Hamiltonian theory of vacuum helical torus lines of magnetic force
International Nuclear Information System (INIS)
Gnudi, Giovanni; Hatori, Tadatsugu
1994-01-01
For making plasma into equilibrium state, the lines of magnetic force must have magnetic surfaces. However in a helical system, space is divided into the region having magnetic surface structure and the region that does not have it. Accordingly, it is an important basic research for the plasma confinement in a helical system to examine where is the boundary of both regions and how is the large area structure of the lines of magnetic force in the boundary region. The lines of magnetic force can be treated as a Hamilton mechanics system, and it has been proved that the Hamiltonian for the lines of magnetic force can be expressed by a set of canonical variables and the function of time. In this research, the Hamiltonian that describes the lines of magnetic force of helical system torus coordination in vacuum was successfully determined concretely. Next, the development of new linear symplectic integration method was carried out. The important supports for the theory of determining Hamiltonian are Lie transformation and paraxial expansion. The procedure is explained. In Appendix, Lie transformation, Hamiltonian for the lines of magnetic force, magnetic potential, Taylor expansion of the potential, cylindrical limit approximation, helical toroidal potential and integrable model are described. (K.I.)
Alpha-helical hydrophobic polypeptides form proton-selective channels in lipid bilayers
Oliver, A. E.; Deamer, D. W.
1994-01-01
Proton translocation is important in membrane-mediated processes such as ATP-dependent proton pumps, ATP synthesis, bacteriorhodopsin, and cytochrome oxidase function. The fundamental mechanism, however, is poorly understood. To test the theoretical possibility that bundles of hydrophobic alpha-helices could provide a low energy pathway for ion translocation through the lipid bilayer, polyamino acids were incorporated into extruded liposomes and planar lipid membranes, and proton translocation was measured. Liposomes with incorporated long-chain poly-L-alanine or poly-L-leucine were found to have proton permeability coefficients 5 to 7 times greater than control liposomes, whereas short-chain polyamino acids had relatively little effect. Potassium permeability was not increased markedly by any of the polyamino acids tested. Analytical thin layer chromatography measurements of lipid content and a fluorescamine assay for amino acids showed that there were approximately 135 polyleucine or 65 polyalanine molecules associated with each liposome. Fourier transform infrared spectroscopy indicated that a major fraction of the long-chain hydrophobic peptides existed in an alpha-helical conformation. Single-channel recording in both 0.1 N HCl and 0.1 M KCl was also used to determine whether proton-conducting channels formed in planar lipid membranes (phosphatidylcholine/phosphatidylethanolamine, 1:1). Poly-L-leucine and poly-L-alanine in HCl caused a 10- to 30-fold increase in frequency of conductive events compared to that seen in KCl or by the other polyamino acids in either solution. This finding correlates well with the liposome observations in which these two polyamino acids caused the largest increase in membrane proton permeability but had little effect on potassium permeability. Poly-L-leucine was considerably more conductive than poly-L-alanine due primarily to larger event amplitudes and, to a lesser extent, a higher event frequency. Poly-L-leucine caused two
Experimental measurement of fluid force coefficients for helical tube arrays in air cross flow
International Nuclear Information System (INIS)
Shen Shifang; Liu Reilan
1993-01-01
A helical coil steam generator is extensively used in the High Temperature Gas Cooled Reactor (HTGCR) and Sodium Cooled Reactor (SCR) nuclear power stations because of its compact structure, good heat-exchange, and small volume. The experimental model is established by the structure parameter of 200MW HTGCR. The fluid elastic instability of helical tube arrays in air cross flow is studied in this experiment, and the fluid force coefficients of helical tube arrays having the same notational direction of two adjacent layers in air cross flow are obtained. As compared to the fluid force coefficients of cylinder tube arrays, the fluid force coefficients of helical tube arrays are smaller in the low velocity area, and greater in the high velocity area. The experimental results help the study of the dynamic characteristics of helical tube arrays in air cross flow
Elastin-like Polypeptide Linkers for Single-Molecule Force Spectroscopy.
