did not attract much attention initially when compared with that accorded to the more penetrating X rays found by the German physicist Wilhelm Konrad Roentgen in 1895. Roentgen received the 1901 Nobel Prize for physics for his outstanding discovery. Fortunately, the significance of Becquerel's contribution was quickly realized and in 1903 he was also awarded the Nobel Prize for physics, which he shared with Pierre Curie and Marie Skoldowska Curie, who were honoured for their research on the radiation phenomenon reported by Becquerel. 9 refs., 1 tab
Henri Becquerel: serendipitous brilliance
Margaritondo, Giorgio
2008-06-01
Serendipity has always been an attendant to great science. Arno Penzias and Robert Wilson discovered the cosmic background radiation after first mistaking it for the effect of pigeon droppings on their microwave antenna. US spy satellites detected gamma-ray bursts when surveying the sky for evidence of secret Soviet nuclear tests during the Cold War. Satyendra Bose arrived at Bose-Einstein statistics only after discovering that a mathematical error explained the experimental data concerning the photoelectric effect. In the words of science-fiction writer Isaac Asimov, "The most exciting phrase in science is not 'Eureka!', but rather, 'That's funny...'.
Becquerel and natural origin radioactivity
International Nuclear Information System (INIS)
2011-01-01
After a brief presentation of the Becquerel as radioactivity measurement unit, this document briefly explains the origin of natural radioactivity (Earth formation and cosmic rays), gives and comments the evolution of radioactivity of some radionuclides (U 238 and descendants, Th 232 and descendants, K 40 ) between 4.5 billions yeas ago and nowadays. It also gives assessments of natural radioactivity due to radon in the atmosphere and in the soil, of natural radioactivity in building materials, coals, ashes, seawater and food. Some remarkable figures are then given
International Nuclear Information System (INIS)
Menezes, Filipe; Fedorov, Alexander; Baleizão, Carlos; Berberan-Santos, Mário N; Valeur, Bernard
2013-01-01
Ensemble fluorescence decays are usually analyzed with a sum of exponentials. However, broad continuous distributions of lifetimes, either unimodal or multimodal, occur in many situations. A simple and flexible fitting function for these cases that encompasses the exponential is the Becquerel function. In this work, the applicability of the Becquerel function for the analysis of complex decays of several kinds is tested. For this purpose, decays of mixtures of four different fluorescence standards (binary, ternary and quaternary mixtures) are measured and analyzed. For binary and ternary mixtures, the expected sum of narrow distributions is well recovered from the Becquerel functions analysis, if the correct number of components is used. For ternary mixtures, however, satisfactory fits are also obtained with a number of Becquerel functions smaller than the true number of fluorophores in the mixture, at the expense of broadening the lifetime distributions of the fictitious components. The quaternary mixture studied is well fitted with both a sum of three exponentials and a sum of two Becquerel functions, showing the inevitable loss of information when the number of components is large. Decays of a fluorophore in a heterogeneous environment, known to be represented by unimodal and broad continuous distributions (as previously obtained by the maximum entropy method), are also measured and analyzed. It is concluded that these distributions can be recovered by the Becquerel function method with an accuracy similar to that of the much more complex maximum entropy method. It is also shown that the polar (or phasor) plot is not always helpful for ascertaining the degree (and kind) of complexity of a fluorescence decay. (paper)
Comparison of the acute effects of Tulbaghia violacea William Henry ...
African Journals Online (AJOL)
Purpose: To assess the effect of the crude methanol leaf extracts of Tulbaghia violacea William Henry Harvey (Alliaceae) on blood pressure (BP) and heart rate in ageing normotensive Wistar Kyoto rats (WKY), and compare the results obtained with those for adult spontaneously hypertensive rats (SHR). Methods: T.
International Nuclear Information System (INIS)
Okada, Hisashi; Yamaguchi, Yoshihisa; Yamamoto, Shuji
2014-01-01
Contaminated soil and incineration ash collected during offsite decontamination work following the accident at the Fukushima Daiichi Nuclear Power Station of Tokyo Electric Power Co., Inc. is being stored in flexible containers. These containers are managed taking their activity level into account in accordance with the Decontamination Guidelines issued by the Ministry of the Environment. Toshiba has developed the 'Becquerel Screening' device that can automatically measure the activity level of the contents of each flexible container simply by placing the container on a palette, without the need to take samples for analysis from the container. The Becquerel Screening device is expected to contribute not only to improved operational efficiency but also to reduced exposure of operators to radiation, because it eliminates the need for direct contact with contaminated soil and ash. (author)
Obituary: Henry Emil Kandrup, 1955-2003
Merritt, David; Gottesman, Stephen T.
2004-12-01
Henry Emil Kandrup died on 18 October 2003 at his home in Gainesville Florida. Henry was a theoretical astrophysicist specializing in the application of chaotic dynamics to stellar systems. At the time of his death, Henry was a Professor at the University of Florida where he had taught for 13 years. Henry was born in Manhasset, New York on July 24, 1955 and spent most of his childhood in Great Neck. His parents, Jytte and Fred, were immigrants from Denmark where his father had worked as a silver smith. Henry was a precocious child, skipping both third and fifth grades. With the help of Sidney Spivack, a professor of sociology at Columbia University, his parents enrolled Henry in the Brooks Preparatory School in Andover, Massachusetts. After graduating at age 16, Henry enrolled at Cornell, transferring to Princeton the following year. Henry's parents adored their only child and worked hard to provide him with intellectual opportunities. Henry became an accomplished musician (organ, piano, French horn) and linguist (English, Danish, German) and was a passionate devotee of opera and ballet. Henry received his PhD in 1980 from the University of Chicago, where his thesis advisor was James Ipser. He taught at Oakland University in Michigan and Syracuse University in New York before coming to the University of Florida in 1990. Henry was sui generis. He shunned conventionality in his personal appearance and in his public demeanor, and always chose forthrightness and candor over polite silence. But to those of us who knew Henry well, his bluntness was a reflection of his intellectual consistency. Henry always said exactly what he thought, both in his published work and his public presentations, and never compromised himself for the sake of appearances. Nothing that he said or wrote was less than fully thought out. Henry's PhD thesis was entitled "Stochastic Problems in Stellar Dynamics," and most of his subsequent research was in this field. Motion in stellar systems can be
Penlington, A.
2010-01-01
This essay will consider recent shifts in performance representations of England and the exotic ‘other’ in Shakespeare’s Henry IV, Henry V and Henry VI plays. By tracing the texts’ varied representations of non-English Britons and those for whom English is not their mother tongue (such as Owen Glyndwr in 1 Henry IV and Princess Catherine in Henry V), recent criticism has identified that Shakespeare’s narrative portrays the challenges of assimilating ‘otherness’ within English culture. This es...
Marie Curie: In the laboratory and on the battlefield
International Nuclear Information System (INIS)
Badash, Lawrence
2003-01-01
This year is the centennial of the Nobel Prize in Physics shared by Henri Becquerel and the Curies for their pioneering work on radioactivity. But Marie Curie's contribution to the medical use of x rays is not widely known
Pearce, J M S
2009-04-01
Little is generally known of Henry Gray, the author of Gray's Anatomy, and even less of his colleague Henry Vandyke Carter, who played a vital role in the dissections and illustrations leading to the production of the first volume in 1859. This essay attempts to sketch briefly the salient, know aspects of these two men and their divergent careers. It traces succinctly the subsequent fate of the unique anatomy book that has influenced and instructed almost every student of medicine. (c) 2009 Wiley-Liss, Inc.
VoxHenry: FFT-Accelerated Inductance Extraction for Voxelized Geometries
Yucel, Abdulkadir C.; Georgakis, Ioannis P.; Polimeridis, Athanasios G.; Bagci, Hakan; White, Jacob K.
2018-01-01
inductance extractor, FastHenry. Just like FastHenry, VoxHenry solves a combination of the electric volume integral equation and the current continuity equation, but with three distinctions that make VoxHenry suitable and extremely efficient for analyzing
VoxHenry: FFT-Accelerated Inductance Extraction for Voxelized Geometries
Yucel, Abdulkadir C.
2018-01-18
VoxHenry, a fast Fourier transform (FFT)-accelerated integral-equation-based simulator for extracting frequency-dependent inductances and resistances of structures discretized by voxels, is presented. VoxHenry shares many features with the popular inductance extractor, FastHenry. Just like FastHenry, VoxHenry solves a combination of the electric volume integral equation and the current continuity equation, but with three distinctions that make VoxHenry suitable and extremely efficient for analyzing voxelized geometries: 1) it leverages a carefully selected set of piecewise-constant and piecewise-linear basis functions; 2) it exploits FFTs to accelerate the matrix-vector multiplications during the iterative solution of system of equations; and 3) it employs a sparse preconditioner to ensure the rapid convergence of iterative solution. VoxHenry is capable of accurately computing frequency-dependent inductances and resistances of arbitrarily shaped and large-scale structures on a desktop computer. The accuracy, efficiency, and applicability of VoxHenry are demonstrated through inductance analysis of various structures, including square and circular coils as well as arrays of RF inductors (situated over ground planes).
Radioactivity. From radioelements to scientific applications
International Nuclear Information System (INIS)
2002-09-01
Radioactivity was not invented by man. It was discovered just over a century ago, in 1896, by the French physicist Henri Becquerel. He was attempting to find out whether the rays emitted by fluorescent uranium salts were the same as the X-rays discovered in 1895 by the German physicist Wilhelm Roentgen. He thought that the uranium salts, after being excited by light, emitted these X-rays. Imagine his surprise when, in Paris in March 1896, he discovered that photographic film had been exposed without 'Radioactivity was not invented by man. It is a natural phenomenon that was discovered at the end of the 19. century'. He concluded that uranium emitted invisible radiation, different from X-rays, spontaneously and inexhaustibly. The phenomenon he discovered was named radioactivity (from the Latin radius, meaning ray). Following Henri Becquerel's work, in 1898 Pierre and Marie Curie isolated polonium and radium, unknown radioactive elements present in uranium ore. (authors)
Henri Poincaré: Death centenary (1854-1912)
Heinzmann, Gerhard; Villani, Cédric
2014-08-01
The year 2012 marked the centenary of the death of Henri Poincaré (Nancy, 1854-Paris, 1912), and through the agency of the Henri-Poincaré Institute in Paris, the Henri-Poincaré Archives in Nancy and The London Mathematical Society, brought with it several exhibitions and meetings commemorating one of the greatest minds in contemporary times. Often referred to as the last polymath, Poincaré embraced multiple branches of mathematics, theoretical physics and celestial mechanics, and made significant contributions to philosophy of science (Heinzmann & Stump, Henri Poincaré, 2013). He wrote 25 textbooks and monographs, 500-plus articles, and was deeply involved in the organization and administration of science at both the national and international levels.1
Henry VIII, McLeod syndrome and Jacquetta's curse.
Stride, P; Lopes Floro, K
2013-01-01
The mental decline of King Henry VIII from being a jovial, charismatic and athletic young man into an increasingly paranoid, brutal tyrant in later life, ever more concerned at his lack of one or more male heirs, has attracted many medical diagnostic theories. Previous hypotheses have included diabetes, syphilis and hypothyroidism, among others. However, these inadequately explain Henry's failure to produce a male heir, despite multiple pairings. The latest postulated diagnoses for Henry are the coexistence of both Kell blood group antigenicity (possibly inherited from Jacquetta Woodville, Henry's maternal great grandmother) causing related impaired fertility, and McLeod syndrome, causing psychotic changes. As the mutated McLeod protein of the syndrome significantly reduces the expression, effectively inactivating the Kell antigen, we critically review this theory, examining in detail the pathophysiology of these conditions and assessing the genealogy of Henry VIII and its effect in subsequent generations.
Directory of Open Access Journals (Sweden)
Željko Kaluđerović
2014-04-01
Full Text Available In this paper the author discusses the views and statements of the French football player Thierry Henry he gave after his illegal play during the playoff match between France and the Republic of Ireland to claim one of the final spots in the World Cup 2010 in South Africa. First, by controlling the ball with his hand before passing it on for the goal Henry has shown disregard for the constitutive rules of football. Then, by stating that he is "not a referee" he demonstrated that for some players rules are not inherent to football and that they can be relativized, given that for them winning is the goal of the highest ontological status. Furthermore, he has rejected the rules of sportsmanship, thus expressing his opinion that the opponents are just obstacles which have to be removed in order to achieve your goals. Henry's action has disrupted major moral values, such as justice, honesty, responsibility and beneficence. The rules of fair play have totally been ignored both in Henry's action and in the Football Association of France's unwillingness to comment on whether a replay should take place. They have ignored one of the basic principles stated in the "Declaration of the International Fair Play Committee", according to which, fair play is much more than playing to the rules of the game; it's about the attitude of the sportsperson. It's about respecting your opponent and preserving his or her physical and psychological integrity. Finally, the author believes that the rules, moral values and fair play in football are required for this game to become actually possible to play
Directory of Open Access Journals (Sweden)
Željko Kaluđerović
2014-04-01
Full Text Available In this paper the author discusses the views and statements of the French football player Thierry Henry he gave after his illegal play during the playoff match between France and the Republic of Ireland to claim one of the final spots in the World Cup 2010 in South Africa. First, by controlling the ball with his hand before passing it on for the goal Henry has shown disregard for the constitutive rules of football. Then, by stating that he is "not a referee" he demonstrated that for some players rules are not inherent to football and that they can be relativized, given that for them winning is the goal of the highest ontological status. Furthermore, he has rejected the rules of sportsmanship, thus expressing his opinion that the opponents are just obstacles which have to be removed in order to achieve your goals. Henry's action has disrupted major moral values, such as justice, honesty, responsibility and beneficence. The rules of fair play have totally been ignored both in Henry's action and in the Football Association of France's unwillingness to comment on whether a replay should take place. They have ignored one of the basic principles stated in the "Declaration of the International Fair Play Committee", according to which, fair play is much more than playing to the rules of the game; it's about the attitude of the sportsperson. It's about respecting your opponent and preserving his or her physical and psychological integrity. Finally, the author believes that the rules, moral values and fair play in football are required for this game to become actually possible to play.
Joseph Henry's Conception of Scientific Knowledge
Theerman, Paul
1997-04-01
Joseph Henry, America's premier physicist and physics teacher in the mid-nineteenth century, had decided views of scientific knowledge. These were expressed in two ways. First of all, scientific knowledge led to moral betterment. Thus the study of science was a morally good thing. This was not only because it led to the contemplation of God's creation, which was a standard reason justifying the study of science dating from the Scientific Revolution and even earlier. More importantly, the study of science itself was a moral discipline, imparting to scientists the habits and virtues of truthfulness, respect for others, care and diligence, and the discernment of meaningful patterns from experience. The moral ideals of science were expressed most strongly in Henry's upholding the international "Republic of Science"; conversely, cheapening science was a sign of moral failure. Second, for Henry and his generation, science provided a path to sure truth, separate from falsehood of both the politics and the quackery that characterized mid-century public life. Henry promoted this in his championing of the Smithsonian Institution a scientific establishment, against the ideas of others who wanted to make it a literary establishment or a training school for teachers. For Henry, the Smithsonian's scientific reputation would be established by relying on careful peer review in its publications, and supporting established scientists to write authoritative popular works. The purpose of both these activities was to raise the profile of science in the United States and further establish science and the scientific method as a guide to public life.
Vanglateenistuse enesekaitsekoolitus / Henri Palm
Palm, Henri
2014-01-01
Vanglateenistus korraldab Tartus, Tallinnas ja Jõhvis enesekaitsekoolitusi gümnaasiumiõpilastele. Jakob Westholmi abiturient Henri Palm on osalenud treeningutel osalenud kolm aastat ning jagab kogemusi
Kolmanda maailma raudteekunn / Henry Posner ; interv. Krister Kivi
Posner, Henry
2005-01-01
Raudteeärimees Henry Posner III, kes kuulub ka Eesti Raudtee omanikeringi, oma äritegevusest, sealhulgas investeeringutest Eestisse. Suhtumisest raudteeturu avamisse. Lisa: Henry Posner mängib rongidega maailma hämarates nurkades
Dune-Yardang Interactions in Becquerel Crater, Mars
Urso, Anna; Chojnacki, Matthew; Vaz, David A.
2018-02-01
Isolated landscapes largely shaped by aeolian processes can occur on Earth, while the majority of Mars' recent history has been dominated by wind-driven activity. Resultantly, Martian landscapes often exhibit large-scale aeolian features, including yardang landforms carved from sedimentary-layered deposits. High-resolution orbital monitoring has revealed that persistent bedform activity is occurring with dune and ripple migration implying ongoing abrasion of the surface. However, little is known about the interaction between dunes and the topography surrounding them. Here we explore dune-yardang interactions in Becquerel crater in an effort to better understand local landscape evolution. Dunes there occur on the north and south sides of a 700 m tall sedimentary deposit, which displays numerous superposed yardangs. Dune and yardang orientations are congruent, suggesting that they both were formed under a predominantly northerly wind regime. Migration rates and sediment fluxes decrease as dunes approach the deposit and begin to increase again downwind of the deposit where the effect of topographic sheltering decreases. Estimated sand abrasion rates (16-40 μm yr-1) would yield a formation time of 1.8-4.5 Myr for the 70 m deep yardangs. This evidence for local aeolian abrasion also helps explain the young exposure ages of deposit surfaces, as estimated by the crater size-frequency distribution. Comparisons to terrestrial dune activity and yardang development begin to place constraints on yardang formation times for both Earth and Mars. These results provide insight into the complexities of sediment transport on uneven terrain and are compelling examples of contemporary aeolian-driven landscape evolution on Mars.
Dune-Yardang Interactions in Becquerel Crater, Mars.
Urso, Anna; Chojnacki, Matthew; Vaz, David A
2018-01-01
Isolated landscapes largely shaped by aeolian processes can occur on Earth, while the majority of Mars' recent history has been dominated by wind-driven activity. Resultantly, Martian landscapes often exhibit large-scale aeolian features, including yardang landforms carved from sedimentary-layered deposits. High-resolution orbital monitoring has revealed that persistent bedform activity is occurring with dune and ripple migration implying ongoing abrasion of the surface. However, little is known about the interaction between dunes and the topography surrounding them. Here we explore dune-yardang interactions in Becquerel crater in an effort to better understand local landscape evolution. Dunes there occur on the north and south sides of a 700 m tall sedimentary deposit, which displays numerous superposed yardangs. Dune and yardang orientations are congruent, suggesting that they both were formed under a predominantly northerly wind regime. Migration rates and sediment fluxes decrease as dunes approach the deposit and begin to increase again downwind of the deposit where the effect of topographic sheltering decreases. Estimated sand abrasion rates (16-40 μm yr -1 ) would yield a formation time of 1.8-4.5 Myr for the 70 m deep yardangs. This evidence for local aeolian abrasion also helps explain the young exposure ages of deposit surfaces, as estimated by the crater size-frequency distribution. Comparisons to terrestrial dune activity and yardang development begin to place constraints on yardang formation times for both Earth and Mars. These results provide insight into the complexities of sediment transport on uneven terrain and are compelling examples of contemporary aeolian-driven landscape evolution on Mars.
TWC Editor
2008-01-01
An interview with Henry Jenkins focussing on Transformative Works and Cultures (TWC), the Organization for Transformative Works (OTW), and Jenkins' academic research into fan and participatory cultures.
Energy Technology Data Exchange (ETDEWEB)
Ksouri, W.; Denoziere, M.; Lecerf, N.; Leroy, E.
2009-07-01
The Laboratoire national Henri Becquerel (LNE-LNHB) has developed national dosimetric standards for x-rays of low and medium energies. This article describes these standards which are aimed at applications of radiation protection of workers and patients in the fields of medical diagnosis and industrial x-ray radiation. Developments for contact radiotherapy are also discussed. (author)
Directory of Open Access Journals (Sweden)
TWC Editor
2008-09-01
Full Text Available An interview with Henry Jenkins focussing on Transformative Works and Cultures (TWC, the Organization for Transformative Works (OTW, and Jenkins' academic research into fan and participatory cultures.
Henry David Thoreau's Spiritual World
Institute of Scientific and Technical Information of China (English)
马云
2013-01-01
Henry David Thoreau was wholeheartedly in love with nature and he devoted almost all his life time to observation, appreciation and study of nature. Thus he formed a deep understanding of nature. In 1845, Thoreau began a two-year and two-month residence at Walden Pond. His life was lonely but full of fragrance. He wanted to live meaningfully, confront the essential facts of life and live a simple life. Based on the review of the literature related to this topic, this paper aims to study Henry David Thoreau’s spiritual world, especially reflected in his famous book-Walden.
Centennial of the discovery of radioactivity - 1896-1898/1996-1998
International Nuclear Information System (INIS)
Bimbot, R.; Casse, M.
2009-01-01
This document summarizes the impacts that the discovery of radioactivity in 1896 has had on the scientific world: 1 - historical aspects (biographies of Henri Becquerel, Pierre Curie and Marie Curie-Sklodowska; context; history of radioactivity discovery; examples of radioactive half-lives); 2 - development of matter sciences (radiochemistry; nuclear and particle physics; nuclear and particle astrophysics); 3 - dating and energy applications: isotope dating; power generation (fission, fusion, nuclear reactor components, reactor types, radioactive wastes); 4 - biological, medical and agronomic applications (biological researches, medical diagnosis, clinical exploration and therapies, man's exposure to ionizing radiations, natural and artificial radioactivity, sources, doses and radiation effects, radioactivity in the Saclay area, radioactivity changes with places, research tool in plants biology and agronomic. Reprints of original communications presented by H. Becquerel and P. and M. Curie at the sessions of the French Academy of Sciences between 1896 and 1906, as well as the talks given at the Academy for the funerals of H. Becquerel, are attached to the document. (J.S.)
Henry Ford Health Systems evolved from a hospital into a system delivering care to 2.5 million patients and includes the Cancer Epidemiology, Prevention and Control Program, which focuses on epidemiologic and public health aspects of cancer.
Atomic Pioneers Book 2 From the Mid-19th to the Early 20th Century
Energy Technology Data Exchange (ETDEWEB)
Hiebert, Ray [University of Maryland; Hiebert, Roselyn
1971-01-01
This book gives a brief account of the lives and work of 26 men and women who contributed to the great surge of knowledge vital to atomic science from the 1800s to the mid-1900s. The 26 are: William Prout, Michael Faraday, Eilhardt Mitscherlich, Joseph Henry, Thomas Graham, Stanislao Cannizzaro, James Clerk Maxwell, Dmitri I. Mendeleev, Joseph Norman Lockyer, John William Strutt, Wilhelm Konrad Roentgen, Antione Henri Becquerel, Hendrik A. Lorentz, J.J. Thomson, Max Planck, Svante A. Arrhenius, Pierre Curie, Marie Curie, Pieter Zeeman, Theodore W. Richards, C.T.R. Wilson, Ernest Rutherford, Francis W. Aston, Frederick Soddy, Lise Meitner, and Otto Hahn.
[Hypospadia and infertility of Henry II of France (1519-1559)].
Hatzinger, M; Al-Shajlawi, S; Sohn, M
2014-03-01
Henry II (1519-1559) of France was the second son of Francis I (1494-1547) and Claude de France (1498-1524) born in 1519 in St. Germain-en-Laye. After his older brother's and his father's death in 1547, he was anointed the French king in Reims. In 1533 already, as a 14-year-old boy, for reasons of state, he was married to the same aged Catherine de Medici (1519-1589), as her uncle was Pope Clement VII (1478-1534). The marriage remained childless for 11 years since Henry, due to a distinct hypospadia and a completely sexually inexperienced wife was unable to conceive children with her. His existing liaison to Diane de Poitiers (1499-1566) - a 19-year-older maid of honor of his father Francis I from 1537 until his death - influenced his sexual life immensely.The blame for the childless marriage was placed primarily on his wife, as Henry had become father of an illegitimate daughter with a mistress. Catherine then underwent all possible medical and alchemical procedures to finally give birth to the hoped Dauphin. Ironically, her rival for the favor of her husband, Diane de Poitiers was one of her greatest allies. She made clear that the cause lay with Henry and not with his wife. This was confirmed by the added solid physician Jean Fernel (1497-1558). His treatment of Henry and the simultaneous training of the unexperienced Catherine by Diane de Poitiers led to success.The result was the birth of Francis II (1544-1560) in 1544, the first of 10 children in 12 years. Thus, the dynasty was saved. After the death of Henry in a tragic tournament accident in 1559, three of his sons became kings of France. But the line of Valois remained without further descendants and was continued by Henry IV, the first Bourbon king in 1589.
Henri Poincaré a biography through the daily papers
Ginoux, Jean-Marc
2014-01-01
On July 17, 2012, the centenary of Henri Poincaré's death was commemorated; his name being associated with so many fields of knowledge that he was considered as the Last Universalist. In Pure and Applied Mathematics, Physics, Astronomy, Engineering and Philosophy, his works have had a great impact all over the world. Poincaré acquired in his lifetime such a reputation that, both nationally and internationally, his life and career were made the object of various articles in the daily papers not only in France, but also in the USA. Some of his philosophical concepts have even caused sharp controversies in the Press (as we will discover in this book).This work presents an original portrait of Henri Poincaré based on various press cuttings from The New York Times, The San Francisco Sunday Call, The Times, The Sun, The Washington Post that chronicled unknown anecdotes of his life (for example, his first name was actually not Henri, but Henry; he obtained his high school diploma in sciences with a zero in mathem...
Richardson, Ruth
2016-03-01
The first edition of Anatomy Descriptive and Surgical (1858) was greeted with accolades, but also provoked serious controversy concerning Henry Gray's failure to acknowledge the work of earlier anatomists. A review in the Medical Times (1859) accused Gray of intellectual theft. The journal took the unusual step of substantiating its indictment by publishing twenty parallel texts from Gray and from a pre-existing textbook, Quain's Anatomy. At the recent "Vesalius Continuum" conference in Zakynthos, Greece (2014) Professor Brion Benninger disputed the theft by announcing from the floor the results of a computer analysis of both texts, which he reported exonerated Gray by revealing no evidence of plagiarism. The analysis has not been forthcoming, however, despite requests. Here the historian of Gray's Anatomy supplements the argument set out in the Medical Times 150 years ago with data suggesting unwelcome personality traits in Henry Gray, and demonstrating the utility of others' work to his professional advancement. Fair dealing in the world of anatomy and indeed the genuineness of the lustre of medical fame are important matters, but whether quantitative evidence has anything to add to the discussion concerning Gray's probity can be assessed only if Benninger makes public his computer analysis. © 2015 Wiley Periodicals, Inc.
Contaminant Monitoring Strategy for Henrys Lake, Idaho
Energy Technology Data Exchange (ETDEWEB)
John S. Irving; R. P. Breckenridge
1992-12-01
Henrys Lake, located in southeastern Idaho, is a large, shallow lake (6,600 acres, {approx} 17.1 feet maximum depth) located at 6,472 feet elevation in Fremont Co., Idaho at the headwaters of the Henrys Fork of the Snake River. The upper watershed is comprised of high mountains of the Targhee National Forest and the lakeshore is surrounded by extensive flats and wetlands, which are mostly privately owned. The lake has been dammed since 1922, and the upper 12 feet of the lake waters are allocated for downriver use. Henrys Lake is a naturally productive lake supporting a nationally recognized ''Blue Ribbon'' trout fishery. There is concern that increasing housing development and cattle grazing may accelerate eutrophication and result in winter and early spring fish kills. There has not been a recent thorough assessment of lake water quality. However, the Department of Environmental Quality (DEQ) is currently conducting a study of water quality on Henrys Lake and tributary streams. Septic systems and lawn runoff from housing developments on the north, west, and southwest shores could potentially contribute to the nutrient enrichment of the lake. Many houses are on steep hillsides where runoff from lawns, driveways, etc. drain into wetland flats along the lake or directly into the lake. In addition, seepage from septic systems (drainfields) drain directly into the wetlands enter groundwater areas that seep into the lake. Cattle grazing along the lake margin, riparian areas, and uplands is likely accelerating erosion and nutrient enrichment. Also, cattle grazing along riparian areas likely adds to nutrient enrichment of the lake through subsurface flow and direct runoff. Stream bank and lakeshore erosion may also accelerate eutrophication by increasing the sedimentation of the lake. Approximately nine streams feed the lake (see map), but flows are often severely reduced or completely eliminated due to irrigation diversion. In addition, subsurface
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 17; Issue 7. The Life of Henry Eyring - From Mines to Molecules. Deepika Janakiraman. General Article Volume 17 Issue 7 July 2012 pp 625-634. Fulltext. Click here to view fulltext PDF. Permanent link:
Henrys Fork near Ashton, ID (YHEN)
Department of the Interior — Henrys Fork near Ashton, Idaho (YHEN) Sample Collection: Samples were collected near the USGS stream gage 13046000 (Latitude 44°04'11", Longitude 111°30'38" NAD83)....
Henri Tamm : algul küsiti mult kogu aeg autogrammi / Henri Tamm ; interv. Ada Kallam
Tamm, Henri
2005-01-01
Draamaseriaali "Kodu keset linna" lapsnäitleja. Lisaks kolleegid Henrist : M. Veinmann "Tekst on tal esimesena peas", K. Maibaum "Võrdväärne partner suurtele". Artikkel pealkirjaga "Henri Tamm : nüüd saan veidi puhkust" : Linnaleht nr. 22, 3. juuni 2005, A2-A3
Henry Taube and Coordination Chemistry
dropdown arrow Site Map A-Z Index Menu Synopsis Henry Taube and Coordination Chemistry Resources with Professor of Chemistry, Emeritus, at Stanford University, received the 1983 Nobel Prize in Chemistry " there from 1940-41. "I became deeply interested in chemistry soon after I came to Berkeley,"
W.E. Henry Symposium compendium: The importance of magnetism in physics and material science
Energy Technology Data Exchange (ETDEWEB)
Carwell, H.
1997-09-19
This compendium contains papers presented at the W. E. Henry Symposium, The Importance of Magnetism in Physics and Material Science. The one-day symposium was conducted to recognize the achievements of Dr. Warren Elliot Henry as educator, scientist, and inventor in a career spanning almost 70 years. Dr. Henry, who is 88 years old, attended the symposium. Nobel Laureate, Dr. Glenn Seaborg, a friend and colleague for over 40 years, attended the event and shared his personal reminiscences. Dr. Seaborg is Associate Director-At-Large at the Lawrence Berkeley National Laboratory. The Compendium begins with three papers which demonstrate the ongoing importance of magnetism in physics and material science. Other contributions cover the highlights of Dr. Henry`s career as a researcher, educator, and inventor. Colleagues and former students share insights on the impact of Dr. Henry`s research in the field of magnetism, low temperature physics, and solid state physics; his influence on students as an educator; and his character, intellect and ingenuity, and passion for learning and teaching. They share a glimpse of the environment and times that molded him as a man, and the circumstances under which he made his great achievements despite the many challenges he faced.
Should bulk cloudwater or fogwater samples obey Henry's law?
Pandis, Spyros N.; Seinfeld, John H.
1991-06-01
Mixing of droplets with different pH that are individually in Henry's law equilibrium with the surrounding atmosphere always results in a bulk mixture that is supersaturated with weak acids like S(IV) and HCOOH, and bases like NH3 with respect to the original atmosphere. High supersaturations result only when the pH of the bulk droplet mixture exceeds the pKa of the species, in which pH range large pH differences among droplets of different sizes lead to large deviations from Henry's law for the bulk mixture. The deviation is shown to depend on the ratio of the arithmetic mean to the harmonic mean of the hydrogen ion concentrations of the droplets with the liquid water content used as weighting factor in the calculation of the means. The theory developed can explain observed discrepancies from Henry's law in atmospheric samples and also other observed phenomena like the reported increase of pH values of bulk aqueous samples during storage.
Energy Technology Data Exchange (ETDEWEB)
Juquois, F. [PHOTEIS, 13 - Aix en Provence (France)
2010-04-15
The photoelectric effect has been characterized in 1839 by Henry Becquerel. More than one hundred years later, in 1958, the first photovoltaic cell is developed for the space exploration. After the first oil shock in 1973, the occidental governments have started considering photovoltaic as one of the potential alternative to fossil in the future. 36 years later, photovoltaic is blossoming on the roof tops of dwellings and commercial buildings, as well as on the poor agricultural value lands. (author)
Photovoltaic electricity applications: history and perspectives
International Nuclear Information System (INIS)
Juquois, F.
2010-01-01
The photoelectric effect has been characterized in 1839 by Henry Becquerel. More than one hundred years later, in 1958, the first photovoltaic cell is developed for the space exploration. After the first oil shock in 1973, the occidental governments have started considering photovoltaic as one of the potential alternative to fossil in the future. 36 years later, photovoltaic is blossoming on the roof tops of dwellings and commercial buildings, as well as on the poor agricultural value lands. (author)
Translating China : Henri Borel (1869-1933)
Heijns, A.J.
2016-01-01
This thesis investigates how Dutch sinologist Henri Borel ‘translated’ China, by examining his renditions of Chinese literature and the writings about China that he produced over a period of forty years. Borel studied Hokkien Chinese at Leiden University and in Xiamen toward a career as Chinese
46 CFR 7.55 - Cape Henry, VA to Cape Fear, NC.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Cape Henry, VA to Cape Fear, NC. 7.55 Section 7.55 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY PROCEDURES APPLICABLE TO THE PUBLIC BOUNDARY LINES Atlantic Coast § 7.55 Cape Henry, VA to Cape Fear, NC. (a) A line drawn from Rudee Inlet Jetty Light “2” to...
Directory of Open Access Journals (Sweden)
Jeannine Hayat
2007-01-01
Full Text Available Miss Grief is a story by Constance Fenimore Woolson, an American novelist who often wrote about the difficulty a woman had in becoming an artist — a writer or a painter — in the nineteenth century. This tale is a very strange text, a kind of anticipation of a meeting to come, in Italy, in 1880, between Woolson and Henry James, and a friendship which lasted until the former’s death in 1894. For thirteen years, both writers would share a common inspiration. Death itself could not break the links between the two authors, who were connected even when settled in different European countries. William James, who was a member of the American Society for Psychical Research, probably helped his brother Henry to communicate — or so it appears — in some way with Woolson, even after her fatal accident, or possible suicide, in Venice. Henry James probably had in mind Miss Grief, a story by his dead friend, before writing some of his books. Indeed, Woolson had been the first to develop the image of “the figure in the carpet,” which was later transformed by Henry James. Woolson was also the first to devise a plot which Henry James would later use as a canvas for his novel The Wings of the Dove. What is an author and what is authorship? It seems impossible to separate what is Woolson’s and what is Henry James’s in four works of fiction that are in fact to be read together : Miss Grief, The Figure in the Carpet, The Beast in the Jungle, The Wings of the Dove.
INOVATION AND ANTREPRENEURIAL CREATIVITY BUSINESS DURING HENRY FORD
Directory of Open Access Journals (Sweden)
GHICAJANU MIHAELA
2015-03-01
Full Text Available In this paper I presented the innovation and entrepeneurial creativity as a basis in the process of business redesign. I chose as a case study the the Ford brand products, because it is considered that Henry Ford is one of the greatest innovators and entrepreneurs of all time and I decided to present and to analyze these things. The first part of the paper will include theoretical approaches on the innovation and creativity business concepts and premises, and then I showed the ways in which four types of economic innovation under the leadership of Henry Ford (innovation in product, in process, market and organizational were achieved, with the purpose to recognize them in other companies, nowadays .
Energy Technology Data Exchange (ETDEWEB)
Anon
2009-07-01
The activities of this section are entrusted to the Henry Becquerel national laboratory (LNE-LNHB), the national laboratory of metrology of the CEA-Saclay, and to the laboratory of dose metrology (LMDN) under the management of IRSN-Cadarache. They treat of ionizing radiations metrology in the domains of activity, photons and charged particles dosimetry, and basic data. This article summarizes the 2008 works carried out at both laboratories: international actions and comparisons, instrumentation improvements, establishment of national references. (J.S.)
Transcendentalism and Henry Barnard's "School Architecture"
Rothfork, John
1977-01-01
Sketches the intellectual and sociological climate that led Henry Barnard to advocate Greek Revival architecture for school buildings, takes a look at why this style and its implicit values were popular in the era between 1820-1860, and examines a few of the plans in Barnard's "School Architecture" (1838-48). (Author/RK)
Pornografia e transgressão na obra literária de Henry Miller
Directory of Open Access Journals (Sweden)
Raquel Catunda Pereira
2016-07-01
Full Text Available The North American writer Henry Miller was marginalized by literary critics since the first publications of his works in the 40s. Accused of being a pornographic text, the book Tropic of Cancer (1934 was forbidden in many countries. This article aims to analyze the obscene in Henry Miller’s work to prove that, beyond the erotic intention, Miller’s books are an expression of freedom and rejection of moral standards. In order to achieve our goal, we will use as theoretical basis the articles Criticismo e sexualidade: uma leitura de Tropico of Capricorn de Henry Miller, by Flávia Andréa Rodrigues Benfatt, and Literatura marginal americana: do épico confessional ao niilismo erótico, by Lainister de Oliveira. The texts mentioned above grant us the argumentation necessary to the analysis of pornographic discourse in Henry Miller’s literary works as the author’s aesthetics choice of taking himself as a transgressor in a decadent society.
Kesknoored tegid visiidi Šveitsi / Henri Kaselo
Kaselo, Henri
2005-01-01
Keskerakonna noorte esindus külastas 20.-25. aprillini 2005 Šveitsi, et osaleda sealsete noorte liberaalide Jungfreisinnige Schweizi kongressil. Delegatsiooni kuulusid esimees Tarmo Lausing, välissekretär Olga Sõtnik, endine pressisekretär Raimond Kaljulaid ja noortekogu esimees Henri Kaselo
International Nuclear Information System (INIS)
Kitamura, Yoshinori; Muroo, Yoji; Hamanaka, Isao
2003-01-01
A new type of burnable poison (BP) volume reduction system is currently being developed. Many BP rods, a subcomponent of spent fuel assemblies are discharged from nuclear power reactors. This new system reduces the overall volume of BP rods. The main system consists of BP rod cutting equipment, equipment for the recovery of BP cut pieces, and special transport equipment for the cut rods. The equipment is all operated by hydraulic press cylinders in water to reduce operator exposure to radioactivity. (author)
Antoine-Henri Jomini: A Bibliographical Survey.
Alger, John I.
Although the writings of Antoine-Henri Jomini influenced military thought during the 19th and 20th centuries, the obscurity of their publishing history has led to misunderstandings of the development and substance of Jomini's thought. This review attempts to (1) point out the continuity of his thought on the conduct of war, and (2) provide an…
Henry Morgenthau's voice in history.
Steiner, Pamela
2015-01-01
Henry Morgenthau (1856-1946) distinguished himself as the U.S. Ambassador to the Ottoman Empire, 1913-1916, and as the chairman of the League of Nations Refugee Settlement Commission (RSC) for Greece, 1923-24. I describe aspects of his early life that shaped the man he became, his accomplishments in these two posts, and his feelings about himself over time. At the end I briefly describe his attitude toward a possible Jewish state in Palestine.
Moerbeke, Pierre; Moll, Victor
2015-01-01
This volume presents a selection of papers by Henry P. McKean, which illustrate the various areas in mathematics in which he has made seminal contributions. Topics covered include probability theory, integrable systems, geometry and financial mathematics. Each paper represents a contribution by Prof. McKean, either alone or together with other researchers, that has had a profound influence in the respective area.
Energy Technology Data Exchange (ETDEWEB)
Jockey, [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1963-07-01
The Henry construction is a convenient way to interpret the total absorption peaks in gamma spectrometry by exploiting their statistical significance. It is so possible to determine graphically, and accurately, such values as: - position of the peak - resolution, etc. The main practical applications are considered. (author) [French] La construction de la droite de Henry fournit un moyen commode d'interpreter les pics d'absorption totale en spectrometrie gamma en exploitant leur signification statistique, il est ainsi possible de determiner graphiquement, avec precision, des notions telles que: - position du pic - resolution, etc. Les principales applications pratiques sont envisagees. (auteur)
Robert Henry Thurston: Professionalism and Engineering Education
Nienkamp, Paul
2016-01-01
Robert Henry Thurston is presented in this article. He provides one the most significant examples of professionalizing engineering through innovative education and promoting scientific education practices in the late nineteenth century. The son of a draftsmen and steam engine mechanic, Thurston spent his early years in Providence, Rhode Island.…
The Teaching Approach of Henry Schaefer-Simmern.
Abrahamson, Roy E.
1980-01-01
This description of the teaching approach of Henry Schaefer-Simmern emphasizes his use of questioning to evoke student self-evaluation and to develop clarity of vision and interfunctional unity in students' art products and their mental, artistic conceiving. Two case reports of his work with elementary students are included. (Author/SJL)
Bryant, Maria; Burton, Wendy; Cundill, Bonnie; Farrin, Amanda J; Nixon, Jane; Stevens, June; Roberts, Kim; Foy, Robbie; Rutter, Harry; Hartley, Suzanne; Tubeuf, Sandy; Collinson, Michelle; Brown, Julia
2017-01-24
Family-based interventions to prevent childhood obesity depend upon parents' taking action to improve diet and other lifestyle behaviours in their families. Programmes that attract and retain high numbers of parents provide an enhanced opportunity to improve public health and are also likely to be more cost-effective than those that do not. We have developed a theory-informed optimisation intervention to promote parent engagement within an existing childhood obesity prevention group programme, HENRY (Health Exercise Nutrition for the Really Young). Here, we describe a proposal to evaluate the effectiveness of this optimisation intervention in regard to the engagement of parents and cost-effectiveness. The Optimising Family Engagement in HENRY (OFTEN) trial is a cluster randomised controlled trial being conducted across 24 local authorities (approximately 144 children's centres) which currently deliver HENRY programmes. The primary outcome will be parental enrolment and attendance at the HENRY programme, assessed using routinely collected process data. Cost-effectiveness will be presented in terms of primary outcomes using acceptability curves and through eliciting the willingness to pay for the optimisation from HENRY commissioners. Secondary outcomes include the longitudinal impact of the optimisation, parent-reported infant intake of fruits and vegetables (as a proxy to compliance) and other parent-reported family habits and lifestyle. This innovative trial will provide evidence on the implementation of a theory-informed optimisation intervention to promote parent engagement in HENRY, a community-based childhood obesity prevention programme. The findings will be generalisable to other interventions delivered to parents in other community-based environments. This research meets the expressed needs of commissioners, children's centres and parents to optimise the potential impact that HENRY has on obesity prevention. A subsequent cluster randomised controlled pilot
International Nuclear Information System (INIS)
Chan, J.G.
2000-01-01
Full text: A monograph for Fluorodeoxyglucose F-18 Injection (FDG) was first released in Supplement 1 of the United States Pharmacopoeia 1990 (USP 90) on 1 November 1989 to become effective on 1 January 1990. As this was the only monograph available until recently it served as the applicable standard to be followed. The Therapeutic Goods Act states that the British Pharmacopoeia (BP) is the precedent to be followed in Australia and implies that if a monograph exists for a finished product then this needs to be applied to achieve a certain standard of quality. If the monograph does not exist in the BP then other pharmacopoeia monographs can be sourced starting with the European Pharmacopoeia (Ph Eur) then the USP. A monograph for FDG first appeared in the Ph Eur in a 1999 Supplement (effective 1 January 1999 and now included in the Ph Eur 2000) and then in the BP 1999 (effective 1 December 1999). The Commonwealth Government Gazette (Notice 48, 1/12/99) published that the BP 99 was adopted on the 1st December 1999. Since then manufacturers have been required to comply with the monograph for FDG in the BP 99. This presentation looks at the content of the BP 99 monograph and compares it with that in the USP. Copyright (2000) The Australian and New Zealand Society of Nuclear Medicine Inc
Henry the Seventh and Italy, an historiographical account
Directory of Open Access Journals (Sweden)
Gian Maria Varanini
2014-06-01
Full Text Available The article represents an introduction to the contributions published in the monographic section dedicated to the expedition of Henry VII of Luxembourg in Italy (1310-1313. It provides an historiographic overview and some insightful clues.
The centenary of discovery of radium
International Nuclear Information System (INIS)
Mazeron, J.-J.; Gerbaulet, A.
1998-01-01
Henri Becquerel presented the discovery of radium by Pierre and Marie Curie at the Paris Academy of Science on 26th December 1898. One century later, radium has been abandoned, mainly for radiation protection difficulties. It is, however, likely that modern techniques of brachytherapy have inherited to those designed for radium sources, and that radium has cured thousands and thousands patients all over the world for about eighty years. The history of discovery and medical use of radium is summarised. (Copyright (c) 1998 Elsevier Science B.V., Amsterdam. All rights reserved.)
Energy Technology Data Exchange (ETDEWEB)
Michotte, C.; Ratel, G. [Bureau International de Poids et Mesures, Pavillon de Breteuil, F-92312 Sevres cedex (France); Cassette, P. [Bureau International de Poids et Mesures, Pavillon de Breteuil, F-92312 Sevres cedex (France); Laboratoire national de metrologie et d' essais -Laboratoire national Henri Becquerel, 91191 Gif-sur-Yvette cedex (France)
2012-02-15
In 2007, the Laboratoire national de metrologie et d'essais - Laboratoire national Henri Becquerel (LNE-LNHB), France submitted a sample of known activity of {sup 222}Rn to the International Reference System (SIR) for comparison. The value of the activity submitted was about 90 kBq. This key comparison result joins that of Switzerland and Germany in the key comparison database that now contains three results, identifier BIPM.RI(II)-K1.Rn-222. Consequently, the KCRV has been updated and the degrees of equivalence with the KCRV have been evaluated. (authors)
Energy Technology Data Exchange (ETDEWEB)
Michotte, C.; Ratel, G. [Bureau International des Poids et Mesures (BIPM), Pavillon de Breteuil, F-92312 Sevres Cedex, (France); Moune, M.; Bobin, C. [Laboratoire national de metrologie et d' essais-Laboratoire national Henri Becquerel, 91191 Gif-sur-Yvette cedex, (France)
2011-07-01
In 2007, the Laboratoire national de metrologie et d'essais-Laboratoire national Henri Becquerel (LNE-LNHB), France submitted a sample of known activity of {sup 124}Sb to the International Reference System (SIR) for activity comparison at the Bureau International des Poids et Mesures (BIPM). The activity was about 5.3 MBq. The key comparison reference value (KCRV) has been recalculated to include this new value and the degrees of equivalence between each equivalent activity for the three participants measured in the SIR and the KCRV are presented in a table and graphically. (authors)
1787 and 1776: Patrick Henry, James Madison, and the Revolutionary Legitimacy of the Constitution.
Banning, Lance
1988-01-01
Discusses Patrick Henry's and James Madison's opinions on how the U.S. Constitution should be constructed. Describes how Henry introduced a set of substantive objections which were shared by Antifederalists throughout the country and persuaded many Revolutionaries that the Constitution was essentially at odds with the principles of 1776. (BSR)
The Ideas of Henry Jenkins and Libraries
Anderson, Byron
2008-01-01
Henry Jenkins, director of the Comparative Media Studies Program at the Massachusetts Institute of Technology and keynote speaker at the 2007 American Library Association's "Gaming, Learning and Libraries Symposium" in Chicago is a visionary leader in the areas of new media and media convergence. In a white paper on digital media and learning…
Henri Fayol and Zero Tolerance Policies
Lee SCHIMMOELLER
2012-01-01
Zero tolerance policies have been increasingly popular in both education and business. Henri Fayol was the one of the earliest and influential thinkers in modern management theory. He defined management as a body of knowledge and defined his 14 administrative principles. It is an interesting exercise to apply Fayol’s teachings to the theory of zero tolerance and attempt to determine what Fayol would think of this new management technique.
Henry James – Modern Theoretician of Narration
Directory of Open Access Journals (Sweden)
Alexandra - Denisa IGNA
2013-01-01
Full Text Available Henry James, properly named world writer, was one of the first modern novelists, with an exigent writing conscience. The American writer subverted the prejudgement of the omniscient author in favour of the narration which is centred on the characters’ point of view, thus modernising the novel before V. Woolf, Huxley, Thomas Mann, or in our case Camil Petrescu and G. Călinescu. Some bio-bibliographical information familiarises the reader with the life and work of this writer. The larger part of the article is dedicated to a case study of the novel with the metaphorical title: The Figure in the Carpet, where Henry James tries to illustrate in an artistic manner his conception regarding the profundity and ineffability of the literary creation. The conclusion which the author reaches, alternating the familiar plan of the relationship between a married couple with the esthetical plan, is that the relationship between writer and his work represents an act of fully intimacy, just like a ceremony that takes place in the wedding night
2013-06-07
... No. AB 1070; (Sub-No. 1X)] Missouri Central Railroad Company--Abandonment Exemption--in Cass, Henry, Johnson, and Pettis Counties, MO; Central Midland Railway Company--Discontinuance of Service Exemption--in Cass, Henry, Johnson, and Pettis Counties, MO Missouri Central Railroad Company (MCRR) and Central...
Congenital Arthrogryposis: An Extension of the 15q11.2 BP1-BP2 Microdeletion Syndrome?
Directory of Open Access Journals (Sweden)
K. M. Usrey
2014-01-01
Full Text Available The proximal 15q11–q13 region contains 5 breakpoints (BP1–BP5. The BP1-BP2 region spans approximately 500 kb and contains four evolutionarily conserved genes. The genes in this region are known to play a role in central nervous system development and/or function. Microdeletions within the 15q11.2 BP1-BP2 region have been reported in patients with neurological dysfunction, developmental delays, behavioral problems, and dysmorphic features. We report two unrelated subjects with the 15q11.2 BP1-BP2 microdeletion and presenting with congenital arthrogryposis, a feature which has not been previously reported as part of this newly recognized microdeletion syndrome. While arthrogryposis seen in these two subjects may be coincidental, we propose that congenital arthrogryposis may result from neurological dysfunction and involvement of the microdeletion of the 15q11.2 BP1-BP2 region, further expanding the phenotype of this microdeletion syndrome. We encourage others to report patients with this chromosome microdeletion and neurological findings to further characterize the clinical phenotype.
Principles in Action: The Work of Henri Wallon
Voyat, Gilbert
1974-01-01
An examination of the life and philosophy of Henri Wallon, A French psychiatrist, psychologist, and educator, focusing on his views regarding the role of imitation in adaptation and learning, emotional development, syncretic thought, his differences with Piaget, and an assessment of the impact of his work. (EH)
Hiina kompartei pole NLKP-ga võrreldav / Henri Kaselo
Kaselo, Henri
2005-01-01
20.-26. novembril Hiinas Pekingis ja sadamalinnas Tianjinis peetud Euroopa ja Aasia noorte kohtumisest, kus Eestit esindasid Keskerakonna noortekogu esimees Henri Kaselo ja Euroopa Noorte Sotsiaaldemokraatide aseesimees ning Toomas Hendrik Ilvese nõunik Rander Läntsi
Evaluating Henry's law constant of N-nitrosodimethylamine (NDMA).
Haruta, Shinsuke; Jiao, Wentao; Chen, Weiping; Chang, Andrew C; Gan, Jay
2011-01-01
N-Nitrosodimethylamine (NDMA), a potential carcinogen, may contaminate the groundwater when the reclaimed wastewater is used for irrigation and groundwater recharge. Henry's law constant is a critical parameter to assess the fate and transport of reclaimed wastewater-borne NDMA in the soil profile. We conducted a laboratory experiment in which the change of NDMA concentration in water exposed to the atmosphere was measured with respect to time and, based on the data, obtained the dimensionless Henry's law constant (K(H)') of NDMA, at 1.0 x 10(-4). The K(H)' suggests that NDMA has a relatively high potential to volatilize in the field where NDMA-containing wastewater is used for irrigation and the volatilization loss may be a significant pathway of NDMA transport. The experiment was based on the two boundary-layer approach of mass transfer at the atmosphere-water interface. It is an expedient method to delineate K(H)' for volatile or semi-volatile compounds present in water at low concentrations.
Obituary: Henry Albers (1925-2009)
Chromey, Fred
2011-12-01
Henry Albers, professor of astronomy at Vassar College for over thirty years, died March 29, 2009, in Fairhope, Alabama. For his work at Vassar, where he held the Maria Mitchell Chair, Albers received the first Maria Mitchell Women in Science Award for his inspiration of women astronomers. He said "In the final analysis it is the students who bring the joy into teaching." As a professional astronomer, Albers did observational work on Galactic structure in the southern Milky Way, and on the structure of the Magellanic Clouds. In retirement, Albers published Maria Mitchell - A Life in Journals and Letters, the firsthand account of America's first woman astronomer. Albers's research was on photographic near-infrared spectroscopy of red giant stars in the southern Milky Way, some proper motion studies, and on the structure of the Magellanic Clouds. A series of seven NSF grants supported his six trips to Chile to make spectroscopic observations, as well as his sabbatical collaborations at Minnesota, Leiden, and the Royal Observatory in Edinburgh. Henry Albers arrived at Vassar in 1958, to find an astronomy program that had been recently absorbed by the physics department, and that was suffering neglect after the retirement of Maud Makemson. For the next 31 years, with incredible energy -- he sometimes taught seven courses a year -- he built the astronomy program into one double in size (from one to two tenure lines), whose th century facilities have been replaced with a st century observatory. For a remarkable stretch of 20-some-years, Albers and physicist Bob Stearns, with considerable grace, alternated chairmanship of the joint department of physics and astronomy. Henry Albers was a devoted citizen of Vassar College and an enthusiastic participant in the process of faculty governance at that institution. He would have been the first to concede that his enthusiasm was sometimes excessive, and that his contributions at faculty meetings occasionally failed to move the
Razdan, Neil K; Koshy, David M; Prausnitz, John M
2017-11-07
A group-contribution method based on scaled-particle theory was developed to predict Henry's constants for six families of persistent organic pollutants: polychlorinated benzenes, polychlorinated biphenyls, polychlorinated dibenzodioxins, polychlorinated dibenzofurans, polychlorinated naphthalenes, and polybrominated diphenyl ethers. The group-contribution model uses limited experimental data to obtain group-interaction parameters for an easy-to-use method to predict Henry's constants for systems where reliable experimental data are scarce. By using group-interaction parameters obtained from data reduction, scaled-particle theory gives the partial molar Gibbs energy of dissolution, Δg̅ 2 , allowing calculation of Henry's constant, H 2 , for more than 700 organic pollutants. The average deviation between predicted values of log H 2 and experiment is 4%. Application of an approximate van't Hoff equation gives the temperature dependence of Henry's constants for polychlorinated biphenyls, polychlorinated naphthalenes, and polybrominated diphenyl ethers in the environmentally relevant range 0-40 °C.
International Nuclear Information System (INIS)
Victor, David G.; House, Joshua C.
2006-01-01
Between 1998 and 2001, BP reduced its emissions of greenhouse gases by more than 10%. BP's success in cutting emissions is often equated with its use of an apparently market-based emissions trading program. However no independent study has ever examined the rules and operation of BP's system and the incentives acting on managers to reduce emissions. We use interviews with key managers and with traders in several critical business units to explore the bound of BP's success with emissions trading. No money actually changed hands when permits were traded, and the main effect of the program was to create awareness of money-saving emission controls rather than strong price incentives. We show that the trading system did not operate like a 'textbook' cap and trade scheme. Rather, the BP system operated much like a 'safety valve' trading system, where managers let the market function until the cost of doing so surpassed what the company was willing to tolerate
The delusion of the Master: the last days of Henry James.
Bartolomeo, Paolo
2013-11-01
The novelist Henry James shared with his brother William, the author of the Principles of Psychology, a deep interest in the ways in which personal identity is built through one's history and experiences. At the end of his life, Henry James suffered a vascular stroke in the right hemisphere and developed a striking identity delusion. He dictated in a perfectly clear and coherent manner two letters as if they were written by Napoleon Bonaparte. He also showed signs of reduplicative paramnesia. Negative symptoms resulting from right hemisphere damage may disrupt the feelings of "warmth and intimacy and immediacy" and the "resemblance among the parts of a continuum of feelings (especially bodily feelings)", which are the foundation of personal identity according to William James. On the other hand, a left hemisphere receiving inadequate input from the damaged right hemisphere may produce positive symptoms such as delusional, confabulatory narratives. Other fragments dictated during Henry James's final disease reveal some form of insight, if partial and disintegrated, into his condition. Thus, even when consciousness is impaired by brain damage, something of its deep nature may persist, as attested by the literary characteristics of the last fragments of the Master.
La Vie et L'oeuvre d'Henri Wallon.
Aubrey, Carol
1987-01-01
Outlines the life and philosophy of noted French child psychologist, Henri Wallon (1879-1962). Reviews the philosophical origins of the Wallonian Approach including the theory of emotions, the development of representational thought, the role of imitation in the formation of representation, and the role of language in the development of thought…
Potential Beneficial Effects of Tulbaghia violacea William Henry ...
African Journals Online (AJOL)
Tulbaghia violacea William Henry Harvey (Harv. Alliaceae) is a small bulbous herb belonging to the family Alliaceae. It is used in South Africa to treat fever, colds, asthma, paralysis, and hypertension. Meanwhile, cardiovascular disease accounts for about 30 % of total global death, with most of these deaths occurring in low ...
NOAA Ship Henry B. Bigelow Underway Meteorological Data, Quality Controlled
National Oceanic and Atmospheric Administration, Department of Commerce — NOAA Ship Henry B. Bigelow Underway Meteorological Data (delayed ~10 days for quality control) are from the Shipboard Automated Meteorological and Oceanographic...
Energy Technology Data Exchange (ETDEWEB)
Almeida, Daniel Ladeira [Universidade Federal do ABC (UFABC), Santo Andre, SP (Brazil)
2010-07-01
The primary assertion is that this article argues that the recovery in production of hydropower in Henry Borden (UHB) is the reduction of environmental liabilities in the Billings reservoir. In this context, the aim of this paper is to provide a first consideration of the possibility of recovery of production Henry Borden hydropower plant of recovering the multiple uses of the reservoir. From this perspective, we interviewed representatives of CETESB (Sanitation Environmental Technology Company) and EMAE (Metropolitan Water and Energy Company SA) for consideration of actions that include environmental policies aimed at increasing the production of electricity in Henry Borden in order to obtain results that may contribute to the multiple uses of the Billings reservoir. Noting that the range of laws aimed at protecting the water sources was limited to disjointed public policy that has reduced the resilience of the Billings reservoir. (author)
Iraagi olukorral on poliitiline lahendus / Henry A. Kissinger
Kissinger, Henry, 1923-
2007-01-01
USA endine riigisekretär Henry Kissinger kirjutab, et Ameerika Ühendriikide eesmärgiks peaks olema riikidevaheline kokkulepe, mis tunnistaks Iraagi rahvusvahelist staatust. See oleks vägivalla lõpetamiseks hea alus ja eeltingimuseks vägede väljaviimisele. Vt. samas: Ameerika Ühendriikide vahekokkuvõte Iraagi sõja kohta oli suhteliselt pessimistlik
Lifescience Database Archive (English)
Full Text Available YMU001_000113_B06 468 Adiantum capillus-veneris mRNA. clone: YMU001_000113_B06. BP918406 - Show BP918406...is mRNA. clone: YMU001_000113_B06. Accession BP918406 Tissue type prothallium Developmental stage - Contig I...programs, Nucleic Acids Res. 25:3389-3402. Query= BP918406|Adiantum capillus-vene...ams, Nucleic Acids Res. 25:3389-3402. Query= BP918406|Adiantum capillus-veneris m
Lifescience Database Archive (English)
Full Text Available YMU001_000108_E11 519 Adiantum capillus-veneris mRNA. clone: YMU001_000108_E11. BP918011 - Show BP91801...is mRNA. clone: YMU001_000108_E11. Accession BP918011 Tissue type prothallium Developmental stage - Contig I...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918011|Adiant...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918011|Adiantum cap
Short speech of Mister Jacques Chirac, President of the French Republic
International Nuclear Information System (INIS)
Tubiana, M.; Gwiazdowska, B.; Tolwinski, J.; Bulski, W.; Maseron, J.J.; Gerbaulet, A.
1999-01-01
A century ago, on the 26. december 1898, Mister Henri Becquerel presented at the Academy of Sciences a communication on the radium discovery made by Pierre and Marie Curie. In this issue is published the text of communications made by Mister Jacques Chirac, President of the French Republic and Mister Maurice Tubiana, co president with Mister Georges Charpak of the High Committee for the centenary of the radioactivity discovery, during the ceremonial in the great amphitheater of the Sorbonne. This text is followed by two historical notes about Pierre and Marie Curie and the discovery and medical use of the radium. (N.C.)
International Nuclear Information System (INIS)
Branger, T.; Bobin, C.; Iroulart, M.-G.; Lepy, M.-C.; Le Garreres, I.; Morelli, S.; Lacour, D.; Plagnard, J.
2008-01-01
Quantitative solid sources are used widely in the field of radionuclide metrology. With the aim to improve the detection efficiency for electrons and x-rays, a comparative study between two source drying techniques has been undertaken at LNE-Laboratoire National Henri Becquerel (LNE-LNHB, France). In this paper, freeze-drying using commercial equipment is compared with a system of drying using hot jets of nitrogen developed at Institute for Reference Materials and Measurements (IRMM, Belgium). In order to characterize the influence of self-absorption, the detection efficiencies for 51 Cr sources have been measured by coincidence counting and photon spectrometry
Energy Technology Data Exchange (ETDEWEB)
Michotte, C.; Ratel, G.; Courte, S. [Bureau International des Poids et Mesures (BIPM), Pavillon de Breteuil, 92 - Sevres (France); Verdeau, E.; Amiot, M.N. [Laboratoire national de metrologie et d' essais-Laboratoire National Henri Becquerel (LNE-LNHB), 91 - Gif-sur-Yvette (France)
2010-10-15
In 2006, the Laboratoire national de metrologie et d'essais - Laboratoire national Henri Becquerel (LNE-LNHB) submitted a sample of known activity of {sup 111}In to the International Reference System (SIR). The value of the activity submitted was about 14 MBq. This provides a new result for France in the matrix of degrees of equivalence in the key comparison database that enables them to maintain their degrees of equivalence for this radionuclide. The key comparison reference value has been re-evaluated and the comparison, identifier BIPM.RI(II)-K1.In-111, now contains five valid results. (authors)
Comparison of the acute effects of Tulbaghia violacea William Henry ...
African Journals Online (AJOL)
William Henry Harvey (Alliaceae) on blood pressure and heart rate of ... (WKY), and compare the results obtained with those for adult spontaneously hypertensive rats (SHR). Methods: T. ... have similar secondary metabolites and biological ...
2018-01-01
Black phosphorus (bP) has been recently investigated for next generation nanoelectronic multifunctional devices. However, the intrinsic instability of exfoliated bP (the bP nanoflakes) toward both moisture and air has so far overshadowed its practical implementation. In order to contribute to fill this gap, we report here the preparation of new hybrid polymer-based materials where bP nanoflakes (bPn) exhibit a significantly improved stability. The new materials have been prepared by different synthetic paths including: (i) the mixing of conventionally liquid-phase exfoliated bP (in dimethyl sulfoxide, DMSO) with poly(methyl methacrylate) (PMMA) solution; (ii) the direct exfoliation of bP in a polymeric solution; (iii) the in situ radical polymerization after exfoliating bP in the liquid monomer (methyl methacrylate, MMA). This last methodology concerns the preparation of stable suspensions of bPn–MMA by sonication-assisted liquid-phase exfoliation (LPE) of bP in the presence of MMA followed by radical polymerization. The hybrids characteristics have been compared in order to evaluate the bP dispersion and the effectiveness of the bPn interfacial interactions with polymer chains aimed at their long-term environmental stabilization. The passivation of the bPn is particularly effective when the hybrid material is prepared by in situ polymerization. By using this synthetic methodology, the nanoflakes, even if with a gradient of dispersion (size of aggregates), preserve their chemical structure from oxidation (as proved by both Raman and 31P-solid state NMR studies) and are particularly stable to air and UV light exposure. The feasibility of this approach, capable of efficiently exfoliating bP while protecting the bPn, has been then verified by using different vinyl monomers (styrene and N-vinylpyrrolidone), thus obtaining hybrids where the nanoflakes are embedded in polymer matrices with a variety of intriguing thermal, mechanical, and solubility characteristics.
Lifescience Database Archive (English)
Full Text Available YMU001_000009_C12 487 Adiantum capillus-veneris mRNA. clone: YMU001_000009_C12. BP911801 - Show BP911801...is mRNA. clone: YMU001_000009_C12. Accession BP911801 Tissue type prothallium Developmental stage - Contig I...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911801.... 25:3389-3402. Query= BP911801|Adiantum capillus-veneris mRNA, clone: YMU001_000
Lifescience Database Archive (English)
Full Text Available YMU001_000133_E11 274 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E11. BP920145 - Show BP92014...is mRNA. clone: YMU001_000133_E11. Accession BP920145 Tissue type prothallium Developmental stage - Contig I..., Nucleic Acids Res. 25:3389-3402. Query= BP920145|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E11.... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920145|Adian
Lifescience Database Archive (English)
Full Text Available YMU001_000133_E05 486 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E05. BP920142 - Show BP92014...is mRNA. clone: YMU001_000133_E05. Accession BP920142 Tissue type prothallium Developmental stage - Contig I...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920142|Adiantum capillus-veneris ...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920142|Adiantum capillus-veneris mRNA, clone: YMU001_0001
Lifescience Database Archive (English)
Full Text Available YMU001_000124_G04 562 Adiantum capillus-veneris mRNA. clone: YMU001_000124_G04. BP919406 - Show BP919406...is mRNA. clone: YMU001_000124_G04. Accession BP919406 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919406|Adiantum capillus-...ucleic Acids Res. 25:3389-3402. Query= BP919406|Adiantum capillus-veneris mRNA, c
Lifescience Database Archive (English)
Full Text Available YMU001_000144_D05 407 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D05. BP921000 - Show BP921000...is mRNA. clone: YMU001_000144_D05. Accession BP921000 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921000|Adiantum cap...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921000|Adiantum capillus-veneris mRN
Lifescience Database Archive (English)
Full Text Available YMU001_000144_C12 350 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C12. BP920995 - Show BP92099...is mRNA. clone: YMU001_000144_C12. Accession BP920995 Tissue type prothallium Developmental stage - Contig I...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099
Lifescience Database Archive (English)
Full Text Available YMU001_000108_F03 437 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F03. BP918015 - Show BP91801...is mRNA. clone: YMU001_000108_F03. Accession BP918015 Tissue type prothallium Developmental stage - Contig I.... 25:3389-3402. Query= BP918015|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F03. (437 letters) Data...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801
Lifescience Database Archive (English)
Full Text Available YMU001_000108_F06 436 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F06. BP918018 - Show BP91801...is mRNA. clone: YMU001_000108_F06. Accession BP918018 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP918018|Adiantum capillus-veneris mRNA, clone: YM...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801
Lifescience Database Archive (English)
Full Text Available YMU001_000023_A07 527 Adiantum capillus-veneris mRNA. clone: YMU001_000023_A07. BP912801 - Show BP912801...is mRNA. clone: YMU001_000023_A07. Accession BP912801 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912801...es. 25:3389-3402. Query= BP912801|Adiantum capillus-veneris mRNA, clone: YMU001_0
Oxalate Content of the Herb Good-King-Henry, Blitum Bonus-Henricus
Directory of Open Access Journals (Sweden)
Wanying Li
2015-05-01
Full Text Available The total, soluble and insoluble oxalate contents of the leaves, stems and buds of Good-King-Henry (Blitum Bonus-Henricus were extracted and measured using HPLC chromatography. The large, mature leaves contained 42% more total oxalate than in the small leaves and the soluble oxalate content of the large leaves was 33% higher than the smaller leaves. Cooking the mixed leaves, stems and buds in boiling water for two minutes significantly (p < 0.05 reduced the total oxalate when compared to the raw plant parts. Pesto sauce made from mixed leaves contained 257 mg total oxalate/100 g fresh weight; this was largely made up of insoluble oxalates (85% of the total oxalate content. Soup made from mixed leaves contained lower levels of total oxalates (44.26 ± 0.49 mg total oxalate/100 g fresh weight and insoluble oxalate made up 49% of the oxalate contents. The levels of oxalates in the Good-King-Henry leaves were high, suggesting that the leaves should be consumed occasionally as a delicacy because of their unique taste rather than as a significant part of the diet. However, the products made from Good-King-Henry leaves indicated that larger amounts could be consumed as the oxalate levels were reduced by dilution and processing.
2. Robin Attfield Henry Odera Oruka, Ecophilosophy and Climate ...
African Journals Online (AJOL)
Attfield
Henry Odera Oruka, ecophilosophy, climate change ethics, impacts of climate ... One of the fields of environmental philosophy which he would almost ... engineering, and on “Humanity's Carbon Budget”, followed by Conclusions about ... countries that are largely responsible for these emissions must take the lion's share of.
Lifescience Database Archive (English)
Full Text Available YMU001_000039_E04 420 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E04. BP914068 - Show BP91406...is mRNA. clone: YMU001_000039_E04. Accession BP914068 Tissue type prothallium Developmental stage - Contig I...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91406...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914068|Adiantum capillus-veneris mRNA, clone:
Lifescience Database Archive (English)
Full Text Available YMU001_000071_B11 433 Adiantum capillus-veneris mRNA. clone: YMU001_000071_B11. BP915406 - Show BP915406...is mRNA. clone: YMU001_000071_B11. Accession BP915406 Tissue type prothallium Developmental stage - Contig I...Acids Res. 25:3389-3402. Query= BP915406|Adiantum capillus-veneris mRNA, clone: Y...leic Acids Res. 25:3389-3402. Query= BP915406|Adiantum capillus-veneris mRNA, clone: YMU001_000071_B11. (433
Lifescience Database Archive (English)
Full Text Available YMU001_000015_B05 315 Adiantum capillus-veneris mRNA. clone: YMU001_000015_B05. BP912099 - Show BP912099...is mRNA. clone: YMU001_000015_B05. Accession BP912099 Tissue type prothallium Developmental stage - Contig I...BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912099...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912099|Adiantum capillus-vene
Lifescience Database Archive (English)
Full Text Available YMU001_000117_F03 542 Adiantum capillus-veneris mRNA. clone: YMU001_000117_F03. BP918801 - Show BP918801...is mRNA. clone: YMU001_000117_F03. Accession BP918801 Tissue type prothallium Developmental stage - Contig I...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918801|Adiantum capillus-veneris mRNA, clone: YMU0...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918801|Adiantum ca
Lifescience Database Archive (English)
Full Text Available YMU001_000105_F04 280 Adiantum capillus-veneris mRNA. clone: YMU001_000105_F04. BP917801 - Show BP917801...is mRNA. clone: YMU001_000105_F04. Accession BP917801 Tissue type prothallium Developmental stage - Contig I...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917801|Adiantum capillus-ve... Nucleic Acids Res. 25:3389-3402. Query= BP917801|Adiantum capillus-veneris mRNA, clone: YMU001_000105_F04.
Lifescience Database Archive (English)
Full Text Available YMU001_000108_F05 267 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F05. BP918017 - Show BP91801...is mRNA. clone: YMU001_000108_F05. Accession BP918017 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918017|Adiantum capillus-veneris m...cleic Acids Res. 25:3389-3402. Query= BP918017|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F05. (26
Lifescience Database Archive (English)
Full Text Available YMU001_000077_B02 555 Adiantum capillus-veneris mRNA. clone: YMU001_000077_B02. BP915801 - Show BP915801...is mRNA. clone: YMU001_000077_B02. Accession BP915801 Tissue type prothallium Developmental stage - Contig I... Nucleic Acids Res. 25:3389-3402. Query= BP915801|Adiantum capillus-veneris mRNA, clone: YMU001_000077_B02. ...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915801|A
Henry Fuseli’s Alternative Classicism
Directory of Open Access Journals (Sweden)
Martin Myrone
2015-12-01
Full Text Available The review considers Andrei Pop’s Antiquity, Theatre & The Painting of Henry Fuseli. This argues for the history painter and writer Fuseli as an exemplary ‘Neopagan’, a term coined by Pop to refer to the new sense of cultural pluralism and historical relativism which emerged in Europe after the discovery of the remains of Pompeii and Herculaneum in 1748. While this perspective offers a fresh view of the artist, relating him to the emergence of modernity, and illuminates some important aspects of his work, the reviewer also suggests that the monographic focus risks re-asserting a sense of Fuseli’s exceptionalism.
Henry constants in polymer solutions with the van der Waals equation of state
DEFF Research Database (Denmark)
Bithas, Sotiris; Kalospiros, Nikolaos; Kontogeorgis, Georgios
1996-01-01
parameter is satisfactory, with typical errors within the experimental uncertainty and comparable to those with the more complex Perturbed Hard Chain Theory-based equations of state with the same number of adjustable parameters. A predictive scheme for calculating Henry constants is also presented, which...... is a corresponding-states correlation for a dimensionless Henry constant defined based on the van der Waals equation of state. Satisfactory results-often close to the ones from the one-parameter correlation-are obtained for all systems investigated in this work. Compared with literature models that have been applied...
Lifescience Database Archive (English)
Full Text Available YMU001_000133_F01 365 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F01. BP920147 - Show BP92014...is mRNA. clone: YMU001_000133_F01. Accession BP920147 Tissue type prothallium Developmental stage - Contig I...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920147|Adiantum capillus-veneris mRNA, clone: YMU001_...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9201
Lifescience Database Archive (English)
Full Text Available YMU001_000133_E09 265 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E09. BP920144 - Show BP92014...is mRNA. clone: YMU001_000133_E09. Accession BP920144 Tissue type prothallium Developmental stage - Contig I...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920144|Adiantum capillus-veneris mRNA, clone: YMU001...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014
Lifescience Database Archive (English)
Full Text Available YMU001_000133_E04 528 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E04. BP920141 - Show BP92014...is mRNA. clone: YMU001_000133_E04. Accession BP920141 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP920141|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E04. (528 lette...cleic Acids Res. 25:3389-3402. Query= BP920141|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E04. (52
Lifescience Database Archive (English)
Full Text Available YMU001_000029_H06 570 Adiantum capillus-veneris mRNA. clone: YMU001_000029_H06. BP913406 - Show BP913406...is mRNA. clone: YMU001_000029_H06. Accession BP913406 Tissue type prothallium Developmental stage - Contig I...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP913406|Adiantum capillus-veneris mRNA, clone: YMU00...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913406|Adiantum capil...LDVTRGLVNGARGVVVAFES--GKHG---------------LPH 406 Query: 387 VRFACNRAEIVIGPDRQTVESGGMQVARRIQVPLILAWALSVHKCQGM
Lifescience Database Archive (English)
Full Text Available YMU001_000108_E12 547 Adiantum capillus-veneris mRNA. clone: YMU001_000108_E12. BP918012 - Show BP91801...is mRNA. clone: YMU001_000108_E12. Accession BP918012 Tissue type prothallium Developmental stage - Contig I...grams, Nucleic Acids Res. 25:3389-3402. Query= BP918012|Adiantum capillus-veneris mRNA, clone: YMU001_000108...ms, Nucleic Acids Res. 25:3389-3402. Query= BP918012|Adiantum capillus-veneris mRNA, clone: YMU001_000108_E1
The Transformative Intellectual: An Examination of Henry Giroux's Ethics
Kashani, Tony
2012-01-01
This article explores Henry Giroux's contributions to critical pedagogy. The author demonstrates how Giroux, as a public intellectual, has found his Ethics in the right place. The author further argues that Giroux's Ethics of virtue are present not only in the public person but also in his transformative writing.
Lifescience Database Archive (English)
Full Text Available YMU001_000018_F09 348 Adiantum capillus-veneris mRNA. clone: YMU001_000018_F09. BP912406... CL1894Contig1 Show BP912406 Clone id YMU001_000018_F09 Library YMU01 Length 348 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_F09. Accession BP912406 Tissue type prothallium Developmental stag...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912406|Adiantum capillus-veneris mRNA...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912406
Lifescience Database Archive (English)
Full Text Available YMU001_000100_D10 492 Adiantum capillus-veneris mRNA. clone: YMU001_000100_D10. BP917406... CL2033Contig1 Show BP917406 Clone id YMU001_000100_D10 Library YMU01 Length 492 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000100_D10. Accession BP917406 Tissue type prothallium Developmental stag...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917406...Nucleic Acids Res. 25:3389-3402. Query= BP917406|Adiantum capillus-veneris mRNA,
Lifescience Database Archive (English)
Full Text Available YMU001_000091_G06 127 Adiantum capillus-veneris mRNA. clone: YMU001_000091_G06. BP916801... CL2168Contig1 Show BP916801 Clone id YMU001_000091_G06 Library YMU01 Length 127 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000091_G06. Accession BP916801 Tissue type prothallium Developmental stag...ds Res. 25:3389-3402. Query= BP916801|Adiantum capillus-veneris mRNA, clone: YMU0...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916801
Lifescience Database Archive (English)
Full Text Available YMU001_000035_D11 562 Adiantum capillus-veneris mRNA. clone: YMU001_000035_D11. BP913801... CL482Contig1 Show BP913801 Clone id YMU001_000035_D11 Library YMU01 Length 562 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000035_D11. Accession BP913801 Tissue type prothallium Developmental stage...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913801|Adiantum...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP913801|Adiantum capillus-veneris mRNA, clone: YMU0
Lifescience Database Archive (English)
Full Text Available YMU001_000141_G10 454 Adiantum capillus-veneris mRNA. clone: YMU001_000141_G10. BP920801... CL819Contig1 Show BP920801 Clone id YMU001_000141_G10 Library YMU01 Length 454 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000141_G10. Accession BP920801 Tissue type prothallium Developmental stage... Acids Res. 25:3389-3402. Query= BP920801|Adiantum capillus-veneris mRNA, clone: ...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920801|Adiantum capillus-
NOAA Ship Henry B. Bigelow Underway Meteorological Data, Near Real Time
National Oceanic and Atmospheric Administration, Department of Commerce — NOAA Ship Henry B. Bigelow Underway Meteorological Data (Near Real Time, updated daily) are from the Shipboard Automated Meteorological and Oceanographic System...
M. Pirgerou on D. Izzo and C. Martinez’s Revisionary Interventions into Henry James
Directory of Open Access Journals (Sweden)
2009-07-01
Full Text Available Donatella Izzo and Carlo Martinez. Revisionary Interventions Into Henry James. Eds. Napoli, 2008. Revisionary Interventions into Henry James is a compilation of a series of papers presented at a colloquium which took place at Università Orientale in Naples, Italy, on October 27, 2006. In her introduction to the volume, Donatella Izzo acknowledges the “rather blatant plagiarism” (7 which lent the book its title. The borrowing, of course, refers to Donald Pease’s landmark Revisionary Interve...
Lifescience Database Archive (English)
Full Text Available YMU001_000133_E03 489 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E03. BP92014...0 CL2574Contig1 Show BP920140 Clone id YMU001_000133_E03 Library YMU01 Length 489 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_E03. Accession BP920140 Tissue type prothallium Developmental stag... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920140|Adian... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014
Lifescience Database Archive (English)
Full Text Available YMU001_000133_E07 533 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E07. BP92014...3 CL2377Contig1 Show BP920143 Clone id YMU001_000133_E07 Library YMU01 Length 533 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_E07. Accession BP920143 Tissue type prothallium Developmental stag...ms, Nucleic Acids Res. 25:3389-3402. Query= BP920143|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E0...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920143|Adiantum
Lifescience Database Archive (English)
Full Text Available YMU001_000133_E12 401 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E12. BP92014...6 CL388Contig1 Show BP920146 Clone id YMU001_000133_E12 Library YMU01 Length 401 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000133_E12. Accession BP920146 Tissue type prothallium Developmental stage...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920146|Adiantum ca...rams, Nucleic Acids Res. 25:3389-3402. Query= BP920146|Adiantum capillus-veneris mRNA, clone: YMU001_000133_
Lifescience Database Archive (English)
Full Text Available YMU001_000133_F02 429 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F02. BP92014...8 CL3819Contig1 Show BP920148 Clone id YMU001_000133_F02 Library YMU01 Length 429 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_F02. Accession BP920148 Tissue type prothallium Developmental stag...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920148|Adiantum capillus-vener...ed BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014
Lifescience Database Archive (English)
Full Text Available YMU001_000133_F03 624 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F03. BP92014...9 CL2860Contig1 Show BP920149 Clone id YMU001_000133_F03 Library YMU01 Length 624 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_F03. Accession BP920149 Tissue type prothallium Developmental stag...ic Acids Res. 25:3389-3402. Query= BP920149|Adiantum capillus-veneris mRNA, clone: YMU001_000133_F03. (624 l...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014
Lifescience Database Archive (English)
Full Text Available YMU001_000039_E01 548 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E01. BP91406...5 CL604Contig1 Show BP914065 Clone id YMU001_000039_E01 Library YMU01 Length 548 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000039_E01. Accession BP914065 Tissue type prothallium Developmental stage...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP914065|Adiantum capillus-veneris mRNA, clone: YMU0...cids Res. 25:3389-3402. Query= BP914065|Adiantum capillus-veneris mRNA, clone: YMU001_000039_E01. (548 lette
Lifescience Database Archive (English)
Full Text Available YMU001_000039_D09 599 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D09. BP91406...1 CL1730Contig1 Show BP914061 Clone id YMU001_000039_D09 Library YMU01 Length 599 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_D09. Accession BP914061 Tissue type prothallium Developmental stag... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914061|Adia...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914061|Adiantum capillus-veneris mRNA, c
Lifescience Database Archive (English)
Full Text Available YMU001_000039_E05 368 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E05. BP91406...9 CL2761Contig1 Show BP914069 Clone id YMU001_000039_E05 Library YMU01 Length 368 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_E05. Accession BP914069 Tissue type prothallium Developmental stag...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP914069|Adiantum capillus-veneris mRNA, clone: YMU001_0000...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP914069|Adiantum capillus-veneris mRNA, clone: YMU001
Lifescience Database Archive (English)
Full Text Available YMU001_000039_D12 560 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D12. BP91406...4 CL532Contig1 Show BP914064 Clone id YMU001_000039_D12 Library YMU01 Length 560 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000039_D12. Accession BP914064 Tissue type prothallium Developmental stage...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914064|Adiantum capillus-vener...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914064|Adi
Lifescience Database Archive (English)
Full Text Available YMU001_000087_D01 556 Adiantum capillus-veneris mRNA. clone: YMU001_000087_D01. BP916406... CL1913Contig1 Show BP916406 Clone id YMU001_000087_D01 Library YMU01 Length 556 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000087_D01. Accession BP916406 Tissue type prothallium Developmental stag...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916406|Adiantum capill...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916406|Adiantum capillus-veneris mRNA, c
Lifescience Database Archive (English)
Full Text Available YMU001_000058_E09 562 Adiantum capillus-veneris mRNA. clone: YMU001_000058_E09. BP914406... CL513Contig1 Show BP914406 Clone id YMU001_000058_E09 Library YMU01 Length 562 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000058_E09. Accession BP914406 Tissue type prothallium Developmental stage...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914406|Adiantum capillus...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914406
Lifescience Database Archive (English)
Full Text Available YMU001_000039_D08 539 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D08. BP91406...0 CL1835Contig1 Show BP914060 Clone id YMU001_000039_D08 Library YMU01 Length 539 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_D08. Accession BP914060 Tissue type prothallium Developmental stag...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914060|Adiantum capillus-veneris ...Acids Res. 25:3389-3402. Query= BP914060|Adiantum capillus-veneris mRNA, clone: YMU001_000039_D08. (539 lett
Lifescience Database Archive (English)
Full Text Available YMU001_000144_D03 529 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D03. BP92099...8 CL1935Contig1 Show BP920998 Clone id YMU001_000144_D03 Library YMU01 Length 529 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_D03. Accession BP920998 Tissue type prothallium Developmental stag...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920998|Adiantum capillus-veneris mRNA, clon... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920998|Adiantum capillus-ven
Lifescience Database Archive (English)
Full Text Available YMU001_000144_D04 588 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D04. BP92099...9 CL317Contig1 Show BP920999 Clone id YMU001_000144_D04 Library YMU01 Length 588 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000144_D04. Accession BP920999 Tissue type prothallium Developmental stage...nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099
Lifescience Database Archive (English)
Full Text Available YMU001_000144_D01 496 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D01. BP92099...6 CL262Contig1 Show BP920996 Clone id YMU001_000144_D01 Library YMU01 Length 496 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000144_D01. Accession BP920996 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920996|Adiantum capillus-ve
Lifescience Database Archive (English)
Full Text Available YMU001_000144_C06 517 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C06. BP92099...3 CL547Contig1 Show BP920993 Clone id YMU001_000144_C06 Library YMU01 Length 517 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000144_C06. Accession BP920993 Tissue type prothallium Developmental stage...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920993|Adiantum capillus-veneris mRNA, clone: YMU001_0001...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920993|Adiantum
Lifescience Database Archive (English)
Full Text Available YMU001_000144_C05 525 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C05. BP92099...2 CL2523Contig1 Show BP920992 Clone id YMU001_000144_C05 Library YMU01 Length 525 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C05. Accession BP920992 Tissue type prothallium Developmental stag...Acids Res. 25:3389-3402. Query= BP920992|Adiantum capillus-veneris mRNA, clone: YMU001_000144_C05. (525 lett...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP920992|Adiantum capillus-veneris mRNA, clone: YMU001_00014
Lifescience Database Archive (English)
Full Text Available YMU001_000129_C11 513 Adiantum capillus-veneris mRNA. clone: YMU001_000129_C11. BP919801... CL1Contig3 Show BP919801 Clone id YMU001_000129_C11 Library YMU01 Length 513 Definition Adiantum capil...lus-veneris mRNA. clone: YMU001_000129_C11. Accession BP919801 Tissue type prothallium Developmental stage -...es. 25:3389-3402. Query= BP919801|Adiantum capillus-veneris mRNA, clone: YMU001_000129_C11. (435 letters) Da...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919801|Adiantum capil
Lifescience Database Archive (English)
Full Text Available YMU001_000108_F01 490 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F01. BP918013 - Show BP91801...is mRNA. clone: YMU001_000108_F01. Accession BP918013 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801...idylinositol-4-phosphate 5-kinase 1 OS=Oryza sativa subsp. japonica GN=PIPK1 PE=2 SV=2 Length = 801 Score = ..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801
Lifescience Database Archive (English)
Full Text Available YMU001_000063_A07 396 Adiantum capillus-veneris mRNA. clone: YMU001_000063_A07. BP914801... CL1121Contig1 Show BP914801 Clone id YMU001_000063_A07 Library YMU01 Length 396 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000063_A07. Accession BP914801 Tissue type prothallium Developmental stag...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914801...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914801|Adiantum capillus-veneris mRNA, clone:
Rahvaliit : Henri Kaselo süüdistus on idiootsus / Jüri Saar
Saar, Jüri, 1946-
2008-01-01
Keskerakonna Tartumaa piirkonna esimeheks valitud Tartu linnavolinik Henri Kaselo kritiseeris teravalt Rahvaliitu kuuluvaid Tartumaa vallajuhte, kelle juhtimisstiil ja korruptiivne poliitika polevat nõukogude ajast muutunud
Kuwabara, Jun; Sawada, Yoshiharu; Yoshimatsu, Mitsuhiro
2018-02-16
In this study, the first aza-Henry reaction of nitriles with nitromethane in a CuI/Cs 2 CO 3 /DBU system is described. The process was conveniently and directly used for the synthesis of β-aminonitroalkenes 2a-x and tolerated aryl-, alkyl-, hetaryl-, alkenyl-, and alkynylnitriles. The resulting aminonitroalkenes 2 could be successfully transformed to the corresponding 2-nitroacetophenones, 2-amino-1-halonitroalkenes, 2-alkylaminonitroalkenes, or 3-nitropyridines. In the presence of H 2 O, the aza-Henry reaction turned the reaction path to the nitrile hydration to exclusively yield the amides 3a-s.
Lifescience Database Archive (English)
Full Text Available YMU001_000144_C10 322 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C10. BP92099...4 CL2871Contig1 Show BP920994 Clone id YMU001_000144_C10 Library YMU01 Length 322 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C10. Accession BP920994 Tissue type prothallium Developmental stag...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099
Lifescience Database Archive (English)
Full Text Available YMU001_000144_C03 445 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C03. BP92099...0 CL4123Contig1 Show BP920990 Clone id YMU001_000144_C03 Library YMU01 Length 445 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C03. Accession BP920990 Tissue type prothallium Developmental stag...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9209...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099
Lifescience Database Archive (English)
Full Text Available YMU001_000144_C04 521 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C04. BP92099...1 CL3173Contig1 Show BP920991 Clone id YMU001_000144_C04 Library YMU01 Length 521 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C04. Accession BP920991 Tissue type prothallium Developmental stag...s. 25:3389-3402. Query= BP920991|Adiantum capillus-veneris mRNA, clone: YMU001_000144_C04. (521 letters) Dat...ucleic Acids Res. 25:3389-3402. Query= BP920991|Adiantum capillus-veneris mRNA, clone: YMU001_000144_C04. (5
Lifescience Database Archive (English)
Full Text Available YMU001_000108_F04 434 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F04. BP91801...6 CL3779Contig1 Show BP918016 Clone id YMU001_000108_F04 Library YMU01 Length 434 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000108_F04. Accession BP918016 Tissue type prothallium Developmental stag..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801...ic Acids Res. 25:3389-3402. Query= BP918016|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F04. (434 l
Henri Fayol’un Yönetim Düşüncesi Üzerine Notlar(Notes on Managerial Thought of Henry Fayol)
Ramazan ŞENGÜL
2007-01-01
Henri Fayol, developed a managerial approach which is a perfect guide for both private and public sectors through focusing systematically upon managerial process. A major advantage of Fayol in creating a general managerial doctrine was his pratician side. His managerial thought which was developed in the early 20th century lasted up to our times. The distinguished characteristic of Fayol’s thought was studying the administrative reality through separating it into its functions, in that it hel...
Henri Pirenne: Historian and Man of the World
Directory of Open Access Journals (Sweden)
Sarah Keymeulen
2016-12-01
Full Text Available Henri Pirenne (1862-1935 is generally recognised as one of the most influential European historians of the late nineteenth- and early twentieth-century. The combination of his scholarly activity with the social mission that he set himself earned him an extraordinarily successful career and a double reputation: at least in Belgium, he was regarded not only as a ‘father of history’, but also as great citizen. Although his influence was unmistakably large, there is no consensus about the existence or the nature of a ‘Pirennian persona’. He combined the ideal collection of skills, values and standards required of historians with very specific personal characteristics. At the same time he was inextricably linked to a certain era and a certain Belgium that died with him. Pirenne therefore, did not so much represent a new type of scientific persona as the prestige of an idealised, long-vanished Belgium and its corresponding academic culture. Henri Pirenne. Historicus en man van de wereldHenri Pirenne (1862-1935 wordt beschouwd als één van de meest invloedrijke Europese geschiedschrijvers van de laatnegentiende en vroegtwintigste eeuw. Het verband tussen zijn wetenschappelijke activiteit en de maatschappelijke taak die hij voor zichzelf zag weggelegd, leverde hem een uitzonderlijk succesvolle carrière en een dubbele reputatie op. Pirenne staat, althans in België, immers niet alleen geboekstaafd als een ‘vader van de geschiedenis’, maar ook als een groot staatsburger. Hoewel de invloed van Pirenne onmiskenbaar groot is geweest, is er geen consensus over het bestaan of de aard van een ‘pirenniaanse persona’. Hij combineerde het ideaalpakket van vaardigheden, normen en waarden die historici werden geacht te bezitten met zeer specifieke karaktereigenschappen. Tegelijk was hij onlosmakelijk verknoopt met een zeker tijdsgewricht en een zeker België, dat samen met hem ter ziele ging. Pirenne stond dan ook niet zozeer model voor een nieuw
Henri Pirenne: Historian and Man of the World.
Directory of Open Access Journals (Sweden)
S. Keymeulen
2016-12-01
Full Text Available Henri Pirenne (1862-1935 is generally recognised as one of the most influential European historians of the late nineteenth- and early twentieth-century. The combination of his scholarly activity with the social mission that he set himself earned him an extraordinarily successful career and a double reputation: at least in Belgium, he was regarded not only as a ‘father of history’, but also as great citizen. Although his influence was unmistakably large, there is no consensus about the existence or the nature of a ‘Pirennian persona’. He combined the ideal collection of skills, values and standards required of historians with very specific personal characteristics. At the same time he was inextricably linked to a certain era and a certain Belgium that died with him. Pirenne therefore, did not so much represent a new type of scientific persona as the prestige of an idealised, long-vanished Belgium and its corresponding academic culture. Henri Pirenne. Historicus en man van de wereld. Henri Pirenne (1862-1935 wordt beschouwd als één van de meest invloedrijke Europese geschiedschrijvers van de laatnegentiende en vroegtwintigste eeuw. Het verband tussen zijn wetenschappelijke activiteit en de maatschappelijke taak die hij voor zichzelf zag weggelegd, leverde hem een uitzonderlijk succesvolle carrière en een dubbele reputatie op. Pirenne staat, althans in België, immers niet alleen geboekstaafd als een ‘vader van de geschiedenis’, maar ook als een groot staatsburger. Hoewel de invloed van Pirenne onmiskenbaar groot is geweest, is er geen consensus over het bestaan of de aard van een ‘pirenniaanse persona’. Hij combineerde het ideaalpakket van vaardigheden, normen en waarden die historici werden geacht te bezitten met zeer specifieke karaktereigenschappen. Tegelijk was hij onlosmakelijk verknoopt met een zeker tijdsgewricht en een zeker België, dat samen met hem ter ziele ging. Pirenne stond dan ook niet zozeer model voor een nieuw
Lifescience Database Archive (English)
Full Text Available YMU001_000108_F08 47 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F08. BP918019 - Show BP91801... mRNA. clone: YMU001_000108_F08. Accession BP918019 Tissue type prothallium Developmental stage - Contig ID
Directory of Open Access Journals (Sweden)
Yang Du
2017-11-01
Full Text Available Ultraviolet (UV-absorbing chemicals (UV filters are used in personal care products for the protection of human skin and hair from damage by UV radiation. Although these substances are released into the environment in the production and consumption processes, little is known about their ecotoxicology effects. The acute toxicity and potential ecological risk of UV filters benzophenone-3 (BP-3 and benzophenone-4 (BP-4 on Chlorella vulgaris, Daphnia magna, and Brachydanio rerio were analyzed in the present study. The EC50 values (96 h of BP-3 and BP-4 on C. vulgaris were 2.98 and 201.00 mg/L, respectively. The 48 h-LC50 of BP-3 and BP-4 on D. magna were 1.09 and 47.47 mg/L, respectively. The 96 h-LC50 of BP-3 and BP-4 on B. rerio were 3.89 and 633.00 mg/L, respectively. The toxicity of a mixture of BP-3 and BP-4 on C. vulgaris, D. magna, and B. rerio all showed antagonistic effects. The induced predicted no-effect concentrations of BP-3 and BP-4 by the assessment factor method were 1.80 × 10−3 and 0.47 mg/L, respectively, by assessment factor (AF method, which were both lower than the concentrations detected in the environment at present, verifying that BP-3 and BP-4 remain low-risk chemicals to the aquatic ecosystem.
The Failed Educations of John Stuart Mill and Henry Adams.
Crossley, Robert
1979-01-01
Analyzes and contrasts Mill's "Autobiography" and Adams'"The Education of Henry Adams" in order to present two approaches to the nature of education and of failure. Maintains that their perspectives may serve as catalysts and cautions for contemporary theories of education and its utility and relevance. (CAM)
2008 USGS Lidar: Twelve County, Illinois (Grundy, Kane, McHenry only)
National Oceanic and Atmospheric Administration, Department of Commerce — This LiDAR data is within Illinois Department of Transportation districts 1 and 3 covering Grundy, Kane and McHenry counties. The data is updated from its original...
Directory of Open Access Journals (Sweden)
D. Wong
2013-01-01
Full Text Available The proximal q arm of chromosome 15 contains breakpoint regions BP1–BP5 with the classic deletion of BP1–BP3 best known to be associated with Prader-Willi and Angelman syndromes. The region is approximately 500 kb and microdeletions within the BP1-BP2 region have been reported in patients with developmental delay, behavioral abnormalities, and motor apraxia as well as dysmorphic features including hypertelorism, cleft or narrow palate, ear abnormalities, and recurrent upper airway infections. We report two patients with unique, never-before-reported 15q11.2 BP1-2 microdeletion syndrome findings, one with proximal esophageal atresia and distal tracheoesophageal fistula (type C and one with congenital cataracts. Cataracts have been described in Prader-Willi syndrome but we could not find any description of cataracts in Angelman syndrome. Esophageal atresia and tracheoesophageal fistula have not been reported to our knowledge in either syndrome. A chance exists that both cases are sporadic birth defects; however, the findings of the concomitant microdeletion cannot be overlooked as a possible cause. Based on our review of the literature and the presentation of our patients, we recommend that esophageal atresia and distal tracheoesophageal fistula as well as congenital cataracts be included in the phenotypic spectrum of 15q11.2 BP1-2 microdeletion syndrome.
Energy Technology Data Exchange (ETDEWEB)
Plagnard, J.; Morel, J.; Tran Tuan, A
2005-07-01
In gamma spectrometry, new acquisition systems based on digital processing of the signals are now available on the market. In order to determine their performances at high count rates, The CEA-LNHB (Commissariat a l'Energie Atomique - Laboratoire National Henri Becquerel) has tested several of these equipments.. These tests have clearly shown that the performances announced by the manufacturers were generally not met. At this point, it was interesting to include in these tests, the system ADONIS (Atelier de Developpement Numerique pour l'Instrumentation en Spectrometrie), which is the new gamma spectrometry system, developed by the CEA-SIAR (Service d'Instrumentation et d'Application des Rayonnements). (authors)
Should bulk cloudwater or fogwater samples obey Henry's law
Energy Technology Data Exchange (ETDEWEB)
Pandis, S.N.; Seinfeld, J.H. (Department of Chemical Engineering and Environmental Quality Laboratory, California Institute of Technology, Pasadena, CA (USA))
1991-06-20
In this work we prove that mixing of droplets with different {ital p}H that are individually in Henry's law equilibrium with the surrounding atmosphere always results in a bulk mixture that is supersaturated with weak acids like S(IV) and HCOOH and bases like NH{sub 3} with respect to the original atmosphere. The degree of supersaturation of the bulk liquid water sample for a particular species depends on its dissociation constant, on the initial {ital p}H of the bulk droplet mixture, and on the distribution of the {ital p}H and of the liquid water over the droplet spectrum. High supersaturations result only when the {ital p}H of the bulk droplet mixture exceeds the {ital p}K{sub {ital a}} of the species, in which {ital p}H range large {ital p}H differences among droplets of different sizes lead to large deviations from Henry's law for the bulk mixture. The deviation is shown to depend on the ratio of the arithmetic mean to the harmonic mean of the hydrogen ion concentrations of the droplets with the liquid water content used was weighting factor in the calculation of the means. The theory developed can explain observed discrepancies from Henry's law in atmospheric samples and also other observed phenomena like the reported increase of {ital p}H values of bulk aqueous samples during storage. {copyright} American Geophysical Union 1991
The personality of Henry Cavendish a great scientist with extraordinary peculiarities
McCormmach, Russell
2014-01-01
This book explores the 18th century natural philosopher Henry Cavendish, best known for his work in chemistry and physics. It traces aspects of his personality, views and interpretations of him, and explores notions of eccentricity and autism.