Ott, Wolfgang; Jobst, Markus A; Bauer, Magnus S; Durner, Ellis; Milles, Lukas F; Nash, Michael A; Gaub, Hermann E
2017-06-27
Single-molecule force spectroscopy (SMFS) is by now well established as a standard technique in biophysics and mechanobiology. In recent years, the technique has benefitted greatly from new approaches to bioconjugation of proteins to surfaces. Indeed, optimized immobilization strategies for biomolecules and refined purification schemes are being steadily adapted and improved, which in turn has enhanced data quality. In many previously reported SMFS studies, poly(ethylene glycol) (PEG) was used to anchor molecules of interest to surfaces and/or cantilever tips. The limitation, however, is that PEG exhibits a well-known trans-trans-gauche to all-trans transition, which results in marked deviation from standard polymer elasticity models such as the worm-like chain, particularly at elevated forces. As a result, the assignment of unfolding events to protein domains based on their corresponding amino acid chain lengths is significantly obscured. Here, we provide a solution to this problem by implementing unstructured elastin-like polypeptides as linkers to replace PEG. We investigate the suitability of tailored elastin-like polypeptides linkers and perform direct comparisons to PEG, focusing on attributes that are critical for single-molecule force experiments such as linker length, monodispersity, and bioorthogonal conjugation tags. Our results demonstrate that by avoiding the ambiguous elastic response of mixed PEG/peptide systems and instead building the molecular mechanical systems with only a single bond type with uniform elastic properties, we improve data quality and facilitate data analysis and interpretation in force spectroscopy experiments. The use of all-peptide linkers allows alternative approaches for precisely defining elastic properties of proteins linked to surfaces.
Optimized molecular dynamics force fields applied to the helix-coil transition of polypeptides.
Best, Robert B; Hummer, Gerhard
2009-07-02
Obtaining the correct balance of secondary structure propensities is a central priority in protein force-field development. Given that current force fields differ significantly in their alpha-helical propensities, a correction to match experimental results would be highly desirable. We have determined simple backbone energy corrections for two force fields to reproduce the fraction of helix measured in short peptides at 300 K. As validation, we show that the optimized force fields produce results in excellent agreement with nuclear magnetic resonance experiments for folded proteins and short peptides not used in the optimization. However, despite the agreement at ambient conditions, the dependence of the helix content on temperature is too weak, a problem shared with other force fields. A fit of the Lifson-Roig helix-coil theory shows that both the enthalpy and entropy of helix formation are too small: the helix extension parameter w agrees well with experiment, but its entropic and enthalpic components are both only about half the respective experimental estimates. Our structural and thermodynamic analyses point toward the physical origins of these shortcomings in current force fields, and suggest ways to address them in future force-field development.
International Nuclear Information System (INIS)
Nagai, Niro; Sugiyama, Kenta; Takeuchi, Masanori; Yoshikawa, Shinji; Yamamoto, Fujio
2006-01-01
The helically coiled tube of heat exchanger is used for the evaporator of prototype fast breeder reactor 'Monju'. This paper aims at the grasp of two-phase flow phenomena of forced convective boiling of water inside helical coiled tube, especially focusing on oscillation phenomena of dryout point. A glass-made helically coiled tube was used to observe the inside water boiling behavior flowing upward, which was heated by high temperature oil outside the tube. This oil was also circulated through a glass made tank to provide the heat source for water evaporation. The criterion for oscillation of dryout point was found to be a function of inlet liquid velocity and hot oil temperature. The observation results suggest the mechanism of dryout point oscillation mainly consists of intensive nucleate boiling near the dryout point and evaporation of thin liquid film flowing along the helical tube. In addition, the oscillation characteristics were experimentally confirmed. As inlet liquid velocity increases, oscillation amplitude also increases but oscillation cycle does not change so much. As hot oil temperature increases, oscillation amplitude and cycle gradually decreases. (author)
Force-free state in a superconducting single crystal and angle-dependent vortex helical instability
del Valle, J.; Gomez, A.; Gonzalez, E. M.; Manas-Valero, S.; Coronado, E.; Vicent, J. L.