Lifescience Database Archive (English)
Full Text Available YMU001_000020_H07 512 Adiantum capillus-veneris mRNA. clone: YMU001_000020_H07. BP912612 - Show BP912612... Clone id YMU001_000020_H07 Library YMU01 Length 512 Definition Adiantum capillus-vener...is mRNA. clone: YMU001_000020_H07. Accession BP912612 Tissue type prothallium Developmental stage - Contig I...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912612|Adiantum cap...illus-veneris mRNA, clone: YMU001_000020_H07. (512 letters) Database: uniprot_sprot.fasta 412,525 sequences;
Lifescience Database Archive (English)
Full Text Available YMU001_000022_A07 476 Adiantum capillus-veneris mRNA. clone: YMU001_000022_A07. BP912712 - Show BP912712...is mRNA. clone: YMU001_000022_A07. Accession BP912712 Tissue type prothallium Developmental stage - Contig I...cleic Acids Res. 25:3389-3402. Query= BP912712|Adiantum capillus-veneris mRNA, cl...one: YMU001_000022_A07. (476 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total let...8%), Positives = 39/69 (56%), Gaps = 4/69 (5%) Frame = +3 Query: 123 TSRRKSNHDQY--LPNYKVGTVHLLLGVKDQHLVSKIDI
Lifescience Database Archive (English)
Full Text Available YMU001_000016_D11 457 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D11. BP912212... CL1085Contig1 Show BP912212 Clone id YMU001_000016_D11 Library YMU01 Length 457 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000016_D11. Accession BP912212 Tissue type prothallium Developmental stag...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912212...|Adiantum capillus-veneris mRNA, clone: YMU001_000016_D11. (457 letters) Database: uniprot_sprot.fasta 412
Lifescience Database Archive (English)
Full Text Available YMU001_000017_F01 489 Adiantum capillus-veneris mRNA. clone: YMU001_000017_F01. BP912312... CL1779Contig1 Show BP912312 Clone id YMU001_000017_F01 Library YMU01 Length 489 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000017_F01. Accession BP912312 Tissue type prothallium Developmental stag...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912312...|Adiantum capillus-veneris mRNA, clone: YMU001_000017_F01. (489 letters) Database: uniprot_sprot.fasta 412
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D10 477 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D10. BP91212...8 CL2328Contig1 Show BP912128 Clone id YMU001_000015_D10 Library YMU01 Length 477 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D10. Accession BP912128 Tissue type prothallium Developmental stag... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...8|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D10. (461 letters) Database: uniprot_sprot.fasta 412
Lifescience Database Archive (English)
Full Text Available YMU001_000024_C05 413 Adiantum capillus-veneris mRNA. clone: YMU001_000024_C05. BP912912... CL1433Contig1 Show BP912912 Clone id YMU001_000024_C05 Library YMU01 Length 413 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000024_C05. Accession BP912912 Tissue type prothallium Developmental stag... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912912|Adiantum capillus-ven...eris mRNA, clone: YMU001_000024_C05. (413 letters) Database: uniprot_sprot.fasta 412
Lifescience Database Archive (English)
Full Text Available YMU001_000131_G09 554 Adiantum capillus-veneris mRNA. clone: YMU001_000131_G09. BP919999... CL2968Contig1 Show BP919999 Clone id YMU001_000131_G09 Library YMU01 Length 554 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000131_G09. Accession BP919999 Tissue type prothallium Developmental stag...b Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generatio...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919999|Adiantum capillus-ve
Lifescience Database Archive (English)
Full Text Available YMU001_000144_D02 534 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D02. BP92099...7 CL10Contig1 Show BP920997 Clone id YMU001_000144_D02 Library YMU01 Length 534 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000144_D02. Accession BP920997 Tissue type prothallium Developmental stage ...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920997|Adian...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 2
In praise of the literary eponym--Henry V sign.
LENUS (Irish Health Repository)
Shanahan, F
2013-01-01
The use of eponyms in medicine is often discouraged. However, the literary eponym should be an exception as it is not linked with many of the difficulties associated with conventional eponyms and offers descriptive brevity and accuracy. Here, we illustrate the point with Henry V sign, which will be familiar to many who have cared for patients in the terminal stage of illness.
International Nuclear Information System (INIS)
Gago-Ferrero, Pablo; Badia-Fabregat, Marina; Olivares, Alba; Piña, Benjamin; Blánquez, Paqui; Vicent, Teresa; Caminal, Gloria; Díaz-Cruz, M. Silvia
2012-01-01
Photodecomposition might be regarded as one of the most important abiotic factors affecting the fate of UV absorbing compounds in the environment and photocatalysis has been suggested as an effective method to degrade organic pollutants. However, UV filters transformation appears to be a complex process, barely addressed to date. The white rot fungus Trametes versicolor is considered as a promising alternative to conventional aerobic bacterial degradation, as it is able to metabolise a wide range of xenobiotics. This study focused on both degradation processes of two widely used UV filters, benzophenone-3 (BP3) and benzophenone-1 (BP1). Fungal treatment resulted in the degradation of more than 99% for both sunscreens in less than 24 h, whereas photodegradation was very inefficient, especially for BP3, which remained unaltered upon 24 h of simulated sunlight irradiation. Analysis of metabolic compounds generated showed BP1 as a minor by-product of BP3 degradation by T. versicolor while the main intermediate metabolites were glycoconjugate derivatives. BP1 and BP3 showed a weak, but significant estrogenic activity (EC50 values of 0.058 mg/L and 12.5 mg/L, respectively) when tested by recombinant yeast assay (RYA), being BP1 200-folds more estrogenic than BP3. Estrogenic activity was eliminated during T. versicolor degradation of both compounds, showing that none of the resulting metabolites possessed significant estrogenic activity at the concentrations produced. These results demonstrate the suitability of this method to degrade both sunscreen agents and to eliminate estrogenic activity. - Highlights: ► Fungus T. versicolor is able to degrade totally BP3 and BP1 in few hours in a fluidised bed bioreactor. ► BP3 is not degraded under simulated sunlight. ► Glycoconjugates have been identified as the main intermediate metabolites. ► Decrease in endocrine activity was found in both photodegradation and biodegradation.
Lifescience Database Archive (English)
Full Text Available YMU001_000032_E04 520 Adiantum capillus-veneris mRNA. clone: YMU001_000032_E04. BP913636... CL2643Contig1 Show BP913636 Clone id YMU001_000032_E04 Library YMU01 Length 520 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000032_E04. Accession BP913636 Tissue type prothallium Developmental stag...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP913636|Adiantum capillus-veneris mRNA, clone: YMU001_00003...tative phospholipid-transporting ATPase ... 149 8e-36 sp|Q9LNQ4|ALA4_ARATH Putati
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D06 531 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D06. BP91212...4 CL2988Contig1 Show BP912124 Clone id YMU001_000015_D06 Library YMU01 Length 531 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D06. Accession BP912124 Tissue type prothallium Developmental stag...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912124|Adiantum capillus-veneris mRNA,... clone: YMU001_000015_D06. (531 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D07 558 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D07. BP912125 - Show BP91212...is mRNA. clone: YMU001_000015_D07. Accession BP912125 Tissue type prothallium Developmental stage - Contig I...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912125|Adiantum capillus-veneris mRN...A, clone: YMU001_000015_D07. (558 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tota...copeptide repeat-containing protein At1g08070 OS=Arabidopsis thaliana GN=PCMP-H12
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D01 500 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D01. BP912120 - Show BP91212...is mRNA. clone: YMU001_000015_D01. Accession BP912120 Tissue type prothallium Developmental stage - Contig I...elated Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum Align length 130 Score (bit) 124.0 E-va...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...0|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D01. (500 letters) Database: uniprot_sprot.fasta 412
Lifescience Database Archive (English)
Full Text Available YMU001_000147_A09 361 Adiantum capillus-veneris mRNA. clone: YMU001_000147_A09. BP921212 - Show BP921212...is mRNA. clone: YMU001_000147_A09. Accession BP921212 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921212|Adiantum capillus-veneris... mRNA, clone: YMU001_000147_A09. (361 letters) Database: uniprot_sprot.fasta 412,...itol-4,5-bisphosphate 3-ki... 30 2.9 sp|O14338|YB33_SCHPO Uncharacterized serine-rich protein C2F12.0... 29
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D08 484 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D08. BP912126 CL412...4Contig1 Show BP912126 Clone id YMU001_000015_D08 Library YMU01 Length 484 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D08. Accession BP912126 Tissue type prothallium Developmental stage - Contig ID CL412...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. ...25:3389-3402. Query= BP912126|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D08. (484 letters) Databa
Lifescience Database Archive (English)
Full Text Available YMU001_000023_B07 575 Adiantum capillus-veneris mRNA. clone: YMU001_000023_B07. BP912812... CL2610Contig1 Show BP912812 Clone id YMU001_000023_B07 Library YMU01 Length 575 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000023_B07. Accession BP912812 Tissue type prothallium Developmental stag... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912812|Adiant...um capillus-veneris mRNA, clone: YMU001_000023_B07. (575 letters) Database: uniprot_sprot.fasta 412,525 sequ
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D04 544 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D04. BP91212...2 CL3363Contig1 Show BP912122 Clone id YMU001_000015_D04 Library YMU01 Length 544 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D04. Accession BP912122 Tissue type prothallium Developmental stag...obium aromaticivorans (strain DSM 12444) Align length 58 Score (bit) 33.1 E-value 0.89 Report BLASTX 2.2.19 ...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912122|Adiantum
Lifescience Database Archive (English)
Full Text Available YMU001_000018_G03 551 Adiantum capillus-veneris mRNA. clone: YMU001_000018_G03. BP912412... CL4248Contig1 Show BP912412 Clone id YMU001_000018_G03 Library YMU01 Length 551 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_G03. Accession BP912412 Tissue type prothallium Developmental stag...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912412|Adiantum capillus-veneris mR...NA, clone: YMU001_000018_G03. (551 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tot
Lifescience Database Archive (English)
Full Text Available YMU001_000012_A06 542 Adiantum capillus-veneris mRNA. clone: YMU001_000012_A06. BP912012... CL2421Contig1 Show BP912012 Clone id YMU001_000012_A06 Library YMU01 Length 542 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_A06. Accession BP912012 Tissue type prothallium Developmental stag...rams, Nucleic Acids Res. 25:3389-3402. Query= BP912012|Adiantum capillus-veneris ...mRNA, clone: YMU001_000012_A06. (542 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 t
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D05 496 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D05. BP91212...3 CL498Contig1 Show BP912123 Clone id YMU001_000015_D05 Library YMU01 Length 496 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000015_D05. Accession BP912123 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...3|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D05. (478 letters) Database: uniprot_sprot.fasta 412
Lifescience Database Archive (English)
Full Text Available YMU001_000019_D01 513 Adiantum capillus-veneris mRNA. clone: YMU001_000019_D01. BP912512... CL17Contig1 Show BP912512 Clone id YMU001_000019_D01 Library YMU01 Length 513 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000019_D01. Accession BP912512 Tissue type prothallium Developmental stage ...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP912512|Adiantum capillus-veneris mRNA, clone: YMU0...01_000019_D01. (489 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Sear
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D11 268 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D11. BP91212...9 CL691Contig1 Show BP912129 Clone id YMU001_000015_D11 Library YMU01 Length 268 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000015_D11. Accession BP912129 Tissue type prothallium Developmental stage...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912129|Adiantum capillus-veneris mRNA, clo...ne: YMU001_000015_D11. (268 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total lett
Lifescience Database Archive (English)
Full Text Available YMU001_000100_A08 270 Adiantum capillus-veneris mRNA. clone: YMU001_000100_A08. BP917373 CL2373...Contig1 Show BP917373 Clone id YMU001_000100_A08 Library YMU01 Length 270 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000100_A08. Accession BP917373 Tissue type prothallium Developmental stage - Contig ID CL2373...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917373|Adiantum capillus-veneris mRNA, clone: YMU...EGAVKHVGVLSS 206 K+ GC+S G SRHGES V KE H SS Sbjct: 473 KKEKGCSSPGSSRHGESHKGVSHTPI
Taxing junk food: applying the logic of the Henry tax review to food.
Bond, Molly E; Williams, Michael J; Crammond, Brad; Loff, Bebe
2010-10-18
The recent review of taxation in Australia - the Henry tax review - has recommended that the federal government increase the taxes already levied on tobacco and alcohol. Tobacco and alcohol taxes are put forward as the best way of reducing the social harms caused by the use and misuse of these substances. Junk foods have the same pattern of misuse and the same social costs as tobacco and alcohol. The Henry tax review rejects the idea of taxing fatty foods, and to date the government has not implemented a tax on junk food. We propose that a tax on junk food be implemented as a tool to reduce consumption and address the obesity epidemic.
Teaching the “Grandsons of Balzac” a Lesson: Henry James in the 1890’s
Directory of Open Access Journals (Sweden)
Dennis F. TREDY
2004-06-01
Full Text Available Lyall H. Powers, in Henry James and the Naturalist Movement, dubs the period spanning from “The Art of Fiction” in 1884 to The Tragic Muse in 1890 Henry James’s “Naturalist Experiment”, and rightfully so (Powers 3. There is much evidence, in James’s own notebooks, that The Bostonians was influenced by Daudet’s L’Évangeliste, The Princess Casamassima by Turgeneff’s Virgin Soil, and The Tragic Muse by the narrative techniques of Maupassant (NB 47, Powers 91, NB 92, and Powers effectively show...
Alpert, Bruce S
2011-04-01
We evaluated two new Welch Allyn automated blood pressure (BP) algorithms. The first, SureBP, estimates BP during cuff inflation; the second, StepBP, does so during deflation. We followed the American National Standards Institute/Association for the Advancement of Medical Instrumentation SP10:2006 standard for testing and data analysis. The data were also analyzed using the British Hypertension Society analysis strategy. We tested children, adolescents, and adults. The requirements of the American National Standards Institute/Association for the Advancement of Medical Instrumentation SP10:2006 standard were fulfilled with respect to BP levels, arm sizes, and ages. Association for the Advancement of Medical Instrumentation SP10 Method 1 data analysis was used. The mean±standard deviation for the device readings compared with auscultation by paired, trained, blinded observers in the SureBP mode were -2.14±7.44 mmHg for systolic BP (SBP) and -0.55±5.98 mmHg for diastolic BP (DBP). In the StepBP mode, the differences were -3.61±6.30 mmHg for SBP and -2.03±5.30 mmHg for DBP. Both algorithms achieved an A grade for both SBP and DBP by British Hypertension Society analysis. The SureBP inflation-based algorithm will be available in many new-generation Welch Allyn monitors. Its use will reduce the time it takes to estimate BP in critical patient care circumstances. The device will not need to inflate to excessive suprasystolic BPs to obtain the SBP values. Deflation is rapid once SBP has been determined, thus reducing the total time of cuff inflation and reducing patient discomfort. If the SureBP fails to obtain a BP value, the StepBP algorithm is activated to estimate BP by traditional deflation methodology.
Lifescience Database Archive (English)
Full Text Available YMU001_000038_B01 468 Adiantum capillus-veneris mRNA. clone: YMU001_000038_B01. BP913939 - Show BP913939...is mRNA. clone: YMU001_000038_B01. Accession BP913939 Tissue type prothallium Developmental stage - Contig I...Nucleic Acids Res. 25:3389-3402. Query= BP913939|Adiantum capillus-veneris mRNA, ... F member 3... 86 9e-17 sp|Q66H39|ABCF3_RAT ATP-binding cassette sub-family F member 3 O... 85 1e-16 sp|Q5R9...aracterized ABC transporter ATP-binding... 56 6e-08 sp|P63390|YHES_ECO57 Uncharacterized ABC transporter ATP
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D09 582 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D09. BP912127 - Show BP91212...is mRNA. clone: YMU001_000015_D09. Accession BP912127 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912127|Adiantum capillus-veneris mRNA,... clone: YMU001_000015_D09. (582 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total ...p|P42825|DNAJ2_ARATH Chaperone protein dnaJ 2 OS=Arabidopsis th... 79 2e-14 sp|Q09912|PSI1_SCHPO Protein psi
Lifescience Database Archive (English)
Full Text Available YMU001_000015_C08 546 Adiantum capillus-veneris mRNA. clone: YMU001_000015_C08. BP912112 - Show BP912112...is mRNA. clone: YMU001_000015_C08. Accession BP912112 Tissue type prothallium Developmental stage - Contig I...Arabidopsis thaliana Align length 171 Score (bit) 121.0 E-value 3.0e-27 Report BLASTX 2.2.19 [Nov-02-2008] R... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912112|Adiantum capillus-veneri...s mRNA, clone: YMU001_000015_C08. (546 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765
Staging Henry Fielding: The Author-Narrator in Tom Jones On Screen
Directory of Open Access Journals (Sweden)
Eli Løfaldli
2017-06-01
Full Text Available As recent adaptation theory has shown, classic-novel adaptation typically sets issues connected to authorship and literal and figurative ownership into play. This key feature of such adaptations is also central to the screen versions of Henry Fielding’s Tom Jones (1749. In much of Fielding’s fiction, the narrator, typically understood as an embodiment of Fielding himself, is a particularly prominent presence. The author-narrator in Tom Jones is no exception: not only is his presence strongly felt throughout the novel, but through a variety of means, ‘The History of Tom Jones, A Foundling’ is also distinctly marked as being under his control and ownership. The two adaptations of Fielding’s novel, a 1963 film and a 1997 television series, both retain the figure of the author-narrator, but differ greatly in their handling of this device and its consequent thematic ramifications. Although the 1963 film de-emphasises Henry Fielding’s status as proprietor of the story, the author-narrator as represented in the film’s voiceover commentary is a figure of authority and authorial control. In contrast, the 1997 adaptation emphasises Fielding’s ownership of the narrative and even includes the author-narrator as a character in the series, but this ownership is undermined by the irreverent treatment to which he is consistently subjected. The representations of Henry Fielding in the form of the author-narrator in both adaptations are not only indicative of shifting conceptions of authorship, but also of the important interplay between authorship, ownership and adaptation more generally.
Energy Technology Data Exchange (ETDEWEB)
Gago-Ferrero, Pablo, E-mail: pablo.gago@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Badia-Fabregat, Marina, E-mail: marina.badia@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Olivares, Alba, E-mail: esalba.olivares@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Pina, Benjamin, E-mail: benjami.pina@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Blanquez, Paqui, E-mail: paqui.blanquez@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Vicent, Teresa, E-mail: teresa.vicent@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Caminal, Gloria, E-mail: gloria.caminal@uab.cat [Unitat de Biocatalisi Aplicada associada al IQAC (CSIC-UAB). Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Diaz-Cruz, M. Silvia, E-mail: silvia.diaz@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); and others
2012-06-15
Photodecomposition might be regarded as one of the most important abiotic factors affecting the fate of UV absorbing compounds in the environment and photocatalysis has been suggested as an effective method to degrade organic pollutants. However, UV filters transformation appears to be a complex process, barely addressed to date. The white rot fungus Trametes versicolor is considered as a promising alternative to conventional aerobic bacterial degradation, as it is able to metabolise a wide range of xenobiotics. This study focused on both degradation processes of two widely used UV filters, benzophenone-3 (BP3) and benzophenone-1 (BP1). Fungal treatment resulted in the degradation of more than 99% for both sunscreens in less than 24 h, whereas photodegradation was very inefficient, especially for BP3, which remained unaltered upon 24 h of simulated sunlight irradiation. Analysis of metabolic compounds generated showed BP1 as a minor by-product of BP3 degradation by T. versicolor while the main intermediate metabolites were glycoconjugate derivatives. BP1 and BP3 showed a weak, but significant estrogenic activity (EC50 values of 0.058 mg/L and 12.5 mg/L, respectively) when tested by recombinant yeast assay (RYA), being BP1 200-folds more estrogenic than BP3. Estrogenic activity was eliminated during T. versicolor degradation of both compounds, showing that none of the resulting metabolites possessed significant estrogenic activity at the concentrations produced. These results demonstrate the suitability of this method to degrade both sunscreen agents and to eliminate estrogenic activity. - Highlights: Black-Right-Pointing-Pointer Fungus T. versicolor is able to degrade totally BP3 and BP1 in few hours in a fluidised bed bioreactor. Black-Right-Pointing-Pointer BP3 is not degraded under simulated sunlight. Black-Right-Pointing-Pointer Glycoconjugates have been identified as the main intermediate metabolites. Black-Right-Pointing-Pointer Decrease in endocrine activity
Directory of Open Access Journals (Sweden)
Azamat Aslanukov
2006-10-01
Full Text Available The Ran-binding protein 2 (RanBP2 is a large multimodular and pleiotropic protein. Several molecular partners with distinct functions interacting specifically with selective modules of RanBP2 have been identified. Yet, the significance of these interactions with RanBP2 and the genetic and physiological role(s of RanBP2 in a whole-animal model remain elusive. Here, we report the identification of two novel partners of RanBP2 and a novel physiological role of RanBP2 in a mouse model. RanBP2 associates in vitro and in vivo and colocalizes with the mitochondrial metallochaperone, Cox11, and the pacemaker of glycolysis, hexokinase type I (HKI via its leucine-rich domain. The leucine-rich domain of RanBP2 also exhibits strong chaperone activity toward intermediate and mature folding species of Cox11 supporting a chaperone role of RanBP2 in the cytosol during Cox11 biogenesis. Cox11 partially colocalizes with HKI, thus supporting additional and distinct roles in cell function. Cox11 is a strong inhibitor of HKI, and RanBP2 suppresses the inhibitory activity of Cox11 over HKI. To probe the physiological role of RanBP2 and its role in HKI function, a mouse model harboring a genetically disrupted RanBP2 locus was generated. RanBP2(-/- are embryonically lethal, and haploinsufficiency of RanBP2 in an inbred strain causes a pronounced decrease of HKI and ATP levels selectively in the central nervous system. Inbred RanBP2(+/- mice also exhibit deficits in growth rates and glucose catabolism without impairment of glucose uptake and gluconeogenesis. These phenotypes are accompanied by a decrease in the electrophysiological responses of photosensory and postreceptoral neurons. Hence, RanBP2 and its partners emerge as critical modulators of neuronal HKI, glucose catabolism, energy homeostasis, and targets for metabolic, aging disorders and allied neuropathies.
Aslanukov, Azamat; Bhowmick, Reshma; Guruju, Mallikarjuna; Oswald, John; Raz, Dorit; Bush, Ronald A; Sieving, Paul A; Lu, Xinrong; Bock, Cheryl B; Ferreira, Paulo A
2006-10-01
The Ran-binding protein 2 (RanBP2) is a large multimodular and pleiotropic protein. Several molecular partners with distinct functions interacting specifically with selective modules of RanBP2 have been identified. Yet, the significance of these interactions with RanBP2 and the genetic and physiological role(s) of RanBP2 in a whole-animal model remain elusive. Here, we report the identification of two novel partners of RanBP2 and a novel physiological role of RanBP2 in a mouse model. RanBP2 associates in vitro and in vivo and colocalizes with the mitochondrial metallochaperone, Cox11, and the pacemaker of glycolysis, hexokinase type I (HKI) via its leucine-rich domain. The leucine-rich domain of RanBP2 also exhibits strong chaperone activity toward intermediate and mature folding species of Cox11 supporting a chaperone role of RanBP2 in the cytosol during Cox11 biogenesis. Cox11 partially colocalizes with HKI, thus supporting additional and distinct roles in cell function. Cox11 is a strong inhibitor of HKI, and RanBP2 suppresses the inhibitory activity of Cox11 over HKI. To probe the physiological role of RanBP2 and its role in HKI function, a mouse model harboring a genetically disrupted RanBP2 locus was generated. RanBP2(-/-) are embryonically lethal, and haploinsufficiency of RanBP2 in an inbred strain causes a pronounced decrease of HKI and ATP levels selectively in the central nervous system. Inbred RanBP2(+/-) mice also exhibit deficits in growth rates and glucose catabolism without impairment of glucose uptake and gluconeogenesis. These phenotypes are accompanied by a decrease in the electrophysiological responses of photosensory and postreceptoral neurons. Hence, RanBP2 and its partners emerge as critical modulators of neuronal HKI, glucose catabolism, energy homeostasis, and targets for metabolic, aging disorders and allied neuropathies.
[From apprenticeship to Nobel Prize: Henri Moissan's fabulous destiny].
Lafont, O
2008-01-01
Born in Paris on September 28, 1852, son of an eastern railways' employee and of a dressmaker, Henri Moissan's secondary schooling in Meaux did not allow him to get access to the sesame diploma "baccalauréat" (GCE). In 1869, he did obtain a special certificate of secondary schooling so that he could become an apprentice in watch making. That could have been the end of the story, but dreadful event for France appeared to have beneficial effects for Moissan. Under the threat of the Prussian army, Moissan's family took refuge near Paris. This gave the young Henri the opportunity to register as a student for the second-class pharmacy diploma, which did not need, at the time, the GCE. Moissan became then a trainee in pharmacy in 1871. Meanwhile, he followed the special schooling of "Ecole de chimie" founded by E. Frémy, and then joined the laboratory of Dehérain at the Museum, where he worked in plant physiology. He finally obtained the famous "baccalauréat" (GCE) and could register as a student in first-class pharmacy. He became a pharmacist as well as a doctor in sciences. In 1883, Moissan was named professor at the school of pharmacy in Paris. In 1886, he isolated fluorine by electrolysis of fluorhydric acid, in the presence of potassium fluoride, at a low temperature. He then studied diamond synthesis and gave a start to high temperature chemistry, designing his famous furnace. These findings and many others allowed Moissan to rise to membership in many learned academies around the world. Crowning achievement, Moissan won the Nobel Prize in 1906. A man of culture, collector of autographs and paintings, he died in 1907. Nothing of that would have been possible if there had not been a second-class pharmacist diploma. The history of Henri Moissan is one of a rise from apprenticeship to the Nobel Prize.
The last ride of Henry II of France: orbital injury and a king's demise.
Eftekhari, Kian; Choe, Christina H; Vagefi, M Reza; Eckstein, Lauren A
2015-01-01
Jousting was a popular pastime for royalty in the Renaissance era. Injuries were common, and the eye was particularly at risk from the splinters of the wooden lance. On June 30, 1559, Henry II of France participated in a jousting tournament to celebrate two royal weddings. In the third match, Gabriel de Montgomery struck Henry on the right shoulder and the lance splintered, sending wooden shards into his face and right orbit. Despite being cared for by the prominent physicians Ambroise Paré and Andreas Vesalius, the king died 10 days later and was found to have a cerebral abscess. The wound was not explored immediately after the injury; nevertheless, wooden foreign bodies were discovered in the orbit at the time of autopsy. The dura had not been violated, suggesting that an infection may have traveled from the orbit into the brain. Nostradamus and Luca Guarico, the astrologer to the Medici family, had prophesied the death of Henry II of France, but he ignored their warnings and thus changed the course of history in Renaissance Europe. Copyright © 2015 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
L. S. Venter
1977-03-01
Full Text Available Die doel van Henry se verblyf by die Silbersteins word vroeg in Sewe dae verwoord as Jock tydens die eerste aandbyeenkoms sê dat Henry „van sekere gevestigde idees” (p. 16 ontslae moet raak. Ook mrs. Silberstein beskou dit as noodsaaklik dat sy on skuld vemietig moet word (p. 22. Op die oggendwandeling van die tweede dag herhaal Jock sy stelling van die vorige aand en voeg daaraan toe dat daar baie dinge is wat Henry ,,sal moet leer en verleer” (p. 28. Vir die modeme mens, wat „van die vrug van kennis geëet” het, is daar „geen illussies meer nie” (p. 32.
Tunneling in BP-MoS2 heterostructure
Liu, Xiaochi; Qu, Deshun; Kim, Changsik; Ahmed, Faisal; Yoo, Won Jong
Tunnel field effect transistor (TFET) is considered to be a leading option for achieving SS mV/dec. In this work, black phosphorus (BP) and molybdenum disulfide (MoS2) heterojunction devices are fabricated. We find that thin BP flake and MoS2 form normal p-n junctions, tunneling phenomena can be observed when BP thickness increases to certain level. PEO:CsClO4 is applied on the surface of the device together with a side gate electrode patterned together with source and drain electrodes. The Fermi level of MoS2 on top of BP layer can be modulated by the side gating, and this enables to vary the MoS2-BP tunnel diode property from off-state to on-state. Since tunneling is the working mechanism of MoS2-BP junction, and PEO:CsClO4\\ possesses ultra high dielectric constant and small equivalent oxide thickness (EOT), a low SS of 55 mV/dec is obtained from MoS2-BP TFET. This work was supported by the Global Research Laboratory and Global Frontier R&D Programs at the Center for Hybrid Interface Materials, both funded by the Ministry of Science, ICT & Future Planning via the National Research Foundation of Korea (NRF).
Henri Wallon's Theory of Early Child Development: The Role of Emotions.
Van der Veer, Rene
1996-01-01
Discusses the stage theory of early child development of French theorist Henri Wallon. Describes Wallon's efforts (in contrast to contemporary Piaget) to describe emotional development and the role emotions play in establishing the child-caregiver bond. Argues that Wallon's theory is unique in its focus, influenced theorists such as Vygotsky, and…
Henri Fayol, théoricien de l’entreprise innovante
Hatchuel , Armand; Segrestin , Blanche
2016-01-01
International audience; Have we correctly read Henri Fayol? His work is still reduced to general principles of administration that seem rigid and trivial. Yet, he has been a great innovative leader that considered scientific research as a major task of the business executive. A new reading of Fayol's masterpiece shows that he introduced sophisticated notions: " the unknown " , " the program of action " , " the advancement " , which meaning was erased by his translators or forgotten. Coming fr...
Energy Technology Data Exchange (ETDEWEB)
Michotte, C.; Ratel, G.; Courte, S. [Bureau International des Poids et Mesures (BIPM), 92 - Sevres (France); Hino, Y.; Yunoki, A. [National Metrology Institute of Japan (NMIJ), National Institute of Advanced Industrial Science and Technology (AIST), Tsukuba, Ibaraki (Japan); Bobin, C.; Moune, M. [CEA Saclay, Laboratoire National de Metrologie et d' Essais, Laboratoire National Henri Becquerel (LNE-LNHB), 91 - Gif-sur-Yvette (France)
2009-04-15
In 2006 and 2007, the National Metrology Institute of Japan (NMIJ) and the Laboratoire national de metrologie et d'essais-Laboratoire national Henri Becquerel (LNE-LNHB) submitted samples of known activity of {sup 57}Co to the International Reference System (SIR). The values of the activity submitted were about 1.7 MBq and 3.7 MBq respectively. The new key comparison results have replaced the previous results for Japan and France. These new results have enabled a re-evaluation of the key comparison reference value. The matrix of degrees of equivalence in the key comparison database that now contains twelve results, identifier BIPM.RI(II)-K1.Co-57, has been updated with the new results. (authors)
Enter the Madcap Prince of Wales: Students Directing "Henry IV, Part I."
Earthman, Elise Ann
1993-01-01
Argues that William Shakespeare's "Henry IV, Part I" is an appropriate and useful text for secondary English classrooms. Shows how the play lends itself to performance-based instruction. Outlines ways of accomplishing student engagement, using film versions, and assigning written work. (HB)
Strelku vsjo ravno perevedut. No v kakuju storonu? / Henry Posner ; interv. Eteri Kekelidze
Posner, Henry
2006-01-01
Eesti Raudtee üks erastajaist, RDC juht Henry Posner III meenutab ER erastamist 2001. a., investeeringutest, reeglite muutmisest, Eesti Raudtee müümise põhjustest, Eesti transiidi tulevikust. Diagramm: Eesti Raudtee kasum 1998-2004
The Royal Entries of Henry VI in a London Civic Manuscript
DEFF Research Database (Denmark)
Bourassa, Kristin
2016-01-01
London Metropolitan Archives, MS Letter Book K, contains descriptions of Henry VI’s royal entries into both Paris (1431) and London (1432). Their placement one after the other in a London Letter Book was likely the work of the city’s common clerk, John Carpenter, who was the author of the descrip...
Mounting a Curricular Revolution: An Interview with Henry Louis Gates, Jr.
von Zastrow, Claus
2009-01-01
This article presents an interview with Henry Louis Gates, Jr., Harvard professor and cultural critic who has captured 25 million viewers with his PBS documentary series, African American Lives (WNET). Using genealogical research and DNA science, Gates traces the family history of 19 famous African Americans. What results is a rich and moving…
Henry Evelyn Bliss--The Other Immortal, or a Prophet without Honour?
Broughton, Vanda
2008-01-01
The paper takes a retrospective look at the work of Henry Evelyn Bliss, classificationist theorist and author of the "Bibliographic Classification". Major features of his writings and philosophy are examined and evaluated for the originality of their contribution to the corpus of knowledge in the discipline. Reactions to Bliss's work are analysed,…
HENRY C. WALLICH: A THIRD GENERATION BANKER
Directory of Open Access Journals (Sweden)
Saul Engelbourg
2001-01-01
Full Text Available Born in Germany and descendant of a wealthy banking family, Henry C. Wallich emigrated to the United States like others of Jewish ancestry who fled during the 1930s. A professor of money and banking at Yale for two decades, Wallich capped his career as a Governor of the Federal Reserve. During the stagflation of the late 1960s, Wallich, a dissenter, tirelessly advocated tighter monetary policy to stem inflation. Always a scholar, Wallich published extensively; he also served as the Fed’s public spokesman. Owing to his Harvard doctorate and his eminence as an economist, Wallich knew everyone worth knowing in the economics profession.
Henri de Régnier portraitiste du Parnasse
Mortelette, Yann
2016-01-01
Henri de Régnier disait de José-Maria de Heredia qu’il avait fait le lien entre le Parnasse et le symbolisme. Lui-même fit le lien entre le symbolisme et le Parnasse. En 1895, il notait dans son journal intime : « J’ai subi de grandes influences. Aux premiers jours, Mallarmé m’a […] nettoyé l’esprit ; j’en ai été affiné et ankylosé. Puis j’ai subi les contacts plus vivants d’Heredia. » Cette seconde influence contrebalança la première. Régnier fréquenta les samedis de la rue Balzac avec autan...
Directory of Open Access Journals (Sweden)
Paulo Henrique S. Fonseca
2011-06-01
Full Text Available OBJETIVO: Analisar a validade da equação de predição da taxa metabólica de repouso proposta por Henry e Rees (1991 em adolescentes do sexo masculino. MÉTODOS: Estudo transversal, com amostra de conveniência constituída de 52 meninos, entre dez e 17 anos, sendo mensuradas a massa corporal e a calorimetria indireta. A massa corporal foi substituída na equação de Henry e Rees para determinar a taxa metabólica de repouso predita. A calorimetria indireta foi determinada pelos valores do consumo de O2 e produção de CO2, e usada na equação de Weir (1949, considerada método padrão para o cálculo da taxa metabólica de repouso. Todas as medidas foram realizadas pela manhã, com o indivíduo em jejum de seis horas, em posição supina e em repouso muscular. Realizaram-se os seguintes procedimentos estatísticos: teste t pareado; erro constante (com diferença aceita entre as médias OBJETIVO: Analizar la validez de la ecuación de predicción de la tasa metabólica de reposo (TMR propuesta por Henry y Rees (1991 en adolescentes del sexo masculino. MÉTODOS: Estudio transversal, con muestra de conveniencia constituida por 52 niños, entre 10 y 17 años, siendo medidas las variables a continuación: masa corporal y calorimetría indirecta (CI. La masa corporal fue sustituida en la ecuación de Henry y Rees (1991 para determinar la TMR predicha. La CI fue determinada por los valores del consumo de O2 y producción de CO2 y usada en la ecuación de Weir (1949, considerada como método estándar de la TMR. Todas las medidas fueron realizadas por la mañana, con el individuo en ayuno de 6 horas, en posición supina y en reposo muscular. Se realizaron los siguientes procedimientos estadísticos: prueba “t” pareada; error constante (EC - con diferencia aceptada entre los promedios menor que 5% y, para análisis de la concordancia entre los dos métodos, el procedimiento gráfico de Bland y Altman. RESULTADOS: La ecuación propuesta por
BP180 dysfunction triggers spontaneous skin inflammation in mice.
Zhang, Yang; Hwang, Bin-Jin; Liu, Zhen; Li, Ning; Lough, Kendall; Williams, Scott E; Chen, Jinbo; Burette, Susan W; Diaz, Luis A; Su, Maureen A; Xiao, Shengxiang; Liu, Zhi
2018-06-04
BP180, also known as collagen XVII, is a hemidesmosomal component and plays a key role in maintaining skin dermal/epidermal adhesion. Dysfunction of BP180, either through genetic mutations in junctional epidermolysis bullosa (JEB) or autoantibody insult in bullous pemphigoid (BP), leads to subepidermal blistering accompanied by skin inflammation. However, whether BP180 is involved in skin inflammation remains unknown. To address this question, we generated a BP180-dysfunctional mouse strain and found that mice lacking functional BP180 (termed Δ NC16A ) developed spontaneous skin inflammatory disease, characterized by severe itch, defective skin barrier, infiltrating immune cells, elevated serum IgE levels, and increased expression of thymic stromal lymphopoietin (TSLP). Severe itch is independent of adaptive immunity and histamine, but dependent on increased expression of TSLP by keratinocytes. In addition, a high TSLP expression is detected in BP patients. Our data provide direct evidence showing that BP180 regulates skin inflammation independently of adaptive immunity, and BP180 dysfunction leads to a TSLP-mediated itch. The newly developed mouse strain could be a model for elucidation of disease mechanisms and development of novel therapeutic strategies for skin inflammation and BP180-related skin conditions.
BP - bisnis põhjas? / Erik Aru
Aru, Erik
2010-01-01
Seoses Mehhiko lahe naftareostusega ootab BP-d kuni 21 mld. dollari suurune trahv, kahjude hüvitamiseks peab BP müüma osa oma varast. Ekspertide hinnangul tähendavad Mehhiko lahe sündmused suuri muutusi kogu naftaäris
Multivalent display of the antimicrobial peptides BP100 and BP143
Directory of Open Access Journals (Sweden)
Imma Güell
2012-12-01
Full Text Available Carbohydrates are considered as promising templates for the display of multiple copies of antimicrobial peptides. Herein, we describe the design and synthesis of chimeric structures containing two or four copies of the antimicrobial peptides KKLFKKILKYL-NH2 (BP100 and KKLfKKILKYL-NH2 (BP143 attached to the carbohydrate template cyclodithioerythritol (cDTE or α-D-galactopyranoside (Galp. The synthesis involved the preparation of the corresponding peptide aldehyde followed by coupling to an aminooxy-functionalized carbohydrate template. After purification, the multivalent display systems were obtained in high purities (90–98% and in good yields (42–64%. These compounds were tested against plant and human pathogenic bacteria and screened for their cytotoxicity on eukaryotic cells. They showed lower MIC values than the parent peptides against the bacteria analyzed. In particular, the carbopeptides derived from cDTE and Galp, which contained two or four copies of BP100, respectively, were 2- to 8-fold more active than the monomeric peptide against the phytopathogenic bacteria. These results suggest that preassembling antimicrobial peptides to multimeric structures is not always associated with a significant improvement of the activity. In contrast, the carbopeptides synthesized were active against human red blood cells pointing out that peptide preassembly is critical for the hemolytic activity. Notably, peptide preassembly resulted in an enhanced bactericidal effect.
W.E. Henry Symposium Compendium, Lawrence Berkeley National Laboratory, September 19, 1997
1997-09-19
Society • Philosophical Society of Washington • Washington Academy of Sciences • New York Academy of Sciences • Institut International du Froid ...Powered Magnets" Reports of NRL Progress, Nov. 1958. 29. Henry, Warren E. "Aimantation dans les champs forts et approche a la saturation absolue du
BP report of the business year 1979
Energy Technology Data Exchange (ETDEWEB)
1980-01-01
The paper presents a survey about the development of the energy- and petroleum market during the year 1979. A commentary of the German BP A.G. and its activities is given here: personnel- and management policy, exploration, supply, refining and distribution, investigation, and development. After a survey about the business situation of the German BP A.G. the detailed annual balance sheets of 1979 of the German BP and of the whole enterprise are given.
Face recognition based on improved BP neural network
Directory of Open Access Journals (Sweden)
Yue Gaili
2017-01-01
Full Text Available In order to improve the recognition rate of face recognition, face recognition algorithm based on histogram equalization, PCA and BP neural network is proposed. First, the face image is preprocessed by histogram equalization. Then, the classical PCA algorithm is used to extract the features of the histogram equalization image, and extract the principal component of the image. And then train the BP neural network using the trained training samples. This improved BP neural network weight adjustment method is used to train the network because the conventional BP algorithm has the disadvantages of slow convergence, easy to fall into local minima and training process. Finally, the BP neural network with the test sample input is trained to classify and identify the face images, and the recognition rate is obtained. Through the use of ORL database face image simulation experiment, the analysis results show that the improved BP neural network face recognition method can effectively improve the recognition rate of face recognition.
História e psicologia em Henri Berr
Waeny, Maria Fernanda Costa
2017-01-01
O artigo aborda algumas das idéias de Henri Berr; trata de sua proposta em história, especialmente no que ela se opõe à filosofia da história e à história alemãs; e examina como esta concepção de história à la francesa introduz a psicologia nas pesquisas em história e inaugura a psicologia histórica.Palavras-chave: História da Psicologia; Psicologia Histórica; História das Ciências Humanas; História das Idéias; Annales
O pensamento crítico de Henri Lefebvre
Directory of Open Access Journals (Sweden)
William Gómez Soto
2012-12-01
Full Text Available Este trabalho é uma análise da presença de Henri Lefebvre na sociologia brasileira. Lefebvre faz uma leitura crítica de Marx, recuperando o método dialético e propondo uma teoria da vida cotidiana. José de Souza Martins influenciado por Lefebvre e utilizando o método dialético, analisa o processo histórico da constituição do capitalismo brasileiro. Apesar de que há certa presença de Lefebvre na sociologia brasileira, ainda a riqueza de sua obra está para ser descoberta.
Burnside, Rachel D; Pasion, Romela; Mikhail, Fady M; Carroll, Andrew J; Robin, Nathaniel H; Youngs, Erin L; Gadi, Inder K; Keitges, Elizabeth; Jaswaney, Vikram L; Papenhausen, Peter R; Potluri, Venkateswara R; Risheg, Hiba; Rush, Brooke; Smith, Janice L; Schwartz, Stuart; Tepperberg, James H; Butler, Merlin G
2011-10-01
The proximal long arm of chromosome 15 has segmental duplications located at breakpoints BP1-BP5 that mediate the generation of NAHR-related microdeletions and microduplications. The classical Prader-Willi/Angelman syndrome deletion is flanked by either of the proximal BP1 or BP2 breakpoints and the distal BP3 breakpoint. The larger Type I deletions are flanked by BP1 and BP3 in both Prader-Willi and Angelman syndrome subjects. Those with this deletion are reported to have a more severe phenotype than individuals with either Type II deletions (BP2-BP3) or uniparental disomy 15. The BP1-BP2 region spans approximately 500 kb and contains four evolutionarily conserved genes that are not imprinted. Reports of mutations or disturbed expression of these genes appear to impact behavioral and neurological function in affected individuals. Recently, reports of deletions and duplications flanked by BP1 and BP2 suggest an association with speech and motor delays, behavioral problems, seizures, and autism. We present a large cohort of subjects with copy number alteration of BP1 to BP2 with common phenotypic features. These include autism, developmental delay, motor and language delays, and behavioral problems, which were present in both cytogenetic groups. Parental studies demonstrated phenotypically normal carriers in several instances, and mildly affected carriers in others, complicating phenotypic association and/or causality. Possible explanations for these results include reduced penetrance, altered gene dosage on a particular genetic background, or a susceptibility region as reported for other areas of the genome implicated in autism and behavior disturbances.
Profile of NF-κBp(65/NFκBp50) among prostate specific antigen sera levels in prostatic pathologies.
Bouraoui, Y; Ben Jemaa, A; Rodriguez, G; Ben Rais, N; Fraile, B; Paniagua, R; Sellemi, S; Royuela, M; Oueslati, R
2012-10-01
The aim of this work was to characterise the immunoexpression of NF-κB (p50/p65) in human prostatic pathologies and to study its profiles of activation among sera prostate specific antigen antigen (PSA) according the three groups: 0-4ng/mL, 4-20ng/mL and >20ng/mL. Twenty-four men with benign prostate hyperplasia (BPH); 19 men with prostate cancer (PC) and five men with normal prostates (NP). Immunohistochemical and western blot analysis was performed. Serum levels of PSA were assayed by immulite autoanalyser. In BPH and PC samples, immunoexpressions were observed for NF-κBp65 and NF-κBp50; while in NP samples, only were detected NF-κBp50. PC samples showed immunoreactions to NF-κBp65 and NF-κBp50 more intense (respectively 24.18±0.67 and 28.23±2.01) than that observed in BPH samples (respectively18.46±2.04 and 18.66±1.59) with special localisation in the nucleus. Different profiles of NF-κBp65 immunoexpressions were observed and BPH patients with sera PSA levels between 0-4ng/mL presented a significant weak percentage compared to BPH patients with sera PSA levels between 4-20ng/mL and >20ng/mL. No immunoreactions to NF-κBp65 were observed in PC patients with sera PSA levels between 4-20ng/mL. The sensibility of both NF-κB and PSA to inflammation allowed confirming the relationship between these two molecules and its involvement in prostatic diseases progression (inflammatory and neoplasic). Copyright © 2011 Elsevier Masson SAS. All rights reserved.
Directory of Open Access Journals (Sweden)
E Holzbecher
2016-03-01
Full Text Available In a classical paper Henry set up a conceptual model for simulating saltwater intrusion into coastal aquifers. Up to now the problem has been taken up by software developers and modellers as a benchmark for codes simulating coupled flow and transport in porous media. The Henry test case has been treated using different numerical methods based on various formulations of differential equations. We compare several of these approaches using multiphysics software. We model the problem using Finite Elements, utilizing the primitive variables and the streamfunction approach, both with and without using the Oberbeck-Boussinesq assumption. We compare directly coupled solvers with segregated solver strategies. Changing finite element orders and mesh refinement, we find that models based on the streamfunction converge 2-4 times faster than runs based on primitive variables. Concerning the solution strategy, we find an advantage of Picard iterations compared to monolithic Newton iterations.
Delille, Emmanuel
2006-01-01
Henri Ellenberger, psychiatrist and historian, experienced a decisive period in his career in the early fifties of the last century. Educated in France, intern at Sainte-Anne Hospital, he was working in Switzerland after the war and then tried to move to the United States. It was during his participation in the French group "l'Evolution Psychiatrique" that he happened to contribute to the treatise of psychiatry (1955) of the French medical and surgical encyclopaedia ("EMC") and organise an observation trip to the United States. He was supported at that time by Henri Ey, key figure of French psychiatry. While going back to his career, we would like to emphasise on his comments about the "Psychotherapy of schizophrenia". Even though later Ellenberger became a well-known researcher in North America, it is more a question for us to discuss the scientific ambition he had in this particular context of a French learned society as a member of "l'Evolution Psychiatrique" and as a psychiatrist formerly intern from the "Hôpitaux psychiatriques de la Seine" (Parisian district).
Henri Fayol’un Yönetim Düşüncesi Üzerine Notlar(Notes on Managerial Thought of Henry Fayol
Directory of Open Access Journals (Sweden)
Ramazan ŞENGÜL
2007-01-01
Full Text Available Henri Fayol, developed a managerial approach which is a perfect guide for both private and public sectors through focusing systematically upon managerial process. A major advantage of Fayol in creating a general managerial doctrine was his pratician side. His managerial thought which was developed in the early 20th century lasted up to our times. The distinguished characteristic of Fayol’s thought was studying the administrative reality through separating it into its functions, in that it helps to understand evolution and operation of organisations. The importance of his doctrine for today is that adapting contemporary managerial techniques into organisations of various kinds needs to refer Fayol’s managerial aproach in one way or another.
Thomas Henry Huxley et la Bible Thomas Henry Huxley and the Bible
Directory of Open Access Journals (Sweden)
Christophe Duvey
2009-10-01
Full Text Available Thomas Henry Huxley devoted several essays to the study of the Bible. This interest can only be accounted for if his ideas on history, religion as well as epistemology are examined. According to him, a struggle between free thought and supernaturalism was culminating during the Victorian era, hence the need for a “New Reformation” which was heir to the ideals of freedom defended by the humanists of the Renaissance. This movement opposed the principles of the supporters of what he called “ecclesiasticism”. The advocates of the “New Reformation” could rely on the progress of modern science, and agnosticism, which Huxley identified with scientific method, became its epistemological foundation. As a result, Huxley thought that the authority of physical science was in conflict with the infallibility of the Scriptures and with the theological arguments which rested on it, and this notably led him to the conclusion that the biblical narrative of the Flood was unhistorical. The naturalisation of the Scriptures seems then logically to follow his philosophical views based on the limits of human knowledge.It appears that it was the question of authority which underlay Huxley’s interest in the Bible. He thought that the authority of the Scriptures must be replaced by that of science.
Full Text Available ... Health Administration 52,779 views 3:41 Managing Stress with the Moving Forward App: An Overview - Duration: 52:29. Veterans Health Administration 310 views 52:29 Cognitive Processing Therapy ...
Henry Duméry and the sacredness of history
Labèque, Marcelo Horacio; Pontificia Universidad Católica Argentina
2014-01-01
Following the steps of the French phenomenologist HenryDuméry, It is pursued to identify the particularities of what have been called before the «historical sacred», in the most general frame of a «morphology of sacred». In that sense it is intended to demonstrate that the originality of the experience and configuration of the sacred, in both Jewish and Christian religion, comes out from a transformation of cosmic archaic experiences and points of view, leading into a new way of sacred that g...
Nicolas, Serge; Barnes, Marissa E; Murray, David J
2015-05-01
There is a rich tradition of writings about the foundation of psychology laboratories, particularly in the United States but also in France. Various documents exist concerning former German laboratories in American and French literature. But the most interesting French paper was certainly written by a young psychologist named Victor Henri (1872-1940) who was a close collaborator of Alfred Binet (1857-1911) in the 1890s. Visiting various psychology laboratories, he wrote, in 1893, a clear description of the laboratories of Wundt, G. E. Müller, Martius and Ebbinghaus. An English translation is given of Henri's paper and the historical importance of his contribution is here expounded by contrasting the German and French psychologies of the time.