2017-06-01
Superconducting 2 H -NbS e2 single crystals show intrinsic low pinning values. Therefore, they are ideal materials with which to explore fundamental properties of vortices. (V , I ) characteristics are the experimental data we have used to investigate the dissipation mechanisms in a rectangular-shaped 2 H -NbS e2 single crystal. Particularly, we have studied dissipation behavior with magnetic fields applied in the plane of the crystal and parallel to the injected currents, i.e., in the force-free state where the vortex helical instability governs the vortex dynamics. In this regime, the data follow the elliptic critical state model and the voltage dissipation shows an exponential dependence, V ∝eα (I -IC ∥ ) , IC ∥ being the critical current in the force-free configuration and α a linear temperature-dependent parameter. Moreover, this exponential dependence can be observed for in-plane applied magnetic fields up to 40° off the current direction, which implies that the vortex helical instability plays a role in dissipation even out of the force-free configuration.
Design and fabrication of forced-flow superconducting poloidal coils for the Large Helical Device
International Nuclear Information System (INIS)
Nakamoto, K.; Yamamoto, T.; Mizumaki, S.; Yamakoshi, T.; Kanai, Y.; Yamamoto, K.; Wachi, Y.; Ushijima, M.; Yoshida, T.; Kai, T.; Takahata, K.; Yamamoto, J.; Satow, T.; Motojima, O.
1995-01-01
Three pairs of superconducting poloidal coils for the LHD (Large Helical Device) have been designed and fabricated using NbTi/Cu cable-in-conduit (CIC) conductors cooled with forced-flow supercritical helium (SHE). In the LHD poloidal coils, high field accuracy as well as high reliability are required. To meet these requirements, detailed field and structural analyses have been performed and key parameters including winding pattern and size and locations of conductor joints have been determined. Compact conductor joint, where NbTi filaments are directly bonded, has also been developed using the solid state bonding technique. (orig.)
Mean-field Ohm's law and coaxial helicity injection in force-free plasmas
International Nuclear Information System (INIS)
Weening, R. H.
2011-01-01
A theoretical analysis of steady-state coaxial helicity injection (CHI) in force-free plasmas is presented using a parallel mean-field Ohm's law that includes resistivity η and hyper-resistivity Λ terms. Using Boozer coordinates, a partial differential equation is derived for the time evolution of the mean-field poloidal magnetic flux, or magnetic Hamiltonian function, from the parallel mean-field Ohm's law. A general expression is obtained from the mean-field theory for the efficiency of CHI current drive in force-free plasmas. Inductances of internal energy, magnetic helicity, and poloidal magnetic flux are used to characterize axisymmetric plasma equilibria that have a model current profile. Using the model current profile, a method is suggested to determine the level of magnetohydrodynamic activity at the magnetic axis and the consequent deviation from the completely relaxed Taylor state. The mean-field Ohm's law model suggests that steady-state CHI can be viewed most simply as a boundary layer problem.
Dynamic Analysis of Helical Planetary Gear Sets under Combined Force and Moment Loading
Directory of Open Access Journals (Sweden)
Yanfang Liu
2017-01-01
Full Text Available The dynamic behavior of a single-stage planetary gear set with helical gears of multishaft automotive automatic transmissions has been studied, in which one component of the planetary gear set is imposed by additional external vertical and axial loading from countershaft gear pair in addition to the moment. Under these combined loading conditions, the contributions of the deflections of the ring gear and the carrier cannot be neglected. A three-dimensional nonlinear time-variant dynamic model considering not only the transverse, torsional, axial, and rotational motions of the gears but also the elasticity of the mounted shafts has been developed by combining the lumped parameter method with finite element method. The natural modes and the forced vibration responses due to static transmission errors have been obtained. The proposed dynamic model is employed to describe the effects of the combined external loading condition and positioning on the dynamic behavior of a four-planet system.