Assembly of human C-terminal binding protein (CtBP) into tetramers.
Bellesis, Andrew G; Jecrois, Anne M; Hayes, Janelle A; Schiffer, Celia A; Royer, William E
2018-06-08
C-terminal binding protein 1 (CtBP1) and CtBP2 are transcriptional coregulators that repress numerous cellular processes, such as apoptosis, by binding transcription factors and recruiting chromatin-remodeling enzymes to gene promoters. The NAD(H)-linked oligomerization of human CtBP is coupled to its co-transcriptional activity, which is implicated in cancer progression. However, the biologically relevant level of CtBP assembly has not been firmly established; nor has the stereochemical arrangement of the subunits above that of a dimer. Here, multi-angle light scattering (MALS) data established the NAD + - and NADH-dependent assembly of CtBP1 and CtBP2 into tetramers. An examination of subunit interactions within CtBP1 and CtBP2 crystal lattices revealed that both share a very similar tetrameric arrangement resulting from assembly of two dimeric pairs, with specific interactions probably being sensitive to NAD(H) binding. Creating a series of mutants of both CtBP1 and CtBP2, we tested the hypothesis that the crystallographically observed interdimer pairing stabilizes the solution tetramer. MALS data confirmed that these mutants disrupt both CtBP1 and CtBP2 tetramers, with the dimer generally remaining intact, providing the first stereochemical models for tetrameric assemblies of CtBP1 and CtBP2. The crystal structure of a subtle destabilizing mutant suggested that small structural perturbations of the hinge region linking the substrate- and NAD-binding domains are sufficient to weaken the CtBP1 tetramer. These results strongly suggest that the tetramer is important in CtBP function, and the series of CtBP mutants reported here can be used to investigate the physiological role of the tetramer. © 2018 Bellesis et al.
L'Abbe Henri Breuil: Archaeologist
Directory of Open Access Journals (Sweden)
Lawrence Guy Straus
1992-05-01
Full Text Available In his otherwise excellent book, A History of Archaeological Thought, Trigger (1989: 156 makes only one passing reference in a half-sentence to the central figure in the development of Paleolithic prehistory in the first half of the 20th century -- and manages to get his name wrong, confusing Henri Breuil with his long-time, close colleague, Hugo Obenrnaie . Thirty years after his death, Breuil's role in the history of Old World prehistory required more serious consideration. He was a seminal figure not only in rock art studies, but also in the archaeology of at least France, Spain, England, Portugal, South Africa, and China. Before I had read Trigger's work or Sackett's (1991 critique of my supposed misinterpretation of Breuil's theoretical stance (e.g., Straus 1986, 1987, I had presented a review of Breuil's contributions in the 1991 Annual Snead-Wertheim Lecture in Anthropology and History at the University of New Mexico (Straus n.d.. The following is a brief summary of some of my conclusions.
Around and beyond 53BP1 Nuclear Bodies.
Fernandez-Vidal, Anne; Vignard, Julien; Mirey, Gladys
2017-12-05
Within the nucleus, sub-nuclear domains define territories where specific functions occur. Nuclear bodies (NBs) are dynamic structures that concentrate nuclear factors and that can be observed microscopically. Recently, NBs containing the p53 binding protein 1 (53BP1), a key component of the DNA damage response, were defined. Interestingly, 53BP1 NBs are visualized during G1 phase, in daughter cells, while DNA damage was generated in mother cells and not properly processed. Unlike most NBs involved in transcriptional processes, replication has proven to be key for 53BP1 NBs, with replication stress leading to the formation of these large chromatin domains in daughter cells. In this review, we expose the composition and organization of 53BP1 NBs and focus on recent findings regarding their regulation and dynamics. We then concentrate on the importance of the replication stress, examine the relation of 53BP1 NBs with DNA damage and discuss their dysfunction.
Around and beyond 53BP1 Nuclear Bodies
Directory of Open Access Journals (Sweden)
Anne Fernandez-Vidal
2017-12-01
Full Text Available Within the nucleus, sub-nuclear domains define territories where specific functions occur. Nuclear bodies (NBs are dynamic structures that concentrate nuclear factors and that can be observed microscopically. Recently, NBs containing the p53 binding protein 1 (53BP1, a key component of the DNA damage response, were defined. Interestingly, 53BP1 NBs are visualized during G1 phase, in daughter cells, while DNA damage was generated in mother cells and not properly processed. Unlike most NBs involved in transcriptional processes, replication has proven to be key for 53BP1 NBs, with replication stress leading to the formation of these large chromatin domains in daughter cells. In this review, we expose the composition and organization of 53BP1 NBs and focus on recent findings regarding their regulation and dynamics. We then concentrate on the importance of the replication stress, examine the relation of 53BP1 NBs with DNA damage and discuss their dysfunction.
Staudigl, Michael
This essay explores the practical significance of Michel Henry's "material phenomenology." Commencing with an exposition of his most basic philosophical intuition, i.e., his insight that transcendental affectivity is the primordial mode of revelation of our selfhood, the essay then brings to light how this intuition also establishes our relation to both the world and others. Animated by a radical form of the phenomenological reduction, Henry's material phenomenology brackets the exterior world in a bid to reach the concrete interior transcendental experience at the base of all exteriority. The essay argues that this "counter reduction," designed as a practical orientation to the world, suspends all traditional parameters of onto(theo)logical individuation in order to rethink subjectivity in terms of its transcendental corporeality, i.e., in terms of the invisible display of "affective flesh." The development of this "metaphysics of the individual" anchors his "practical philosophy" as he developed it-under shifting accents-throughout his oeuvre. In particular, the essay brings into focus Henry's reflections on modernity, the industry of mass culture and their "barbaric" movements. The essay briefly puts these cultural and political areas of Henry's of thinking into contact with his late "theological turn," i.e., his Christological account of Life and the (inter)subjective self-realization to which it gives rise.
Edward Henry Sieveking and the demise of essential epilepsy.
Bladin, Peter F
2008-04-01
Edward Henry Sieveking, eminent London physician of Victorian times, is best known as the speaker at the historic meeting at which the chairman, Sir Charles Locock, seem to overshadow him in announcing the introduction of bromide--the first effective anti-convulsant. But in fact Sieveking had announced a most important conceptual advance in epileptology--the demise of "essential epilepsy". In addition his book, published soon after and based upon his lecture, is an important historical resumé of Victorian era concepts and management of epilepsy. His important contributions to the understanding and management of this condition are discussed herein.
Henri Ey's neojacksonism and the psychopathology of disintegrated mind.
Farina, Benedetto; Ceccarelli, Maurizio; Di Giannantonio, Massimo
2005-01-01
The French psychiatrist Henri Ey developed his organo-dynamic theory of the mind function and consciousness 50 years ago incorporating Hughling Jackson's thinking, along with psychiatric and philosophical theorizations by Janet and Bergson. This model has not received the attention it deserved, but recent advances in neuroscience rekindled interest for Ey's theory. By overcoming the Cartesian mind-body dualism and treating the mind-body unit as an inseparable whole, this model opens the way for the integrated treatment of mental disorders. Ey's conceptualization of consciousness as being simultaneously both synchronous and diachronic anticipates current theories of consciousness (Damasio, Edelman, Mesulam).
Ernest Henry Starling (1866-1927): the scientist and the man
DEFF Research Database (Denmark)
Henriksen, Jens H
2005-01-01
The pre-eminent achievements of the English physician and physiologist Ernest Henry Starling were his quantitative explanation of the transcapillary transport of fluid, the discovery of the first hormone, secretin, and his formulation of the law of the heart. In some ways Starling was an outsider...... and he was the centre of several scientific and social controversies. However, throughout his life he stressed fundamental scientific attitudes and ideas with remarkable persistence and power, although also balance, and his scientific achievements have stood the test of time....
Publicações póstumas de Henri Fayol: revisitando sua teoria administrativa.
Directory of Open Access Journals (Sweden)
Edson Miranda de Souza
2011-02-01
Full Text Available O engenheiro francês Henri Fayol (1841-1925 é usualmente apresentado aos estudantes de Administração como o Pai da Escola Clássica de Administração, o que demonstra uma representação limitada da amplitude de sua contribuição para a evolução do pensamento administrativo. Além disso, é frequentemente associado ao seu contemporâneo, o teórico norte-americano Frederick Taylor, sendo aos dois atribuída a defesa de um modelo autoritário de administração. Entretanto, recentemente, pesquisadores descobriram, através do exame de documentos raros e inéditos, um desconhecido retrato desse pioneiro. Este trabalho resulta de uma investigação que buscou levantar fontes de informação bibliográfica disponíveis, publicadas ou não, incluindo resultados de trabalhos de pesquisadores da França, dos Estados Unidos, do Canadá, da Austrália e do Japão. Esses pesquisadores compõem um reduzido grupo de estudiosos, aqui denominados “novos fayolistas” porque retomam, depois de anos de quase amnésia no meio acadêmico, o interesse pelas contribuições de Henri Fayol. Tais estudos revelam conceitos desenvolvidos por Fayol que antecipam aspectos de teorias e práticas da Administração que, somente mais tarde, seriam desenvolvidas, como a Escola de Relações Humanas, a Teoria Contingencial e o Planejamento Estratégico. Ao apresentar as recentes pesquisas sobre o homem e o teórico Henri Fayol, este estudo permite, aos docentes e estudantes de língua portuguesa, acesso a escritos e palestras de sua autoria que, até então, permaneciam desconhecidos.
Fin-de-Siecle Advances in Neuroeducation: Henry Herbert Donaldson and Reuben Post Halleck
Theodoridou, Zoe D.; Triarhou, Lazaros C.
2009-01-01
This article focuses on two early attempts at bridging neuroscience and education, made by Henry Herbert Donaldson (1857-1938), a neurologist, and Reuben Post Halleck (1859-1936), an educator. Their works, respectively entitled "The Growth of the Brain: A Study of the Nervous System in Relation to Education" (1895) and "The Education of the…
Directory of Open Access Journals (Sweden)
Yuhong Li
2017-12-01
Full Text Available Crust-derived helium is generated from the radioactive decay of uranium, thorium and other radioactive elements in geological bodies. Compared with conventional natural gas, helium is a typical weak source gas as a result of extremely slow generation rate and absence of helium-generating peak. It is associated with methane or carbon dioxide reservoirs frequently and related to groundwater closely. Helium can meet the industry standard with 0.1% in volume fraction. In order to study the accumulation mechanism of helium, the previous research on Henry's coefficient and solubility of helium, nitrogen and methane are summarized and the key roles of Henry's Law in the helium migration, accumulation and preservation are discussed by simulating calculation taking Weihe Basin as an example. According to the Law, the gas solubility in dilute solution is controlled by the gas partial pressure and the Henry's coefficient. Compared with the carrier gases, the Henry's constant of helium is high, with striking difference at low and high temperature. In addition, the helium partial pressure is greatly different in helium source rocks and gas reservoirs, resulting in the great differences of helium solubility in the two places. The accumulation progresses are as follows. Firstly, helium can dissolve into water and migrate out of helium source rocks due to the high helium solubility, which is caused by high helium partial pressure and high temperature in source rock. Secondly, when dissolved helium is transported to the shallow gas reservoir, it is prone to be out of solution and into reservoir due to the extremely low partial pressure and low temperature. Meanwhile part of carrier gases dissolves into water, as if helium is “replaced” out. Furthermore, the low concentration funnel of dissolved helium is formed near the gas reservoir, then other dissolved helium continues to migrate towards the gas reservoir, which greatly improves the helium accumulation
Paul Henry Latimer (1925-2011): discoverer of selective scattering in photosynthetic systems.
Latimer, Margaret Gwyn; Bannister, Thomas T; Govindjee
2017-10-01
We provide here a brief tribute to Paul Henry Latimer (November 25, 1925 to October 1, 2011), a dedicated biological physicist, discoverer of selective scattering in biological systems, a wonderful teacher, husband, and father. We provide here a glimpse of his personal and professional life, including reminiscences from F. Dudley Bryant, Dan A. Cross, Bobby E. Pyle, Bryan L. Seiber, and Bruce A. Seiber.
Le Bacquer, Olivier; Petroulakis, Emmanuel; Paglialunga, Sabina; Poulin, Francis; Richard, Denis; Cianflone, Katherine; Sonenberg, Nahum
2007-02-01
The most common pathology associated with obesity is insulin resistance, which results in the onset of type 2 diabetes mellitus. Several studies have implicated the mammalian target of rapamycin (mTOR) signaling pathway in obesity. Eukaryotic translation initiation factor 4E-binding (eIF4E-binding) proteins (4E-BPs), which repress translation by binding to eIF4E, are downstream effectors of mTOR. We report that the combined disruption of 4E-BP1 and 4E-BP2 in mice increased their sensitivity to diet-induced obesity. Increased adiposity was explained at least in part by accelerated adipogenesis driven by increased expression of CCAAT/enhancer-binding protein delta (C/EBPdelta), C/EBPalpha, and PPARgamma coupled with reduced energy expenditure, reduced lipolysis, and greater fatty acid reesterification in the adipose tissue of 4E-BP1 and 4E-BP2 double KO mice. Increased insulin resistance in 4E-BP1 and 4E-BP2 double KO mice was associated with increased ribosomal protein S6 kinase (S6K) activity and impairment of Akt signaling in muscle, liver, and adipose tissue. These data clearly demonstrate the role of 4E-BPs as a metabolic brake in the development of obesity and reinforce the idea that deregulated mTOR signaling is associated with the development of the metabolic syndrome.
Air Sampling Data for BP Spill/Deepwater Horizon
U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...
Waste Sampling Data for BP Spill/Deepwater Horizon
U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...
Air Monitoring Data for BP Spill/Deepwater Horizon
U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...
Water Sampling Data for BP Spill/Deepwater Horizon
U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...
Sediment Sampling Data for BP Spill/Deepwater Horizon
U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...
Staging Henry Fielding: The Author-Narrator in Tom Jones On Screen
Løfaldli, Eli
2017-01-01
As recent adaptation theory has shown, classic-novel adaptation typically sets issues connected to authorship and literal and figurative ownership into play. This key feature of such adaptations is also central to the screen versions of Henry Fielding’s Tom Jones (1749). In much of Fielding’s fiction, the narrator, typically understood as an embodiment of Fielding himself, is a particularly prominent presence. The author-narrator in Tom Jones is no exception: not only is his presence strongly...
CacyBP/SIP promotes the proliferation of colon cancer cells.
Directory of Open Access Journals (Sweden)
Huihong Zhai
Full Text Available CacyBP/SIP is a component of the ubiquitin pathway and is overexpressed in several transformed tumor tissues, including colon cancer, which is one of the most common cancers worldwide. It is unknown whether CacyBP/SIP promotes the proliferation of colon cancer cells. This study examined the expression level, subcellular localization, and binding activity of CacyBP/SIP in human colon cancer cells in the presence and absence of the hormone gastrin. We found that CacyBP/SIP was expressed in a high percentage of colon cancer cells, but not in normal colonic surface epithelium. CacyBP/SIP promoted the cell proliferation of colon cancer cells under both basal and gastrin stimulated conditions as shown by knockdown studies. Gastrin stimulation triggered the translocation of CacyBP/SIP to the nucleus, and enhanced interaction between CacyBP/SIP and SKP1, a key component of ubiquitination pathway which further mediated the proteasome-dependent degradation of p27kip1 protein. The gastrin induced reduction in p27kip1 was prevented when cells were treated with the proteasome inhibitor MG132. These results suggest that CacyBP/SIP may be promoting growth of colon cancer cells by enhancing ubiquitin-mediated degradation of p27kip1.
DNA-Catalyzed Henry Reaction in Pure Water and the Striking Influence of Organic Buffer Systems
Directory of Open Access Journals (Sweden)
Marleen Häring
2015-03-01
Full Text Available In this manuscript we report a critical evaluation of the ability of natural DNA to mediate the nitroaldol (Henry reaction at physiological temperature in pure water. Under these conditions, no background reaction took place (i.e., control experiment without DNA. Both heteroaromatic aldehydes (e.g., 2-pyridinecarboxaldehyde and aromatic aldehydes bearing strong or moderate electron-withdrawing groups reacted satisfactorily with nitromethane obeying first order kinetics and affording the corresponding β-nitroalcohols in good yields within 24 h. In contrast, aliphatic aldehydes and aromatic aldehydes having electron-donating groups either did not react or were poorly converted. Moreover, we discovered that a number of metal-free organic buffers efficiently promote the Henry reaction when they were used as reaction media without adding external catalysts. This constitutes an important observation because the influence of organic buffers in chemical processes has been traditionally underestimated.
International Nuclear Information System (INIS)
Anon.
1998-01-01
In this speech, the President of France Jacques Chirac outlines the personality of the great scientists Henri Becquerel, Pierre and Marie Curie, and highlights their hard work and struggle to make science progress. Science always appears as a construction wonderfully logical but behind this facade, the daily life of research workers is made up of doubt, multiple choices, dead ends, errors and misinterpretations. The President wishes the nation to reach a perfect partnership with its scientific community. Science should be a source of inspiration for the industrial world but also a valuable help to solve present and future problems. Because of the universality of most problems, science has always favoured the cooperation between states. This cooperation should be turned into solidarity because whoever we are we live in the same world. (A.C.)
Beyond the Historical Record? Henry James in “The Master at St. Bartholomew’s Hospital
Directory of Open Access Journals (Sweden)
Elena Ogliari
2018-02-01
Full Text Available The article analyses the short-story “The Master at St Bartholomew’s Hospital 1914–1916” by Joyce Carol Oates (2007 in the broader context of the Jamesian biofiction, a series of novels and tales featuring Henry James as their protagonist. The addition of the prefix “bio-” to “fiction” points out the hybrid nature of these texts, which are a melange of biography, autobiography, criticism and fiction. Oates’s story not only epitomizes this hybridity, but it also proves to be an exploration of the potentiality of this subgenre to penetrate the mystery surrounding James’s persona and saturate the lacunae in his biography by resorting to what David Lodge defined as “the novelist’s licence”. The short-story is yet another evidence of Oates’s fascination with the unsaid in James’s life and prose, because it revolves around the silence into which he sank at the outbreak of the Great War, when he did not write anything in his pocket diaries for three months. In an attempt to go beyond the limits of the historical record, Oates gives insights into the mind of the author by depicting a Henry James in crisis – nagged by doubts about his artistic legacy – in an atmosphere of uncertainty enhanced by a complex intertextual play. The result is ‘a Henry James’ slightly divergent from the historical one: thus, the tale advocates the inaccessibility of the private life of a real individual. Nonetheless, the acknowledgement of this limit spurs the celebration of fictional imagination.
76 FR 69712 - Application To Export Electric Energy; BP Energy Company
2011-11-09
... DEPARTMENT OF ENERGY [OE Docket No. EA-315-A] Application To Export Electric Energy; BP Energy.... SUMMARY: BP Energy Company (BP Energy) has applied to renew its authority to transmit electric energy from... BP Energy to transmit electric energy from the United States to Canada as a power marketer for a five...
Henri Fayol. Performativity of his ideas and oblivion of their creator
Dumez , Hervé
2018-01-01
Henri Fayol formulated one of the first theories of management and allows us to see how one of the first scientific approaches of management could or could not perform management practices. Therefore, Fayol is particularly interesting from the point of view of performativity (Callon, 1998, 2007, MacKenzie et al., 2007, Muniesa, 2014). The case is all the richer because it presents the rare characteristic of a direct confrontation between two rival theories, his and Taylor's, at the level of t...
BP1 Homeoprotein Enhances Metastatic Potential in ER-negative Breast Cancer
Fu, Yebo; Lian, Yi; Kim, Kyung Soon; Zhang, Lei; Hindle, A. Katharine; Brody, Fred; Siegel, Robert S.; McCaffrey, Timothy A.; Fu, Sidney W.
2010-01-01
Tumor invasion and metastasis remain a major cause of mortality in breast cancer patients. It was reported that BP1, a homeobox isoform of DLX4, is overexpressed in 80% of breast cancer patients and in 100% of estrogen receptor negative (ER-) tumors. The prevalence of BP1 positive cells and the intensity of BP1 immunoreactivity increased with the extent of ductal proliferation and tumorigenesis. These findings imply that BP1 may play an important role in ER- breast cancer. We sought to determine the effects and mechanisms of BP1 on cell proliferation and metastasis using ER- Hs578T cells as a model. Cells were transfected with either pcDNA3.2 plasmid containing BP1 gene, or pcDNA3.2 vector, then selected and cloned. Overexpression of BP1 increased cell proliferation rate by 2-5 fold (p=2.0. Of those genes, 49 were up-regulated and 22 were down-regulated. Significant pathways were identified involving cell proliferation and metastasis. These data demonstrated that overexpression of BP1 significantly enhanced cell proliferation and metastatic potential in ER- Hs578T cells. Further analysis with more ER- cell lines and patient samples is warranted to establish BP1 as a therapeutic target for ER- breast cancer. PMID:20842225
4E-BP1 regulates the differentiation of white adipose tissue.
Tsukiyama-Kohara, Kyoko; Katsume, Asao; Kimura, Kazuhiro; Saito, Masayuki; Kohara, Michinori
2013-07-01
4E Binding protein 1 (4E-BP1) suppresses translation initiation. The absence of 4E-BP1 drastically reduces the amount of adipose tissue in mice. To address the role of 4E-BP1 in adipocyte differentiation, we characterized 4E-BP1(-/-) mice in this study. The lack of 4E-BP1 decreased the amount of white adipose tissue and increased the amount of brown adipose tissue. In 4E-BP1(-/-) MEF cells, PPARγ coactivator 1 alpha (PGC-1α) expression increased and exogenous 4E-BP1 expression suppressed PGC-1α expression. The level of 4E-BP1 expression was higher in white adipocytes than in brown adipocytes and showed significantly greater up-regulation in white adipocytes than in brown adipocytes during preadipocyte differentiation into mature adipocytes. The amount of PGC-1α was consistently higher in HB cells (a brown preadipocyte cell line) than in HW cells (a white preadipocyte cell line) during differentiation. Moreover, the ectopic over-expression of 4E-BP1 suppressed PGC-1α expression in white adipocytes, but not in brown adipocytes. Thus, the results of our study indicate that 4E-BP1 may suppress brown adipocyte differentiation and PGC-1α expression in white adipose tissues. © 2013 The Authors Genes to Cells © 2013 by the Molecular Biology Society of Japan and Wiley Publishing Asia Pty Ltd.
Royère, C
1999-03-01
The trace of Henri Moissan's pioneer work 100 years ago is clearly evidenced by an overview of achievements in high temperature devices; 1987: "Le four électrique" by Henri Moissan; 1948-1952: "High temperature heating in a cavity rotary kiln using focusing of solar radiation" by Félix Trombe; 1962: "The cavity rotary kiln using focused solar radiation jointly with a plasma gun" by Marc Foëx; 1970: "The rotary kiln with two plasma guns and arc transfer" by Marc Foëx; 1984: "The plasma furnace" by Electricité de France (EDF) at Renardières; 1997: "The plasma furnace" by the Atomic Energy Center (CEA) at Cadarache, the VULCANO program. The first part of this contribution is devoted to Henri Moissan. Re-reading his early book on the electric furnace, especially the first chapter and the sections on silica, carbon vapor and experiments performed in casting molten metal--the conclusions are outstanding--provides modern readers with an amazing insight into future developments. The last two parts are devoted to Félix Trombe and Marc Foëx, tracing the evolution of high temperature cavity processus leading to the solar furnace and the present day plasma furnace at the CEA. Focus is placed on research conducted by the French National Center for Scientific Research (CNRS) with the solar and plasma furnaces at Odeillo. The relationships with Henri Moissan's early work are amazing, offering a well deserved homage to this pioneer researcher.
BP1 Homeoprotein Enhances Metastatic Potential in Er-Negative Breast Cancer
Directory of Open Access Journals (Sweden)
Yebo Fu, Yi Lian, Kyung Soon Kim, Lei Zhang, A. Katharine Hindle, Fred Brody, Robert S. Siegel, Timothy A. McCaffrey, Sidney W. Fu
2010-01-01
Full Text Available Tumor invasion and metastasis remain a major cause of mortality in breast cancer patients. It was reported that BP1, a homeobox isoform of DLX4, is overexpressed in 80% of breast cancer patients and in 100% of estrogen receptor negative (ER- tumors. The prevalence of BP1 positive cells and the intensity of BP1 immunoreactivity increased with the extent of ductal proliferation and tumorigenesis. These findings imply that BP1 may play an important role in ER- breast cancer. I sought to determine the effects and mechanisms of BP1 on cell proliferation and metastasis using ER- Hs578T cells as a model. Cells were transfected with either pcDNA3.2 plasmid containing BP1 gene, or pcDNA3.2 vector, then selected and cloned. Overexpression of BP1 increased cell proliferation rate by 2-5 fold (p<0.005, and enhanced the in vitro invasive activity by 25-65 fold (p<0.001. Microarray experiments were performed to identify differentially expressed genes when BP1 is overexpressed. The gene expression profile of the transfected cell lines were compared, resulting in 71 differentially expressed genes with a fold-change of >=2.0. Of those genes, 49 were up-regulated and 22 were down-regulated. Significant pathways were identified involving cell proliferation and metastasis. These data demonstrated that overexpression of BP1 significantly enhanced cell proliferation and metastatic potential in ER- Hs578T cells. Further analysis with more ER- cell lines and patient samples is warranted to establish BP1 as a therapeutic target.
BP/Mobil. Joint-venture directions for use
International Nuclear Information System (INIS)
Anon.
1997-01-01
This paper analyzes the economical reasons which have led BP and Mobil companies to join their forces in 1996. Thanks to their complementarity and to their European implantation, the two companies could win the first or second position in petroleum products marketing in 8 European countries. The cumulated petrol sales and the number of petrol stations of the BP/Mobil joint venture are the highest in Europe (800 petrol stations in France). (J.S.)
The 'Overly-Broad' Selden Patent, Henry Ford and Development in the Early US Automobile Industry
DEFF Research Database (Denmark)
Howells, John; Katznelson, Ron D
of the Selden patent claims. We use new primary sources to show how Henry Ford and others engaged in what today is called “Freedom to Operate” patent analysis when it most mattered commercially. We show that Ford correctly anticipated that a future court adjudication of the Selden patent claims would...
Laupmaa, Henri
2015-01-01
Intervjuu IT-ettevõtja, kodanikuühiskonna arendaja ning toetusplatvormi Hooandja ühe käivitaja Henri Laupmaaga Hooandja platvormi õnnestunud projektidest, uuest ühisrahastusplatvormist Fundwise, kommunikatsioonist ühisrahastusprojektide ellu viimisel
AMP-activated protein kinase phosphorylates CtBP1 and down-regulates its activity
Energy Technology Data Exchange (ETDEWEB)
Kim, Jae-Hwan; Choi, Soo-Youn; Kang, Byung-Hee; Lee, Soon-Min [National Creative Research Center for Epigenome Reprogramming Network, Departments of Biomedical Sciences and Biochemistry and Molecular Biology, Ischemic/Hypoxic Disease Institute, Seoul National University College of Medicine, Seoul 110-799 (Korea, Republic of); Park, Hyung Soon; Kang, Gum-Yong; Bang, Joo Young [Center for Biomedical Mass Spectrometry, Diatech Korea Co., Ltd., Seoul (Korea, Republic of); Cho, Eun-Jung [National Research Laboratory for Chromatin Dynamics, College of Pharmacy, Sungkyunkwan University, Suwon 440-746 (Korea, Republic of); Youn, Hong-Duk, E-mail: hdyoun@snu.ac.kr [National Creative Research Center for Epigenome Reprogramming Network, Departments of Biomedical Sciences and Biochemistry and Molecular Biology, Ischemic/Hypoxic Disease Institute, Seoul National University College of Medicine, Seoul 110-799 (Korea, Republic of); WCU Department of Molecular Medicine and Biopharmaceutical Sciences, Graduate School of Convergence and Technology, Seoul National University, Seoul (Korea, Republic of)
2013-02-01
Highlights: ► AMPK phosphorylates CtBP1 on serine 158. ► AMPK-mediated phosphorylation of CtBP1 causes the ubiquitination and nuclear export of CtBP1. ► AMPK downregulates the CtBP1-mediated repression of Bax transcription. -- Abstract: CtBP is a transcriptional repressor which plays a significant role in the regulation of cell proliferation and tumor progression. It was reported that glucose withdrawal causes induction of Bax due to the dissociation of CtBP from the Bax promoter. However, the precise mechanism involved in the regulation of CtBP still remains unclear. In this study, we found that an activated AMP-activated protein kinase (AMPK) phosphorylates CtBP1 on Ser-158 upon metabolic stresses. Moreover, AMPK-mediated phosphorylation of CtBP1 (S158) attenuates the repressive function of CtBP1. We also confirmed that triggering activation of AMPK by various factors resulted in an increase of Bax gene expression. These findings provide connections of AMPK with CtBP1-mediated regulation of Bax expression for cell death under metabolic stresses.
Surface Water Sampling Data for BP Spill/Deepwater Horizon
U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...
Energy Technology Data Exchange (ETDEWEB)
Cerofolini, G F
1977-01-01
A unified description of adsorption on real surfaces from the Henry Range to the formation of the liquid layer was developed on the basis of the BET theory and the assumption that sites on real surfaces are not energetically homogeneous. The model describes the successive Henry, Dubinin-Radushkevich, Freundlich, and multilayer BET behavior of the adsorbed phase as the pressure increases. An analysis of isotherms over the whole coverage range showed that the heterogeneous surface character decreases with increasing number of adsorbed layers; that adsorption into the first and higher layers may be competitive, which produces a new isotherm resembling a mixed type II and III isotherm as proposed by Cerofolini and coworkers.
Chakraborty, Anutosh; Saha, Bidyut Baran; Ng, Kim Choon; Koyama, Shigeru; Srinivasan, Kandadai
2009-01-01
evaluated and compared with experimental data. It is found that the adsorbents with higher specific surface areas tend to possess lower heat of adsorption (ΔH°) at the Henry regime. In this paper, we have established the definitive relation between Ai and ΔH
Henry Fayol’s 14 Principles of Management: Implications for Libraries and Information Centres
Uzuegbu, C. P.; Nnadozie, C. O.
2015-01-01
This paper focuses generally on the ‘fourteen principles of management’ by Henri Fayol. However, it specifically analyses their application to and implications for libraries and information centres. An extensive review of published works on management generally, and library management in particular, was conducted. This yielded vital insights on the original meaning and later modifications of these principles, as well as their application in the management of various organisation...
Energy Technology Data Exchange (ETDEWEB)
Herman, B. [BP Canada Energy Company, Calgary, AB (Canada)
2006-07-01
This presentation focused on why it is important to drive safely. It addressed driver fatigue as well as BP's global driving standard. The Standard applies to all BP employees and contractors that drive any vehicle on BP business and consists of 10 mandatory elements focusing on safety of the driver, the safety of the journey, and the safety of the vehicle. The driving standards focus on several themes, including skill and competency of the driver, safety of the journey, and safety of the vehicle. Fatigue causes more than 20 per cent of motorway accidents and is the most frequent cause of accidental death of truck drivers. The presentation also discussed vehicle data recorders, driving immersion, and Driving Safety Program results. Journey management, driver training, vehicle inspections and policies, and statistics on vehicle incidents were also provided. The presentation revealed that a lack of pre-trip journey management, inadequate training or recall of training, and not following safe driving practices were major contributors to incident occurrences. It also revealed that traveling on gravel or ice and avoiding wildlife were factors in many vehicle incidents. 1 tab., 1 fig.
InterProScan Result: BP184018 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP184018 BP184018_2_ORF2 4FEA411FDBEADEDD PANTHER PTHR21347 CLEFT LIP AND PALATE ASSOCIATED TRANSME...MBRANE PROTEIN-RELATED 6.1e-73 T IPR008429 Cleft lip and palate transmembrane 1 ...
Directory of Open Access Journals (Sweden)
Pyhrr, Stuart W.
1999-12-01
Full Text Available In 1835 an important group of arms, some of them from Real Armeria, was sent by Eusebio Zuloaga to the gunmaker Henri Lepage in Paris. This paper documents the transaction and seeks to identify the present location of some items.
En 1835 un importante conjunto de armas, algunas procedentes de la Real Armeria, fue enviado por Eusebio Zuloaga a1 arcabucero Henri Lepage de París. Este artículo documenta dicho envió y pretende señalar el paradero actual de alguno de los objetos
Rayner-Canham, Geoff; Rayner-Canham, Marelene
2015-01-01
Though guided-inquiry learning, discovery learning, student-centered learning, and problem-based learning are commonly believed to be recent new approaches to the teaching of chemistry, in fact, the concept dates back to the late 19th century. Here, we will show that it was the British chemist, Henry Armstrong, who pioneered this technique,…
Hart, Stan; Basu, Asish
Publication of this monograph will coincide, to a precision of a few per mil, with the centenary of Henri Becquerel's discovery of "radiations actives" (C. R. Acad. Sci., Feb. 24, 1896). In 1896 the Earth was only 40 million years old according to Lord Kelvin. Eleven years later, Boltwood had pushed the Earth's age past 2000 million years, based on the first U/Pb chemical dating results. In exciting progression came discovery of isotopes by J. J. Thomson in 1912, invention of the mass spectrometer by Dempster (1918) and Aston (1919), the first measurement of the isotopic composition of Pb (Aston, 1927) and the final approach, using Pb-Pb isotopic dating, to the correct age of the Earth: close—2.9 Ga (Gerling, 1942), closer—3.0 Ga (Holmes, 1949) and closest—4.50 Ga (Patterson, Tilton and Inghram, 1953).
Earth Processes: Reading the Isotopic Code
Basu, Asish; Hart, Stan
Publication of this monograph will coincide, to a precision of a few per mil, with the centenary of Henri Becquerel's discovery of "radiations actives" (C. R. Acad. Sci., Feb. 24, 1896). In 1896 the Earth was only 40 million years old according to Lord Kelvin. Eleven years later, Boltwood had pushed the Earth's age past 2000 million years, based on the first U/Pb chemical dating results. In exciting progression came discovery of isotopes by J. J. Thomson in 1912, invention of the mass spectrometer by Dempster (1918) and Aston (1919), the first measurement of the isotopic composition of Pb (Aston, 1927) and the final approach, using Pb-Pb isotopic dating, to the correct age of the Earth: close—2.9 Ga (Gerling, 1942), closer—3.0 Ga (Holmes, 1949) and closest—4.50 Ga (Patterson, Tilton and Inghram, 1953).
Energy Technology Data Exchange (ETDEWEB)
Allisy-Roberts, P.J.; Kessler, C.; Burns, D.T. [Bureau International des Poids et Mesures (BIPM), 92 - Sevres (France); Delaunay, F.; Donois, M. [CEA Saclay, LNE-LNHB, Lab. National Henri Becquerel 91 - Gif-sur-Yvette (France)
2009-10-15
A direct comparison of the standards for air kerma of the Laboratoire National de Metrologie et d'Essais-Laboratoire National Henri Becquerel (LNE-LNHB), France and of the Bureau International des Poids et Mesures (BIPM) was carried out in the {sup 137}Cs radiation beam of the BIPM in November 2008. The result, expressed as a ratio of the LNE-LNHB and the BIPM standards for air kerma, is 0.9984 with a combined standard uncertainty of 2.6 * 10{sup -3}. The result of the earlier direct comparison in {sup 137}Cs {gamma} rays, made in 1995, was 1.0019(30); taking into account the changes made to the BIPM standard and using the present correction factors for the LNE-LNHB standard, the 1995 result becomes 0.9989(26), which is in agreement with the present comparison result. (authors)
Energy Technology Data Exchange (ETDEWEB)
Michotte, C.; Courte, S.; Ratel, G. [Bureau International des Poids et Mesures (BIPM), 92 - Sevres (France); Moune, M. [LNE-LNHB, Laboratoire national de metrologie et d' essais-Laboratoire National Henri Becquerel, Gif sur Yvette (France); Johansson, L.; Keightley, J. [National Physical Laboratory (NPL), Middlesex (United Kingdom)
2010-12-15
In 2007 and 2008 respectively, the Laboratoire national de metrologie et d'essais -Laboratoire national Henri Becquerel (LNE-LNHB), France and the National Physical Laboratory (NPL), UK, submitted ampoules with between 10 MBq and 130 MBq activity of {sup 99m}Tc to the International Reference System (SIR), to update their results in the BIPM.RI(II)-K1.Tc-99m comparison. Together with the four other national metrology institutes (NMI) that are participants, thirteen samples have been submitted since 1983. The key comparison reference value (KCRV) has been recalculated to include the latest primary results of the PTB and the LNE-LNB as this makes the evaluation more robust. The degrees of equivalence between each equivalent activity measured in the SIR are given in the form of a matrix for all six NMIs. A graphical presentation is also given. (authors)
Henri Lopès : d’Une Quête Incessante à une identité plurielle
Directory of Open Access Journals (Sweden)
Vincent Simédoh
2006-04-01
Full Text Available Dans plusieurs oeuvres d’Henri Lopès, les personnages sont constamment en quête d’une identité. Une quête qu’ils entament comme un parcours puisque désormais ils vivent au confluent de plusieurs cultures et ils se sentent comme en exil. Ce n’est pas forcément un exil extérieur parce qu’ils ont quitté leur pays d’origine mais c’est plutôt un exil intérieur. Ainsi les personnages se sentent incapables de se situer par rapport à eux-mêmes et à autrui. Dès lors surgit une tentation, celle de se réfugier dans le souvenir qui n’existe même plus. La mémoire s’estompe. L’histoire elle-même fuit et disparaît. Ce qui fait naître chez les personnages un vide qui conduit à un malaise identitaire, d’où déchirement. En face de cet écartèlement, surgit une multitude de pistes. Et c’est dans cette perspective qu’Henri Lopès propose une identité plurielle.
4977-bp mitochondrial DNA deletion in infertile patients with varicocele.
Gashti, N G; Salehi, Z; Madani, A H; Dalivandan, S T
2014-04-01
Varicocele is the abnormal inflexion and distension of veins of the pampiniform plexus within spermatic cord and is one of the amendable causes of male infertility. It can increase reactive oxygen species (ROS) production in semen and cause oxidative stress. The purpose of this study was to analyse spermatozoa mtDNA 4977-bp deletion in infertile men with varicocele. To detect 4977-bp deletion in spermatozoa mtDNA, semen samples of 60 infertile patients with clinical varicocele and 90 normal men from northern Iran were prepared. After extraction of spermatozoa total DNA, Gap polymerase chain reaction (Gap PCR) was performed. 4977-bp deletion was observed in 81.66% of patients with varicocele, while approximately 15.55% of controls had this deletion. As spermatozoa from patients with varicocele had a high frequency of occurrence of 4977-bp deletion in mtDNA [OR = 24.18, 95% confidence interval (CI) = 10.15-57.57, P deletion in spermatozoa and cause infertility in north Iranian men. However, to determine the relation between sperm mtDNA 4977-bp deletion and varicocele-induced infertility, larger population-based studies are needed. It is concluded that there is an association between sperm mtDNA 4977-bp deletion and varicocele-induced infertility in the population studied. © 2013 Blackwell Verlag GmbH.
InterProScan Result: BP116799 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP116799 BP116799_1_ORF2 D3F3F8C61868AD4C PANTHER PTHR11792 ARRESTIN 3.5e-15 T IPR000698 Arrestin Biological... Process: signal transduction (GO:0007165)|Biological Process: sensory perception (GO:0007600) ...
InterProScan Result: BP116799 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP116799 BP116799_1_ORF2 D3F3F8C61868AD4C PRINTS PR00309 ARRESTIN 6e-17 T IPR000698 Arrestin Biological... Process: signal transduction (GO:0007165)|Biological Process: sensory perception (GO:0007600) ...
The MCM-associated protein MCM-BP is important for human nuclear morphology.
Jagannathan, Madhav; Sakwe, Amos M; Nguyen, Tin; Frappier, Lori
2012-01-01
Mini-chromosome maintenance complex-binding protein (MCM-BP) was discovered as a protein that is strongly associated with human MCM proteins, known to be crucial for DNA replication in providing DNA helicase activity. The Xenopus MCM-BP homologue appears to play a role in unloading MCM complexes from chromatin after DNA synthesis; however, the importance of MCM-BP and its functional contribution to human cells has been unclear. Here we show that depletion of MCM-BP by sustained expression of short hairpin RNA (shRNA) results in highly abnormal nuclear morphology and centrosome amplification. The abnormal nuclear morphology was not seen with depletion of other MCM proteins and was rescued with shRNA-resistant MCM-BP. MCM-BP depletion was also found to result in transient activation of the G2 checkpoint, slowed progression through G2 and increased replication protein A foci, indicative of replication stress. In addition, MCM-BP depletion led to increased cellular levels of MCM proteins throughout the cell cycle including soluble MCM pools. The results suggest that MCM-BP makes multiple contributions to human cells that are not limited to unloading of the MCM complex.
Directory of Open Access Journals (Sweden)
Milovanov Dajana
2017-01-01
Full Text Available The paper examines possible interpretations of poetry and poetic image analysing the dialogue between the arts of literature and painting. The paper studies the poet Sylvia Plath's referencing Henri Rousseau's painting The Snake Charmer in her poem 'Snakecharmer'. What is analysed is the creative superstructure based upon nonliterary reference, as well as the visual elements attained through two diverse artistic media.
76 FR 69713 - Application To Export Electric Energy; BP Energy Company
2011-11-09
... DEPARTMENT OF ENERGY [OE Docket No. EA-314-A] Application To Export Electric Energy; BP Energy.... SUMMARY: BP Energy Company (BP Energy) has applied to renew its authority to transmit electric energy from... electric energy from the United States to Mexico as a power marketer for a five-year term using existing...
Expression of the Transcription Factor E4BP4 in Human Basophils
DEFF Research Database (Denmark)
Jensen, Bettina Margrethe; Gohr, Maria; Poulsen, Lars Kærgaard
2014-01-01
Rationale The cytokine IL-3 plays an important role for human basophil development, function and survival. IL-3 is also reported to induce the expression of the transcription factor E4BP4, but it is not known whether E4BP4 is expressed in basophils and influences basophil responsiveness. The aim...... by Alcian blue. RNA was extracted (0.005-0.02 µg RNA from 0.5 - 1 x 106 cells), and the corresponding cDNA analyzed by real-time PCR where E4BP4 expression was calculated as 2-(CT(E4BP4) - CT(β-actin)). E4BP4 protein expression was visualized in basophil lysates (107 cells/ml) by Western blot followed...... the transcription factor E4BP4 which might have an impact on basophil histamine release....
Nuclear Enterprises portable dose rate meter type PDR4 and external probes types BP1/1, BP8 and GP9
International Nuclear Information System (INIS)
Burgess, P.H.; Iles, W.J.
1979-08-01
The performance characteristics of Nuclear Enterprises Portable Dose Rate Meter Type PDR4 are evaluated under the headings: general description, facilities and controls, radiation characteristics, electrical characteristics, environmental characteristics, mechanical characteristics, the manual, summary of performance, and conclusions. Results of an investigation of the radiation characteristics of the external probes Type BP1/1, Type BP8, and Type GP9 are also detailed. (U.K.)
Restauration de la statue de Henri IV
Directory of Open Access Journals (Sweden)
Stéphanie Celle
2012-04-01
Full Text Available Cette intervention de conservation du bronze de la statue de Henri IV était la première depuis sa création en 1818 : on héritait de la surface originale de l’œuvre altérée par les vicissitudes du temps et les événements historiques traversés. Le protocole de conservation se voulait respectueux de cette authenticité de la patine et a cherché à en laisser les marques tout en apportant une réponse pour contrer la corrosion active de l’alliage. C’est en conformité aux principes de conservation établis par Cesare Brandi, qu’ont été définis le nettoyage sélectif des surfaces et l’application de couches protectives sur le bronze. Par ailleurs, le moment du chantier est un moment privilégié pour observer un monument et mieux connaître son histoire particulière. Ce chantier nous a permis de redécouvrir deux ensembles de boîtes déposées dans l’antre du cheval dans des situations parfois surprenantes.This conservation treatment for the bronze statue of Henri IV is the first since its creation in 1818. While the original surface of the work remains, it has been altered by natural and human forces; including the weathering of the material from exposure to the elements and damage caused by historic events. The conservation protocol is respectful of this authenticity of the surface patina and the marks of damage due to historical events, while developing a treatment plan to counter the active corrosion of the alloy. In keeping with the principles of conservation established by Cesare Brandi, the treatment program defines the selective cleaning of the surface and the application of several layers of a protective coating on the bronze. In addition, the conservation project is an opportunity to carefully study a monument to better understand its unique history. This project allowed us to rediscover two sets of boxes placed inside the cavity of the horse; an unxpected discovery.
Kiebert-Gruen, Cathleen
2009-01-01
A comparative case study of two cultural institutions, Henry Street Settlement and El Museo del Barrio, founded almost eighty years apart, were involved in social justice causes and community arts. Although both of these institutions participated in the political activism of their time, they also demonstrated an important adaptability. They were…
Intensive Versus Standard Blood Pressure Control in SPRINT-Eligible Participants of ACCORD-BP.
Buckley, Leo F; Dixon, Dave L; Wohlford, George F; Wijesinghe, Dayanjan S; Baker, William L; Van Tassell, Benjamin W
2017-12-01
We sought to determine the effect of intensive blood pressure (BP) control on cardiovascular outcomes in participants with type 2 diabetes mellitus (T2DM) and additional risk factors for cardiovascular disease (CVD). This study was a post hoc, multivariate, subgroup analysis of ACCORD-BP (Action to Control Cardiovascular Risk in Diabetes Blood Pressure) participants. Participants were eligible for the analysis if they were in the standard glucose control arm of ACCORD-BP and also had the additional CVD risk factors required for SPRINT (Systolic Blood Pressure Intervention Trial) eligibility. We used a Cox proportional hazards regression model to compare the effect of intensive versus standard BP control on CVD outcomes. The "SPRINT-eligible" ACCORD-BP participants were pooled with SPRINT participants to determine whether the effects of intensive BP control interacted with T2DM. The mean baseline Framingham 10-year CVD risk scores were 14.5% and 14.8%, respectively, in the intensive and standard BP control groups. The mean achieved systolic BP values were 120 and 134 mmHg in the intensive and standard BP control groups ( P control reduced the composite of CVD death, nonfatal myocardial infarction (MI), nonfatal stroke, any revascularization, and heart failure (hazard ratio 0.79; 95% CI 0.65-0.96; P = 0.02). Intensive BP control also reduced CVD death, nonfatal MI, and nonfatal stroke (hazard ratio 0.69; 95% CI 0.51-0.93; P = 0.01). Treatment-related adverse events occurred more frequently in participants receiving intensive BP control (4.1% vs. 2.1%; P = 0.003). The effect of intensive BP control on CVD outcomes did not differ between patients with and without T2DM ( P > 0.62). Intensive BP control reduced CVD outcomes in a cohort of participants with T2DM and additional CVD risk factors. © 2017 by the American Diabetes Association.
Directory of Open Access Journals (Sweden)
Sandra Guardini T. Vasconcelos
2000-01-01
Full Text Available Henry Fielding, um dos fundadores do romance inglês, deixou um material teórico bastante rico a respeito do gênero em ascensão, que ele discutiu em prefácios e nos célebres capítulos introdutórios a Tom Jones. Esse artigo tem como objetivo apresentar alguns dos impasses e dilemas enfrentados pelo romancista e as soluções formais que ele propôs para resolvê-los.Henry Fielding, one of the founders of the English novel, has left a wealth theoretical material about the rising genre, which he discussed in prefaces and in his famous introductory chapters to Tom Jones, this article aims to present some of the impasses and double binds faced by the novelist and the formal solutions he proposed to deal with them.
"Audacity or Precision": The Paradoxes of Henri Villat's Fluid Mechanics in Interwar France
Aubin , David
2010-01-01
In Interwar France, Henri Villat became the true leader of theoretical researches on fluid mechanics. Most of his original work was done before the First World War; it was highly theoretical and its applicability was questioned. After having organized the first post-WWI International Congress of Mathematicians in 1920, Villat became the editor of the famous Journal de math\\'ematiques pure et appliqu\\'es and the director of the influential book series "M\\'emorial des sciences math\\'ematiques."...
Henri Walon: por uma teoria dialética na educação
Directory of Open Access Journals (Sweden)
Maria Inês Naujorks
2000-04-01
Full Text Available O texto aborda as principais idéias desenvolvidas por Henri Wallon. Tendo como método o materialismo dialético, seu projeto foi o de formular uma "ciência do homem". Para o autor o desenvolvimento é a síntese dialética do biológico e do social e só pode ser entendido à luz das contradições de um processo que se estende por toda vida toda.