International Nuclear Information System (INIS)
Shi, Zhongyuan; Dong, Tao
2014-01-01
Highlights: • Variation of total entropy generation is investigated parametrically. • Pareto solution sets for heat transfer and flow friction components are obtained. • Dominant irreversibility component and impact of key variables are discussed. - Abstract: Based on the second law of thermodynamics, an entropy generation investigation is carried out under given dimensionless parameters, i.e. heat exchanger duty, heat flux, with respect to heat transfer and frictional pressure drop in a rotating helical tube heat exchanger with laminar convective flow. The entropy generation from heat transfer across a finite temperature difference – Ψ h decreases with increasing Dean number which represents the impact of centrifugal force induced secondary flow in enhancing heat transfer. Another aspect of increasing Dean number is that intensified momentum transfer in the radial direction also raises the entropy generation from frictional pressure drop – Ψ f , the superposed effect of which yields a decreasing–increasing trend of the total entropy generation-Ψ, a local minimum located in between. The rotation of the helical tube in streamwise (co-rotation) or counter streamwise (counter-rotation) direction leads to a decrease in Ψ h and a increase in Ψ f which complicates the situation that whether or where the minimum of total entropy generation exists is dependent on whether Ψ is dominated by Ψ h or Ψ f or somewhere in between. No difference is discerned between pairs of cases with constant wall temperature and uniform wall heat flux but the same set of variables and parameters. A multi-objective optimization targeting Ψ h and Ψ f simultaneously is implemented using the non-dominated sorting genetic algorithm II (NSGA II). Five solution sets are selected and compared with the conventional optimization in regard of Ψ distinguishing the Ψ h -dominated region from the Ψ f -dominated region, the dimensionless variable η 1 is found to be the most suitable
Magnetic force study for the helical afterburner for the European XFEL
Li, Peng; Wei, Tao; Li, Yuhui; Pflueger, Joachim
2017-05-01
At present the SASE3 undulator line at the European XFEL is using a planar undulator producing linear polarized soft Xray radiation only. In order to satisfy the demand for circular polarized radiation a helical undulator system, the so-called afterburner is in construction. It will be operated as a radiator using the pre-bunched beam of the SASE3 undulator system. Among several options for the magnetic structure the Apple-X geometry was chosen. This is a pure permanent magnet undulator using NdFeB material. Four magnet arrays are arranged symmetrically the beam axis. Polarization can be changed by adjusting the phase shift (PS) between the two orthogonal structures. The field strength can be adjusted either by gap adjustment or alternatively by the amplitude shift (AS) scheme. For an engineering design the maximum values of forces and torques on each of the components under worst case operational conditions are important. The superposition principle is used to reduce calculation time. It is found that the maximum forces Fx, Fy and Fz for a 2m long Apple-X undulator are 1.8*104N, 2.4*104N and 2.3*104N, respectively. More results are presented in this paper.
International Nuclear Information System (INIS)
Tadesse, Yonas; Grange, Robert W; Priya, Shashank
2009-01-01
This study focuses on the synthesis and characterization of thick and thin film polypyrrole (PPy)–metal composite actuators for application as artificial muscles in facial robotics. The fabrication method consists of three steps based upon the approach proposed by Ding et al (2003 Synth. Met. 138 391–8): (i) winding the conductive spiral structure around the platinum (Pt) wire core, (ii) deposition of PPy film on the Pt wire core, and (iii) removal of the Pt wire core. This approach yielded good performance from the synthesized actuators, but was complex to implement due to the difficulty in implementing the third step. To overcome the problem of mechanical damage occurring during withdrawal of the Pt wire, the core was replaced with a dispensable gold coated polylactide fiber that could be etched at the end of deposition step. Experimental results indicate that thin film actuators perform better in terms of response time and blocking force. A unique muscle-like structure with smoothly varying cross-section was grown by combining layer by layer deposition with changes in position and orientation of the counter electrode in reference to the working electrode
Helicity, Reconnection, and Dynamo Effects
International Nuclear Information System (INIS)
Ji, Hantao
1998-01-01
The inter-relationships between magnetic helicity, magnetic reconnection, and dynamo effects are discussed. In laboratory experiments, where two plasmas are driven to merge, the helicity content of each plasma strongly affects the reconnection rate, as well as the shape of the diffusion region. Conversely, magnetic reconnection events also strongly affect the global helicity, resulting in efficient helicity cancellation (but not dissipation) during counter-helicity reconnection and a finite helicity increase or decrease (but less efficiently than dissipation of magnetic energy) during co-helicity reconnection. Close relationships also exist between magnetic helicity and dynamo effects. The turbulent electromotive force along the mean magnetic field (alpha-effect), due to either electrostatic turbulence or the electron diamagnetic effect, transports mean-field helicity across space without dissipation. This has been supported by direct measurements of helicity flux in a laboratory plasma. When the dynamo effect is driven by electromagnetic turbulence, helicity in the turbulent field is converted to mean-field helicity. In all cases, however, dynamo processes conserve total helicity except for a small battery effect, consistent with the observation that the helicity is approximately conserved during magnetic relaxation
Nanostructured complexes of polyelectrolytes and charged polypeptides
Czech Academy of Sciences Publication Activity Database
Müller, M.; Ouyang, W.; Bohatá, Karolína; Kessler, B.
2010-01-01
Roč. 12, Sp. Iss. 9 (2010), B519-B528 ISSN 1438-1656. [Sino-German Symposium on Advanced Biomedical Nanostructures /1./. Jena, 26.10.2009-30.10.2009] Institutional research plan: CEZ:AV0Z40500505 Keywords : situ ATR-FTIR * alpha-helical polypeptides * multilayer films Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.746, year: 2010
Permanent Electric Dipole-Dipole Interactions in Lyotropic Polypeptide Liquid Crystals
MORI, Norio; Norio, MORI; Research Associate, Department of Industrial Chemistry
1981-01-01
The interaction energy between two adjacent α-helical molecules was calculated taking into account for permanent electric dipoles locating orl the helical core of a polymer mainchain in order to explain the cholesteric structure of lyotropic polypeptide liquid crystals. It was concluded that the dipole-dipole interactions were responsible for the formation of the cholesteric structure.
Pulling Helices inside Bacteria: Imperfect Helices and Rings
Allard, Jun F.; Rutenberg, Andrew D.
2009-04-01
We study steady-state configurations of intrinsically-straight elastic filaments constrained within rod-shaped bacteria that have applied forces distributed along their length. Perfect steady-state helices result from axial or azimuthal forces applied at filament ends, however azimuthal forces are required for the small pitches observed for MreB filaments within bacteria. Helix-like configurations can result from distributed forces, including coexistence between rings and imperfect helices. Levels of expression and/or bundling of the polymeric protein could mediate this coexistence.
Case, Ryan; Schollmeyer, Hauke; Kohl, Phillip; Sirota, Eric B; Pynn, Roger; Ewert, Kai E; Safinya, Cyrus R; Li, Youli
2017-12-01
Hydration forces between DNA molecules in the A- and B-Form were studied using a newly developed technique enabling simultaneous in situ control of temperature and relative humidity. X-ray diffraction data were collected from oriented calf-thymus DNA fibers in the relative humidity range of 98%-70%, during which DNA undergoes the B- to A-form transition. Coexistence of both forms was observed over a finite humidity range at the transition. The change in DNA separation in response to variation in humidity, i.e. change of chemical potential, led to the derivation of a force-distance curve with a characteristic exponential decay constant of∼2Å for both A- and B-DNA. While previous osmotic stress measurements had yielded similar force-decay constants, they were limited to B-DNA with a surface separation (wall-to-wall distance) typically>5Å. The current investigation confirms that the hydration force remains dominant even in the dry A-DNA state and at surface separation down to∼1.5Å, within the first hydration shell. It is shown that the observed chemical potential difference between the A and B states could be attributed to the water layer inside the major and minor grooves of the A-DNA double helices, which can partially interpenetrate each other in the tightly packed A phase. The humidity-controlled X-ray diffraction method described here can be employed to perform direct force measurements on a broad range of biological structures such as membranes and filamentous protein networks. Copyright © 2017 Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Nishizawa, Manami; Nishizawa, Kazuhisa
2014-01-01
Interaction of transmembrane (TM) proteins is important in many biological processes. Large-scale computational studies using coarse-grained (CG) simulations are becoming popular. However, most CG model parameters have not fully been calibrated with respect to lateral interactions of TM peptide segments. Here, we compare the potential of mean forces (PMFs) of dimerization of TM helices obtained using a MARTINI CG model and an atomistic (AT) Berger lipids-OPLS/AA model (AT OPLS ). For helical, tryptophan-flanked, leucine-rich peptides (WL15 and WALP15) embedded in a parallel configuration in an octane slab, the AT OPLS PMF profiles showed a shallow minimum (with a depth of approximately 3 kJ/mol; i.e., a weak tendency to dimerize). A similar analysis using the CHARMM36 all-atom model (AT CHARMM ) showed comparable results. In contrast, the CG analysis generally showed steep PMF curves with depths of approximately 16–22 kJ/mol, suggesting a stronger tendency to dimerize compared to the AT model. This CG > AT discrepancy in the propensity