Gallavan, Nancy P.; Kottler, Ellen
2010-01-01
Delving into the life and legacy of Henry VIII is both complex and captivating. People seem compelled to learn more abut his critical contributions and controversial conduct that range from the significant to the scandalous. Reflecting on the history of the world would be incomplete without investigating the events and escapades associated with…
International Nuclear Information System (INIS)
Boee, Reidulv; Lepland, Aivo; Blikra, Lars Harald; Longva, Oddvar; Soenstegaard, Eivind
2002-01-01
The Ormen Lange Gas Field was discovered in the Norwegian Sea outside the Moere og Romsdal in 1997. The development of this field which is located in the area of the Storegga Slide, requires safety assessment. The project aims to collect and compile data on slides, avalanches and gravitational faults that may have resulted from large earthquakes or tsunamis in the north west of Western Norway. A major task in the present project has been to investigate the spatial extent and interpret the origin of a postulated mass movement event ca. 2000 years ago and to evaluate its causes, climate variations, a tsunami (possibly caused by an earthquake affecting the offshore area), and earthquake only affecting parts of Western Norway or a combination of an earthquake and a tsunami. Several other mass movements, including the Storegga Slide tsunami deposits and pre-Storegga Slide slide and debris flow deposits have been studied both in the fjord and the lake sediments. Five of the 16 investigated fjords (Dalsfjorden, Foerdefjorden, Syvdsfjorden, Voldafjorden, Oerstadfjorden) provide evidence for a 2000 - 2200 years BP (calendar years before present, i.e. 1950) event. Previous investigations show no indication of a large shelf edge slide in the Storegga area, that may have created a tsunami at that time, nor are any mass movement deposits found on land or in the investigated lakes. This suggests that the 2000 - 2200 BP debris flows and turbidites were most likely related to one or more earthquakes on land or close to the coast and not an offshore mega slide generated tsunami. The Storegga Slide (8200 BP) tsunami deposits are observed in cores over most of the investigated area, both in the deep fjords and in lakes. Striking similarity between major slide and debris flow deposits at the 2000 - 2200 BP and ca. 11000 - 11700 BP stratigraphic levels suggest a common triggering mechanism, probably earthquakes with epicentres in the Sunnfjord Sunnmoere region. A period of debris flows
Gear Fault Diagnosis Based on BP Neural Network
Huang, Yongsheng; Huang, Ruoshi
2018-03-01
Gear transmission is more complex, widely used in machinery fields, which form of fault has some nonlinear characteristics. This paper uses BP neural network to train the gear of four typical failure modes, and achieves satisfactory results. Tested by using test data, test results have an agreement with the actual results. The results show that the BP neural network can effectively solve the complex state of gear fault in the gear fault diagnosis.
Victor Henri: 111 years of his equation.
Cornish-Bowden, Athel; Mazat, Jean-Pierre; Nicolas, Serge
2014-12-01
Victor Henri's great contribution to the understanding of enzyme kinetics and mechanism is not always given the credit that it deserves. In addition, his earlier work in experimental psychology is totally unknown to biochemists, and his later work in spectroscopy and photobiology almost equally so. Applying great rigour to his analysis he succeeded in obtaining a model of enzyme action that explained all of the observations available to him, and he showed why the considerable amount of work done in the preceding decade had not led to understanding. His view was that only physical chemistry could explain the behaviour of enzymes, and that models should be judged in accordance with their capacity not only to explain previously known facts but also to predict new observations against which they could be tested. The kinetic equation usually attributed to Michaelis and Menten was in reality due to him. His thesis of 1903 is now available in English. Copyright © 2014 Elsevier B.V. and Société française de biochimie et biologie Moléculaire (SFBBM). All rights reserved.
2011-10-14
... International, Inc., containing a civil penalty of $1,100,000.00. DATES: Any interested person may ask the... report of a death involving a Target Set on or about May 1, 2006, after an 8-year-old boy choked on a dart and died on March 9, 2006. 8. In response to the death reported on or about May 1, 2006, Henry...
[Clinical significance of NS1-BP expression in esophageal squamous cell carcinoma].
Ren, K; Qian, D; Wang, Y W; Pang, Q S; Zhang, W C; Yuan, Z Y; Wang, P
2018-01-23
Objective: To investigate the clinical significance of NS1-BP expression in patients with esophageal squamous cell carcinoma (ESCC), and to study the roles of NS1-BP in proliferation and apoptosis of ESCC cells. Methods: A total of 98 tumor tissues and 30 adjacent normal tissues from 98 ESCC patients were used as study group and control group, and these samples were collected in Sun Yat-Sen University Cancer Center between 2002 and 2008. In addition, 46 ESCC tissues which were collected in Cancer Institute and Hospital of Tianjin Medical University were used as validation group. Expression of mucosal NS1-BP was detected by immunohistochemistry. Kaplan-Meier curve and log-rank test were used to analyze the survival rate. Multivariate Cox proportional hazard model was used to analyze the prognostic factors. Furthermore, NS1-BP was over expressed or knocked down in ESCC cells by transient transfection. Protein levels of c-Myc were detected by western blot. Cell viability and apoptosis was analyzed by MTT assay and flow cytometry. Results: Among all of tested samples, NS1-BP were down-regulated in 9 out of 30 non-tumorous normal esophageal tissues (30.0%) and 85 out of 144 ESCC tissues (59.0%), respectively, showing a statistically significant difference ( P =0.012). In the study group, three-year disease-free survival rate of NS1-BP high expression group (53.2%) was significantly higher than that of NS1-BP low expression group (27.6%; P =0.009). In the validation group, the three-year disease-free survival rates were 57.8% and 25.5% in NS1-BP high and low levels groups, respectively, showing a similar results ( P =0.016). Importantly, multivariate analyses showed that low expression of NS1-BP was an independent predictor for chemoradiotherapy sensitivity and shorter disease-free survival time in ESCC patients( P <0.05 for all). Furthermore, overexpressed NS1-BP in TE-1 cells repressed c-Myc expression, inhibited cell proliferation and promoted apoptosis. In contrast
A new BP Fourier algorithm and its application in English teaching evaluation
Pei, Xuehui; Pei, Guixin
2017-08-01
BP neural network algorithm has wide adaptability and accuracy when used in complicated system evaluation, but its calculation defects such as slow convergence have limited its practical application. The paper tries to speed up the calculation convergence of BP neural network algorithm with Fourier basis functions and presents a new BP Fourier algorithm for complicated system evaluation. First, shortages and working principle of BP algorithm are analyzed for subsequent targeted improvement; Second, the presented BP Fourier algorithm adopts Fourier basis functions to simplify calculation structure, designs new calculation transfer function between input and output layers, and conducts theoretical analysis to prove the efficiency of the presented algorithm; Finally, the presented algorithm is used in evaluating university English teaching and the application results shows that the presented BP Fourier algorithm has better performance in calculation efficiency and evaluation accuracy and can be used in evaluating complicated system practically.
InterProScan Result: BP117067 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP117067 BP117067_1_ORF2 D483359C05197373 PFAM PF00067 p450 6e-05 T IPR001128 Cytochrome P450 Molecular... Function: monooxygenase activity (GO:0004497)|Molecular Function: iron ion binding (GO:0005506)|Molecular... Function: electron carrier activity (GO:0009055)|Molecular Function: heme binding (GO:0020037) ...
InterProScan Result: BP124291 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP124291 BP124291_5_ORF1 92B626ADD33C8436 PFAM PF00067 p450 1.8e-09 T IPR001128 Cytochrome P450 Molecular... Function: monooxygenase activity (GO:0004497)|Molecular Function: iron ion binding (GO:0005506)|Molecular... Function: electron carrier activity (GO:0009055)|Molecular Function: heme binding (GO:0020037) ...
InterProScan Result: BP123442 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP123442 BP123442_1_ORF1 331440C6CA592A17 PRINTS PR00385 P450 6.3e-05 T IPR001128 Cytochrome P450 Molecular... Function: monooxygenase activity (GO:0004497)|Molecular Function: iron ion binding (GO:0005506)|Molecular... Function: electron carrier activity (GO:0009055)|Molecular Function: heme binding (GO:0020037) ...
TopBP1 associates with NBS1 and is involved in homologous recombination repair
International Nuclear Information System (INIS)
Morishima, Ken-ichi; Sakamoto, Shuichi; Kobayashi, Junya; Izumi, Hideki; Suda, Tetsuji; Matsumoto, Yoshiyuki; Tauchi, Hiroshi; Ide, Hiroshi; Komatsu, Kenshi; Matsuura, Shinya
2007-01-01
TopBP1 is involved in DNA replication and DNA damage checkpoint. Recent studies have demonstrated that TopBP1 is a direct positive effecter of ATR. However, it is not known how TopBP1 recognizes damaged DNA. Here, we show that TopBP1 formed nuclear foci after exposure to ionizing radiation, but such TopBP1 foci were abolished in Nijmegen breakage syndrome cells. We also show that TopBP1 physically associated with NBS1 in vivo. These results suggested that NBS1 might regulate TopBP1 recruitment to the sites of DNA damage. TopBP1-depleted cells showed hypersensitivity to Mitomycin C and ionizing radiation, an increased frequency of sister-chromatid exchange level, and a reduced frequency of DNA double-strand break induced homologous recombination repair. Together, these results suggested that TopBP1 might be a mediator of DNA damage signaling from NBS1 to ATR and promote homologous recombination repair
The human element of right-sizing. BP experiences
International Nuclear Information System (INIS)
Hollis, J.W.
1994-01-01
BP (British Petroleum) Exploration has been engaged in a world-wide repositioning exercise to improve its business performance. Despite a 40% fall in average oil price, the profitability and revenues have both grown, while the workforce has more than halved. BP is now able to test itself against price assumptions as low as $ 14 a barrel and make as good a return as it was near to $ 20. The paper discusses such a process of repositioning
The human element of right-sizing. BP experiences
Energy Technology Data Exchange (ETDEWEB)
Hollis, J W [BP Norge (Norway)
1994-12-31
BP (British Petroleum) Exploration has been engaged in a world-wide repositioning exercise to improve its business performance. Despite a 40% fall in average oil price, the profitability and revenues have both grown, while the workforce has more than halved. BP is now able to test itself against price assumptions as low as $ 14 a barrel and make as good a return as it was near to $ 20. The paper discusses such a process of repositioning
Amundsen, Michael
2012-01-01
Arvustus: Crusading and chronicle writing on the medieval Baltic frontier : a companion to the Chronicle of Henry of Livonia / edited by Marek Tamm, Linda Kaljundi, Carsten Selch Jensen. Farnham : Ashgate, 2011
International Nuclear Information System (INIS)
Switsur, Roy
1986-01-01
A history of the development of the technique of radiocarbon dating highlights the two problems with this method. The first is calibration; the radiocarbon calendar is not linear. However two independent experiments to provide high precision measurements in tree rings have resulted in a high precision calibration curve. The second is how to denote radiocarbon ages and calibrated dates, as this depends on how the dendrochronology time scale used in the calibration is transferred to the actual calendar. If the zero of the dendroscale is transferred from the origin of the Christian calendar to AD 1950, radiocarbon ages are designated CAL BP (BP = before present). There is an alternative method which results in CAL AD and CAL BC. A suggestion for a standard notation is made to avoid the confusion of two systems. (U.K.)
Thinking in time an introduction to Henri Bergson
Guerlac, Suzanne
2006-01-01
"In recent years, we have grown accustomed to philosophical language that is intensely self-conscious and rhetorically thick, often tragic in tone. It is enlivening to read Bergson, who exerts so little rhetorical pressure while exacting such a substantial effort of thought. . . . Bergson's texts teach the reader to let go of entrenched intellectual habits and to begin to think differently—to think in time. . . . Too much and too little have been said about Bergson. Too much, because of the various appropriations of his thought. Too little, because the work itself has not been carefully studied in recent decades."—from Thinking in TimeHenri Bergson (1859–1941), whose philosophical works emphasized motion, time, and change, won the Nobel Prize for Literature in 1927. His work remains influential, particularly in the realms of philosophy, cultural studies, and new media studies. In Thinking in Time, Suzanne Guerlac provides readers with the conceptual and contextual tools necessary for informed appreciati...
BP teatas harvast edusammust / Hendrik Vosman
Vosman, Hendrik
2010-01-01
Naftakompanii BP teatas, et suudab Mehhiko lahest päevas kinni püüda sinna lekkinud 10 000 barrelit naftat. Tegu on ajutise lahendusega, lõplikult peaks naftavoo peatama merepõhja puuritavad nn. asenduskaevud
Henri Mitterand – Critique génétique et sociocritique
Mitterand, Henri; Biasi, Pierre-Marc de; Herschberg Pierrot, Anne
2013-01-01
Henri Mitterand est l’un des fondateurs de la sociocritique en France, et de la génétique zolienne. Il est aussi linguiste, sémioticien et stylisticien. Nous l’avons interrogé sur les relations complexes de la génétique et de la sociocritique. Sociocritique et sociogenèse Pierre-Marc de Biasi – Après une trentaine d’années de recul et d’expérience, quelle place donneriez-vous à la sociocritique et à la sociogenèse dans la construction du nouveau rapport critique qui s’est institué avec les ma...
International Nuclear Information System (INIS)
Iwabuchi, Kuniyoshi; Matsui, Tadashi; Hashimoto, Mitsumasa; Matsumoto, Yoshihisa; Kurihara, Takayuki; Date, Takayasu
2008-01-01
53BP1 plays important roles in checkpoint signaling and repair for DNA double-strand breaks. We found that a colon cancer cell line, SW48, expressed a splicing variant form of 53BP1, which lacks the residues corresponding to exons 10 and 11. Activation of ATM and phosphorylation of ATM and ATR targets occurred in SW48 cells in response to X-irradiation, and these X-ray-induced responses were not enhanced by expression of full-length 53BP1 in SW48 cells, indicating that this splicing variant fully activates the major checkpoint signaling in SW48 cells. In contrast, the expression of full-length 53BP1 in SW48 cells promoted the repair of X-ray-induced DNA damage, evidenced by faster disappearance of X-ray-induced γ-H2AX foci, a marker for DNA damage, and less residual chromosomal aberrations after X-irradiation. We conclude that the two major roles of 53BP1, the checkpoint signaling and repair for DNA damage, can be functionally separated
Dr. Henry Rodriguez, director of the Office of Cancer Clinical Proteomics Research (OCCPR) at NCI, speaks with ecancer television at WIN 2017 about the translation of the proteins expressed in a patient's tumor into a map for druggable targets. By combining genomic and proteomic information (proteogenomics), leading scientists are gaining new insights into ways to detect and treat cancer due to a more complete and unified understanding of complex biological processes.
Directory of Open Access Journals (Sweden)
Oniki Yoshika
2002-01-01
Full Text Available We report Pelecitus helicinus Railliet & Henry, 1910 from 13 species of birds of 2 orders and 7 families, collected from the states of São Paulo and Mato Grosso, Brazil. All 13 constitute new host records for this nematode. In addition, we report the first record of Aprocta golvani Diaz-Ungria, 1963 from Brazil and Monasa nigrifrons (Bucconidae, as well as a number of other nematode records from Neotropical birds.
DEFF Research Database (Denmark)
Henriksen, Jens Henrik Sahl
2014-01-01
The English physiologist, Ernest Henry Starling (1866–1927) (Fig. 1) in 1896, provided a quantitative explanation of the transcapillary transport of fluid. Six years later, he discovered the first hormone and introduced the concept of hormones in 1905, and at the time of the First World War, he f......’s achievements in cardiovascular physiology and endocrinology....
IGF2BP3 Modulates the Interaction of Invasion-Associated Transcripts with RISC
Directory of Open Access Journals (Sweden)
Hanane Ennajdaoui
2016-05-01
Full Text Available Insulin-like growth factor 2 mRNA binding protein 3 (IGF2BP3 expression correlates with malignancy, but its role(s in pathogenesis remains enigmatic. We interrogated the IGF2BP3-RNA interaction network in pancreatic ductal adenocarcinoma (PDAC cells. Using a combination of genome-wide approaches, we have identified 164 direct mRNA targets of IGF2BP3. These transcripts encode proteins enriched for functions such as cell migration, proliferation, and adhesion. Loss of IGF2BP3 reduced PDAC cell invasiveness and remodeled focal adhesion junctions. Individual nucleotide resolution crosslinking immunoprecipitation (iCLIP revealed significant overlap of IGF2BP3 and microRNA (miRNA binding sites. IGF2BP3 promotes association of the RNA-induced silencing complex (RISC with specific transcripts. Our results show that IGF2BP3 influences a malignancy-associated RNA regulon by modulating miRNA-mRNA interactions.
IGF2BP3 Modulates the Interaction of Invasion-Associated Transcripts with RISC.
Ennajdaoui, Hanane; Howard, Jonathan M; Sterne-Weiler, Timothy; Jahanbani, Fereshteh; Coyne, Doyle J; Uren, Philip J; Dargyte, Marija; Katzman, Sol; Draper, Jolene M; Wallace, Andrew; Cazarez, Oscar; Burns, Suzanne C; Qiao, Mei; Hinck, Lindsay; Smith, Andrew D; Toloue, Masoud M; Blencowe, Benjamin J; Penalva, Luiz O F; Sanford, Jeremy R
2016-05-31
Insulin-like growth factor 2 mRNA binding protein 3 (IGF2BP3) expression correlates with malignancy, but its role(s) in pathogenesis remains enigmatic. We interrogated the IGF2BP3-RNA interaction network in pancreatic ductal adenocarcinoma (PDAC) cells. Using a combination of genome-wide approaches, we have identified 164 direct mRNA targets of IGF2BP3. These transcripts encode proteins enriched for functions such as cell migration, proliferation, and adhesion. Loss of IGF2BP3 reduced PDAC cell invasiveness and remodeled focal adhesion junctions. Individual nucleotide resolution crosslinking immunoprecipitation (iCLIP) revealed significant overlap of IGF2BP3 and microRNA (miRNA) binding sites. IGF2BP3 promotes association of the RNA-induced silencing complex (RISC) with specific transcripts. Our results show that IGF2BP3 influences a malignancy-associated RNA regulon by modulating miRNA-mRNA interactions. Copyright © 2016 The Author(s). Published by Elsevier Inc. All rights reserved.
BP Canada Energy Company : climate change action plan update 1999-2000
International Nuclear Information System (INIS)
2001-10-01
An aggressive, world-wide target for a 10 per cent reduction of greenhouse gas emissions was set by BP p.l.c. and BP Canada Energy Company has supported this endeavour. Six major areas have been identified as offering potential solutions to the problem of climate change: the control of greenhouse gases, the conservation of energy, the introduction of new technologies, the promotion of flexible market instruments, the participation in the policy process, and an investment in research. This document reviewed the efforts expanded to date in those areas. It was noted that a deliberate shift was made by BP leadership from oil to natural gas production, releasing much less carbon dioxide in the atmosphere when burned. A brief overview of the operations of BP Canada Energy Company was provided in chapter 1, followed by the philosophy concerning greenhouse gases in chapter 2. In chapter 3, the topic of BP's global emissions trading system was discussed. The current and projected greenhouse gas emissions were looked at in chapter 4, while chapter 5 dealt with setting global targets, with specific emphasis on Canadian targets. In chapter 6 , the emphasis was placed on BP's emission reduction initiatives. In chapter 7, the question of raising awareness was examined. 7 tabs., 7 figs
All Are Worthy to Know the Earth: Henry De la Beche and the Origin of Geological Literacy
Clary, Renee M.; Wandersee, James H.
2009-01-01
Henry T. De la Beche (1796-1855) began his geological career within an elite circle (Geological Society of London, 1817; FRS, 1819), collaborating with influential gentlemen geologists and publishing original research. When his independent income dwindled, De la Beche managed to secure governmental funding for his mapping projects. This led to…
Joseph, John E.
1996-01-01
Discusses Victor Henry's innovative presentation of some underlying contradictions in the premises on which linguistics is founded, cast in the Kantian form of antinomies. The review argues that no science remains more strongly contested than linguistics, a science whose origins are paradoxical and that contains outdated concepts. (30 references)…
Preliminary Geological Findings on the BP-1 Simulant
Stoeser, D. B.; Rickman, D. L.; Wilson, S.
2010-01-01
A waste material from an aggregate producing quarry has been used to make an inexpensive lunar simulant called BP-1. The feedstock is the Black Point lava flow in northern Arizona. Although this is part of the San Francisco volcanic field, which is also the source of the JSC-1 series feedstock, BP-1 and JSC-1 are distinct. Chemically, the Black Point flow is an amygdaloidal nepheline-bearing basalt. The amygdules are filled with secondary minerals containing opaline silica, calcium carbonate, and ferric iron minerals. X-ray diffraction (XRD) detected approximately 3% quartz, which is in line with tests done by the Kennedy Space Center Industrial Hygiene Office. Users of this material should use appropriate protective equipment. XRD also showed the presence of significant halite and some bassanite. Both are interpreted to be evaporative residues due to recycling of wash water at the quarry. The size distribution of BP-1 may be superior to some other simulants for some applications.
Conformational Dynamics of apo-GlnBP Revealed by Experimental and Computational Analysis
Feng, Yitao
2016-10-13
The glutamine binding protein (GlnBP) binds l-glutamine and cooperates with its cognate transporters during glutamine uptake. Crystal structure analysis has revealed an open and a closed conformation for apo- and holo-GlnBP, respectively. However, the detailed conformational dynamics have remained unclear. Herein, we combined NMR spectroscopy, MD simulations, and single-molecule FRET techniques to decipher the conformational dynamics of apo-GlnBP. The NMR residual dipolar couplings of apo-GlnBP were in good agreement with a MD-derived structure ensemble consisting of four metastable states. The open and closed conformations are the two major states. This four-state model was further validated by smFRET experiments and suggests the conformational selection mechanism in ligand recognition of GlnBP. © 2016 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim
Fault Diagnosis of Power System Based on Improved Genetic Optimized BP-NN
Directory of Open Access Journals (Sweden)
Yuan Pu
2015-01-01
Full Text Available BP neural network (Back-Propagation Neural Network, BP-NN is one of the most widely neural network models and is applied to fault diagnosis of power system currently. BP neural network has good self-learning and adaptive ability and generalization ability, but the operation process is easy to fall into local minima. Genetic algorithm has global optimization features, and crossover is the most important operation of the Genetic Algorithm. In this paper, we can modify the crossover of traditional Genetic Algorithm, using improved genetic algorithm optimized BP neural network training initial weights and thresholds, to avoid the problem of BP neural network fall into local minima. The results of analysis by an example, the method can efficiently diagnose network fault location, and improve fault-tolerance and grid fault diagnosis effect.
Conformational Dynamics of apo-GlnBP Revealed by Experimental and Computational Analysis
Feng, Yitao; Zhang, Lu; Wu, Shaowen; Liu, Zhijun; Gao, Xin; Zhang, Xu; Liu, Maili; Liu, Jianwei; Huang, Xuhui; Wang, Wenning
2016-01-01
The glutamine binding protein (GlnBP) binds l-glutamine and cooperates with its cognate transporters during glutamine uptake. Crystal structure analysis has revealed an open and a closed conformation for apo- and holo-GlnBP, respectively. However, the detailed conformational dynamics have remained unclear. Herein, we combined NMR spectroscopy, MD simulations, and single-molecule FRET techniques to decipher the conformational dynamics of apo-GlnBP. The NMR residual dipolar couplings of apo-GlnBP were in good agreement with a MD-derived structure ensemble consisting of four metastable states. The open and closed conformations are the two major states. This four-state model was further validated by smFRET experiments and suggests the conformational selection mechanism in ligand recognition of GlnBP. © 2016 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim
Chain reaction. History of the atomic bomb
International Nuclear Information System (INIS)
Mania, Hubert
2010-01-01
Henri becquerel tracked down in 1896 a strange radiation, which was called radioactivity by Marie Curie. In the following centuries German scientists Max Planck, Albert Einstein and Werner Heisenberg presented fundamental contributions to understand processes in the atomic nucleus. At Goettingen, center of the international nuclear physics community, the American student J. Robert Oppenheimer admit to this physical research. In the beginning of 1939 the message of Otto Hahns' nuclear fission electrified researchers. The first step, unleashing atomic energy, was done. A half year later the Second World War begun. And suddenly being friend with and busily communicating physicians were devided into hostile power blocs as bearers of official secrets. The author tells in this exciting book the story of the first atomic bomb as a chain reaction of ideas, discoveries and visions, of friendships, jealousy and intrigues of scientists, adventurers and genius. (orig./GL)
Chain reaction. History of the atomic bomb; Kettenreaktion. Die Geschichte der Atombombe
Energy Technology Data Exchange (ETDEWEB)
Mania, Hubert
2010-07-01
Henri becquerel tracked down in 1896 a strange radiation, which was called radioactivity by Marie Curie. In the following centuries German scientists Max Planck, Albert Einstein and Werner Heisenberg presented fundamental contributions to understand processes in the atomic nucleus. At Goettingen, center of the international nuclear physics community, the American student J. Robert Oppenheimer admit to this physical research. In the beginning of 1939 the message of Otto Hahns' nuclear fission electrified researchers. The first step, unleashing atomic energy, was done. A half year later the Second World War begun. And suddenly being friend with and busily communicating physicians were devided into hostile power blocs as bearers of official secrets. The author tells in this exciting book the story of the first atomic bomb as a chain reaction of ideas, discoveries and visions, of friendships, jealousy and intrigues of scientists, adventurers and genius. (orig./GL)
Literary Practice according to Michel Henry: A Philosophical Introduction to his Novels
Directory of Open Access Journals (Sweden)
Jean-Baptiste Dussert
2012-12-01
Full Text Available Although the author of four novels, Michel Henry never produced an aesthetics of literature. The purpose of this article is, after a presentation of his philosophy of immanence and his concept of life, to locate where the literary practice takes place in his system. In this study, we are not interested in the poetic quality of his works, but in the possibility to base his singular creativity on his philosophical reflection. This leads us to insert literature in the vast phenomenon of culture and ethics, and to grasp the function of poetics in the struggle against barbarism.
Elementos de política de gestión en Henry Mintzberg
García-Álvarez, S. (Santiago); García-Martínez, A.N. (Alejandro Néstor); Múgica, F. (Fernando)
2016-01-01
El trabajo de investigación consistió en estudiar un buen número de los escritos de Henry Mintzberg y prácticamente todas sus obras relacionadas con los elementos de política de gestión: no únicamente los libros, sino numerosos artículos y textos relacionados. He leído también muchos libros y artículos de otros autores de management, como Drucker, Collins, Kotter, Pfeffer, Peters y varios más, para enriquecer el texto y contrastar posturas. He estudiado con particular interés y detenimiento l...
TopBP1-mediated DNA processing during mitosis.
Gallina, Irene; Christiansen, Signe Korbo; Pedersen, Rune Troelsgaard; Lisby, Michael; Oestergaard, Vibe H
2016-01-01
Maintenance of genome integrity is crucial to avoid cancer and other genetic diseases. Thus faced with DNA damage, cells mount a DNA damage response to avoid genome instability. The DNA damage response is partially inhibited during mitosis presumably to avoid erroneous processing of the segregating chromosomes. Yet our recent study shows that TopBP1-mediated DNA processing during mitosis is highly important to reduce transmission of DNA damage to daughter cells. (1) Here we provide an overview of the DNA damage response and DNA repair during mitosis. One role of TopBP1 during mitosis is to stimulate unscheduled DNA synthesis at underreplicated regions. We speculated that such genomic regions are likely to hold stalled replication forks or post-replicative gaps, which become the substrate for DNA synthesis upon entry into mitosis. Thus, we addressed whether the translesion pathways for fork restart or post-replicative gap filling are required for unscheduled DNA synthesis in mitosis. Using genetics in the avian DT40 cell line, we provide evidence that unscheduled DNA synthesis in mitosis does not require the translesion synthesis scaffold factor Rev1 or PCNA ubiquitylation at K164, which serve to recruit translesion polymerases to stalled forks. In line with this finding, translesion polymerase η foci do not colocalize with TopBP1 or FANCD2 in mitosis. Taken together, we conclude that TopBP1 promotes unscheduled DNA synthesis in mitosis independently of the examined translesion polymerases.
Henry Agard Wallace, the Iowa Corn Yield Tests, and the Adoption of Hybrid Corn
Richard C. Sutch
2008-01-01
This research report makes the following claims: 1] There was not an unambiguous economic advantage of hybrid corn over the open-pollinated varieties in 1936. 2] The early adoption of hybrid corn before 1937 can be better explained by a sustained propaganda campaign conducted by the U.S. Department of Agriculture at the direction of the Secretary of Agriculture, Henry Agard Wallace. The Department's campaign echoed that of the commercial seed companies. The most prominent hybrid seed company,...
BP pääseb lekkest kuiva nahaga / Heiki Suurkask
Suurkask, Heiki, 1972-
2010-01-01
BP saab peagi valmis tagavara-naftapuuraugu, lekkinud puuraugule õnnestus peale valada betoonkiht. Autor märgib, et tegelikult ei saa USA võimud ühtegi edusammu naftalekke peatamisel selgelt oma nimele kirjutada ning ainsaks kaotajaks selles lekkes peale looduse ja kalurite paistab olevat ameti kaotav BP juht Tony Hatward
200-BP-5 operable unit Technical Baseline report
International Nuclear Information System (INIS)
Jacques, I.D.; Kent, S.K.
1991-10-01
This report supports development of a remedial investigation/feasibility study work plan for the 200-BP-5 operable unit. The report summarizes baseline information for waste sites and unplanned release sites located in the 200-BP-5 operable unit. The sites were investigated by the Technical Baseline Section of the Environmental Engineering Group, Westinghouse Hanford Company (Westinghouse Hanford). The investigation consisted of review and evaluation of current and historical Hanford Site reports, drawings, and photographs, and was supplemented with recent inspections of the Hanford Site and employee interviews. No field investigations or sampling were conducted
Advertising as Insurance or Commitment? Evidence from the BP Oil Spill
Lint Barrage; Eric Chyn; Justine Hastings
2014-01-01
This paper explores how advertising impacts the consumer response to news about unobserved product quality. Specifically, we estimate how British Petroleum’s (BP) 2000-2008 “Beyond Petroleum” advertising campaign affected the impact of the 2010 BP oil spill. We find that BP station margins declined by 4.2 cents per gallon, and volumes declined by 3.6 percent after the spill. However, pre-spill advertising significantly dampened the price response in the short-run, and reduced the fraction of ...
Henry Head and the Theatre of Reverie
Directory of Open Access Journals (Sweden)
Tiffany Watt-Smith
2011-04-01
Full Text Available In 1903, the neurologist Henry Head (1861-1940 embarked on a painful self-experiment, in which he severed the radial nerve of his left arm, and then charted the gradual and faltering return of sensitivity to the limb over the next four and a half years. To directly experience his own sensations, Head entered into a trance-like state of distraction or reverie he called a ‘negative attitude of attention’. This article explores Head’s peculiar technique for looking within, and argues that while introspection was an established strategy in psychological laboratories, Head’s reverie also resonated with techniques associated with actors and theatrical audiences during this period. Viewing psychological self-experimentation through the lens of theatre, this article makes visible aspects of Head’s embodied, affective laboratory encounters, often obscured in accounts of his experiment. At the same time, it proposes that the broader historical and cultural significance of Head’s experiment lies in his attempt to observe himself by producing states of inattention and reverie at will, mental ‘attitudes’ that were themselves the subject of a rapidly evolving debate in scientific and aesthetic circles at the turn of the twentieth century.
Levels of the E2 interacting protein TopBP1 modulate papillomavirus maintenance stage replication
International Nuclear Information System (INIS)
Kanginakudru, Sriramana; DeSmet, Marsha; Thomas, Yanique; Morgan, Iain M.; Androphy, Elliot J.
2015-01-01
The evolutionarily conserved DNA topoisomerase II beta-binding protein 1 (TopBP1) functions in DNA replication, DNA damage response, and cell survival. We analyzed the role of TopBP1 in human and bovine papillomavirus genome replication. Consistent with prior reports, TopBP1 co-localized in discrete nuclear foci and was in complex with papillomavirus E2 protein. Similar to E2, TopBP1 is recruited to the region of the viral origin of replication during G1/S and early S phase. TopBP1 knockdown increased, while over-expression decreased transient virus replication, without affecting cell cycle. Similarly, using cell lines harboring HPV-16 or HPV-31 genome, TopBP1 knockdown increased while over-expression reduced viral copy number relative to genomic DNA. We propose a model in which TopBP1 serves dual roles in viral replication: it is essential for initiation of replication yet it restricts viral copy number. - Highlights: • Protein interaction study confirmed In-situ interaction between TopBP1 and E2. • TopBP1 present at papillomavirus ori in G1/S and early S phase of cell cycle. • TopBP1 knockdown increased, over-expression reduced virus replication. • TopBP1 protein level change did not influence cell survival or cell cycle. • TopBP1 displaced from papillomavirus ori after initiation of replication
Levels of the E2 interacting protein TopBP1 modulate papillomavirus maintenance stage replication
Energy Technology Data Exchange (ETDEWEB)
Kanginakudru, Sriramana, E-mail: skangina@iu.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); DeSmet, Marsha, E-mail: mdesmet@iupui.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); Thomas, Yanique, E-mail: ysthomas@umail.iu.edu [Department of Microbiology and Immunology, Indiana University School of Medicine, Indianapolis, IN (United States); Morgan, Iain M., E-mail: immorgan@vcu.edu [VCU Philips Institute for Oral Health Research, Virginia Commonwealth University, Richmond, Virginia (United States); Androphy, Elliot J., E-mail: eandro@iu.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); Department of Microbiology and Immunology, Indiana University School of Medicine, Indianapolis, IN (United States)
2015-04-15
The evolutionarily conserved DNA topoisomerase II beta-binding protein 1 (TopBP1) functions in DNA replication, DNA damage response, and cell survival. We analyzed the role of TopBP1 in human and bovine papillomavirus genome replication. Consistent with prior reports, TopBP1 co-localized in discrete nuclear foci and was in complex with papillomavirus E2 protein. Similar to E2, TopBP1 is recruited to the region of the viral origin of replication during G1/S and early S phase. TopBP1 knockdown increased, while over-expression decreased transient virus replication, without affecting cell cycle. Similarly, using cell lines harboring HPV-16 or HPV-31 genome, TopBP1 knockdown increased while over-expression reduced viral copy number relative to genomic DNA. We propose a model in which TopBP1 serves dual roles in viral replication: it is essential for initiation of replication yet it restricts viral copy number. - Highlights: • Protein interaction study confirmed In-situ interaction between TopBP1 and E2. • TopBP1 present at papillomavirus ori in G1/S and early S phase of cell cycle. • TopBP1 knockdown increased, over-expression reduced virus replication. • TopBP1 protein level change did not influence cell survival or cell cycle. • TopBP1 displaced from papillomavirus ori after initiation of replication.
Interactions of the human MCM-BP protein with MCM complex components and Dbf4.
Directory of Open Access Journals (Sweden)
Tin Nguyen
Full Text Available MCM-BP was discovered as a protein that co-purified from human cells with MCM proteins 3 through 7; results which were recapitulated in frogs, yeast and plants. Evidence in all of these organisms supports an important role for MCM-BP in DNA replication, including contributions to MCM complex unloading. However the mechanisms by which MCM-BP functions and associates with MCM complexes are not well understood. Here we show that human MCM-BP is capable of interacting with individual MCM proteins 2 through 7 when co-expressed in insect cells and can greatly increase the recovery of some recombinant MCM proteins. Glycerol gradient sedimentation analysis indicated that MCM-BP interacts most strongly with MCM4 and MCM7. Similar gradient analyses of human cell lysates showed that only a small amount of MCM-BP overlapped with the migration of MCM complexes and that MCM complexes were disrupted by exogenous MCM-BP. In addition, large complexes containing MCM-BP and MCM proteins were detected at mid to late S phase, suggesting that the formation of specific MCM-BP complexes is cell cycle regulated. We also identified an interaction between MCM-BP and the Dbf4 regulatory component of the DDK kinase in both yeast 2-hybrid and insect cell co-expression assays, and this interaction was verified by co-immunoprecipitation of endogenous proteins from human cells. In vitro kinase assays showed that MCM-BP was not a substrate for DDK but could inhibit DDK phosphorylation of MCM4,6,7 within MCM4,6,7 or MCM2-7 complexes, with little effect on DDK phosphorylation of MCM2. Since DDK is known to activate DNA replication through phosphorylation of these MCM proteins, our results suggest that MCM-BP may affect DNA replication in part by regulating MCM phosphorylation by DDK.
Interactions of the human MCM-BP protein with MCM complex components and Dbf4.
Nguyen, Tin; Jagannathan, Madhav; Shire, Kathy; Frappier, Lori
2012-01-01
MCM-BP was discovered as a protein that co-purified from human cells with MCM proteins 3 through 7; results which were recapitulated in frogs, yeast and plants. Evidence in all of these organisms supports an important role for MCM-BP in DNA replication, including contributions to MCM complex unloading. However the mechanisms by which MCM-BP functions and associates with MCM complexes are not well understood. Here we show that human MCM-BP is capable of interacting with individual MCM proteins 2 through 7 when co-expressed in insect cells and can greatly increase the recovery of some recombinant MCM proteins. Glycerol gradient sedimentation analysis indicated that MCM-BP interacts most strongly with MCM4 and MCM7. Similar gradient analyses of human cell lysates showed that only a small amount of MCM-BP overlapped with the migration of MCM complexes and that MCM complexes were disrupted by exogenous MCM-BP. In addition, large complexes containing MCM-BP and MCM proteins were detected at mid to late S phase, suggesting that the formation of specific MCM-BP complexes is cell cycle regulated. We also identified an interaction between MCM-BP and the Dbf4 regulatory component of the DDK kinase in both yeast 2-hybrid and insect cell co-expression assays, and this interaction was verified by co-immunoprecipitation of endogenous proteins from human cells. In vitro kinase assays showed that MCM-BP was not a substrate for DDK but could inhibit DDK phosphorylation of MCM4,6,7 within MCM4,6,7 or MCM2-7 complexes, with little effect on DDK phosphorylation of MCM2. Since DDK is known to activate DNA replication through phosphorylation of these MCM proteins, our results suggest that MCM-BP may affect DNA replication in part by regulating MCM phosphorylation by DDK.
The Allison V. Armour / William Henry Holmes 1895 Expedition to Mexico
Directory of Open Access Journals (Sweden)
Warren Haskin
2001-11-01
Full Text Available The foundation of the Field Museum's reputation as a place where serious science is practiced was laid by Allison V. Armour and William Henry Holmes in 1895, a little more than a year after the Museum was established. Looking back after a career of almost 60 years as an anthropologist, and having twice been honored as the outstanding practitioner in the field, Holmes described the trip to Mexico (the only expedition he led during his brief tenure as the Museum's first Curator of Anthropology as "one of the most gratifying and important events of my life." It was also one of the most important events in the history of anthropology at the Museum.
Sanz, E.; Voss, C.I.
2006-01-01
Inverse modeling studies employing data collected from the classic Henry seawater intrusion problem give insight into several important aspects of inverse modeling of seawater intrusion problems and effective measurement strategies for estimation of parameters for seawater intrusion. Despite the simplicity of the Henry problem, it embodies the behavior of a typical seawater intrusion situation in a single aquifer. Data collected from the numerical problem solution are employed without added noise in order to focus on the aspects of inverse modeling strategies dictated by the physics of variable-density flow and solute transport during seawater intrusion. Covariances of model parameters that can be estimated are strongly dependent on the physics. The insights gained from this type of analysis may be directly applied to field problems in the presence of data errors, using standard inverse modeling approaches to deal with uncertainty in data. Covariance analysis of the Henry problem indicates that in order to generally reduce variance of parameter estimates, the ideal places to measure pressure are as far away from the coast as possible, at any depth, and the ideal places to measure concentration are near the bottom of the aquifer between the center of the transition zone and its inland fringe. These observations are located in and near high-sensitivity regions of system parameters, which may be identified in a sensitivity analysis with respect to several parameters. However, both the form of error distribution in the observations and the observation weights impact the spatial sensitivity distributions, and different choices for error distributions or weights can result in significantly different regions of high sensitivity. Thus, in order to design effective sampling networks, the error form and weights must be carefully considered. For the Henry problem, permeability and freshwater inflow can be estimated with low estimation variance from only pressure or only
Bp'S Baku-Tbilisi-Ceyhan pipeline: the new corporate colonialism.
Marriott, James; Muttitt, Greg
2006-01-01
An international campaign was waged questioning the benefits of BP's Baku-Tbilisi-Ceyhan pipeline in an effort to avoid a "zone of sacrifice" there. This article is an offshoot of that effort and explains the contemporary struggle over the pipeline project. The authors describe the project's background and evaluate the actual and potential impacts of the project in which they consider eight areas. They also assess BP's capacity to confront resistance to the pipeline.
Correlation of expression of BP1, a homeobox gene, with estrogen receptor status in breast cancer
International Nuclear Information System (INIS)
Fu, Sidney W; Poola, Indira; Stephan, Dietrich A; Berg, Patricia E; Schwartz, Arnold; Stevenson, Holly; Pinzone, Joseph J; Davenport, Gregory J; Orenstein, Jan M; Gutierrez, Peter; Simmens, Samuel J; Abraham, Jessy
2003-01-01
BP1 is a novel homeobox gene cloned in our laboratory. Our previous studies in leukemia demonstrated that BP1 has oncogenic properties, including as a modulator of cell survival. Here BP1 expression was examined in breast cancer, and the relationship between BP1 expression and clinicopathological data was determined. Total RNA was isolated from cell lines, tumors, and matched normal adjacent tissue or tissue from autopsy. Reverse transcription polymerase chain reaction was performed to evaluate BP1 expression. Statistical analysis was accomplished with SAS. Analysis of 46 invasive ductal breast tumors demonstrated BP1 expression in 80% of them, compared with a lack of expression in six normal breast tissues and low-level expression in one normal breast tissue. Remarkably, 100% of tumors that were negative for the estrogen receptor (ER) were BP1-positive, whereas 73% of ER-positive tumors expressed BP1 (P = 0.03). BP1 expression was also associated with race: 89% of the tumors of African American women were BP1-positive, whereas 57% of those from Caucasian women expressed BP1 (P = 0.04). However, there was no significant difference in BP1 expression between grades I, II, and III tumors. Interestingly, BP1 mRNA expression was correlated with the ability of malignant cell lines to cause breast cancer in mice. Because BP1 is expressed abnormally in breast tumors, it could provide a useful target for therapy, particularly in patients with ER-negative tumors. The frequent expression of BP1 in all tumor grades suggests that activation of BP1 is an early event
200-BP-5 operable unit treatability test report
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-04-01
The 200-BP-5 Operable Unit was established in response to recommendations presented in the 200 East Groundwater Aggregate Area Management Study Report (AAMSR) (DOE-RL 1993a). Recognizing different approaches to remediation, the groundwater AAMSR recommended separating groundwater from source and vadose zone operable units and subdividing 200 East Area groundwater into two operable units. The division between the 200-BP-5 and 200-PO-1 Operable Units was based principally on source operable unit boundaries and distribution of groundwater plumes derived from either B Plant or Plutonium/Uranium Extraction (PUREX) Plant liquid waste disposal sites.
200-BP-5 operable unit treatability test report
International Nuclear Information System (INIS)
1996-04-01
The 200-BP-5 Operable Unit was established in response to recommendations presented in the 200 East Groundwater Aggregate Area Management Study Report (AAMSR) (DOE-RL 1993a). Recognizing different approaches to remediation, the groundwater AAMSR recommended separating groundwater from source and vadose zone operable units and subdividing 200 East Area groundwater into two operable units. The division between the 200-BP-5 and 200-PO-1 Operable Units was based principally on source operable unit boundaries and distribution of groundwater plumes derived from either B Plant or Plutonium/Uranium Extraction (PUREX) Plant liquid waste disposal sites
Study on MPGA-BP of Gravity Dam Deformation Prediction
Directory of Open Access Journals (Sweden)
Xiaoyu Wang
2017-01-01
Full Text Available Displacement is an important physical quantity of hydraulic structures deformation monitoring, and its prediction accuracy is the premise of ensuring the safe operation. Most existing metaheuristic methods have three problems: (1 falling into local minimum easily, (2 slowing convergence, and (3 the initial value’s sensitivity. Resolving these three problems and improving the prediction accuracy necessitate the application of genetic algorithm-based backpropagation (GA-BP neural network and multiple population genetic algorithm (MPGA. A hybrid multiple population genetic algorithm backpropagation (MPGA-BP neural network algorithm is put forward to optimize deformation prediction from periodic monitoring surveys of hydraulic structures. This hybrid model is employed for analyzing the displacement of a gravity dam in China. The results show the proposed model is superior to an ordinary BP neural network and statistical regression model in the aspect of global search, convergence speed, and prediction accuracy.
RanBP3 influences interactions between CRM1 and its nuclear protein export substrates
Englmeier, Ludwig; Fornerod, Maarten; Bischoff, F. Ralf; Petosa, Carlo; Mattaj, Iain W.; Kutay, Ulrike
2001-01-01
We investigated the role of RanBP3, a nuclear member of the Ran-binding protein 1 family, in CRM1-mediated protein export in higher eukaryotes. RanBP3 interacts directly with CRM1 and also forms a trimeric complex with CRM1 and RanGTP. However, RanBP3 does not bind to CRM1 like an export substrate. Instead, it can stabilize CRM1–export substrate interaction. Nuclear RanBP3 stimulates CRM1-dependent protein export in permeabilized cells. These data indicate that RanBP3 functions by a novel mec...
BP Investment Exceeds $4 Bln in china
Institute of Scientific and Technical Information of China (English)
Wang Ping
2008-01-01
@@ British Petroleum (BP) recently signed a series of agreements with China including those in clean energy and wind power generation, during British Prime Minister Gordon Brown's visit to China in mid-January.
National Oceanic and Atmospheric Administration, Department of Commerce — A multi-disciplinary team of scientists on the Henry Bigelow HB1204 mission surveyed and ground-truthed known or suspected deep-sea coral habitats associated with...
Directory of Open Access Journals (Sweden)
Aikaterini Patsatsi
2012-01-01
Full Text Available 39 bullous pemphigoid (BP patients were studied to assess the clinical significance of anti-BP180 and anti-BP230 circulating autoantibodies of BP and correlate their titers with the clinical scores of the BP Disease Area Index (BPDAI and the Autoimmune Bullous Skin Disorder Intensity Score (ABSIS as well as with the intensity of pruritus measured by the BPDAI pruritus component. All parameters were evaluated by the time of diagnosis (baseline, month 3, and month 6. Titers of anti-BP180 autoantibodies were strongly correlated with BPDAI (, and ABSIS (, values, as well as with BPDAI component for the intensity of pruritus (, at baseline. At month 3, titers of anti-BP180 autoantibodies were strongly correlated with BPDAI (, and ABSIS (, values, as well as with the BPDAI component for the intensity of pruritus (, . At month 6, titers of anti-BP180 autoantibodies were strongly correlated with BPDAI (, and ABSIS (, values, as well as with the BPDAI component for the intensity of pruritus (, . There was no statistically significant correlation between titers of anti-BP230 autoantibodies and the BPDAI, ABSIS, and BPDAI component for the intensity of pruritus at the same time points.
Style and non-style in anatomical illustration: From Renaissance Humanism to Henry Gray.
Kemp, Martin
2010-02-01
Style is a familiar category for the analysis of art. It is less so in the history of anatomical illustration. The great Renaissance and Baroque picture books of anatomy illustrated with stylish woodcuts and engravings, such as those by Charles Estienne, Andreas Vesalius and Govard Bidloo, showed figures in dramatic action in keeping with philosophical and theological ideas about human nature. Parallels can be found in paintings of the period, such as those by Titian, Michelangelo and Hans Baldung Grien. The anatomists also claimed to portray the body in an objective manner, and showed themselves as heroes of the discovery of human knowledge. Rembrandt's painting of Dr Nicholas Tulp is the best-known image of the anatomist as hero. The British empirical tradition in the 18th century saw William Cheselden and William Hunter working with techniques of representation that were intended to guarantee detailed realism. The ambition to portray forms life-size led to massive volumes, such as those by Antonio Mascagni. John Bell, the Scottish anatomist, criticized the size and pretensions of the earlier books and argued for a plain style adapted to the needs of teaching and surgery. Henry Gray's famous Anatomy of 1858, illustrated by Henry Vandyke Carter, aspired to a simple descriptive mode of functional representation that avoided stylishness, resulting in a style of its own. Successive editions of Gray progressively saw the replacement of Gray's method and of all his illustrations. The 150th anniversary edition, edited by Susan Standring, radically re-thinks the role of Gray's book within the teaching of medicine.
Sleep-time BP: prognostic marker of type 2 diabetes and therapeutic target for prevention.
Hermida, Ramón C; Ayala, Diana E; Mojón, Artemio; Fernández, José R
2016-02-01
We investigated the prognostic value of clinic and ambulatory BP (ABP) to predict new-onset diabetes and whether risk reduction is related to the progressive decrease of clinic BP or awake or asleep ABP. We prospectively evaluated 2,656 individuals without diabetes, 1,292 men and 1,364 women, 50.6 ± 14.3 years of age, with baseline BP ranging from normotension to hypertension according to ABP criteria. At baseline and annually (more frequently if hypertension treatment was adjusted based on ABP) thereafter, ABP and physical activity (wrist actigraphy) were simultaneously monitored for 48 h to accurately derive the awake and asleep BP means. During a 5.9-year median follow-up, 190 participants developed type 2 diabetes. The asleep systolic ABP mean was the most significant predictor of new-onset diabetes in a Cox proportional-hazard model adjusted for age, waist circumference, glucose, chronic kidney disease (CKD) and hypertension treatment. Daytime clinic BP and awake or 48 h ABP mean had no predictive value when corrected by the asleep ABP mean. Analyses of BP changes during follow-up revealed a 30% reduction in the risk of new-onset diabetes per 1-SD decrease in asleep systolic ABP mean, independent of changes in clinic BP or awake or 48 h ABP means. Sleep-time BP is a highly significant independent prognostic marker for new-onset diabetes. Alteration in sleep-time BP regulation seems to precede, rather than follow, the development of new-onset diabetes. Most important, lowering asleep BP, a novel therapeutic target requiring ABP evaluation, could be a significant method for reducing new-onset diabetes risk.
CHANDRA X-RAY DETECTION OF THE ENIGMATIC FIELD STAR BP Psc
International Nuclear Information System (INIS)
Kastner, Joel H.; Montez, Rodolfo; Rodriguez, David; Zuckerman, B.; Perrin, Marshall D.; Grosso, Nicolas; Forveille, Thierry; Graham, James R.