for dimerization was also seen for dilauroylphosphatidylcholine (DLPC)-embedded peptides. For a WL15 (and WALP15)/DLPC bilayer system, AT OPLS PMF showed a repulsive mean force for a wide range of interhelical distances, in contrast to the attractive forces observed in the octane system. The change from the octane slab to the DLPC bilayer also mitigated the dimerization propensity in the CG system. The dimerization energies of CG (AALALAA) 3 peptides in DLPC and dioleoylphosphatidylcholine bilayers were in good agreement with previous experimental data. The lipid headgroup, but not the length of the lipid tails, was a key causative factor contributing to the differences between octane and DLPC. Furthermore, the CG model, but not the AT model, showed high sensitivity to changes in amino acid residues located near the lipid-water interface and hydrophobic mismatch between the peptides and membrane. These findings may help interpret
DEFF Research Database (Denmark)
Damsbo, Martin; Kinnear, Brian S; Hartings, Matthew R
2004-01-01
We present an evolutionary method for finding the low-energy conformations of polypeptides. The application, called FOLDAWAY,is based on a generic framework and uses several evolutionary operators as well as local optimization to navigate the complex energy landscape of polypeptides. It maintains...... mobility measurements. It has a flat energy landscape where helical and globular conformations have similar energies. FOLDAWAY locates several large groups of structures not found in previous molecular dynamics simulations for this peptide, including compact globular conformations, which are probably...... two complementary representations of the structures and uses the CHARMM force field for evaluating the energies. The method is applied to unsolvated Met-enkephalin and Ac-(Ala-Gly-Gly)(5)-Lys(+)H(+). Unsolvated Ac-(Ala-Gly-Gly)(5)-Lys(+)H(+) has been the object of recent experimental studies using ion...
Energy Technology Data Exchange (ETDEWEB)
Barbieri, Nicholas; Lim, Khan; Durand, Magali; Baudelet, Matthieu; Richardson, Martin [Townes Laser Institute, CREOL—The College of Optics and Photonics, University of Central Florida, Orlando, Florida 32816 (United States); Hosseinimakarem, Zahra; Johnson, Eric [Micro-Photonics Laboratory – Center for Optical Material Science, Clemson, Anderson, South Carolina 29634 (United States)
2014-06-30
The shaping of laser-induced filamenting plasma channels into helical structures by guiding the process with a non-diffracting beam is demonstrated. This was achieved using a Bessel beam superposition to control the phase of an ultrafast laser beam possessing intensities sufficient to induce Kerr effect driven non-linear self-focusing. Several experimental methods were used to characterize the resulting beams and confirm the observed structures are laser air filaments.
Hanay, Saltuk
2018-01-01
There is a need for biocompatible, biodegradable, 3-D printable and stable hydrogels especially in the areas of tissue engineering, drug delivery, bio-sensing technologies and antimicrobial coatings. The main aim of this Ph.D. work was to fabricate polypeptide based hydrogel which may find a potential application in those fields. Focusing on tyrosine or tryptophan-containing copolypeptides prepared by NCarboxyanhydride (NCA) polymerizations, three different crosslinking strategies have been t...
Mosaic HIV envelope immunogenic polypeptides
Korber, Bette T. M.; Gnanakaran, S.; Perkins, Simon; Sodroski, Joseph; Haynes, Barton
2018-01-02
Disclosed herein are mosaic HIV envelope (Env) polypeptides that can elicit an immune response to HIV (such as cytotoxic T cell (CTL), helper T cell, and/or humoral responses). Also disclosed are sets of the disclosed mosaic Env polypeptides, which include two or more (for example, three) of the polypeptides. Also disclosed herein are methods for treating or inhibiting HIV in a subject including administering one or more of the disclosed immunogenic polypeptides or compositions to a subject infected with HIV or at risk of HIV infection. In some embodiments, the methods include inducing an immune response to HIV in a subject comprising administering to the subject at least one (such as two, three, or more) of the immunogenic polypeptides or at least one (such as two, three, or more) nucleic acids encoding at least one of the immunogenic polypeptides disclosed herein.