2010-01-01
BP Psc is a remarkable emission-line field star that is orbited by a dusty disk and drives a parsec-scale system of jets. We report the detection by the Chandra X-ray Observatory of a weak X-ray point source coincident with the centroids of optical/IR and submillimeter continuum emission at BP Psc. As the star's photosphere is obscured throughout the visible and near-infrared, the Chandra X-ray source likely represents the first detection of BP Psc itself. The X-rays most likely originate with magnetic activity at BP Psc and hence can be attributed either to a stellar corona or to star-disk interactions. The log of the ratio of X-ray to bolometric luminosity, log(L X /L bol ), lies in the range -5.8 to -4.2. This is smaller than log(L X /L bol ) ratios typical of low-mass, pre-main sequence stars, but is well within the log(L X /L bol ) range observed for rapidly rotating (FK Com-type) G giant stars. Hence, the Chandra results favor an exotic model wherein the disk/jet system of BP Psc is the result of its very recently engulfing a companion star or a giant planet, as the primary star ascended the giant branch.
Overexpressed CacyBP/SIP leads to the suppression of growth in renal cell carcinoma
International Nuclear Information System (INIS)
Sun, Shiren; Ning, Xiaoxuan; Liu, Jie; Liu, Lili; Chen, Yu; Han, Shuang; Zhang, Yanqi; Liang, Jie; Wu, Kaichun; Fan, Daiming
2007-01-01
Calcyclin-binding protein/Siah-1-interacting protein (CacyBP/SIP), a target protein of S100, has been identified as a component of a novel ubiquitinylation complex leading to β-catenin degradation, which was found to be related to the malignant phenotypes of gastric cancer. However, the roles of CacyBP/SIP in renal cell carcinoma still remain unclear. In the present study, we had analyzed the expression of the CacyBP/SIP protein in human renal cancer cells and clinical tissue samples. The possible roles of CacyBP/SIP in regulating the malignant phenotype of renal cancer cells were also investigated. The results demonstrated that the expression of CacyBP/SIP was markedly down-regulated in renal cell carcinoma tissues and cell lines. Ectopic overexpression of CacyBP/SIP in A498 cells inhibited the proliferation of this cell and delayed cell cycle progression significantly, which might be related to the down-regulation of Cyclin D1 through reducing β-catenin protein. CacyBP/SIP also suppressed colony formation in soft agar and its tumorigenicity in nude mice. Taken together, our work showed that CacyBP/SIP, as a novel down-regulated gene in renal cell carcinoma, suppressed proliferation and tumorigenesis of renal cancer cells
Bidet, Katell; Dadlani, Dhivya; Garcia-Blanco, Mariano A
2014-07-01
Viral RNA-host protein interactions are critical for replication of flaviviruses, a genus of positive-strand RNA viruses comprising major vector-borne human pathogens including dengue viruses (DENV). We examined three conserved host RNA-binding proteins (RBPs) G3BP1, G3BP2 and CAPRIN1 in dengue virus (DENV-2) infection and found them to be novel regulators of the interferon (IFN) response against DENV-2. The three RBPs were required for the accumulation of the protein products of several interferon stimulated genes (ISGs), and for efficient translation of PKR and IFITM2 mRNAs. This identifies G3BP1, G3BP2 and CAPRIN1 as novel regulators of the antiviral state. Their antiviral activity was antagonized by the abundant DENV-2 non-coding subgenomic flaviviral RNA (sfRNA), which bound to G3BP1, G3BP2 and CAPRIN1, inhibited their activity and lead to profound inhibition of ISG mRNA translation. This work describes a new and unexpected level of regulation for interferon stimulated gene expression and presents the first mechanism of action for an sfRNA as a molecular sponge of anti-viral effectors in human cells.
BP Oil Company's approach to risk management
International Nuclear Information System (INIS)
Fryman, C.E.
1996-01-01
The oil and chemical industries face major challenges in deciding how to handle the numerous recommendations coming from various audits, reviews and studies conducted in the functional areas of personnel health and safety, loss prevention, and environmental protection. And, the number of recommendations continues to grow with time, as regulations and normal business requirements are met. BP Oil has developed a methodology for risk ranking the events leading to specific recommendations and then determining the cost-effectiveness of the recommendations in reducing the risk. The author completed successful pilot tests of this methodology at two of BP Oil's petroleum refineries, examining the recommendations from process hazards analyses and studies completed over the past few years. The methodology has since been implemented throughout their petroleum refining, distribution, transportation, and retail business streams
Catón, Matthias
2006-01-01
Das Buch Rethinking Social Inquiry, herausgegeben von Henry E. BRADY und David COLLIER, ist eine Antwort auf den Band von KING, KEOHANE und VERBA (1994), in dem versucht wird, Standards der quantitativen Forschung in der qualitativen Forschung einzuführen. Die Autoren des hier rezensierten Buchs kritisieren viele der Vorschläge, da sie argumentieren, dass qualitative Forschung anderer Werkzeuge bedürfe. Trotzdem stimmen sie zu, dass die Grundlagen des Forschungsaufbaus ähnlich sind. Das Buch ...
Matthias Catón
2006-01-01
Das Buch Rethinking Social Inquiry, herausgegeben von Henry E. BRADY und David COLLIER, ist eine Antwort auf den Band von KING, KEOHANE und VERBA (1994), in dem versucht wird, Standards der quantitativen Forschung in der qualitativen Forschung einzuführen. Die Autoren des hier rezensierten Buchs kritisieren viele der Vorschläge, da sie argumentieren, dass qualitative Forschung anderer Werkzeuge bedürfe. Trotzdem stimmen sie zu, dass die Grundlagen des Forschungsaufbaus ähnlich sind. Das Buch ...
Prediction of BP Reactivity to Talking Using Hybrid Soft Computing Approaches
Directory of Open Access Journals (Sweden)
Gurmanik Kaur
2014-01-01
Full Text Available High blood pressure (BP is associated with an increased risk of cardiovascular diseases. Therefore, optimal precision in measurement of BP is appropriate in clinical and research studies. In this work, anthropometric characteristics including age, height, weight, body mass index (BMI, and arm circumference (AC were used as independent predictor variables for the prediction of BP reactivity to talking. Principal component analysis (PCA was fused with artificial neural network (ANN, adaptive neurofuzzy inference system (ANFIS, and least square-support vector machine (LS-SVM model to remove the multicollinearity effect among anthropometric predictor variables. The statistical tests in terms of coefficient of determination (R2, root mean square error (RMSE, and mean absolute percentage error (MAPE revealed that PCA based LS-SVM (PCA-LS-SVM model produced a more efficient prediction of BP reactivity as compared to other models. This assessment presents the importance and advantages posed by PCA fused prediction models for prediction of biological variables.
Prediction of BP reactivity to talking using hybrid soft computing approaches.
Kaur, Gurmanik; Arora, Ajat Shatru; Jain, Vijender Kumar
2014-01-01
High blood pressure (BP) is associated with an increased risk of cardiovascular diseases. Therefore, optimal precision in measurement of BP is appropriate in clinical and research studies. In this work, anthropometric characteristics including age, height, weight, body mass index (BMI), and arm circumference (AC) were used as independent predictor variables for the prediction of BP reactivity to talking. Principal component analysis (PCA) was fused with artificial neural network (ANN), adaptive neurofuzzy inference system (ANFIS), and least square-support vector machine (LS-SVM) model to remove the multicollinearity effect among anthropometric predictor variables. The statistical tests in terms of coefficient of determination (R (2)), root mean square error (RMSE), and mean absolute percentage error (MAPE) revealed that PCA based LS-SVM (PCA-LS-SVM) model produced a more efficient prediction of BP reactivity as compared to other models. This assessment presents the importance and advantages posed by PCA fused prediction models for prediction of biological variables.
Publicações póstumas de Henri Fayol: revisitando sua teoria administrativa
Souza, Edson Miranda De; Aguiar, Afrânio Carvalho
2011-01-01
O engenheiro francês Henri Fayol (1841-1925) é usualmente apresentado aos estudantes de Administração como o Pai da Escola Clássica de Administração, o que demonstra uma representação limitada da amplitude de sua contribuição para a evolução do pensamento administrativo. Além disso, é frequentemente associado ao seu contemporâneo, o teórico norte-americano Frederick Taylor, sendo aos dois atribuída a defesa de um modelo autoritário de administração. Entretanto, recentemente, pesquisadores des...
Publicações póstumas de Henri Fayol: revisitando sua teoria administrativa.
Edson Miranda de Souza; Afrânio Carvalho Aguiar
2011-01-01
O engenheiro francês Henri Fayol (1841-1925) é usualmente apresentado aos estudantes de Administração como o Pai da Escola Clássica de Administração, o que demonstra uma representação limitada da amplitude de sua contribuição para a evolução do pensamento administrativo. Além disso, é frequentemente associado ao seu contemporâneo, o teórico norte-americano Frederick Taylor, sendo aos dois atribuída a defesa de um modelo autoritário de administração. Entretanto, recentemente, pesquisadores des...
Divergent homologs of the predicted small RNA BpCand697 in Burkholderia spp.
Damiri, Nadzirah; Mohd-Padil, Hirzahida; Firdaus-Raih, Mohd
2015-09-01
The small RNA (sRNA) gene candidate, BpCand697 was previously reported to be unique to Burkholderia spp. and is encoded at 3' non-coding region of a putative AraC family transcription regulator gene. This study demonstrates the conservation of BpCand697 sequence across 32 Burkholderia spp. including B. pseudomallei, B. mallei, B. thailandensis and Burkholderia sp. by integrating both sequence homology and secondary structural analyses of BpCand697 within the dataset. The divergent sequence of BpCand697 was also used as a discriminatory power in clustering the dataset according to the potential virulence of Burkholderia spp., showing that B. thailandensis was clearly secluded from the virulent cluster of B. pseudomallei and B. mallei. Finally, the differential co-transcript expression of BpCand697 and its flanking gene, bpsl2391 was detected in Burkholderia pseudomallei D286 after grown under two different culture conditions using nutrient-rich and minimal media. It is hypothesized that the differential expression of BpCand697-bpsl2391 co-transcript between the two standard prepared media might correlate with nutrient availability in the culture media, suggesting that the physical co-localization of BpCand697 in B. pseudomallei D286 might be directly or indirectly involved with the transcript regulation of bpsl2391 under the selected in vitro culture conditions.
Biskup, Radosław
2014-01-01
Arvustus: Crusading and chronicle writing on the medieval Baltic frontier : a companion to the chronicle of Henry of Livonia, eds. Marek Tamm, Linda Kaljundi, Carsten Selch Jensen. Farnham ; Burlington (Vt.) : Ashgate, c2011
PM : Cabinet likely to choose TNK-BP
2005-01-01
Tõenäoliselt saab Mazeikiu Nafta aktsiate ostjaks Suurbritannia-Vene ettevõte TNK-BP. Endiselt soovib ka Leedu Jukose osa naftakompaniist osta, kuid selleks raha laenamine võib mõjutada riigi majandust ja üleminekut eurole
Lamin A/C-dependent interaction with 53BP1 promotes cellular responses to DNA damage
DEFF Research Database (Denmark)
Gibbs-Seymour, Ian; Markiewicz, Ewa; Bekker-Jensen, Simon
2015-01-01
Lamins A/C have been implicated in DNA damage response pathways. We show that the DNA repair protein 53BP1 is a lamin A/C binding protein. In undamaged human dermal fibroblasts (HDF), 53BP1 is a nucleoskeleton protein. 53BP1 binds to lamins A/C via its Tudor domain, and this is abrogated by DNA...... damage. Lamins A/C regulate 53BP1 levels and consequently lamin A/C-null HDF display a 53BP1 null-like phenotype. Our data favour a model in which lamins A/C maintain a nucleoplasmic pool of 53BP1 in order to facilitate its rapid recruitment to sites of DNA damage and could explain why an absence...
Mallamaci, Francesca; Tripepi, Rocco; Leonardis, Daniela; Mafrica, Angela; Versace, Maria Carmela; Provenzano, Fabio; Tripepi, Giovanni; Zoccali, Carmine
2016-10-01
The clinical relevance of ambulatory blood pressure monitoring (ABPM) for risk stratification in renal transplant patients still remains poorly defined. We investigated the association between clinic and ABPM with an established biomarker of atherosclerosis (intima-media thickness [IMT] by echo-color Doppler) in a large, inclusive survey (n = 172) in renal transplant patients at a single institution. Forty-two patients (24%) were classified as hypertensive by ABPM criteria and 29 (17%) by clinic blood pressure (BP) criteria. Average daytime and nighttime BP was 126 ± 12/78 ± 9 mm Hg and 123 ± 13/74 ± 10 mm Hg, respectively. Forty-five patients (26%) were classified as hypertensive by the daytime criterion (>135/85 mm Hg) and a much higher proportion (n = 119, 69%) by the nighttime criterion (>120/70 mm Hg). Sixty-two patients (36%) had a night-day ratio of 1 or greater, indicating clear-cut nondipping. The average nighttime systolic BP (r = 0.24, P = 0.001) and the night-day systolic BP ratio (r = 0.23, P = 0.002) were directly related to IMT, and these associations were much more robust than the 24-hour systolic BP-IMT relationship (r = 0.16, P = 0.04). Average daytime BP and clinic B were unrelated to IMT. In a multiple regression analysis adjusting for confounders, the night-day systolic BP ratio maintained an independent association with IMT (β = 0.14, P = 0.04). In renal transplant patients, the prevalence of nocturnal hypertension by far exceeds the prevalence of hypertension as assessed by clinic, daytime, and 24-hour ABPM. Nighttime systolic BP and the night-day ratio but no other BP metrics are independently associated with IMT. Blood pressure during nighttime may provide unique information for the assessment of cardiovascular risk attributable to BP burden in renal transplant patients.
Directory of Open Access Journals (Sweden)
Bigya Shah
2014-01-01
Full Text Available This section provides a historical perspective and contributions from one of the most studied patients in neuroscience, Henry Molaison (1926-2008, known as H.M during his life to protect his privacy. The peculiar memory deficits seen after an experimental operation for intractable epilepsy led to some critical discoveries pertaining to memory organization in human brain.
Chakraborty, Anutosh
2009-07-07
The Henry coefficients of a single component adsorbent + adsorbate system are calculated from experimentally measured adsorption isotherm data, from which the heat of adsorption at zero coverage is evaluated. The first part of the papers relates to the development of thermodynamic property surfaces for a single-component adsorbent + adsorbate system1 (Chakraborty, A.; Saha, B. B.; Ng, K. C.; Koyama, S.; Srinivasan, K. Langmuir 2009, 25, 2204). A thermodynamic framework is presented to capture the relationship between the specific surface area (Ai) and the energy factor, and the surface structural and the surface energy heterogeneity distribution factors are analyzed. Using the outlined approach, the maximum possible amount of adsorbate uptake has been evaluated and compared with experimental data. It is found that the adsorbents with higher specific surface areas tend to possess lower heat of adsorption (ΔH°) at the Henry regime. In this paper, we have established the definitive relation between Ai and ΔH° for (i) carbonaceous materials, metal organic frameworks (MOFs), carbon nanotubes, zeolites + hydrogen, and (ii) activated carbons + methane systems. The proposed theoretical framework of At and AH0 provides valuable guides for researchers in developing advanced porous adsorbents for methane and hydrogen uptake. © 2009 American Chemical Society.
Energy Technology Data Exchange (ETDEWEB)
Ksouri, W
2008-12-15
Progress in radiation protection and radiotherapy, and the increased needs in terms of accuracy lead national metrology institutes to improve the standard. For ionizing radiation, the standard is defined by an absolute instrument used for air kerma rate measurement. The aim of the thesis is to establish standards, in terms of air kerma for X-rays beams of low and medium-energies. This work enables to complement the standard beam range of the Laboratoire National Henri Becquerel (LNHB). Two free-air chambers have been developed, WK06 for medium-energy and WK07 for low-energy. The air-kerma rate is corrected by several correction factors. Some are determined experimentally; and the others by using Monte Carlo simulations. The uncertainty budget of the air-kerma rate at one standard deviation has been established. These dosimetric standards were compared with those of counterparts' laboratories and are consistent in terms of degree of equivalence. (author)
Directory of Open Access Journals (Sweden)
Katell Bidet
2014-07-01
Full Text Available Viral RNA-host protein interactions are critical for replication of flaviviruses, a genus of positive-strand RNA viruses comprising major vector-borne human pathogens including dengue viruses (DENV. We examined three conserved host RNA-binding proteins (RBPs G3BP1, G3BP2 and CAPRIN1 in dengue virus (DENV-2 infection and found them to be novel regulators of the interferon (IFN response against DENV-2. The three RBPs were required for the accumulation of the protein products of several interferon stimulated genes (ISGs, and for efficient translation of PKR and IFITM2 mRNAs. This identifies G3BP1, G3BP2 and CAPRIN1 as novel regulators of the antiviral state. Their antiviral activity was antagonized by the abundant DENV-2 non-coding subgenomic flaviviral RNA (sfRNA, which bound to G3BP1, G3BP2 and CAPRIN1, inhibited their activity and lead to profound inhibition of ISG mRNA translation. This work describes a new and unexpected level of regulation for interferon stimulated gene expression and presents the first mechanism of action for an sfRNA as a molecular sponge of anti-viral effectors in human cells.
Directory of Open Access Journals (Sweden)
Aurino Lima Ferreira
2010-01-01
Full Text Available O presente artigo versa sobre as contribuições de Henri Wallon à relação cognição e afetividade na educação. Situa e define os complexos afetivos e cognitivos na teoria waloniana e destaca a noção de pessoa engajada como síntese fundamental para o entendimento da relação entre afetividade e cognição no campo educacional. Busca ainda apontar a importância da visão dialética e humanista da pessoa completa de Wallon para as práticas educacionais e retoma a ideia de "circularidade fundamental" de Francisco Varela para atualizar a visão de Wallon sobre a não separatividade entre homem e mundo.This paper focuses on the contributions from Henri Wallon about the relationship between cognition and affectivity in the education. It also defines the complex interdependency between affective and cognitive dimensions of such theory and emphasizes the notion of engaged person as a fundamental synthesis to understanding the relationship between affectivity and cognition in the educational field. This article also highlights the importance of dialectical and humanist view of integral person for educational practices and it incorporates the idea of "fundamental circularity" of Francisco Varela aiming to updating the view of Wallon about non-separateness between human beings and world.
Marine04 marine radiocarbon age calibration, 0-26 cal kyr BP
Hughen, Konrad A.; Baillie, Mike G.L.; Bard, Edouard; Beck, J. Warren; Bertrand, Chanda J.H.; Blackwell, Paul G.; Buck, Caitlin E.; Burr, George S.; Cutler, Kirsten B.; Damon, Paul E.; Edwards, Richard L.; Fairbanks, Richard G.; Friedrich, Michael; Guilderson, Thomas P.; Kromer, Bernd; McCormac, Gerry; Manning, Sturt; Bronk Ramsey, Christopher; Reimer, Paula J.; Reimer, Ron W.; Remmele, Sabine; Southon, John R.; Stuiver, Minze; Talamo, Sahra; Taylor, F.W.; Plicht, Johannes van der; Weyhenmeyer, Constanze E.
2004-01-01
New radiocarbon calibration curves, IntCal04 and Marine04, have been constructed and internationally ratified to replace the terrestrial and marine components of IntCal98. The new calibration data sets extend an additional 2000 yr, from 0–26 cal kyr BP (Before Present, 0 cal BP = AD 1950), and
An Inventory Controlled Supply Chain Model Based on Improved BP Neural Network
Directory of Open Access Journals (Sweden)
Wei He
2013-01-01
Full Text Available Inventory control is a key factor for reducing supply chain cost and increasing customer satisfaction. However, prediction of inventory level is a challenging task for managers. As one of the widely used techniques for inventory control, standard BP neural network has such problems as low convergence rate and poor prediction accuracy. Aiming at these problems, a new fast convergent BP neural network model for predicting inventory level is developed in this paper. By adding an error offset, this paper deduces the new chain propagation rule and the new weight formula. This paper also applies the improved BP neural network model to predict the inventory level of an automotive parts company. The results show that the improved algorithm not only significantly exceeds the standard algorithm but also outperforms some other improved BP algorithms both on convergence rate and prediction accuracy.
The prenyl-binding protein PrBP/δ: a chaperone participating in intracellular trafficking.
Zhang, Houbin; Constantine, Ryan; Frederick, Jeanne M; Baehr, Wolfgang
2012-12-15
Expressed ubiquitously, PrBP/δ functions as chaperone/co-factor in the transport of a subset of prenylated proteins. PrBP/δ features an immunoglobulin-like β-sandwich fold for lipid binding, and interacts with diverse partners. PrBP/δ binds both C-terminal C15 and C20 prenyl side chains of phototransduction polypeptides and small GTP-binding (G) proteins of the Ras superfamily. PrBP/δ also interacts with the small GTPases, ARL2 and ARL3, which act as release factors (GDFs) for prenylated cargo. Targeted deletion of the mouse Pde6d gene encoding PrBP/δ resulted in impeded trafficking to the outer segments of GRK1 and cone PDE6 which are predicted to be farnesylated and geranylgeranylated, respectively. Rod and cone transducin trafficking was largely unaffected. These trafficking defects produce progressive cone-rod dystrophy in the Pde6d(-/-) mouse. Copyright © 2012 Elsevier Ltd. All rights reserved.
[Segmentation of whole body bone SPECT image based on BP neural network].
Zhu, Chunmei; Tian, Lianfang; Chen, Ping; He, Yuanlie; Wang, Lifei; Ye, Guangchun; Mao, Zongyuan
2007-10-01
In this paper, BP neural network is used to segment whole body bone SPECT image so that the lesion area can be recognized automatically. For the uncertain characteristics of SPECT images, it is hard to achieve good segmentation result if only the BP neural network is employed. Therefore, the segmentation process is divided into three steps: first, the optimal gray threshold segmentation method is employed for preprocessing, then BP neural network is used to roughly identify the lesions, and finally template match method and symmetry-removing program are adopted to delete the wrongly recognized areas.
Spearing, M K; Post, R M; Leverich, G S; Brandt, D; Nolen, W
1997-12-05
The Clinical Global Impressions Scale (CGI) was modified specifically for use in assessing global illness severity and change in patients with bipolar disorder. Criticisms of the original CGI were addressed by correcting inconsistencies in scaling, identifying time frames for comparison, clarifying definitions of illness severity and change, and separating out assessment of treatment side effects from illness improvement during treatment. A Detailed User's Guide was developed to train clinicians in the use of the new CGI-Bipolar Version (CGI-BP) for rating severity of manic and depressive episodes and the degree of change from the immediately preceding phase and from the worst phase of illness. The revised scale and manual provide a focused set of instructions to facilitate the reliability of these ratings of mania, depression, and overall bipolar illness during treatment of an acute episode or in longer-term illness prophylaxis. Interrater reliability of the scale was demonstrated in preliminary analyses. Thus, the modified CGI-BP is anticipated to be more useful than the original CGI in studies of bipolar disorder.
Never say Never. About the Restoration of Henry van de Velde’s Booktower
Directory of Open Access Journals (Sweden)
Sylvia van Peteghem
2006-08-01
Full Text Available The role of the central library within the university of Ghent (27.000 students is fourfold: it is the centre of the library’s network and its reorganisation, trying to get the current number (> 300 of libraries down. It is the digital library in all its aspects, it is the repository library for cultural heritage and “passive” collections and it offers a working place in its wonderful book tower of Henry van de Velde. The story of the book tower starts in the 1930s when Henry van de Velde was asked to build a University Library and offices for the department of Art history. His tower-idea was not exactly what the chief librarian had in mind, so he had to (network hard to get the building he wanted. It was finished on the verge of the second world war. The concrete building has a height of 64 meter, has 24 floors and a “belvedere” and houses almost 3 million books in closed racks. The university did not neglect the tower during all these years, but was not always aware of the historical value and often choose the cheapest way for building matters. A couple of years ago a private person bought the Van de Velde archive of the book tower (which was in private hands, got fascinated with the building, got angry because of lack of care and networked (maybe as hard as Van de Velde once did to get it built to get it restored. The board of directors of the university said yes to the restoration (estimated on 41 million Euro in September 2005.
Design of a gap tunable flux qubit with FastHenry
Akhtar, Naheed; Zheng, Yarui; Nazir, Mudassar; Wu, Yulin; Deng, Hui; Zheng, Dongning; Zhu, Xiaobo
2016-12-01
In the preparations of superconducting qubits, circuit design is a vital process because the parameters and layout of the circuit not only determine the way we address the qubits, but also strongly affect the qubit coherence properties. One of the most important circuit parameters, which needs to be carefully designed, is the mutual inductance among different parts of a superconducting circuit. In this paper we demonstrate how to design a gap-tunable flux qubit by layout design and inductance extraction using a fast field solver FastHenry. The energy spectrum of the gap-tunable flux qubit shows that the measured parameters are close to the design values. Project supported by the National Natural Science Foundation of China (Grant Nos. 11374344, 11404386, and 91321208), the National Basic Research Program of China (Grant No. 2014CB921401), and the Strategic Priority Research Program of the Chinese Academy of Sciences (Grant No. XDB07010300).
Directory of Open Access Journals (Sweden)
Tao Qin
Full Text Available Dendritic cells (DCs play a vital role in the regulation of immune-mediated inflammatory diseases. Thus, DCs have been regarded as a major target for the development of immunomodulators. However, oxidative stress could disturb inflammatory regulation in DCs. Here, we examined the effect of bursopentine (BP5, a novel pentapeptide isolated from chicken bursa of fabricius, on the protection of DCs against oxidative stress for immunosuppression. BP5 showed potent protective effects against the lipopolysaccharide (LPS-induced oxidative stress in DCs, including nitric oxide, reactive oxygen species and lipid peroxidation. Furthermore, BP5 elevated the level of cellular reductive status through increasing the reduced glutathione (GSH and the GSH/GSSG ratio. Concomitant with these, the activities of several antioxidative redox enzymes, including glutathione peroxidase (GPx, catalase (CAT and superoxide dismutase (SOD, were obviously enhanced. BP5 also suppressed submucosal DC maturation in the LPS-stimulated intestinal epithelial cells (ECs/DCs coculture system. Finally, we found that heme oxygenase 1 (HO-1 was remarkably upregulated by BP5 in the LPS-induced DCs, and played an important role in the suppression of oxidative stress and DC maturation. These results suggested that BP5 could protect the LPS-activated DCs against oxidative stress and have potential applications in DC-related inflammatory responses.
Sünker, Heinz
2014-01-01
Henri Lefebvre (1901-91), philosopher and sociologist, is, together with Theodor W. Adorno, Max Horkheimer, Walter Benjamin and Ernst Bloch, one of the most relevant representatives of the first generation in Western Marxism. His engagement with Marxism led him to analyse everyday life in post-war France in order to decipher the possibilities of,…
Bzoura, Elie; Flahaut, Jean
2004-01-01
Charles-Henri Fialon stopped his pharmaceutical activities in 1892 and he devoted his time to artistic and historic works. He achieved an important collection of pharmaceutical pots and objects which he gave to the school of Pharmacy of Paris. These gifts were collected in a room named "Musée Fialon ". This museum was enlarged twice and presently is in the "Guillaume Valette" gallery. His content is described in this paper.
Energy Technology Data Exchange (ETDEWEB)
Delbone, Edval; Matos, Jose Alberto da S.; Grassi, Marco A; Oliveira, Robinson C; Sertori, Sergio R [Eletricidade de Sao Paulo SA, SP (Brazil); Duarte, F I; Pires, Nilo Ramos; Yamagushi, Luiz Massao [Asea Brown Boveri (ABB) (Brazil)
1996-12-31
The need for the substitution of several the generating equipment of Henry Borden hydroelectric power plant due to the end of their service life, in addition to the difficult economic situation and specific characteristics of the unit, leaded ELETROPAULO company to decide for the power improvement of some equipment. This work presents this experience giving special emphasis to the procedure adopted and results obtained 2 tabs.
Henry Beecher's Contributions to the Ethics of Clinical Research.
Veatch, Robert M
2016-01-01
In the 1950s and '60s, Henry Beecher pioneered the discussion of the ethics of clinical research, leading eventually to the publication of the famous New England Journal of Medicine article summarizing 22 research studies that Beecher suggests were unethical. Those studies generally showed a pattern of posing serious risks to subjects without anticipated proportional benefit. Beecher famously claimed that the problem was not that researchers were malicious or evil; rather, he claimed the problem was they manifested thoughtlessness or carelessness. He called for more rigorous self-scrutiny rather than public review.This article argues that Beecher's reliance on conscientious investigators is problematic. In particular, it focuses on benefits and harms to the exclusion of other moral criteria. However, both research subjects and public regulators are also concerned about autonomy and the consent requirement, confidentiality, and fairness in subject selection and research design. The movement in the 1970s toward more public scrutiny was critical, even though Beecher was right in holding that it was not "vicious disregard for subject welfare" that explained unethical protocols.
Fordlândia e Belterra: as cidades de Henry Ford na Amazônia
Duarte Jr., Antonio Marcos; UERJ & Ibmec/RJ
2015-01-01
Ao final de 1945, a Ford Motor Company apresenta sérios problemas de gestão. Nesse contexto, Henry Ford II precisa decidir o que fazer com Fordlândia e Belterra, as duas problemáticas cidades construídas por seu avô na Amazônia brasileira.O caso foi elaborado para utilização em disciplinas na área de finanças corporativas, abordando temas relacionados a análise econômica e de riscos presentes em projetos de investimento. Pode ser interessante também em diferentes disciplinas que tratem de te...
BP erioperatsioon naftalekke peatamiseks nurjus / Jürgen Tamme
Tamme, Jürgen
2010-01-01
Naftakompanii BP katse peatada Mehhiko lahe naftaleke ebaõnnestus, nüüd püütakse reostust peatada uue toru paigaldamise abil. USA president Barack Obama avaldas taas rahulolematust naftakompaniiga. Kaart
Directory of Open Access Journals (Sweden)
Erika Cazzonatto Zerwes
2016-08-01
Full Text Available This article aims to grasp some aspects of the notion of humanism in photography and its closeness to the political culture and the visual culture in the period, through the specific experiences of George Rodger and Henri Cartier-Bresson, two photographers who were first-hand witnesses and provided accounts of horror in the Nazi concentration camps at the end of World War II. George Rodger photographed the Bergen-Belsen camp as soon as it was liberated by the British troops. Henri Cartier-Bresson was there with a film crew recording the deported masses newly freed from the Nazi concentration and extermination camps. These experiences came to have profound impact on the biography and work of both of them. In the two cases, there is a notion of humanism linked to World War II events, which is observed in photography and photographic representation, and it has a significant consequence for the contemporary visual culture. Keywords: Visual Culture; Political Culture; War Photography; Photojournalism; Concentration Camps. Original title: O humano e o desumano: cultura visual, cultura política e as imagens feitas por George Rodger e Henri Cartier-Bresson nos campos de concentração nazistas.
EST Table: BP117517 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP117517 ce--0464 10/09/28 63 %/173 aa ref|XP_002092422.1| GE14184 [Drosophila yakuba] gb|EDW92134.1| GE14...184 [Drosophila yakuba] 10/08/28 63 %/173 aa FBpp0259194|DyakGE14184-PA 10/08/28 35 %
Directory of Open Access Journals (Sweden)
Hua Bai
Full Text Available Mutations of the insulin/IGF signaling (IIS pathway extend Drosophila lifespan. Based on genetic epistasis analyses, this longevity assurance is attributed to downstream effects of the FOXO transcription factor. However, as reported FOXO accounts for only a portion of the observed longevity benefit, suggesting there are additional outputs of IIS to mediate aging. One candidate is target of rapamycin complex 1 (TORC1. Reduced TORC1 activity is reported to slow aging, whereas reduced IIS is reported to repress TORC1 activity. The eukaryotic translation initiation factor 4E binding protein (4E-BP is repressed by TORC1, and activated 4E-BP is reported to increase Drosophila lifespan. Here we use genetic epistasis analyses to test whether longevity assurance mutants of chico, the Drosophila insulin receptor substrate homolog, require Drosophila d4eBP to slow aging. In chico heterozygotes, which are robustly long-lived, d4eBP is required but not sufficient to slow aging. Remarkably, d4eBP is not required or sufficient for chico homozygotes to extend longevity. Likewise, chico heterozygote females partially require d4eBP to preserve age-dependent locomotion, and both chico genotypes require d4eBP to improve stress-resistance. Reproduction and most measures of growth affected by either chico genotype are always independent of d4eBP. In females, chico heterozygotes paradoxically produce more rather than less phosphorylated 4E-BP (p4E-BP. Altered IRS function within the IIS pathway of Drosophila appears to have partial, conditional capacity to regulate aging through an unconventional interaction with 4E-BP.
MCM-BP regulates unloading of the MCM2–7 helicase in late S phase
Nishiyama, Atsuya; Frappier, Lori; Méchali, Marcel
2011-01-01
Origins of DNA replication are licensed by recruiting MCM2–7 to assemble the prereplicative complex (pre-RC). How MCM2–7 is inactivated or removed from chromatin at the end of S phase is still unclear. Here, we show that MCM-BP can disassemble the MCM2–7 complex and might function as an unloader of MCM2–7 from chromatin. In Xenopus egg extracts, MCM-BP exists in a stable complex with MCM7, but is not associated with the MCM2–7 hexameric complex. MCM-BP accumulates in nuclei in late S phase, well after the loading of MCM2–7 onto chromatin. MCM-BP immunodepletion in Xenopus egg extracts inhibits replication-dependent MCM dissociation without affecting pre-RC formation and DNA replication. When excess MCM-BP is incubated with Xenopus egg extracts or immunopurified MCM2–7, it binds to MCM proteins and promotes disassembly of the MCM2–7 complex. Recombinant MCM-BP also releases MCM2–7 from isolated late-S-phase chromatin, but this activity is abolished when DNA replication is blocked. MCM-BP silencing in human cells also delays MCM dissociation in late S phase. We propose that MCM-BP plays a key role in the mechanism by which pre-RC is cleared from replicated DNA in vertebrate cells. PMID:21196493
Oxygen-dependent acetylation and dimerization of the corepressor CtBP2 in neural stem cells
International Nuclear Information System (INIS)
Karaca, Esra; Lewicki, Jakub; Hermanson, Ola
2015-01-01
The transcriptional corepressor CtBP2 is essential for proper development of the nervous system. The factor exerts its repression by interacting in complexes with chromatin-modifying factors such as histone deacetylases (HDAC) 1/2 and the histone demethylase LSD1/KDM1. Notably, the histone acetyl transferase p300 acetylates CtBP2 and this is an important regulatory event of the activity and subcellular localization of the protein. We recently demonstrated an essential role for CtBPs as sensors of microenvironmental oxygen levels influencing the differentiation potential of neural stem cells (NSCs), but it is not known whether oxygen levels influence the acetylation levels of CtBP factors. Here we show by using proximity ligation assay (PLA) that CtBP2 acetylation levels increased significantly in undifferentiated, proliferating NSCs under hypoxic conditions. CtBP2 interacted with the class III HDAC Sirt1 but this interaction was unaltered in hypoxic conditions, and treatment with the Sirt1 inhibitor Ex527 did not result in any significant change in total CtBP2 acetylation levels. Instead, we revealed a significant decrease in PLA signal representing CtBP2 dimerization in NSCs under hypoxic conditions, negatively correlating with the acetylation levels. Our results suggest that microenvironmental oxygen levels influence the dimerization and acetylation levels, and thereby the activity, of CtBP2 in proliferating NSCs
Oxygen-dependent acetylation and dimerization of the corepressor CtBP2 in neural stem cells
Energy Technology Data Exchange (ETDEWEB)
Karaca, Esra; Lewicki, Jakub; Hermanson, Ola, E-mail: Ola.Hermanson@ki.se
2015-03-01
The transcriptional corepressor CtBP2 is essential for proper development of the nervous system. The factor exerts its repression by interacting in complexes with chromatin-modifying factors such as histone deacetylases (HDAC) 1/2 and the histone demethylase LSD1/KDM1. Notably, the histone acetyl transferase p300 acetylates CtBP2 and this is an important regulatory event of the activity and subcellular localization of the protein. We recently demonstrated an essential role for CtBPs as sensors of microenvironmental oxygen levels influencing the differentiation potential of neural stem cells (NSCs), but it is not known whether oxygen levels influence the acetylation levels of CtBP factors. Here we show by using proximity ligation assay (PLA) that CtBP2 acetylation levels increased significantly in undifferentiated, proliferating NSCs under hypoxic conditions. CtBP2 interacted with the class III HDAC Sirt1 but this interaction was unaltered in hypoxic conditions, and treatment with the Sirt1 inhibitor Ex527 did not result in any significant change in total CtBP2 acetylation levels. Instead, we revealed a significant decrease in PLA signal representing CtBP2 dimerization in NSCs under hypoxic conditions, negatively correlating with the acetylation levels. Our results suggest that microenvironmental oxygen levels influence the dimerization and acetylation levels, and thereby the activity, of CtBP2 in proliferating NSCs.
A central role for R7bp in the regulation of itch sensation.
Pandey, Mritunjay; Zhang, Jian-Hua; Mishra, Santosh K; Adikaram, Poorni R; Harris, Benjamin; Kahler, John F; Loshakov, Anna; Sholevar, Roxanne; Genis, Allison; Kittock, Claire; Kabat, Juraj; Ganesan, Sundar; Neubig, Richard R; Hoon, Mark A; Simonds, William F
2017-05-01
Itch is a protective sensation producing a desire to scratch. Pathologic itch can be a chronic symptom of illnesses such as uremia, cholestatic liver disease, neuropathies and dermatitis, however current therapeutic options are limited. Many types of cell surface receptors, including those present on cells in the skin, on sensory neurons and on neurons in the spinal cord, have been implicated in itch signaling. The role of G protein signaling in the regulation of pruriception is poorly understood. We identify here 2 G protein signaling components whose mutation impairs itch sensation. R7bp (a.k.a. Rgs7bp) is a palmitoylated membrane anchoring protein expressed in neurons that facilitates Gαi/o -directed GTPase activating protein activity mediated by the Gβ5/R7-RGS complex. Knockout of R7bp diminishes scratching responses to multiple cutaneously applied and intrathecally-administered pruritogens in mice. Knock-in to mice of a GTPase activating protein-insensitive mutant of Gαo (Gnao1 G184S/+) produces a similar pruriceptive phenotype. The pruriceptive defect in R7bp knockout mice was rescued in double knockout mice also lacking Oprk1, encoding the G protein-coupled kappa-opioid receptor whose activation is known to inhibit itch sensation. In a model of atopic dermatitis (eczema), R7bp knockout mice showed diminished scratching behavior and enhanced sensitivity to kappa opioid agonists. Taken together, our results indicate that R7bp is a key regulator of itch sensation and suggest the potential targeting of R7bp-dependent GTPase activating protein activity as a novel therapeutic strategy for pathological itch.
The Paradox of Being a Wounded Healer: Henri J.M. Nouwen’s Contribution to Pastoral Theology
Directory of Open Access Journals (Sweden)
S. Philip Nolte
2010-11-01
Full Text Available This article is the first in a series of two dealing with Henri Nouwen’s contribution to pastoral care. The present article focuses on the impact of cognitive dissonance and the role it plays in pastors becoming constrained in their ministry. The point of departure is that during the past two decades, pastors have been subjected to profound changes. While pastors view their involvement with people in the social and faith communities in which they live and work as guiding people towards a life of wholeness and integrity, they themselves, because of their own inner woundedness, struggle to live a life of wholeness. This article investigates how pastors can act congruently and with integrity in a world that has been profoundly changed by a shift from a modern to a postmodern paradigm. This reflection explores the ancient Greek mythological origins of the concept ‘wounded healer’. It also shows that, in its utilisation by the Swiss psychiatrist Carl Jung, the concept became a metaphor. This insight leads to a discussion of how Henri Nouwen applied the significance of the metaphor to pastoral ministry. The discussion takes on the form of certain relevant biographical side notes on Nouwen’s contribution to pastoral theology. The article concludes with an exposition of Nouwens’s use of the metaphor in his book, The wounded healer: Ministry in contemporary society.
CacyBP/SIP binds ERK1/2 and affects transcriptional activity of Elk-1
International Nuclear Information System (INIS)
Kilanczyk, Ewa; Filipek, Slawomir; Jastrzebska, Beata; Filipek, Anna
2009-01-01
In this work we showed for the first time that mouse CacyBP/SIP interacts with extracellular signal regulated kinases 1 and 2 (ERK1/2). We also established that a calcium binding protein, S100A6, competes for this interaction. Moreover, the E217K mutant of CacyBP/SIP does not bind significantly to ERK1/2 although it retains the ability to interact with S100A6. Molecular modeling shows that the E217K mutation in the 189-219 CacyBP/SIP fragment markedly changes its electrostatic potential, suggesting that the binding with ERK1/2 might have an electrostatic character. We also demonstrate that CacyBP/SIP-ERK1/2 interaction inhibits phosphorylation of the Elk-1 transcription factor in vitro and in the nuclear fraction of NB2a cells. Altogether, our data suggest that the binding of CacyBP/SIP with ERK1/2 might regulate Elk-1 phosphorylation/transcriptional activity and that S100A6 might further modulate this effect via Ca 2+ -dependent interaction with CacyBP/SIP and competition with ERK1/2.
BP and sustainable development and biodiversity in Azerbaijan
International Nuclear Information System (INIS)
Grant, Vidrine; Askerov, Faig
2002-01-01
Full text: BP takes its commitment to the environmental extremely seriously. BP believes it is essential to ensure that our operations and activities comply with the environmental standards in our PSAs and with the laws of Azerbaijan. To achieve this we have developed Environmental Operating Procedures. These procedures are currently being audited and we expect to receive ISO 14001 certification for all of our operations. Together with our Emergency Response and Oil Spill Response Plans we are able to manage our operations to ensure minimum impact and regulatory compliance. Additional, AIOC contributed to opening the Caspian Environmental Laboratory in 1999 to provide on a commercial basis, environmental services in Azerbaijan of an internationally recognized standard. We have conducted many other activities to promote biodiversity. In absence of the appropriate infrastructure we have built a waste management site at Serenja where we are currently disposing of synthetic based muds from our offshore drilling operations. We have also developed and implemented a Research and Monitoring Program in co-operation with representatives from SOCAR, Academy of Sciences, Azgipromorneftegaz and State Committee of Ecology. We have conducted Seals mortality investigation, Birds monitoring, Fish monitoring, Offshore surveys studying macrobenthos, water chemistry, sediments, groundwater monitoring, re-vegetation, etc. In developing our overall strategy BP has set some long term environmental aspirations or expectations: stop the use of halocarbons; to reduce Green House Gases by 10% by 20 lOin comparison with baseline data for 1990; stop venting and flaring; stop discharges to water of synthetic and oil based muds. BP recognizes that this is a goal. It is something we commit to and aspire to achieve and something we are wise enough to realize cannot be achieved overnight. None-the-less, it is something we constantly work towards. We also realize that this goal cannot be achieved in
TopBP1 is required at mitosis to reduce transmission of DNA damage to G1 daughter cells
DEFF Research Database (Denmark)
Pedersen, Rune Troelsgaard; Kruse, Thomas; Nilsson, Jakob
2015-01-01
mitotic entry. In early mitosis, TopBP1 marks sites of and promotes unscheduled DNA synthesis. Moreover, TopBP1 is required for focus formation of the structure-selective nuclease and scaffold protein SLX4 in mitosis. Persistent TopBP1 foci transition into 53BP1 nuclear bodies (NBs) in G1 and precise...... temporal depletion of TopBP1 just before mitotic entry induced formation of 53BP1 NBs in the next cell cycle, showing that TopBP1 acts to reduce transmission of DNA damage to G1 daughter cells. Based on these results, we propose that TopBP1 maintains genome integrity in mitosis by controlling chromatin...
BP reactivity to public speaking in stage 1 hypertension: influence of different task scenarios.
Palatini, Paolo; Bratti, Paolo; Palomba, Daniela; Bonso, Elisa; Saladini, Francesca; Benetti, Elisabetta; Casiglia, Edoardo
2011-10-01
To investigate the blood pressure (BP) reaction to public speaking performed according to different emotionally distressing scenarios in stage 1 hypertension. METHODS. We assessed 64 hypertensive and 30 normotensive subjects. They performed three speech tasks with neutral, anger and anxiety scenarios. BP was assessed with the Finometer beat-to-beat non-invasive recording system throughout the test procedure. For all types of speech, the systolic BP response was greater in the hypertensive than the normotensive subjects (all p public speaking is increased in stage 1 hypertension. A speech with anxiety or anger scenario elicits a greater diastolic BP reaction than tasks with neutral content.
EST Table: BP124521 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP124521 epV32477 10/09/28 59 %/164 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 55 %/163 aa FBpp0160847|DmojGI11630-PA 10/08/28 n.h 10/09/1
EST Table: BP123885 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP123885 epV31590 10/09/28 57 %/174 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 55 %/163 aa FBpp0160847|DmojGI11630-PA 10/08/28 n.h 10/09/1
EST Table: BP125106 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP125106 fbpv0387 10/09/28 58 %/165 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 56 %/165 aa FBpp0212871|DsimGD14469-PA 10/08/28 n.h 10/09/1
EST Table: BP125521 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP125521 fbpv0944 10/09/28 59 %/165 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 56 %/164 aa FBpp0160847|DmojGI11630-PA 10/08/28 n.h 10/09/1
EST Table: BP125005 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP125005 fbpv0197 10/09/28 58 %/185 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 58 %/173 aa FBpp0160847|DmojGI11630-PA 10/08/28 n.h 10/09/1
EST Table: BP121749 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP121749 ceN-5256 10/09/28 100 %/172 aa ref|NP_001036831.1| saposin-related [Bombyx...|GB16561-PA 10/09/10 44 %/178 aa gi|91077504|ref|XP_966852.1| PREDICTED: similar to saposin isoform 1 [Tribolium castaneum] FS791050 ceN- ...
EST Table: BP121763 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP121763 ceN-5273 10/09/28 99 %/184 aa ref|NP_001036831.1| saposin-related [Bombyx ...GB16561-PA 10/09/10 43 %/192 aa gi|91077504|ref|XP_966852.1| PREDICTED: similar to saposin isoform 1 [Tribolium castaneum] FS791050 ceN- ...
Magnetoresistance Effect in NiFe/BP/NiFe Vertical Spin Valve Devices
Directory of Open Access Journals (Sweden)
Leilei Xu
2017-01-01
Full Text Available Two-dimensional (2D layered materials such as graphene and transition metal dichalcogenides are emerging candidates for spintronic applications. Here, we report magnetoresistance (MR properties of a black phosphorus (BP spin valve devices consisting of thin BP flakes contacted by NiFe ferromagnetic (FM electrodes. The spin valve effect has been observed from room temperature to 4 K, with MR magnitudes of 0.57% at 4 K and 0.23% at 300 K. In addition, the spin valve resistance is found to decrease monotonically as temperature is decreased, indicating that the BP thin film works as a conductive interlayer between the NiFe electrodes.
Kennedy, G.; Bolat, Elvira
2017-01-01
Social media has created different dimension of consumers for luxury products, specifically the aspirational consumer who wishes to own a product, but for economic reasons cannot. In other words aspirational consumers use luxury brands to create value for themselves using social media to conspicuously consume without purchase. Aspirational consumers are mostly found among HENRYs (high earners, not rich yet). Studies around conspicuous consumption of luxury products as a result of digital tech...
Banque centrale, taux de l'escompte et politique monétaire chez Henry Thornton (1760-1815).
Mésonnier, J-S.
2002-01-01
Henry Thornton (1760-1815), whose major work - An Enquiry into the Nature and Effects of the Paper Credit of Great Britain - is celebrating its bicentennary in 2002, is considered today to be one of the most prominent classical monetary economist, in particular with regard to its seminal contribution to the theory of the lender of last resort. However, Thornton's original views about the rate of interest on bank credit have barely been commented so far. In this paper, we endeavour to link the...
IntCal04 terrestrial radiocarbon age calibration, 0-26 cal kyr BP
Reimer, Paula J.; Baillie, Mike G.L.; Bard, Edouard; Bayliss, Alex; Beck, J. Warren; Bertrand, Chanda J.H.; Blackwell, Paul G.; Buck, Caitlin E.; Burr, George S.; Cutler, Kirsten B.; Damon, Paul E.; Edwards, R. Lawrence; Fairbanks, Richard G.; Friedrich, Michael; Guilderson, Thomas P.; Hogg, Alan G.; Hughen, Konrad A.; Kromer, Bernd; McCormac, Gerry; Manning, Sturt; Bronk Ramsey, Christopher; Reimer, Ron W.; Remmele, Sabine; Southon, John R.; Stuiver, Minze; Talamo, Sahra; Taylor, F.W.; Plicht, Johannes van der; Weyhenmeyer, Constanze E.
2004-01-01
A new calibration curve for the conversion of radiocarbon ages to calibrated (cal) ages has been constructed and internationally ratified to replace IntCal98, which extended from 0–24 cal kyr BP (Before Present, 0 cal BP = AD 1950). The new calibration data set for terrestrial samples extends from
BP1, an Isoform of DLX4 Homeoprotein, Negatively Regulates BRCA1 in Sporadic Breast Cancer
Kluk, Brian J.; Fu, Yebo; Formolo, Trina A.; Zhang, Lei; Hindle, Anne K.; Man, Yan-gao; Siegel, Robert S.; Berg, Patricia E.; Deng, Chuxia; McCaffrey, Timothy A.; Fu, Sidney W.
2010-01-01
Introduction: Several lines of evidence point to an important role for BP1, an isoform of DLX4 homeobox gene, in breast carcinogenesis and progression. BRCA1 is a well-known player in the etiology of breast cancer. While familial breast cancer is often marked by BRCA1 mutation and subsequent loss of heterozygosity, sporadic breast cancers exhibit reduced expression of wild type BRCA1, and loss of BRCA1 expression may result in tumor development and progression. Methods: The Cister algorithm and Genomatix program were used to identify potential BP1 binding sites in BRCA1 gene. Real-time PCR, Western blot and immunohistochemistry analysis were performed to verify the expression of BRCA1 and BP1 in cell lines and breast cancer tissues. Double-stranded siRNA transfection was carried out for silencing BP1 expression. ChIP and EMSA were used to confirm that BP1 specifically binds to BRCA1. Results: A putative BP1 binding site was identified in the first intron of BRCA1, which was confirmed by chromatin immunoprecipiation and electrophoresis mobility shift assay. BP1 and BRCA1 expression were inversely correlated in breast cancer cell lines and tissues, suggesting that BP1 may suppress BRCA1 transcription through consensus sequence binding. Conclusions: BP1 homeoprotein represses BRCA1 expression through direct binding to its first intron, which is consistent with a previous study which identified a novel transcriptional repressor element located more than 500 base pairs into the first intron of BRCA1, suggesting that the first intron plays an important role in the negative regulation of BRCA1. Although further functional studies are necessary to confirm its repressor activity towards BRCA1, the elucidation of the role of BP1 in breast tumorigenesis holds great promise in establishing BP1 as a novel target for drug therapy. PMID:20877436
Directory of Open Access Journals (Sweden)
Doris Moreno
2013-12-01
Full Text Available Se aborda en este artículo la vida y pensamiento de Henry Charles Lea en relación a sus estudios sobre la historia de la Inquisición española. Se esboza brevemente la red de colaboradores que Lea estableció en toda Latinoamérica así como su perfil político e intelectual, subrayando su importancia para la escritura de la obra The Inquisition in the Spanish Dependencies (1908. Finalmente, se plantean los motivos que llevaron a estos intelectuales a colaborar intensamente con el historiador norteamericano en el marco de los procesos de construcción de identidades sociales y políticas en Latinoamérica en la segunda mitad del siglo XIX. Se toma como eje conductor de este planteamiento la correspondencia de Juan María Gutiérrez con Henry Charles Lea.
EST Table: BP182610 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP182610 NRPG0829 10/09/28 35 %/122 aa ref|XP_967620.1| PREDICTED: similar to anopheles stephen...nl|Amel|GB19565-PA 10/09/10 35 %/122 aa gi|91093471|ref|XP_967620.1| PREDICTED: similar to anopheles stephensi ubiquitin, putative [Tribolium castaneum] FS914988 NRPG ...
Ion-beam-induced reactions in metal-thin-film-/BP system
International Nuclear Information System (INIS)
Kobayashi, N.; Kumashiro, Y.; Revesz, P.; Mayer, J.W.
1989-01-01
Ion-beam-induced reactions in Ni thin films on BP(100) have been investigated and compared with the results of the thermal reaction. The full reaction of Ni layer with BP induced by energetic heavy ion bombardments (600 keV Xe) was observed at 200degC and the formation of the crystalline phase corresponding to a composition of Ni 4 BP was observed. Amorphous layer with the same composition was formed by the bombardments below RT. For thermally annealed samples the reaction of the Ni layer on BP started at temperatures between 350degC and 400degC and full reaction was observed at 450degC. Metal-rich ternary phase or mixed binary phase is thought to be the first crystalline phase formed both in the ion-beam-induced and in the thermally induced reactions. The crystalline phase has the same composition and X-ray diffraction pattern both for ion-beam-induced and thermal reactions. Linear dependence of the reacted thickness on the ion fluence was also observed. The authors would like to express their sincere gratitude to Jian Li and Shi-Qing Wang for X-ray diffraction measurements at Cornell University. One of the authors (N.K.) acknowledge the Agency of Science and Technology of Japan for the financial support of his stay at Cornell. We also acknowledge Dr. H. Tanoue at ETL for his help in ion bombardment experiments. (author)
Mutant p53 perturbs DNA replication checkpoint control through TopBP1 and Treslin.
Liu, Kang; Lin, Fang-Tsyr; Graves, Joshua D; Lee, Yu-Ju; Lin, Weei-Chin
2017-05-09
Accumulating evidence supports the gain-of-function of mutant forms of p53 (mutp53s). However, whether mutp53 directly perturbs the DNA replication checkpoint remains unclear. Previously, we have demonstrated that TopBP1 forms a complex with mutp53s and mediates their gain-of-function through NF-Y and p63/p73. Akt phosphorylates TopBP1 and induces its oligomerization, which inhibits its ATR-activating function. Here we show that various contact and conformational mutp53s bypass Akt to induce TopBP1 oligomerization and attenuate ATR checkpoint response during replication stress. The effect on ATR response caused by mutp53 can be exploited in a synthetic lethality strategy, as depletion of another ATR activator, DNA2, in mutp53-R273H-expressing cancer cells renders cells hypersensitive to cisplatin. Expression of mutp53-R273H also makes cancer cells more sensitive to DNA2 depletion or DNA2 inhibitors. In addition to ATR-activating function during replication stress, TopBP1 interacts with Treslin in a Cdk-dependent manner to initiate DNA replication during normal growth. We find that mutp53 also interferes with TopBP1 replication function. Several contact, but not conformational, mutp53s enhance the interaction between TopBP1 and Treslin and promote DNA replication despite the presence of a Cdk2 inhibitor. Together, these data uncover two distinct mechanisms by which mutp53 enhances DNA replication: ( i ) Both contact and conformational mutp53s can bind TopBP1 and attenuate the checkpoint response to replication stress, and ( ii ) during normal growth, contact (but not conformational) mutp53s can override the Cdk2 requirement to promote replication by facilitating the TopBP1/Treslin interaction.
Henri Cartier-Bresson / Walker Evans : Photographier l’Amérique (1929-1947
Directory of Open Access Journals (Sweden)
François Brunet
2009-08-01
Full Text Available Dans un mot adressé en 2001 à Peter Galassi, conservateur de la photographie au MOMA, Henri Cartier-Bresson, alors âgé de quatre-vingt-treize ans, écrivait plaisamment — mais non pas complaisamment : « If it had not been for the challenge of the work of Walker Evans, I don’t think I would have remained a fotographer » (« sans le défi constitué par le travail de Walker Evans, je ne crois pas que je serais resté fotographe ». Pour fêter le centenaire de Cartier-Bresson, c’est ce défi — plutôt ...
Samuel Hartlib on the death of Descartes: a rediscovered letter to Henry More
Penman, Leigh T. I.
2015-01-01
This paper discloses the content of a previously overlooked epistle by the Anglo-Prussian intelligencer Samuel Hartlib to Henry More concerning the death of René Descartes. After a discussion situating the letter within the sequence of the More–Hartlib correspondence, an analysis of the rhetorical structure of the epistle is offered, followed by a brief assessment of Hartlib's attitude towards Descartes, and the identification of his source concerning the news of the philosopher's death. An account of the transmission of the letter via a nineteenth-century periodical is also provided. The text of Hartlib's letter and an overlooked passage of Hartlib's diary concerning Descartes's death, which draws on the content of the More letter, are presented as appendixes.
Ji, Chang; Boisvert, Susanne M.; Arida, Ann-Marie C.; Day, Shannon E.
2008-01-01
An internal standard method applicable to undergraduate instrumental analysis or environmental chemistry laboratory has been designed and tested to determine the Henry's law constants for a series of alkyl nitriles. In this method, a mixture of the analytes and an internal standard is prepared and used to make a standard solution (organic solvent)…
Cabinet chooses TNK-BP, but doors remain open
2005-01-01
Leedu valitsus alustab Vene-Suurbritannia ühisfirmaga TNK-BP läbirääkimisi Mazeikiu Nafta aktsiaenamuse omandamiseks. Kuid samal ajal on võimalik alustada läbirääkimisi ka teiste võimalike investoritega
Phase 1 remedial investigation report for 200-BP-1 operable unit
International Nuclear Information System (INIS)
1993-09-01
The US Department of Energy (DOE) Hanford Site, in Washington State is organized into numerically designated operational areas including the 100, 200, 300, 400, 600, and 1100 Areas. The US Environmental Protection Agency (EPA), in November 1989 included the 200 Areas of the Hanford Site on the National Priority List (NPL) under the Comprehensive Environmental Response, Compensation and Liability Act of 1980 (CERCLA). Inclusion on the NPL initiated the remedial investigation (RD process for the 200-BP-1 operable unit. These efforts are being addressed through the Hanford Federal Facility Agreement and Consent Order (Ecology et al. 1989) which was negotiated and approved by the DOE, the EPA, and the State of Washington Department of Ecology (Ecology) in May 1989. This agreement, known as the Tri-Party Agreement, governs all CERCLA efforts at Hanford. In March of 1990, the Department of Energy, Richland Operations (DOE-RL) issued a Remedial Investigation/Feasibility Study (RI/FS) work plan (DOE-RL 1990a) for the 200-BP-1 operable unit. The work plan initiated the first phase of site characterization activities associated with the 200-BP-1 operable unit. The purpose of the 200-BP-1 operable unit RI is to gather and develop the necessary information to adequately understand the risks to human health and the environment posed by the site and to support the development and analysis of remedial alternatives during the FS. The RI analysis will, in turn, be used by Tri-Party Agreement signatories to make a risk-management-based selection of remedies for the releases of hazardous substances that have occurred from the 200-BP-1 operable unit
John, Alin; Weir, Matthew R.; Smith, Stephen R.; Hunsicker, Lawrence; Kasiske, Bertram L.; Kusek, John W.; Bostom, Andrew; Ivanova, Anastasia; Levey, Andrew S.; Solomon, Scott; Pesavento, Todd; Weiner, Daniel E.
2014-01-01
The optimal BP level in kidney transplant recipients remains uncertain. This post hoc analysis of the Folic Acid for Vascular Outcome Reduction in Transplantation (FAVORIT) trial cohort assessed associations of BP with a pooled cardiovascular disease (CVD) outcome and with all-cause mortality. In 3474 prevalent kidney transplant patients, mean age was 52±9 years, 63% were men, 76% were white, 20% had a history of CVD, 40% had a history of diabetes mellitus, and the median time since transplant was 4.1 years (25th to 75th percentiles, 1.7–7.4); mean systolic BP was 136±20 mmHg and mean diastolic BP was 79±12 mmHg. There were 497 CVD events and 406 deaths. After adjustment for demographic and transplant characteristics and CVD risk factors, each 20-mmHg increase in baseline systolic BP associated with a 32% increase in subsequent CVD risk (hazard ratio [HR], 1.32; 95% confidence interval [95% CI], 1.19 to 1.46) and a 13% increase in mortality risk (HR, 1.13; 95% CI, 1.01 to 1.27). Similarly, after adjustment, at diastolic BP levels70 mmHg, there was no significant relationship between diastolic BP and outcomes. Higher systolic BP strongly and independently associated with increased risk of CVD and all-cause mortality, without evidence of a J shape, whereas only lower levels of diastolic BP associated with increased risk of CVD and death in this trial. PMID:24627349
EST Table: BP121050 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP121050 ceN-4078 10/09/28 35 %/122 aa ref|XP_967620.1| PREDICTED: similar to anopheles stephen...nl|Amel|GB19565-PA 10/09/10 35 %/122 aa gi|91093471|ref|XP_967620.1| PREDICTED: similar to anopheles stephensi ubiquitin, putative [Tribolium castaneum] FS914988 ceN- ...
Breakout Prediction Based on BP Neural Network in Continuous Casting Process
Directory of Open Access Journals (Sweden)
Zhang Ben-guo
2016-01-01
Full Text Available An improved BP neural network model was presented by modifying the learning algorithm of the traditional BP neural network, based on the Levenberg-Marquardt algorithm, and was applied to the breakout prediction system in the continuous casting process. The results showed that the accuracy rate of the model for the temperature pattern of sticking breakout was 96.43%, and the quote rate was 100%, that verified the feasibility of the model.
Radioactivity nuclide identification based on BP and LM algorithm neural network
International Nuclear Information System (INIS)
Wang Jihong; Sun Jian; Wang Lianghou
2012-01-01
The paper provides the method which can identify radioactive nuclide based on the BP and LM algorithm neural network. Then, this paper compares the above-mentioned method with FR algorithm. Through the result of the Matlab simulation, the method of radioactivity nuclide identification based on the BP and LM algorithm neural network is superior to the FR algorithm. With the better effect and the higher accuracy, it will be the best choice. (authors)
BP-Mobil partnership. The common network takes place
International Nuclear Information System (INIS)
Anon.
1997-01-01
After the partnership between BP and Mobil was signed, the program of transformation of the petrol stations network started in November 1996 in the UK and concern 3300 stations in Europe and 800 stations in France. About 9100 stations will be transformed by the end of 1998. BP France is the operator for petroleum products (petrol, fuel, bitumens, LPG..) with a 70% share holding (30% for Mobil) while Mobil is the major shareholder (51%) for the lubricants and special products activities. The chemical, aviation nd maritime activities are not concerned. Thanks to the fusion of their down-file activities in Europe, the benefits of the partnership should reach 600 to 700 million of US Dollars each year. However the restructuring cost should reach 740 millions of US Dollars in two years, which doubles the initial estimation. Short paper. (J.S.)
INTCAL09 AND MARINE09 RADIOCARBON AGE CALIBRATION CURVES, 0-50,000 YEARS CAL BP
Reimer, P. J.; Baillie, M. G. L.; Bard, E.; Bayliss, A.; Beck, J. W.; Blackwell, P. G.; Ramsey, C. Bronk; Buck, C. E.; Burr, G. S.; Edwards, R. L.; Friedrich, M.; Grootes, P. M.; Guilderson, T. P.; Hajdas, I.; Heaton, T. J.; Hogg, A. G.; Hughen, K. A.; Kaiser, K. F.; Kromer, B.; McCormac, F. G.; Manning, S. W.; Reimer, R. W.; Richards, D. A.; Southon, J. R.; Talamo, S.; Turney, C. S. M.; van der Plicht, J.; Weyhenmeye, C. E.; Weyhenmeyer, C.E.
2009-01-01
The IntCal04 and Marine04 radiocarbon calibration curves have been updated from 12 cal kBP (cal kBP is here defined as thousands of calibrated years before AD 1950), and extended to 50 cal kBP, utilizing newly available data sets that meet the IntCal Working Group criteria for pristine corals and
Angiogenenic effects of BpLec, a C-type lectin isolated from Bothrops pauloensis snake venom.
Castanheira, Letícia Eulalio; Lopes, Daiana Silva; Gimenes, Sarah Natalie Cirilo; Deconte, Simone Ramos; Ferreira, Bruno Antônio; Alves, Patricia Terra; Filho, Luiz Ricardo Goulart; Tomiosso, Tatiana Carla; Rodrigues, Renata Santos; Yoneyama, Kelly Aparecida Geraldo; Araújo, Fernanda de Assis; Rodrigues, Veridiana de Melo
2017-09-01
The present work reports the effects of a C-type lectin (BpLec) isolated from Bothrops pauloensis snake venom upon in vitro and in vivo angiogenesis models. Initially, we noted that BpLec was not cytotoxic to endothelial cells (tEnd) in doses up to 40μg/mL, but lower doses (2.5μg/mL, 5μg/mL, 10μg/mL and 20μg/mL) reduced tEnd cells adhesion to some extracellular matrix proteins and inhibited the in vitro vessel formation in Matrigel assay stimulated by bFGF. β-galactosides (d-lactose, N-acetyl-d-galactosamine and d-galactose) at 400mM reversed the effect of BpLec on tEnd cells adhesion, whereas d-galactose (400mM) partially reversed BpLec property of inhibiting vessel formation by tEnd cells in Matrigel. In vivo assays showed that BpLec increased hemoglobin content and capillary vessels number in polyether-polyurethane sponge discs subcutaneously implanted into dorsal skin mice. Additionally, BpLec also reduced collagen deposition and did not induce a pro-inflammatory response, as demonstrated by the decreased the secretion of some inflammatory cytokines, whereas myeloperoxidase (MPO) and N-acetylglucosaminidase (NAG) activities were not altered by BpLec. Taken together, our results indicate that BpLec might represent an interesting angiogenesis and inflammatory modulator that could also be used for searching possible therapeutic targets involved in these processes. Copyright © 2017 Elsevier B.V. All rights reserved.
Anarchism and homosexuality in Wilhelmine Germany: Senna Hoy, Erich Mühsam, John Henry Mackay.
Fähnders, W
1995-01-01
Homosexuality and its social and legal suppression were heatedly discussed in early twentieth-century Germany, including on the left. Among the anarchists, positions with markedly diverse forms of argument were espoused by such prominent advocates of individualist anarchism as John Henry Mackay and by others coming from the Bakuninist tradition, such as Senna Hoy and Erich Mühsam. Their writings evidence that prior to World War I and into the 1920s, German anarchists--especially when compared with the Social Democrats--intervened consistently on behalf of individual self-determination extending into the sexual sphere, even though an undercurrent of hostility toward homosexuals persisted within the leftist movement as a whole.
Genealogía de la conciencia en la filosofía de Henri Bergson
Urquijo Reguera, Mariana
2016-01-01
Esta investigación se propone mostrar la concepción de la conciencia de Henri Bergson (1859-1941) a través de una lectura crítica de su filosofía. El análisis recorre los textos del autor exponiendo su filosofía de la duración, frente a la filosofía que piensa en el espacio. El objetivo de este estudio ha sido demostrar la vigencia de su filosofía de cara a un diálogo con la ciencia contemporánea, su actualidad para pensar lso problemas filosóficos y los problemas contemporáneos. Partiendo d...
Prediction of Industrial Electric Energy Consumption in Anhui Province Based on GA-BP Neural Network
Zhang, Jiajing; Yin, Guodong; Ni, Youcong; Chen, Jinlan
2018-01-01
In order to improve the prediction accuracy of industrial electrical energy consumption, a prediction model of industrial electrical energy consumption was proposed based on genetic algorithm and neural network. The model use genetic algorithm to optimize the weights and thresholds of BP neural network, and the model is used to predict the energy consumption of industrial power in Anhui Province, to improve the prediction accuracy of industrial electric energy consumption in Anhui province. By comparing experiment of GA-BP prediction model and BP neural network model, the GA-BP model is more accurate with smaller number of neurons in the hidden layer.
A 310-bp minimal promoter mediates smooth muscle cell-specific expression of telokin.
Smith, A F; Bigsby, R M; Word, R A; Herring, B P
1998-05-01
A cell-specific promoter located in an intron of the smooth muscle myosin light chain kinase gene directs transcription of telokin exclusively in smooth muscle cells. Transgenic mice were generated in which a 310-bp rabbit telokin promoter fragment, extending from -163 to +147, was used to drive expression of simian virus 40 large T antigen. Smooth muscle-specific expression of the T-antigen transgene paralleled that of the endogenous telokin gene in all smooth muscle tissues except uterus. The 310-bp promoter fragment resulted in very low levels of transgene expression in uterus; in contrast, a transgene driven by a 2.4-kb fragment (-2250 to +147) resulted in high levels of transgene expression in uterine smooth muscle. Telokin expression levels correlate with the estrogen status of human myometrial tissues, suggesting that deletion of an estrogen response element (ERE) may account for the low levels of transgene expression driven by the 310-bp rabbit telokin promoter in uterine smooth muscle. Experiments in A10 smooth muscle cells directly showed that reporter gene expression driven by the 2.4-kb, but not 310-bp, promoter fragment could be stimulated two- to threefold by estrogen. This stimulation was mediated through an ERE located between -1447 and -1474. Addition of the ERE to the 310-bp fragment restored estrogen responsiveness in A10 cells. These data demonstrate that in addition to a minimal 310-bp proximal promoter at least one distal cis-acting regulatory element is required for telokin expression in uterine smooth muscle. The distal element may include an ERE between -1447 and -1474.
BP-Broker use-cases in the UncertWeb framework
Roncella, Roberto; Bigagli, Lorenzo; Schulz, Michael; Stasch, Christoph; Proß, Benjamin; Jones, Richard; Santoro, Mattia
2013-04-01
The UncertWeb framework is a distributed, Web-based Information and Communication Technology (ICT) system to support scientific data modeling in presence of uncertainty. We designed and prototyped a core component of the UncertWeb framework: the Business Process Broker. The BP-Broker implements several functionalities, such as: discovery of available processes/BPs, preprocessing of a BP into its executable form (EBP), publication of EBPs and their execution through a workflow-engine. According to the Composition-as-a-Service (CaaS) approach, the BP-Broker supports discovery and chaining of modeling resources (and processing resources in general), providing the necessary interoperability services for creating, validating, editing, storing, publishing, and executing scientific workflows. The UncertWeb project targeted several scenarios, which were used to evaluate and test the BP-Broker. The scenarios cover the following environmental application domains: biodiversity and habitat change, land use and policy modeling, local air quality forecasting, and individual activity in the environment. This work reports on the study of a number of use-cases, by means of the BP-Broker, namely: - eHabitat use-case: implements a Monte Carlo simulation performed on a deterministic ecological model; an extended use-case supports inter-comparison of model outputs; - FERA use-case: is composed of a set of models for predicting land-use and crop yield response to climatic and economic change; - NILU use-case: is composed of a Probabilistic Air Quality Forecasting model for predicting concentrations of air pollutants; - Albatross use-case: includes two model services for simulating activity-travel patterns of individuals in time and space; - Overlay use-case: integrates the NILU scenario with the Albatross scenario to calculate the exposure to air pollutants of individuals. Our aim was to prove the feasibility of describing composite modeling processes with a high-level, abstract
TopBP1 is required at mitosis to reduce transmission of DNA damage to G1 daughter cells
Pedersen, Rune Troelsgaard; Kruse, Thomas; Nilsson, Jakob
2015-01-01
Genome integrity is critically dependent on timely DNA replication and accurate chromosome segregation. Replication stress delays replication into G2/M, which in turn impairs proper chromosome segregation and inflicts DNA damage on the daughter cells. Here we show that TopBP1 forms foci upon mitotic entry. In early mitosis, TopBP1 marks sites of and promotes unscheduled DNA synthesis. Moreover, TopBP1 is required for focus formation of the structure-selective nuclease and scaffold protein SLX4 in mitosis. Persistent TopBP1 foci transition into 53BP1 nuclear bodies (NBs) in G1 and precise temporal depletion of TopBP1 just before mitotic entry induced formation of 53BP1 NBs in the next cell cycle, showing that TopBP1 acts to reduce transmission of DNA damage to G1 daughter cells. Based on these results, we propose that TopBP1 maintains genome integrity in mitosis by controlling chromatin recruitment of SLX4 and by facilitating unscheduled DNA synthesis. PMID:26283799
High-resolution records of thermocline in the Okinawa Trough since about 10000 aBP
Institute of Scientific and Technical Information of China (English)
无
2001-01-01
The present paper uses planktonic foraminifera and their stableisotopes to study the changes in the depth of thermocline (DOT) in the Okinawa Trough since the last 10000 a based on the analysis of Core B-3GC in the northern Okinawa Trough, together with that of the core in the southern Okinawa Trough. As results show, the thermocline was shallow before 6400 aBP, and deepened afterward, then became shallow again from 4000 to 2000 aBP. The DOT fluctuations display a positive correlation with those of sea surface temperature (SST). In addition, the changes in the northern Okinawa Trough are similar to those in the southern trough, implying a possible connection with the variation of the Kuroshio Current. The changes of SST and DOT suggest that the Kuroshio Current changed its intensity or main axis from 4000 to 2000 aBP and around about 6400 aBP respectively. Moreover, the changes of DOT from 8200 to 6400 aBP may indicate a gradual intensification of the Kuroshio Current.
Rasputin, more promiscuous than ever: a review of G3BP.
Irvine, Katharine; Stirling, Renee; Hume, David; Kennedy, Derek
2004-12-01
In this review, we highlight what G3BP's domain structure initially suggested; that G3BPs are "scaffolding" proteins linking signal transduction to RNA metabolism. Whilst it is most attractive to hypothesise about G3BP's role in signalling to mRNA metabolism, it is not known whether all G3BP functions impinge on their RNA-binding activities, so any theories are naturally subject to this qualification. It is hypothesised that, in coordination with an array of other proteins, G3BP, in a phosphorylation-dependent manner, is involved in the post-transcriptional regulation of a subset of mRNAs, at least some of which are in common with those regulated by Hu proteins. These transcripts, partially controlled at the post-transcriptional level by G3BPs, code for proteins important in transcription (e.g. c-Myc) and cytoskeletal arrangement (e.g. Tau), amongst other as yet undetermined pathways. The subtle differences between G3BP family members could dictate binding to a variety of signalling proteins, so each of the G3BPs may participate in different, though possibly related mRNPs, which are assembled in response to different stimuli. The combinatorial nature of the mRNP complex offers a powerful means of regulating gene expression, beyond that provided by a simple mRNA sequence. The ways in which mRNP flexibility and specificity may be harnessed to coordinate gene expression of functionally or structurally related mRNAs are not yet fully appreciated. Characterising mRNP composition and the function/s of mRNP components, such as the G3BPs, will aid in the understanding of how post-transcriptional mechanisms contribute to the global regulation of gene expression.
Based on BP Neural Network Stock Prediction
Liu, Xiangwei; Ma, Xin
2012-01-01
The stock market has a high profit and high risk features, on the stock market analysis and prediction research has been paid attention to by people. Stock price trend is a complex nonlinear function, so the price has certain predictability. This article mainly with improved BP neural network (BPNN) to set up the stock market prediction model, and…
Czech Academy of Sciences Publication Activity Database
Androvič, L.; Drabina, P.; Panov, I.; Frumarová, Božena; Kalendová, A.; Sedlák, M.
2014-01-01
Roč. 25, č. 9 (2014), s. 775-780 ISSN 0957-4166 Institutional support: RVO:61389013 Keywords : cooper complexes * copolymers * asymmetric Henry reaction Subject RIV: CC - Organic Chemistry Impact factor: 2.155, year: 2014
Quantitative analysis of the interplay between hsc70 and its co-chaperone HspBP1
Directory of Open Access Journals (Sweden)
Hicham Mahboubi
2015-12-01
Full Text Available Background. Chaperones and their co-factors are components of a cellular network; they collaborate to maintain proteostasis under normal and harmful conditions. In particular, hsp70 family members and their co-chaperones are essential to repair damaged proteins. Co-chaperones are present in different subcellular compartments, where they modulate chaperone activities.Methods and Results. Our studies assessed the relationship between hsc70 and its co-factor HspBP1 in human cancer cells. HspBP1 promotes nucleotide exchange on hsc70, but has also chaperone-independent functions. We characterized the interplay between hsc70 and HspBP1 by quantitative confocal microscopy combined with automated image analyses and statistical evaluation. Stress and the recovery from insult changed significantly the subcellular distribution of hsc70, but had little effect on HspBP1. Single-cell measurements and regression analysis revealed that the links between the chaperone and its co-factor relied on (i the physiological state of the cell and (ii the subcellular compartment. As such, we identified a linear relationship and strong correlation between hsc70 and HspBP1 distribution in control and heat-shocked cells; this correlation changed in a compartment-specific fashion during the recovery from stress. Furthermore, we uncovered significant stress-induced changes in the colocalization between hsc70 and HspBP1 in the nucleus and cytoplasm.Discussion. Our quantitative approach defined novel properties of the co-chaperone HspBP1 as they relate to its interplay with hsc70. We propose that changes in cell physiology promote chaperone redistribution and thereby stimulate chaperone-independent functions of HspBP1.
Energy Technology Data Exchange (ETDEWEB)
Vogue, A. de
1997-08-01
The annual production of the Dunkerque`s refinery (France) represents 330000 t of lubricants, 16000 t of paraffins, 17000 t of wax, 34000 t of extracts, 304000 t of diesel fuel and 300000 t of bitumens. From the legal aspect, Mobil is operator of the unit which belongs to an independent company held by BP (60%) and Elf (40%). After the BP-Mobil agreement was signed, the Dunkerque`s refinery entered into new Mobil`s network of 6 lubricants refineries which represent an overall over-capacity of 400000 t/year. This over-capacity is a consequence of export limitations due to profits reduction. (J.S.)
14C concentrations in the old woods at 6000yrBP and the variations of cosmic rays
International Nuclear Information System (INIS)
Sato, Taiichi; Sakurai, Hirohisa; Tokanai, Huyuki
2008-01-01
A large quantity of old woods was recently excavated with the Chuetsu-oki Earthquake in the bottom of the sea of near the Izumozaki-oki Nigata Prefecture. First of all, we have measured the radiocarbon ages for the three samples to identify the calendar ages of the woods. The radiocarbon ages were 5357±45 yrBP, 4573±52 yrBP, and 4812±52 yrBP, respectively. Using the OXCAL program, the calendar ages were calculated in the range from 6300 yrBP to 5100 yrBP. The IntCal04 data shows that the 14 C concentrations with the era are very variable with 20 per mille variations. We show a plan to investigate 14 C concentrations of the old tree rings around 6000 yrBP. (author)
Erika Cazzonatto Zerwes
2016-01-01
Este artigo busca compreender alguns aspectos da noção de humanismo na fotografia e sua proximidade com a cultura política e a cultura visual do período, a partir das experiências específicas de George Rodger e Henri Cartier-Bresson, dois fotógrafos que viveram em primeira mão e que deram testemunho do horror dos campos de concentração nazistas ao final da Segunda Guerra Mundial. George Rodger fotografou o campo de Bergen-Belsen assim que foi libertado pelas tropas britânicas. Henri Cartier-B...
SHOCKS AND A GIANT PLANET IN THE DISK ORBITING BP PISCIUM?
International Nuclear Information System (INIS)
Melis, C.; Zuckerman, B.; Gielen, C.; Chen, C. H.; Rhee, Joseph H.; Song, Inseok
2010-01-01
Spitzer Infrared Spectrograph data support the interpretation that BP Piscium, a gas and dust enshrouded star residing at high Galactic latitude, is a first-ascent giant rather than a classical T Tauri star. Our analysis suggests that BP Piscium's spectral energy distribution can be modeled as a disk with a gap that is opened by a giant planet. Modeling the rich mid-infrared emission line spectrum indicates that the solid-state emitting grains orbiting BP Piscium are primarily composed of ∼75 K crystalline, magnesium-rich olivine; ∼75 K crystalline, magnesium-rich pyroxene; ∼200 K amorphous, magnesium-rich pyroxene; and ∼200 K annealed silica (cristobalite). These dust grains are all sub-micron sized. The giant planet and gap model also naturally explains the location and mineralogy of the small dust grains in the disk. Disk shocks that result from disk-planet interaction generate the highly crystalline dust which is subsequently blown out of the disk mid-plane and into the disk atmosphere.
National Research Council Canada - National Science Library
Fritz, W. B
1980-01-01
On April 2, 1980, the J. J. Henry Company, Inc signed an agreement with Cali & Associates to use the SPADES system of computer programs to enhance its preliminary contract and detail design service for its clients...
The Application and Research of the GA-BP Neural Network Algorithm in the MBR Membrane Fouling
Directory of Open Access Journals (Sweden)
Chunqing Li
2014-01-01
Full Text Available It is one of the important issues in the field of today's sewage treatment of researching the MBR membrane flux prediction for membrane fouling. Firstly this paper used the principal component analysis method to achieve dimensionality and correlation of input variables and obtained the three major factors affecting membrane fouling most obvious: MLSS, total resistance, and operating pressure. Then it used the BP neural network to establish the system model of the MBR intelligent simulation, the relationship between three parameters, and membrane flux characterization of the degree of membrane fouling, because the BP neural network has slow training speed, is sensitive to the initial weights and the threshold, is easy to fall into local minimum points, and so on. So this paper used genetic algorithm to optimize the initial weights and the threshold of BP neural network and established the membrane fouling prediction model based on GA-BP network. As this research had shown, under the same conditions, the BP network model optimized by GA of MBR membrane fouling is better than that not optimized for prediction effect of membrane flux. It demonstrates that the GA-BP network model of MBR membrane fouling is more suitable for simulation of MBR membrane fouling process, comparing with the BP network.
EST Table: BP182659 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP182659 NRPG0886 10/09/28 51 %/153 aa ref|XP_001659582.1| xaa-pro dipeptidase pepd/pepq(e.coli...) [Aedes aegypti] gb|EAT39285.1| xaa-pro dipeptidase pepd/pepq(e.coli) [Aedes aegypti] 10/08/29 ...33738|ref|XP_971576.2| PREDICTED: similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] FS768084 NRPG ...
EST Table: BP125370 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available 10 56 %/150 aa gi|189241063|ref|XP_967018.2| PREDICTED: similar to restin (Reed-Steinberg cell-expressed intermediate filament-associated protein) [Tribolium castaneum] FS906662 fbpv ... ...n (Reed-Steinberg cell-expressed intermediate filament-associated protein) [Tribolium castaneum] 10/08/29 55...BP125370 fbpv0758 10/09/28 56 %/150 aa ref|XP_967018.2| PREDICTED: similar to resti
EST Table: BP182152 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP182152 NRPG0186 10/09/28 87 %/125 aa ref|NP_001098702.1| nanos-like protein [Bomb...yx mori] gb|ABS17681.1| nanos-like protein [Bombyx mori] 10/08/29 low homology 10/08/28 n.h 10/09/10 low homology 10/09/10 low homology 10/09/10 low homology NM_001105232 NRPG ...
Effect of CPAP Withdrawal on BP in OSA: Data from Three Randomized Controlled Trials.
Schwarz, Esther I; Schlatzer, Christian; Rossi, Valentina A; Stradling, John R; Kohler, Malcolm
2016-12-01
Based on meta-analyses, the BP-lowering effect of CPAP therapy in patients with OSA is reported to be approximately 2 to 3 mm Hg. This figure is derived from heterogeneous trials, which are often limited by poor CPAP adherence, and thus the treatment effect may possibly be underestimated. We analyzed morning BP data from three randomized controlled CPAP withdrawal trials, which included only patients with optimal CPAP compliance. Within the three trials, 149 patients with OSA who were receiving CPAP were randomized to continue therapeutic CPAP (n = 65) or to withdraw CPAP (n = 84) for 2 weeks. Morning BP was measured at home before and after sleep studies in the hospital. CPAP withdrawal was associated with a return of OSA (apnea-hypopnea index [AHI] at a baseline of 2.8/h and at follow-up of 33.2/h). Office systolic BP (SBP) increased in the CPAP withdrawal group compared with the CPAP continuation group by +5.4 mm Hg (95% CI, 1.8-8.9 mm Hg; P = .003) and in the home SBP group by +9.0 mm Hg (95% CI, 5.7-12.3 mm Hg; P CPAP withdrawal results in a clinically relevant increase in BP, which is considerably higher than in conventional CPAP trials; it is also underestimated when office BP is used. Greater OSA severity is associated with a higher BP rise in response to CPAP withdrawal. ClinicalTrials.gov; No.: NCT01332175 and NCT01797653) URL: www.clinicaltrials.gov and ISRCTN registry (ISRCTN 93153804) URL: http://www.isrctn.com/. Copyright © 2016 American College of Chest Physicians. Published by Elsevier Inc. All rights reserved.
Wu, Jingbo; Zhang, Hui; Wang, Yuanzhi; Qiao, Jun; Chen, Chuangfu; Gao, Goege F.; Allain, Jean-Pierre; Li, Chengyao
2012-01-01
More than 35,000 new cases of human brucellosis were reported in 2010 by the Chinese Center for Disease Control and Prevention. An attenuated B. melitensis vaccine M5-90 is currently used for vaccination of sheep and goats in China. In the study, a periplasmic protein BP26 from M5-90 was characterized for its epitope reactivity with mouse monoclonal and sheep antibodies. A total of 29 monoclonal antibodies (mAbs) against recombinant BP26 (rBP26) were produced, which were tested for reactivity with a panel of BP26 peptides, three truncated rBP26 and native BP26 containing membrane protein extracts (NMP) of B. melitensis M5-90 in ELISA and Western-Blot. The linear, semi-conformational and conformational epitopes from native BP26 were identified. Two linear epitopes recognized by mAbs were revealed by 28 of 16mer overlapping peptides, which were accurately mapped as the core motif of amino acid residues 93DRDLQTGGI101 (position 93 to 101) or residues 104QPIYVYPD111, respectively. The reactivity of linear epitope peptides, rBP26 and NMP was tested with 137 sheep sera by ELISAs, of which the two linear epitopes had 65–70% reactivity and NMP 90% consistent with the results of a combination of two standard serological tests. The results were helpful for evaluating the reactivity of BP26 antigen in M5-90. PMID:22457830
How the Other Half Lives: Under the Arch with Lady Henry Somerset
Directory of Open Access Journals (Sweden)
Paisana Joanne
2017-10-01
Full Text Available The reforming work of Isabella Caroline Somerset (Lady Henry Somerset 1851-1921 is largely overlooked today. Dedicated to women’s causes at home and abroad and to temperance in particular, having first-hand knowledge of the privileged and the underprivileged, this determined, multi-talented and opinionated woman uncharacteristically wrote a fictional novel, Under the Arch (1906. In the novel, London aristocrats are portrayed rubbing shoulders with slum dwellers, but there is little real connection. The problems that the social policies introduced by the Liberals from 1906-1914 would address are nevertheless highlighted. It can be no coincidence that Somerset was well acquainted with many of these politicians. The themes of relieving the poor, Christian doctrine, marriage, women’s suffrage and imperialism are addressed, although Somerset’s focus is simply on “doing good” and loving one’s neighbour
Directory of Open Access Journals (Sweden)
Nereyda Martínez Suárez
2006-12-01
Full Text Available La investigación se centra en la caracterización de la actividad profesional del Contingente Médico Internacional “Henry Reeve”, especializado en situaciones de desastre y graves epidemias, tomando en cuenta el condicionamiento histórico social de la génesis del mismo, su desempeño profesional como parte de la sociedad revolucionaria cubana, así como su repercusión internacional; para lo mismo se realizó un estudio teórico, basado en la aplicación de los métodos históricos, de análisis y síntesis de fuentes documentales. El estudio permitió observar que, los servicios médicos no son únicamente un asunto de formación científica, es un asunto de política y de formación humanista. La posibilidad de su realización está condicionada histórica y socialmente de un modo concreto. La ciencia, ética y sociedad constituyen una unidad histórica que se asienta en un tipo cualitativo de política, por lo que la formación actual y futura de médicos y profesionales de la salud en nuestro país, deberá basarse en las necesidades de los campos, aldeas, barrios marginales y pobres de las ciudades del Tercer Mundo, consolidando los valores humanos necesarios en estos profesionales. Los miembros del Contingente Henry Reeve son portadores de profundos conocimientos científicos, de una fortaleza política, altos valores humanos y principios éticos inconfundibles, demostrados a través de estos años de revolución mediante la atención a nuestro pueblo, el cumplimiento de misiones internacionalistas y la colaboración médica en más de 100 países.This investigation is centred in the characterization of the professional activity of the International Medical Contingent ‘‘Henry Reeves'', specialized in disaster situations and serius epidemics, taking into account, its own social and historical nature, its professional acting as a part of the Cuban Revolutionary Society, as well as its international repercussion. For this reason a
BP Spill in the Gulf of Mexico Sediment Data
U.S. Environmental Protection Agency — In response to the BP oil spill, EPA monitored sediment near the spill. While emergency response data collection has ended, results continue to be available on this...
TopBP1/Dpb11 binds DNA anaphase bridges to prevent genome instability
DEFF Research Database (Denmark)
Germann, Susanne Manuela; Schramke, Vera; Pedersen, Rune Troelsgaard
2014-01-01
yeast Saccharomyces cerevisiae and the avian DT40 cell line as model systems for studying DNA anaphase bridges and show that TopBP1/Dpb11 plays an evolutionarily conserved role in their metabolism. Together with the single-stranded DNA binding protein RPA, TopBP1/Dpb11 binds to UFBs, and depletion...
NotCal04 : Comparison/calibration C-14 records 26-50 cal kyr BP
Plicht, J. van der; Beck, J.W.; Bard, E.; Baillie, M.G.L.; Blackwell, P.G.; Buck, C.E.; Friedrich, M.; Guilderson, T.P.; Hughen, K.A.; Kromer, B.; McCormac, F.G.; Bronk Ramsey, C.; Reimer, P.J.; Reimer, R.W.; Remmele, S.; Richards, D.A.; Southon, J.R.; Stuiver, M.; Weyhenmeyer, C.E.
2004-01-01
The radiocarbon calibration curve ImCal04 extends back to 26 cal kyr BP. While several high-resolution records exist beyond this limit, these data sets exhibit discrepancies of up, to several millennia. As a result, no calibration curve for the time range 26-50 cal kyr BP can be recommended as yet,
Mass spectroscopic phosphoprotein mapping of Ral binding protein 1 (RalBP1/Rip1/RLIP76)
International Nuclear Information System (INIS)
Herlevsen, Mikael C.; Theodorescu, Dan
2007-01-01
RalBP1, a multifunctional protein implicated in cancer cell proliferation, radiation and chemoresistance, and ligand dependent receptor internalization, is upregulated in bladder cancer and is a downstream effector of RalB, a GTPase associated with metastasis. RalBP1 can be regulated by phosphorylation by protein kinase C (PKC). No studies have comprehensively mapped RalBP1 phosphorylation sites or whether RalB affects these. We identified 14 phosphorylation sites of RalBP1 in human bladder carcinoma UMUC-3 and embryonic kidney derived 293T cells. The phosphorylated residues are concentrated at the N-terminus. Ten of the first 100 amino acids of the primary structure were phosphorylated. Nine were serine residues, and one a threonine. We evaluated the effect of RalB overexpression on RalBP1 phosphorylation and found the largest change in phosphorylation status at S463 and S645. Further characterization of these sites will provide novel insights on RalBP1 biology, its functional relationship to RalB and possible avenues for therapeutic intervention
Application of the GA-BP Neural Network in Earthwork Calculation
Fang, Peng; Cai, Zhixiong; Zhang, Ping
2018-01-01
The calculation of earthwork quantity is the key factor to determine the project cost estimate and the optimization of the scheme. It is of great significance and function in the excavation of earth and rock works. We use optimization principle of GA-BP intelligent algorithm running process, and on the basis of earthwork quantity and cost information database, the design of the GA-BP neural network intelligent computing model, through the network training and learning, the accuracy of the results meet the actual engineering construction of gauge fan requirements, it provides a new approach for other projects the calculation, and has good popularization value.
Comparison of two bone anchored hearing instruments: BP100 and Ponto Pro
DEFF Research Database (Denmark)
Olsen, Steen Østergaard; Glad, Henrik; Nielsen, Lars Holme
2011-01-01
This study aimed at investigating if there were differences in auditory performance, operation, or user preference between the Ponto Pro or the BP100, two bone anchored hearing instruments (BAHI) with modern sound processing technology.......This study aimed at investigating if there were differences in auditory performance, operation, or user preference between the Ponto Pro or the BP100, two bone anchored hearing instruments (BAHI) with modern sound processing technology....
International Nuclear Information System (INIS)
DuWaldt, J.; Meyer, T.
1993-07-01
This report presents the results of the preliminary assessment (PA) conducted by Argonne National Laboratory at a Montana Army National Guard (MTARNG) property near Helena, Montana. Preliminary assessments of federal facilities are being conducted to compile the information necessary for completing preremedial activities and to provide a basis for establishing corrective actions in response to releases of hazardous substances. The principal objective of the PA is to characterize the site accurately and determine the need for further action by examining site activities, quantities of hazardous substances present, and potential pathways by which contamination could affect public health and the environment. This PA satisfies, for the Fort William Henry Harrison property, requirements of the Department of Defense Installation Restoration Program
TopBP1/Dpb11 binds DNA anaphase bridges to prevent genome instability.
Germann, Susanne M; Schramke, Vera; Pedersen, Rune Troelsgaard; Gallina, Irene; Eckert-Boulet, Nadine; Oestergaard, Vibe H; Lisby, Michael
2014-01-06
DNA anaphase bridges are a potential source of genome instability that may lead to chromosome breakage or nondisjunction during mitosis. Two classes of anaphase bridges can be distinguished: DAPI-positive chromatin bridges and DAPI-negative ultrafine DNA bridges (UFBs). Here, we establish budding yeast Saccharomyces cerevisiae and the avian DT40 cell line as model systems for studying DNA anaphase bridges and show that TopBP1/Dpb11 plays an evolutionarily conserved role in their metabolism. Together with the single-stranded DNA binding protein RPA, TopBP1/Dpb11 binds to UFBs, and depletion of TopBP1/Dpb11 led to an accumulation of chromatin bridges. Importantly, the NoCut checkpoint that delays progression from anaphase to abscission in yeast was activated by both UFBs and chromatin bridges independently of Dpb11, and disruption of the NoCut checkpoint in Dpb11-depleted cells led to genome instability. In conclusion, we propose that TopBP1/Dpb11 prevents accumulation of anaphase bridges via stimulation of the Mec1/ATR kinase and suppression of homologous recombination.
Impact of histone H4 lysine 20 methylation on 53BP1 responses to chromosomal double strand breaks.
Directory of Open Access Journals (Sweden)
Andrea J Hartlerode
Full Text Available Recruitment of 53BP1 to chromatin flanking double strand breaks (DSBs requires γH2AX/MDC1/RNF8-dependent ubiquitination of chromatin and interaction of 53BP1 with histone H4 methylated on lysine 20 (H4K20me. Several histone methyltransferases have been implicated in 53BP1 recruitment, but their quantitative contributions to the 53BP1 response are unclear. We have developed a multi-photon laser (MPL system to target DSBs to subfemtoliter nuclear volumes and used this to mathematically model DSB response kinetics of MDC1 and of 53BP1. In contrast to MDC1, which revealed first order kinetics, the 53BP1 MPL-DSB response is best fitted by a Gompertz growth function. The 53BP1 MPL response shows the expected dependency on MDC1 and RNF8. We determined the impact of altered H4K20 methylation on 53BP1 MPL response kinetics in mouse embryonic fibroblasts (MEFs lacking key H4K20 histone methyltransferases. This revealed no major requirement for the known H4K20 dimethylases Suv4-20h1 and Suv4-20h2 in 53BP1 recruitment or DSB repair function, but a key role for the H4K20 monomethylase, PR-SET7. The histone methyltransferase MMSET/WHSC1 has recently been implicated in 53BP1 DSB recruitment. We found that WHSC1 homozygous mutant MEFs reveal an alteration in balance of H4K20 methylation patterns; however, 53BP1 DSB responses in these cells appear normal.
EST Table: BP183868 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP183868 P5PG0462 10/09/28 50 %/126 aa ref|XP_001659582.1| xaa-pro dipeptidase pepd/pepq(e.coli...) [Aedes aegypti] gb|EAT39285.1| xaa-pro dipeptidase pepd/pepq(e.coli) [Aedes aegypti] 10/08/29 ...33738|ref|XP_971576.2| PREDICTED: similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] FS768084 P5PG ...
EST Table: BP126151 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP126151 ps4M0084 10/09/28 52 %/232 aa ref|XP_001659582.1| xaa-pro dipeptidase pepd/pepq(e.coli...) [Aedes aegypti] gb|EAT39285.1| xaa-pro dipeptidase pepd/pepq(e.coli) [Aedes aegypti] 10/08/29 ...33738|ref|XP_971576.2| PREDICTED: similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] FS768084 ps4M ...
Johansson, Mikael
2017-01-01
The BP Deepwater Horizon crisis in 2010 was one the largest catastrophes in the history of the oil industry. BP was sued over the disaster, and lost several billion dollars. This study examines the crisis response strategies and/or image repair strategies, which can be found in BP's press releases following the Deepwater Horizon crisis. In particular, the study looks closer at what established crisis communication strategies could be discerned in the material, and how they are used discursive...
Association between the CCR5 32-bp deletion allele and late onset of schizophrenia
DEFF Research Database (Denmark)
Rasmussen, Henrik Berg; Timm, Sally; Wang, August G
2006-01-01
OBJECTIVE: The 32-bp deletion allele in chemokine receptor CCR5 has been associated with several immune-mediated diseases and might be implicated in schizophrenia as well. METHOD: The authors genotyped DNA samples from 268 schizophrenia patients and 323 healthy subjects. Age at first admission...... of the deletion allele in the latter subgroup of patients. CONCLUSIONS: These findings suggest that the CCR5 32-bp deletion allele is a susceptibility factor for schizophrenia with late onset. Alternatively, the CCR5 32-bp deletion allele may act as a modifier by delaying the onset of schizophrenia without...
Energy Technology Data Exchange (ETDEWEB)
Chihara, Kazuyasu [Division of Genome Science and Microbiology, Department of Pathological Sciences, Faculty of Medical Sciences, Fukui 910-1193 (Japan); Organization for Life Science Advancement Programs, University of Fukui, Fukui 910-1193 (Japan); Kimura, Yukihiro [Division of Genome Science and Microbiology, Department of Pathological Sciences, Faculty of Medical Sciences, Fukui 910-1193 (Japan); Division of Otorhinolaryngology Head and Neck Surgery, Department of Sensory and Locomotor Medicine, Faculty of Medical Sciences, Fukui 910-1193 (Japan); Honjoh, Chisato [Division of Genome Science and Microbiology, Department of Pathological Sciences, Faculty of Medical Sciences, Fukui 910-1193 (Japan); Third Department of Internal Medicine, Faculty of Medical Sciences, Fukui 910-1193 (Japan); Yamauchi, Shota; Takeuchi, Kenji [Division of Genome Science and Microbiology, Department of Pathological Sciences, Faculty of Medical Sciences, Fukui 910-1193 (Japan); Organization for Life Science Advancement Programs, University of Fukui, Fukui 910-1193 (Japan); Sada, Kiyonao, E-mail: ksada@u-fukui.ac.jp [Division of Genome Science and Microbiology, Department of Pathological Sciences, Faculty of Medical Sciences, Fukui 910-1193 (Japan); Organization for Life Science Advancement Programs, University of Fukui, Fukui 910-1193 (Japan)
2014-03-10
Adaptor protein c-Abl SH3 domain-binding protein-2 (3BP2) is known to play regulatory roles in immunoreceptor-mediated signal transduction. We have previously demonstrated that Tyr{sup 174}, Tyr{sup 183} and Tyr{sup 446} in mouse 3BP2 are predominantly phosphorylated by Syk, and the phosphorylation of Tyr{sup 183} and the Src homology 2 (SH2) domain of mouse 3BP2 are critical for B cell receptor (BCR)-induced activation of nuclear factor of activated T cells (NFAT) in human B cells. In this report, we have shown that Syk, but not Abl family protein-tyrosine kinases, is critical for BCR-mediated tyrosine phosphorylation of 3BP2 in chicken DT40 cells. Mutational analysis showed that Tyr{sup 174}, Tyr{sup 183} and Tyr{sup 426} of chicken 3BP2 are the major phosphorylation sites by Syk and the SH2 domain of 3BP2 is critical for tyrosine phosphorylation. In addition, phosphorylation of Tyr{sup 426} is required for the inducible interaction with the SH2 domain of Vav3. Moreover, the expression of the mutant form of 3BP2 in which Tyr{sup 426} was substituted to Phe resulted in the reduction in BCR-mediated Rac1 activation, when compared with the case of wild-type. Altogether, these data suggest that 3BP2 is involved in the activation of Rac1 through the regulation of Vav3 by Syk-dependent phosphorylation of Tyr{sup 426} following BCR stimulation. - Highlights: • 3BP2 is phosphorylated by Syk, but not Abl family kinases in BCR signaling. • Tyr183 and Tyr426 in chicken 3BP2 are the major phosphorylation sites by Syk. • The SH2 domain of 3BP2 is critical for tyrosine phosphorylation of 3BP2. • Phosphorylation of Tyr426 in 3BP2 is required for the inducible binding with Vav3. • 3BP2 is involved in the regulation of BCR-mediated Rac1 activation.
International Nuclear Information System (INIS)
Chihara, Kazuyasu; Kimura, Yukihiro; Honjoh, Chisato; Yamauchi, Shota; Takeuchi, Kenji; Sada, Kiyonao
2014-01-01
Adaptor protein c-Abl SH3 domain-binding protein-2 (3BP2) is known to play regulatory roles in immunoreceptor-mediated signal transduction. We have previously demonstrated that Tyr 174 , Tyr 183 and Tyr 446 in mouse 3BP2 are predominantly phosphorylated by Syk, and the phosphorylation of Tyr 183 and the Src homology 2 (SH2) domain of mouse 3BP2 are critical for B cell receptor (BCR)-induced activation of nuclear factor of activated T cells (NFAT) in human B cells. In this report, we have shown that Syk, but not Abl family protein-tyrosine kinases, is critical for BCR-mediated tyrosine phosphorylation of 3BP2 in chicken DT40 cells. Mutational analysis showed that Tyr 174 , Tyr 183 and Tyr 426 of chicken 3BP2 are the major phosphorylation sites by Syk and the SH2 domain of 3BP2 is critical for tyrosine phosphorylation. In addition, phosphorylation of Tyr 426 is required for the inducible interaction with the SH2 domain of Vav3. Moreover, the expression of the mutant form of 3BP2 in which Tyr 426 was substituted to Phe resulted in the reduction in BCR-mediated Rac1 activation, when compared with the case of wild-type. Altogether, these data suggest that 3BP2 is involved in the activation of Rac1 through the regulation of Vav3 by Syk-dependent phosphorylation of Tyr 426 following BCR stimulation. - Highlights: • 3BP2 is phosphorylated by Syk, but not Abl family kinases in BCR signaling. • Tyr183 and Tyr426 in chicken 3BP2 are the major phosphorylation sites by Syk. • The SH2 domain of 3BP2 is critical for tyrosine phosphorylation of 3BP2. • Phosphorylation of Tyr426 in 3BP2 is required for the inducible binding with Vav3. • 3BP2 is involved in the regulation of BCR-mediated Rac1 activation
Techniques to produce and accelerate radioactive ion beams
Penescu, Liviu Constantin; Lettry, Jacques; Cata-Danil, Gheorghe
The production and acceleration of the Radioactive Ion Beams (RIB) continues the long line of nuclear investigations started in the XIXth century by Pierre and Marie Curie, Henri Becquerel and Ernest Rutherford. The contemporary applications of the RIBs span a wide range of physics fields: nuclear and atomic physics, solid-state physics, life sciences and material science. ISOLDE is a world-leading Isotope mass-Separation On-Line (ISOL) facility hosted at CERN in Geneva for more than 40 years, offering the largest variety of radioactive ion beams with, until now, more than 1000 isotopes of more than 72 elements (with Z ranging from 2 to 88), with half-lives down to milliseconds and intensities up to 1011 ions/s. The post acceleration of the full variety of beams allows reaching final energies between 0.8 and 3.0 MeV/u. This thesis describes the development of a new series of FEBIAD (“Forced Electron Beam Induced Arc Discharge”) ion sources at CERN-ISOLDE. The VADIS (“Versatile Arc Discharge Ion Source�...
Lee, Peisan; Liu, Ju-Chi; Hsieh, Ming-Hsiung; Hao, Wen-Rui; Tseng, Yuan-Teng; Liu, Shuen-Hsin; Lin, Yung-Kuo; Sung, Li-Chin; Huang, Jen-Hung; Yang, Hung-Yu; Ye, Jong-Shiuan; Zheng, He-Shun; Hsu, Min-Huei; Syed-Abdul, Shabbir; Lu, Richard; Nguyen, Phung-Anh; Iqbal, Usman; Huang, Chih-Wei; Jian, Wen-Shan; Li, Yu-Chuan Jack
2016-08-01
Less than 50% of patients with hypertensive disease manage to maintain their blood pressure (BP) within normal levels. The aim of this study is to evaluate whether cloud BP system integrated with computerized physician order entry (CPOE) can improve BP management as compared with traditional care. A randomized controlled trial done on a random sample of 382 adults recruited from 786 patients who had been diagnosed with hypertension and receiving treatment for hypertension in two district hospitals in the north of Taiwan. Physicians had access to cloud BP data from CPOE. Neither patients nor physicians were blinded to group assignment. The study was conducted over a period of seven months. At baseline, the enrollees were 50% male with a mean (SD) age of 58.18 (10.83) years. The mean sitting BP of both arms was no different. The proportion of patients with BP control at two, four and six months was significantly greater in the intervention group than in the control group. The average capture rates of blood pressure in the intervention group were also significantly higher than the control group in all three check-points. Cloud-based BP system integrated with CPOE at the point of care achieved better BP control compared to traditional care. This system does not require any technical skills and is therefore suitable for every age group. The praise and assurance to the patients from the physicians after reviewing the Cloud BP records positively reinforced both BP measuring and medication adherence behaviors. Copyright © 2016. Published by Elsevier Ireland Ltd.
Une autre ville pour une autre vie. Henri Lefebvre et les situationnistes
Directory of Open Access Journals (Sweden)
Philippe Simay
2008-12-01
Full Text Available L’un des traits distinctifs du mouvement situationniste est de s’être constamment préoccupé de la question urbaine. Conçue comme l’espace de production de la société du spectacle mais aussi comme un terrain de lutte et d’expérimentation, la ville a représenté pour ce mouvement estudiantin, proche d’Henri Lefebvre, le lieu d’une réinvention radicale de la vie quotidienne. Cet article revient sur la critique situationniste de l’urbanisme de l’après-guerre ainsi que sur les pratiques auxquelles elle a donné lieu (détournement, dérive, cartes psychogéographiques, construction de situations éphémères. Celles-ci peuvent être regardées comme la première expression d’un « droit à la ville », tel que l’entendait Lefebvre. Reste à savoir si le groupe de Guy Debord souhaitait véritablement « changer la ville pour changer la vie » ou si la ville n’était que le théâtre d’une révolution à venir.One of the distinctive traits of the situationist movement is its constant preoccupation with the urban issue. For this student movement close to Henri Lefebvre, the city has been thought of as a choice generic location for the production of the Society of the Spectacle, but also as a test ground for struggle and experimentation – the place where a radical reinvention of daily life can occur. This paper goes back to the situationist critique of post-war urbanism, as well as the behaviors and practices it has given birth to (misappropriation, drifts in meaning, psychogeographic maps, the construct of short-lived situations. These can be seen as the first expression of a « right to the city », in the sense Lefebvre originally meant it have. However, it is still unknown whether Guy Debord's group really wished to « change city-life to change life itself », or if to them the city was merely a theater for the enactment of a revolution to come.
Directory of Open Access Journals (Sweden)
Nadal Anna
2012-09-01
Full Text Available Abstract Background The Biopeptide BP100 is a synthetic and strongly cationic α-helical undecapeptide with high, specific antibacterial activity against economically important plant-pathogenic bacteria, and very low toxicity. It was selected from a library of synthetic peptides, along with other peptides with activities against relevant bacterial and fungal species. Expression of the BP100 series of peptides in plants is of major interest to establish disease-resistant plants and facilitate molecular farming. Specific challenges were the small length, peptide degradation by plant proteases and toxicity to the host plant. Here we approached the expression of the BP100 peptide series in plants using BP100 as a proof-of-concept. Results Our design considered up to three tandemly arranged BP100 units and peptide accumulation in the endoplasmic reticulum (ER, analyzing five BP100 derivatives. The ER retention sequence did not reduce the antimicrobial activity of chemically synthesized BP100 derivatives, making this strategy possible. Transformation with sequences encoding BP100 derivatives (bp100der was over ten-fold less efficient than that of the hygromycin phosphotransferase (hptII transgene. The BP100 direct tandems did not show higher antimicrobial activity than BP100, and genetically modified (GM plants constitutively expressing them were not viable. In contrast, inverted repeats of BP100, whether or not elongated with a portion of a natural antimicrobial peptide (AMP, had higher antimicrobial activity, and fertile GM rice lines constitutively expressing bp100der were produced. These GM lines had increased resistance to the pathogens Dickeya chrysanthemi and Fusarium verticillioides, and tolerance to oxidative stress, with agronomic performance comparable to untransformed lines. Conclusions Constitutive expression of transgenes encoding short cationic α-helical synthetic peptides can have a strong negative impact on rice fitness. However, GM
ALS mutant SOD1 interacts with G3BP1 and affects stress granule dynamics.
Gal, Jozsef; Kuang, Lisha; Barnett, Kelly R; Zhu, Brian Z; Shissler, Susannah C; Korotkov, Konstantin V; Hayward, Lawrence J; Kasarskis, Edward J; Zhu, Haining
2016-10-01
Amyotrophic lateral sclerosis (ALS) is a fatal neurodegenerative disease. Mutations in Cu/Zn superoxide dismutase (SOD1) are responsible for approximately 20 % of the familial ALS cases. ALS-causing SOD1 mutants display a gain-of-toxicity phenotype, but the nature of this toxicity is still not fully understood. The Ras GTPase-activating protein-binding protein G3BP1 plays a critical role in stress granule dynamics. Alterations in the dynamics of stress granules have been reported in several other forms of ALS unrelated to SOD1. To our surprise, the mutant G93A SOD1 transgenic mice exhibited pathological cytoplasmic inclusions that co-localized with G3BP1-positive granules in spinal cord motor neurons. The co-localization was also observed in fibroblast cells derived from familial ALS patient carrying SOD1 mutation L144F. Mutant SOD1, unlike wild-type SOD1, interacted with G3BP1 in an RNA-independent manner. Moreover, the interaction is specific for G3BP1 since mutant SOD1 showed little interaction with four other RNA-binding proteins implicated in ALS. The RNA-binding RRM domain of G3BP1 and two particular phenylalanine residues (F380 and F382) are critical for this interaction. Mutant SOD1 delayed the formation of G3BP1- and TIA1-positive stress granules in response to hyperosmolar shock and arsenite treatment in N2A cells. In summary, the aberrant mutant SOD1-G3BP1 interaction affects stress granule dynamics, suggesting a potential link between pathogenic SOD1 mutations and RNA metabolism alterations in ALS.
Research on wind field algorithm of wind lidar based on BP neural network and grey prediction
Chen, Yong; Chen, Chun-Li; Luo, Xiong; Zhang, Yan; Yang, Ze-hou; Zhou, Jie; Shi, Xiao-ding; Wang, Lei
2018-01-01
This paper uses the BP neural network and grey algorithm to forecast and study radar wind field. In order to reduce the residual error in the wind field prediction which uses BP neural network and grey algorithm, calculating the minimum value of residual error function, adopting the residuals of the gray algorithm trained by BP neural network, using the trained network model to forecast the residual sequence, using the predicted residual error sequence to modify the forecast sequence of the grey algorithm. The test data show that using the grey algorithm modified by BP neural network can effectively reduce the residual value and improve the prediction precision.
X rays and radioactivity: a complete surprise
International Nuclear Information System (INIS)
Radvanyi, P.; Bordry, M.
1995-01-01
The discoveries of X rays and of radioactivity came as complete experimental surprises; the physicists, at that time, had no previous hint of a possible structure of atoms. It is difficult now, knowing what we know, to replace ourselves in the spirit, astonishment and questioning of these years, between 1895 and 1903. The nature of X rays was soon hypothesized, but the nature of the rays emitted by uranium, polonium and radium was much more difficult to disentangle, as they were a mixture of different types of radiations. The origin of the energy continuously released in radioactivity remained a complete mystery for a few years. The multiplicity of the radioactive substances became soon a difficult matter: what was real and what was induced ? Isotopy was still far ahead. It appeared that some radioactive substances had ''half-lifes'': were they genuine radioactive elements or was it just a transitory phenomenon ? Henri Becquerel (in 1900) and Pierre and Marie Curie (in 1902) hesitated on the correct answer. Only after Ernest Rutherford and Frederick Soddy established that radioactivity was the transmutation of one element into another, could one understand that a solid element transformed into a gaseous element, which in turn transformed itself into a succession of solid radioactive elements. It was only in 1913 - after the discovery of the atomic nucleus -, through precise measurements of X ray spectra, that Henry Moseley showed that the number of electrons of a given atom - and the charge of its nucleus - was equal to its atomic number in the periodic table. (authors)
X rays and radioactivity: a complete surprise
Energy Technology Data Exchange (ETDEWEB)
Radvanyi, P. [Laboratoire National Saturne, Centre d`Etudes de Saclay, 91 - Gif-sur-Yvette (France); Bordry, M. [Institut du Radium, 75 - Paris (France)
1995-12-31
The discoveries of X rays and of radioactivity came as complete experimental surprises; the physicists, at that time, had no previous hint of a possible structure of atoms. It is difficult now, knowing what we know, to replace ourselves in the spirit, astonishment and questioning of these years, between 1895 and 1903. The nature of X rays was soon hypothesized, but the nature of the rays emitted by uranium, polonium and radium was much more difficult to disentangle, as they were a mixture of different types of radiations. The origin of the energy continuously released in radioactivity remained a complete mystery for a few years. The multiplicity of the radioactive substances became soon a difficult matter: what was real and what was induced ? Isotopy was still far ahead. It appeared that some radioactive substances had ``half-lifes``: were they genuine radioactive elements or was it just a transitory phenomenon ? Henri Becquerel (in 1900) and Pierre and Marie Curie (in 1902) hesitated on the correct answer. Only after Ernest Rutherford and Frederick Soddy established that radioactivity was the transmutation of one element into another, could one understand that a solid element transformed into a gaseous element, which in turn transformed itself into a succession of solid radioactive elements. It was only in 1913 - after the discovery of the atomic nucleus -, through precise measurements of X ray spectra, that Henry Moseley showed that the number of electrons of a given atom - and the charge of its nucleus - was equal to its atomic number in the periodic table. (authors).
The enigmatic figure of Dr Henry Maudsley (1835-1918).
Pantelidou, Maria; Demetriades, Andreas K
2014-08-01
In spite of his contribution to psychiatry in 19th century Britain, Henry Maudsley remains a mysterious figure, a man mostly known for his donation to the London County Council for the building of the Maudsley Hospital and for The Maudsley Annual Lecture created in honour of his benevolence. Besides Sir Aubrey Lewis' article in 1951 and Michael Collie's attempt in 1988 to construct a biographical study on Maudsley, there does not seem to be any current endeavour to tell the story of his life, whereas Trevor Turner's contribution to the 2004 Oxford Dictionary of National Biography gives a somewhat scathing but unattributed account of Maudsley's personality. This essay attempts to explore his contributions to the Medico-Psychological Association (MPA), the current Royal College of Psychiatrists, his editorship of the Journal of Mental Health (currently named the British Journal of Psychiatry), his literary contributions and his vision for a psychiatric hospital. This essay is an attempt to demystify his figure and to explore some of the rumours and criticisms surrounding his name and the reasons why so little has been written about him. It is also a venture to unravel his complex personality and his intricate philosophy. © The Author(s) 2014 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.
HENRY H. CHEEK AND TRANSFORMISM: NEW LIGHT ON CHARLES DARWIN'S EDINBURGH BACKGROUND.
Jenkins, Bill
2015-06-20
Evidence for the transformist ideas espoused by Henry H. Cheek (1807-33), a contemporary of Charles Darwin's at the University of Edinburgh, sheds new light on the intellectual environment of Edinburgh in the late 1820s and early 1830s. Cheek was the author of several papers dealing with the transmutation of species influenced by the theories of Etienne Geoffroy Saint-Hilaire (1772-1844), Jean-Baptiste Lamarck (1744-1829) and the Comte de Buffon (1707-88). Some of these were read to student societies, others appeared in the Edinburgh Journal of Natural and Geographical Science, which Cheek edited between 1829 and 1831. His writings give us a valuable window onto some of the transformist theories that were circulating among Darwin's fellow medical students in the late 1820s, to which Darwin would have been exposed during his time in Edinburgh, and for which little other concrete evidence survives.
BP Canada Energy Company energy efficiency and GHG reduction opportunities
Energy Technology Data Exchange (ETDEWEB)
Forsyth, B. [BP Canada Energy Company, Calgary, AB (Canada)
2004-07-01
This paper presented an outline of the BP Canada Energy Company's energy efficiency program, which uses an innovative approach that relies on front line operations staff to generate, evaluate and implement ideas for energy reduction projects. An outline of the organization team was presented, with details of the small central Calgary group responsible for coordination, technical support and tracking of data. Key objectives of the team were identified as: the promotion of energy efficiency; sharing of best practices; and coordination of efforts at operations at both the development and corporate level. An outline of BP upstream operations and emissions reduction strategies was provided along with a timeline of BP Canada greenhouse gas (GHG) emissions and sustainable reductions projects. A chart representing energy savings through conversion to natural gas was also presented, sorted by project type. Results included over 400 GHG or energy reduction projects completed, with an average pay out of 30 months as well as 300,000 tonnes equivalent of GHGs reduced at an estimated value of of $13,000,000. Areas of focus for future projects include: compression; fired equipment; flaring; venting; and fugitive emissions. Strategies to reduce emissions in all areas of future research were also provided. tabs, figs.
Modeling and Prediction of Coal Ash Fusion Temperature based on BP Neural Network
Directory of Open Access Journals (Sweden)
Miao Suzhen
2016-01-01
Full Text Available Coal ash is the residual generated from combustion of coal. The ash fusion temperature (AFT of coal gives detail information on the suitability of a coal source for gasification procedures, and specifically to which extent ash agglomeration or clinkering is likely to occur within the gasifier. To investigate the contribution of oxides in coal ash to AFT, data of coal ash chemical compositions and Softening Temperature (ST in different regions of China were collected in this work and a BP neural network model was established by XD-APC PLATFORM. In the BP model, the inputs were the ash compositions and the output was the ST. In addition, the ash fusion temperature prediction model was obtained by industrial data and the model was generalized by different industrial data. Compared to empirical formulas, the BP neural network obtained better results. By different tests, the best result and the best configurations for the model were obtained: hidden layer nodes of the BP network was setted as three, the component contents (SiO2, Al2O3, Fe2O3, CaO, MgO were used as inputs and ST was used as output of the model.
Directory of Open Access Journals (Sweden)
Hosseini, S.D.
2013-12-01
Full Text Available Brucellosis is a debilitative disease that imposes costs on both economy and society. It is shown that although the vaccine can prevent abortion, it does not provide complete protection against infection. In Iran, Brucella melitensis is a common causative agent for brucellosis and BP26 protein of this bacterium having a good antigenesity and an important vaccine candidate. In this study B. melitensis bp26 gene was cloned first in to PTZ57R/T vector and accessed on the PET28a vector and sequenced. Recombinant vector transformed and expressed in to E. coli BL21 (DE3 and then recombinant protein was purified with Ni-NTA column of chromatography against His tag. Obtained rOmp28 could be used as a research experimental tool to find its potential as a detection kit and vaccine candidate.
Dai, Faxiang; Xuan, Yi; Jin, Jie-Jie; Yu, Shengjia; Long, Zi-Wen; Cai, Hong; Liu, Xiao-Wen; Zhou, Ye; Wang, Ya-Nong; Chen, Zhong; Huang, Hua
2017-04-25
C-terminal binding protein-2 (CtBP2), a transcriptional corepressor, has been reported to correlate with tumorigenesis and progression and predict a poor prognosis in several human cancers. However, few studies on CtBP2 in gastric cancer (GC) have been performed. In this research, we evaluated the correlations between CtBP2 expression and the clinicopathological characteristics, as well as prognosis of GC patients. The effects of silencing CtBP2 expression on GC cells biology activity were also assessed. The results showed that CtBP2 was overexpressed in GC tissues and closely correlated with poor differentiation, advanced tumor stage and poor prognosis in GC patients. CtBP2 induced epithelial-to-mesenchymal transition (EMT) and repressed PTEN to increase proliferation rate, migration, and invasion in GC cells. Silencing CtBP2 inhibited GC growth in nude mice model. In conclusion, CtBP2 is overexpressed in GC and may accelerate GC tumorigenesis and metastasis, which could represent an independent prognostic marker and promising therapeutic target for GC.
18 Ka BP records of climatic changes, Bay of Bengal: Isotopic and sedimentological evidences
Digital Repository Service at National Institute of Oceanography (India)
Chauhan, O.S.; Suneethi, J.
are also identified at 10.3 and 11.5 Ka BP. The later event matches well with that of the ‘Younger Dryas’ event of world climate models. The beginning of the Holocene is marked by lighter d18O values (at around 9.5 Ka BP), which has been interpreted...
Studies of the viral binding proteins of shrimp BP53, a receptor of white spot syndrome virus.
Li, Chen; Gao, Xiao-Xiao; Huang, Jie; Liang, Yan
2016-02-01
The specific binding between viral attachment proteins (VAPs) of a virus and its cellular receptors on host cells mediates virus entry into host cells, which triggers subsequent viral infections. Previous studies indicate that F1 ATP synthase β subunit (named BP53), is found on the surface of shrimp cells and involved in white spot syndrome virus (WSSV) infection by functioning as a potential viral receptor. Herein, in a far-western blotting assay, three WSSV proteins with molecular weights of 28 kDa, 37 kDa, and >50 kDa were found to interact with BP53. The 28 kDa and 37 kDa proteins were identified as the envelope protein VP28 and VP37 of WSSV respectively, which could be recognized by the polyclonal antibodies. Enzyme-linked immunosorbent binding assays revealed that VP37 contributed to almost 80% of the binding capability for BP53 compared with the same amount of total WSSV protein. The relationship between BP53 and its complementary interacting protein, VP37, was visualized using a co-localization assay. Bound VP37 on the cell surface co-localized with BP53 and shared a similar subcellular location on the outer surface of shrimp cells. Pearson's correlation coefficients reached to 0.67 ± 0.05 and the Mander's overlap coefficients reached 0.70 ± 0.05, which indicated a strong relationship between the localization of BP53 and bound rVP37. This provides evidence for an interaction between BP53 and VP37 obtained at the molecular and cellular levels, supporting the hypothesis that BP53 serves as a receptor for WSSV by binding to VP37. The identification of the viral binding proteins of shrimp BP53 is helpful for better understanding the pathogenic mechanisms of WSSV to infect shrimp at the cellular level. Copyright © 2016 Elsevier Inc. All rights reserved.
CtBP1/BARS Gly172 → Glu mutant structure: Impairing NAD(H)-binding and dimerization
International Nuclear Information System (INIS)
Nardini, Marco; Valente, Carmen; Ricagno, Stefano; Luini, Alberto; Corda, Daniela; Bolognesi, Martino
2009-01-01
C-terminal binding proteins (CtBPs) are multi-functional proteins involved in nuclear transcriptional co-repression, Golgi membrane fission, and synaptic ribbon formation. Binding of NAD(H) to CtBPs promotes dimerization. CtBP dimers act as a scaffold for multimeric protein complex formation, thus bridging transcriptional repressors and their targets in the nucleus. Based on size-exclusion chromatography experiments and on the crystal structure of the NAD(H)-free G172E CtBP mutant, we show here that absence of NAD(H) induces flexibility/backbone conformational changes at the dimerization interface and at the CtBP interdomain region. The results presented shed first light on the correlation between NAD(H)-binding and functional CtBP dimerization.
Huang, Ai; Yao, Jing; Liu, Tao; Lin, Zhenyu; Zhang, Sheng; Zhang, Tao; Ma, Hong
2018-04-01
This study aimed to investigate the influence of the expression of P53-binding protein 1 (53BP1), a key component in DNA damage repair pathways, on the radiosensitizing effect of icotinib hydrochloride in colorectal cancer and to elucidate the mechanisms underlying this influence. Real-time RT-PCR and Western blotting were performed to verify the gene-knockout effect of 53BP1 small hairpin RNA (ShRNA), and colony formation assay was employed to investigate the influence of 53BP1 downregulation on the radiosensitizing effect of icotinib hydrochloride in HCT116 cells. Cell apoptosis, cell cycle distributions, and histone H2AX (γ-H2AX) fluorescence foci after 53BP1 knockdown were evaluated. Relative protein expression in the ataxia telangiectasia mutated kinase (ATM)-checkpoint kinase-2 (CHK2)-P53 pathway was measured by Western blot analysis to unravel the molecular mechanisms linking the pathway to the above phenomena. Icotinib hydrochloride increased the radiosensitivity of HCT116 cells; however, this effect was suppressed by the downregulation of 53BP1 expression, a change that inhibited cell apoptosis, increased the percentage of HCT116 cells arrested in S-phase and inhibited the protein expression of key molecules in the ATM-CHK2-P53 apoptotic pathway. Our studies confirmed that the loss of 53BP1 serves as a negative regulator of the radiosensitizing effect of icotinib in part by suppressing the ATM-CHK2-P53 apoptotic pathway.
International Nuclear Information System (INIS)
Calitchi, E.; Pan, Q.; Diana, C.; Belkacemi, Y.; Lagrange, J.L.
2010-01-01
As Merkel tumour treatment modalities are still a matter of discussion, the authors report the experience gained on 21 patients in the radiotherapy department of the Henri Mondor Hospital between 1990 and 2005. The treatment always comprised a surgical exeresis followed by radiotherapy. The authors analyse the obtained results which confirm the interest of postoperative radiotherapy. The detailed analysis of modalities (radiation type, total dose, irradiation volume) allows an optimal irradiation scheme to be proposed. Short communication
Henry Solomon Wellcome: A philanthropist and a pioneer sponsor of medical research in the Sudan.
Adeel, Ahmed Awad A
2013-01-01
Henry Solomon Wellcome, the famous drug manufacturer had a fascinating association with the Sudan. Besides supporting tropical medicine research in this country, he established an extensive project in the Sudan that aimed at combining archeological excavations, philanthropy and social reform. This article is an archives-based account on this side of Wellcome's association with the Sudan. The article starts with Wellcome's early years in the American Midwest and the evolution of his career and his rise as a world-renowned drug manufacturer. After the battle of Omdurman, Wellcome visited Sudan in 1900 - 1901 where he offered to support the establishment of the research laboratories which later came to be known as the Wellcome Tropical Research Laboratories in Khartoum. He then became directly involved in the planning and running of extensive archeological excavations in the central Sudan. This project served as a field in which Wellcome found an outlet for his philanthropy. More than 4000 labourers were employed in Jebel Moya. Professional archeologists and anatomists were recruited by Wellcome to supervise the work, and all the requirements in terms of equipment were catered for. Wellcome devised a Savings Bank System whereby part of the earnings of each labourer were saved to him till the end of the season. He also introduced one of his innovations: aerial photography using box kite which was used for the first time in archeology. Wellcome made it a rule that no applicant should be turned away. The Camp Commandant had to find suitable work for each applicant, including the handicapped who were assigned to appropriate jobs like mending baskets or cutting grass for building huts. Wellcome's welfare work had a significant impact on the local inhabitants of Jebel Moya. Henry Solomon Wellcome, 1906. Oil painting by Hugh Goldwin Riviere. Credit: Wellcome Library.
EST Table: BP183486 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available n (Reed-Steinberg cell-expressed intermediate filament-associated protein) [Tribolium castaneum] 10/08/29 56...43 aa gnl|Amel|GB30360-PB 10/09/10 54 %/174 aa gi|189241063|ref|XP_967018.2| PREDICTED: similar to restin (Reed-Steinberg cell-expres...sed intermediate filament-associated protein) [Tribolium castaneum] FS906662 NRPG ... ...BP183486 NRPG1970 10/09/28 54 %/174 aa ref|XP_967018.2| PREDICTED: similar to resti
The Arabidopsis homolog of human G3BP1 is a key regulator of stomatal and apoplastic immunity
Abulfaraj, Aala A.; Mariappan, Kiruthiga; Bigeard, Jean; Manickam, Prabhu; Blilou, Ikram; Guo, Xiujie; Al-Babili, Salim; Pflieger, Delphine; Hirt, Heribert; Rayapuram, Naganand
2018-01-01
Mammalian Ras-GTPase–activating protein SH3-domain–binding proteins (G3BPs) are a highly conserved family of RNA-binding proteins that link kinase receptor-mediated signaling to RNA metabolism. Mammalian G3BP1 is a multifunctional protein that functions in viral immunity. Here, we show that the Arabidopsis thaliana homolog of human G3BP1 negatively regulates plant immunity. Arabidopsis g3bp1 mutants showed enhanced resistance to the virulent bacterial pathogen Pseudomonas syringae pv. tomato. Pathogen resistance was mediated in Atg3bp1 mutants by altered stomatal and apoplastic immunity. Atg3bp1 mutants restricted pathogen entry into stomates showing insensitivity to bacterial coronatine–mediated stomatal reopening. AtG3BP1 was identified as a negative regulator of defense responses, which correlated with moderate up-regulation of salicylic acid biosynthesis and signaling without growth penalty.
The Arabidopsis homolog of human G3BP1 is a key regulator of stomatal and apoplastic immunity
Abulfaraj, Aala Abdulaziz Hussien
2018-05-31
Mammalian Ras-GTPase–activating protein SH3-domain–binding proteins (G3BPs) are a highly conserved family of RNA-binding proteins that link kinase receptor-mediated signaling to RNA metabolism. Mammalian G3BP1 is a multifunctional protein that functions in viral immunity. Here, we show that the Arabidopsis thaliana homolog of human G3BP1 negatively regulates plant immunity. Arabidopsis g3bp1 mutants showed enhanced resistance to the virulent bacterial pathogen Pseudomonas syringae pv. tomato. Pathogen resistance was mediated in Atg3bp1 mutants by altered stomatal and apoplastic immunity. Atg3bp1 mutants restricted pathogen entry into stomates showing insensitivity to bacterial coronatine–mediated stomatal reopening. AtG3BP1 was identified as a negative regulator of defense responses, which correlated with moderate up-regulation of salicylic acid biosynthesis and signaling without growth penalty.
About Time. Physics, Philosophy and the Battle Between Albert Einstein and Henri Bergson
Frank, Adam
The historical relationship between physics and philosophy has had many famous high and low points. The two function best when both can challenge and support each other. In this talk I explore the famous debate between Albert Einstein and Henri Bergson over the nature of time. While history rightly judged Einstein to have won the debate in terms of relativity, there were deeper aspects of Bergsons critique that remain unappreciated. We will explore the different ways philosophy approaches the issue of time. In particular, we will look at the Continental Schools\\x9D, such as Phenomenology, which brings a unique perspective to the debate lying outside the traditional approach of physicists. From this perspective questions related to the act of being an observer, its essential subjective nature and the proper context of physics can be explored.
Energy Technology Data Exchange (ETDEWEB)
Dredge, Paula; Ives, Simon [Art Gallery of New South Wales (AGNSW), Sydney, NSW (Australia); Howard, Daryl L.; Spiers, Kathryn M. [Australian Synchrotron, Clayton, VIC (Australia); Yip, Andrew [Art Gallery of New South Wales (AGNSW), Sydney, NSW (Australia); University of New South Wales, Laboratory for Innovation in Galleries, Libraries, Archives and Museums (iGLAM), National Institute for Experimental Arts, Sydney, NSW (Australia); Kenderdine, Sarah [University of New South Wales, Laboratory for Innovation in Galleries, Libraries, Archives and Museums (iGLAM), National Institute for Experimental Arts, Sydney, NSW (Australia)
2015-11-15
A portrait of Henry VIII on oak panel c. 1535 has recently undergone technical examination to inform questions regarding authorship and the painting's relationship to a group of similar works in the collections of the National Portrait Gallery, London, and the Society of Antiquaries. Due to previous conservation treatments of the painting, the conventional transmission X-radiograph image was difficult to interpret. As a result, the painting underwent high-definition X-ray fluorescence (XRF) elemental mapping on the X-ray fluorescence microscopy beamline of the Australian Synchrotron. Scans were conducted at 12.6 and 18.5 keV, below and above the lead (Pb) L edges, respectively. Typical scan parameters were 120 μm pixel size at 7 ms dwell time, with the largest scan covering an area 545 x 287 mm{sup 2} collected in 23 h (10.8 MP). XRF mapping of the panel has guided the conservation treatment of the painting and the revelation of previously obscured features. It has also provided insight into the process of making of the painting. The informative and detailed elemental maps, alongside ultra-high-definition scans of the painting undertaken before and after varnish and over-paint removal, have assisted in comparison of the finely painted details with the London paintings. The resolution offered by the combination of imaging techniques identifies pigment distribution at an extremely fine scale, enabling a new understanding of the artist's paint application. (orig.)
International Nuclear Information System (INIS)
Dredge, Paula; Ives, Simon; Howard, Daryl L.; Spiers, Kathryn M.; Yip, Andrew; Kenderdine, Sarah
2015-01-01
A portrait of Henry VIII on oak panel c. 1535 has recently undergone technical examination to inform questions regarding authorship and the painting's relationship to a group of similar works in the collections of the National Portrait Gallery, London, and the Society of Antiquaries. Due to previous conservation treatments of the painting, the conventional transmission X-radiograph image was difficult to interpret. As a result, the painting underwent high-definition X-ray fluorescence (XRF) elemental mapping on the X-ray fluorescence microscopy beamline of the Australian Synchrotron. Scans were conducted at 12.6 and 18.5 keV, below and above the lead (Pb) L edges, respectively. Typical scan parameters were 120 μm pixel size at 7 ms dwell time, with the largest scan covering an area 545 x 287 mm 2 collected in 23 h (10.8 MP). XRF mapping of the panel has guided the conservation treatment of the painting and the revelation of previously obscured features. It has also provided insight into the process of making of the painting. The informative and detailed elemental maps, alongside ultra-high-definition scans of the painting undertaken before and after varnish and over-paint removal, have assisted in comparison of the finely painted details with the London paintings. The resolution offered by the combination of imaging techniques identifies pigment distribution at an extremely fine scale, enabling a new understanding of the artist's paint application. (orig.)
Hydraulic Pump Fault Diagnosis Control Research Based on PARD-BP Algorithm
Directory of Open Access Journals (Sweden)
LV Dongmei
2014-12-01
Full Text Available Combining working principle and failure mechanism of RZU2000HM hydraulic press, with its present fault cases being collected, the working principle of the oil pressure and faults phenomenon of the hydraulic power unit –swash-plate axial piston pump were studied with some emphasis, whose faults will directly affect the dynamic performance of the oil pressure and flow. In order to make hydraulic power unit work reliably, PARD-BP (Pruning Algorithm based Random Degree neural network fault algorithm was introduced, with swash-plate axial piston pump’s vibration fault sample data regarded as input, and fault mode matrix regarded as target output, so that PARD-BP algorithm could be trained. In the end, the vibration results were verified by the vibration modal test, and it was shown that the biggest upward peaks of vacuum pump in X-direction, Y-direction and Z- direction have fallen by 30.49 %, 21.13 % and 18.73 % respectively, so that the reliability of the fact that PARD-BP algorithm could be used for the online fault detection and diagnosis of the hydraulic pump was verified.
A Note on Child Neglect in American Victorianism: Henry James’ "The Pupil"
Directory of Open Access Journals (Sweden)
F. Gül KOÇSOY
2016-12-01
Full Text Available In this study, the theme of “neglected child” in Henry James’ “The Pupil” (1891 is explored. Morgan is a neglected child with unscrupulous parents who hold strictly on the Victorian values which reflect American cultural consciousness in the last decades of 19th century. Although he is a brilliant boy, the family does not love him; because he reminds them of their vulgarity. They neglect him physically and emotionally, seeing him as a burden. Although his tutor tries to keep the boy from the family’s corruption, he contributes to his death; he neglects his illness and deserts him when he is most needy. As an interpreter, James draws attention to the situation of children that are not working but being tutored at home. He criticizes this culture’s general attitude towards children. It is a disturbing social reality and he shows how that materialistic culture victimizes children in terms of neglectful parenting
Thomsen, Dana; Lee, Chow H.
2014-01-01
Studies on Coding Region Determinant-Binding Protein (CRD-BP) and its orthologs have confirmed their functional role in mRNA stability and localization. CRD-BP is present in extremely low levels in normal adult tissues, but it is over-expressed in many types of aggressive human cancers and in neonatal tissues. Although the exact role of CRD-BP in tumour progression is unclear, cumulative evidence suggests that its ability to physically associate with target mRNAs is an important criterion for its oncogenic role. CRD-BP has high affinity for the 3′UTR of the oncogenic CD44 mRNA and depletion of CRD-BP in cells led to destabilization of CD44 mRNA, decreased CD44 expression, reduced adhesion and disruption of invadopodia formation. Here, we further characterize the CRD-BP-CD44 RNA interaction and assess specific antisense oligonucleotides and small molecule antibiotics for their ability to inhibit the CRD-BP-CD44 RNA interaction. CRD-BP has a high affinity for binding to CD44 RNA nts 2862–3055 with a Kd of 645 nM. Out of ten antisense oligonucleotides spanning nts 2862–3055, only three antisense oligonucleotides (DD4, DD7 and DD10) were effective in competing with CRD-BP for binding to 32P-labeled CD44 RNA. The potency of DD4, DD7 and DD10 in inhibiting the CRD-BP-CD44 RNA interaction in vitro correlated with their ability to specifically reduce the steady-state level of CD44 mRNA in cells. The aminoglycoside antibiotics neomycin, paramomycin, kanamycin and streptomycin effectively inhibited the CRD-BP-CD44 RNA interaction in vitro. Assessing the potential inhibitory effect of aminoglycoside antibiotics including neomycin on the CRD-BP-CD44 mRNA interaction in cells proved difficult, likely due to their propensity to non-specifically bind nucleic acids. Our results have important implications for future studies in finding small molecules and nucleic acid-based inhibitors that interfere with protein-RNA interactions. PMID:24622399
Energy Technology Data Exchange (ETDEWEB)
Tong, Yuxin; Li, Yan [Department of Cell Biology, Key Laboratory of Cell Biology, Ministry of Public Health, and Key Laboratory of Medical Cell Biology, Ministry of Education, China Medical University, Shenyang, Liaoning 110122 (China); Gu, Hui [Department of Key Laboratory of Health Ministry for Congenital Malformation Shengjing Hospital, China Medical University, Shenyang, Liaoning 110004 (China); Wang, Chunyu [Department of Cell Biology, Key Laboratory of Cell Biology, Ministry of Public Health, and Key Laboratory of Medical Cell Biology, Ministry of Education, China Medical University, Shenyang, Liaoning 110122 (China); Liu, Funan [Department of Surgical Oncology, The First Hospital of China Medical University, Shenyang, Liaoning 110001 (China); Shao, Yangguang; Li, Jiabin; Cao, Liu [Department of Cell Biology, Key Laboratory of Cell Biology, Ministry of Public Health, and Key Laboratory of Medical Cell Biology, Ministry of Education, China Medical University, Shenyang, Liaoning 110122 (China); Li, Feng, E-mail: fli@mail.cmu.edu.cn [Department of Cell Biology, Key Laboratory of Cell Biology, Ministry of Public Health, and Key Laboratory of Medical Cell Biology, Ministry of Education, China Medical University, Shenyang, Liaoning 110122 (China)
2015-11-27
ArgBP2 is an adapter protein that plays an important role in actin-dependent processes such as cell adhesion and migration. However, its function and regulation mechanisms in gastric cancer have not yet been investigated. Here, we showed the low expression of ArgBP2 mRNA level in gastric tumor samples and its repressive function in the proliferation, migration, and invasion of gastric cancer cells. Then, we cloned and identified ArgBP2 promoter and verified that MORC2 bound to the promoter. Moreover, we demonstrated that MORC2 enhanced the recruitment of EZH2, which promoted the tri-methylation of H3K27, leading to the transcriptional repression of ArgBP2. Our results might thus contribute to understanding the molecular mechanisms of ArgBP2 regulation and suggesting ArgBP2 as a potential therapeutic target for gastric cancer. - Highlights: • ArgBP2 inhibits proliferation, migration, and invasion of gastric cancer cells. • Identification of ArgBP2 promoter and its transcription factor MORC2. • EZH2 is required in MORC2 down-regulating ArgBP2 via histone methylation.
International Nuclear Information System (INIS)
Tong, Yuxin; Li, Yan; Gu, Hui; Wang, Chunyu; Liu, Funan; Shao, Yangguang; Li, Jiabin; Cao, Liu; Li, Feng
2015-01-01
ArgBP2 is an adapter protein that plays an important role in actin-dependent processes such as cell adhesion and migration. However, its function and regulation mechanisms in gastric cancer have not yet been investigated. Here, we showed the low expression of ArgBP2 mRNA level in gastric tumor samples and its repressive function in the proliferation, migration, and invasion of gastric cancer cells. Then, we cloned and identified ArgBP2 promoter and verified that MORC2 bound to the promoter. Moreover, we demonstrated that MORC2 enhanced the recruitment of EZH2, which promoted the tri-methylation of H3K27, leading to the transcriptional repression of ArgBP2. Our results might thus contribute to understanding the molecular mechanisms of ArgBP2 regulation and suggesting ArgBP2 as a potential therapeutic target for gastric cancer. - Highlights: • ArgBP2 inhibits proliferation, migration, and invasion of gastric cancer cells. • Identification of ArgBP2 promoter and its transcription factor MORC2. • EZH2 is required in MORC2 down-regulating ArgBP2 via histone methylation.
2009-01-01
Küsimustele tänavusele üldlaulu- ja üldtantsupeole minekust ja peo repertuaari raskusest vastavad Aruküla noortekoori laulja Henri Reeder, Äksi segakoori dirigent Ly Rääsk, üldlaulupeo segakooride liigijuht Heli Jürgenson, Laulu- ja Tantsupeo SA muusikatoimetaja Ave Sopp, Laulu- ja Tantsupeo SA tantsutoimetaja Kadri Tiis , Lüganuse segakoori dirigent Priit-Andres Pärtna ja kolme tantsurühma juhendaja Vändrast Kädi Pärnoja
Kario, Kazuomi; Tomitani, Naoko; Buranakitjaroen, Peera; Chen, Chen-Huan; Chia, Yook-Chin; Divinagracia, Romeo; Park, Sungha; Shin, Jinho; Siddique, Saulat; Sison, Jorge; Soenarta, Arieska Ann; Sogunuru, Guru Prasad; Tay, Jam Chin; Turana, Yuda; Wang, Ji-Guang; Wong, Lawrence; Zhang, Yuqing; Wanthong, Sirisawat; Hoshide, Satoshi; Kanegae, Hiroshi
2018-01-01
Home blood pressure (BP) monitoring is endorsed in multiple guidelines as a valuable adjunct to office BP measurements for the diagnosis and management of hypertension. In many countries throughout Asia, physicians are yet to appreciate the significant contribution of BP variability to cardiovascular events. Furthermore, data from Japanese cohort studies have shown that there is a strong association between morning BP surge and cardiovascular events, suggesting that Asians in general may benefit from more effective control of morning BP. We designed the Asia BP@Home study to investigate the distribution of hypertension subtypes, including white-coat hypertension, masked morning hypertension, and well-controlled and uncontrolled hypertension. The study will also investigate the determinants of home BP control status evaluated by the same validated home BP monitoring device and the same standardized method of home BP measurement among 1600 or more medicated patients with hypertension from 12 countries/regions across Asia. ©2017 Wiley Periodicals, Inc.
Phase 1 remedial investigation report for 200-BP-1 operable unit. Volume 1
Energy Technology Data Exchange (ETDEWEB)
1993-09-01
The US Department of Energy (DOE) Hanford Site, in Washington State is organized into numerically designated operational areas including the 100, 200, 300, 400, 600, and 1100 Areas. The US Environmental Protection Agency (EPA), in November 1989 included the 200 Areas of the Hanford Site on the National Priority List (NPL) under the Comprehensive Environmental Response, Compensation and Liability Act of 1980 (CERCLA). Inclusion on the NPL initiated the remedial investigation (RD process for the 200-BP-1 operable unit. These efforts are being addressed through the Hanford Federal Facility Agreement and Consent Order (Ecology et al. 1989) which was negotiated and approved by the DOE, the EPA, and the State of Washington Department of Ecology (Ecology) in May 1989. This agreement, known as the Tri-Party Agreement, governs all CERCLA efforts at Hanford. In March of 1990, the Department of Energy, Richland Operations (DOE-RL) issued a Remedial Investigation/Feasibility Study (RI/FS) work plan (DOE-RL 1990a) for the 200-BP-1 operable unit. The work plan initiated the first phase of site characterization activities associated with the 200-BP-1 operable unit. The purpose of the 200-BP-1 operable unit RI is to gather and develop the necessary information to adequately understand the risks to human health and the environment posed by the site and to support the development and analysis of remedial alternatives during the FS. The RI analysis will, in turn, be used by Tri-Party Agreement signatories to make a risk-management-based selection of remedies for the releases of hazardous substances that have occurred from the 200-BP-1 operable unit.
BP fusion model for the detection of oil spills on the sea by remote sensing
Chen, Weiwei; An, Jubai; Zhang, Hande; Lin, Bin
2003-06-01
Oil spills are very serious marine pollution in many countries. In order to detect and identify the oil-spilled on the sea by remote sensor, scientists have to conduct a research work on the remote sensing image. As to the detection of oil spills on the sea, edge detection is an important technology in image processing. There are many algorithms of edge detection developed for image processing. These edge detection algorithms always have their own advantages and disadvantages in the image processing. Based on the primary requirements of edge detection of the oil spills" image on the sea, computation time and detection accuracy, we developed a fusion model. The model employed a BP neural net to fuse the detection results of simple operators. The reason we selected BP neural net as the fusion technology is that the relation between simple operators" result of edge gray level and the image"s true edge gray level is nonlinear, while BP neural net is good at solving the nonlinear identification problem. Therefore in this paper we trained a BP neural net by some oil spill images, then applied the BP fusion model on the edge detection of other oil spill images and obtained a good result. In this paper the detection result of some gradient operators and Laplacian operator are also compared with the result of BP fusion model to analysis the fusion effect. At last the paper pointed out that the fusion model has higher accuracy and higher speed in the processing oil spill image"s edge detection.
International Nuclear Information System (INIS)
Zhang Yipei
2009-01-01
Objective: To explore the feasibility of determining radiosensitivity of human tumor cell lines in vitro using the assay of mtDNA4977bp deletion. Methods: Three human tumor cell lines were selected in this study, HepG 2 , EC-9706 and MCF-7. The surviving fraction(SF), the ratio of mtDNA4977bp deletion and DNA damage were detected by MTT assay and nested PCR technique respectively. Results: MTT assay: The SF of HepG 2 and EC-9706 after irradiated by 2, 4and 8Gy was lower significantly than that of MCF-7, which showed that the radiosensitivity of HepG 2 and EC-9706 was higher than that of MCF-7. But there was no statistical difference of SF between HepG 2 and EC-9706. PCR method:The differences on mtDNA 4977bp deletion in mitochondrial DNA among HepG 2 , EC-9706 and MCF-7 were not significant after 1Gy and 4Gy γ-ray irradiation. The ratio of 4977bp deletion in mitochondrial DNA of HepG 2 and EC-9706 increased while that of MCF-7 decreased after 8Gy irradiation. The ratio of mtDNA 4977bp deletion of HepG 2 and EC-9706 was higher significantly than that of MCF-7, which implies that the radiosensitivity of HepG 2 and EC-9706 was higher than that of MCF -7. Conclusion: As a new biological marker, mtDNA4977bp deletion may be hopeful to evaluate the radiosensitivity of tumor cells more objectively and exactly. (authors)
Directory of Open Access Journals (Sweden)
Antonia Spinelli
2015-01-01
Full Text Available The Turn of the Screw by Henry James has inspired the most various critical debates for over a century. What is hidden in the folds of the story? What kind of impact does it have on the reader? Like a borderless nebula who attracts and reflects light from other stars, this novella is permeated by a vide fascinant, by a chaotic and disturbing matter “such stuff as dreams are made”. This feeling of absence and uncertainty, that characterizes the story, developed trough the contribution of readers and critics and it found a further still precious echo in The Innocents, a film directed by Jack Clayton in 1961.
Remedial investigation for the 200-BP-1 operable unit, Hanford Site, Richland, Washington
International Nuclear Information System (INIS)
Buckmaster, M.A.
1991-01-01
The Hanford Site, Richland, Washington, contains over 1500 identified waste sites that will be characterized and remediated over the next 30 years. In support of the ''Hanford Federal Facility Agreement and Consent Order,'' the US Department of Energy has initiated a remedial investigation/feasibility study (RI/FS) at the 200-BP-1 operable unit. The 200-BP-1 RI is the first Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) investigation on the Hanford Site that involves drilling into highly radioactive and chemically contaminated soils. The initial phase of the site characterization is oriented toward determining the nature and extent of any contamination present in the vicinity of the 200-BP-1 operable unit. The major focus of the Phase I RI is the drilling and sampling of 10 inactive waste disposal units which received low level radioactive liquid waste