Peptides and polypeptides as scaffolds for optoelectronics and biomaterials applications
Charati, Manoj B.
effects on peptide conformation. pi-orbital interactions at the molecular level were observed to be very sensitive to intermolecular distance and orientation of the chromophores attached to the alpha-helical peptide templates. When the methylstilbene or Oxa-PPV molecules were arranged on the same side of the helix with intermolecular spacing of 6A, the chromophores interacted strongly with each other forming excimers. Such interactions were absent when the molecules were arranged on the opposite side of the helix. These peptide-templated systems therefore offer enormous opportunities for the elucidation of complex photophysical phenomena that occur in relatively aggregated morphologies of conjugated species, but under dilute solution conditions in which the number of chromphores in the aggregate can be manipulated. Part 2. Synthesis and characterization of biocompatible polypeptide elastomer. Lately, the significance of mechanical forces and biological cues involved in tissue remodeling are highly valued; thus the capacity of a biomaterial to present a fitting mechanical and biological environment for optimal tissue generation has become a key parameter for biomaterial design. In addition to having suitable mechanical properties, materials used for these applications need to be biologically active, i.e. trigger dynamic interactions with cells and stimulate explicit cell and tissue responses. Thus, we have designed a resilin-based modular biomaterial incorporating both mechanically and biologically active domains to sense and aptly respond to the bio-mechanical demand or changes in their environment. The use of resilin-like polypeptides offers access to a class of hydrophilic elastomers with excellent resilience and high frequency responsiveness, which can be used for encapsulating hydrophilic drugs like proteins for drug delivery, and provides hydrophilic extracellular matrix mimicking cell adhesive and enzyme degradable substrate for tissue engineering. Hence, we have
International Nuclear Information System (INIS)
Ogura, Isao; Nakamura, Katsuichi; Tanaka, Hiroshi; Takahashi, Katsuhiro; Ozaki, Makoto
1981-01-01
Almost the same results were obtained from the additional dipeptide, Gly-DL-Ala and DL-Ala-DL-Phe, by the γ-irradiation as previous report. Tri and tetrapeptide consisted of the same amino acid signified good stability than the others. Every polypeptide composed from sulfur contained amino acid exhaled the smell of hydrogen sulfide by the irradiation. It seemed that the stability by the difference of position of amino group in amino acid increased in order α, β, γ ... amino acid and that by the existence of hydroxyl group became smaller. (author)
Bellomo, Enrico Giuseppe
2005-07-01
Aqueous cholesteric liquid crystals using uncharged rodlike polypeptides . The aqueous, lyotropic liquid-crystalline phase behavior of an alpha helical polypeptide, has been studied using optical microscopy and X-ray scattering. Solutions of optically pure polypeptide were found to form cholesteric liquid crystals at volume fractions that decreased with increasing average chain length. At very high volume fractions, the formation of a hexagonal mesophase was observed. The pitch of the cholesteric phase could be varied by a mixture of enantiomeric samples, where the pitch increased as the mixture approached equimolar. The cholesteric phases could be untwisted, using either magnetic field or shear flow, into nematic phases, which relaxed into cholesterics upon removal of field or shear. We have found that the phase diagram of this polypeptide in aqueous solution parallels that of poly(gamma-benzyl glutamate) in organic solvents, thus providing a useful system for liquid-crystal applications requiring water as solvent. Polypeptide vesicles by conformation-specific assembly. We have found that block copolymers composed of polypeptide segments provide significant advantages in controlling both the function and supramolecular structure of bioinspired self-assemblies. Incorporation of the stable chain conformations found in proteins into block copolymers was found to provide an additional element of control, beyond amphiphilicity and composition that defines self-assembled architecture. The abundance of functionality present in amino acids, and the ease by which they can be incorporated into these materials, also provides a powerful mechanism to impart block copolypeptides with function. This combination of structure and function work synergistically to enable significant advantages in the preparation of therapeutic agents as well as provide insight into design of self-assemblies beginning to approach the complexity of natural structures such as virus capsids. Ordered
Helicity content and tokamak applications of helicity
International Nuclear Information System (INIS)
Boozer, A.H.
1986-05-01
Magnetic helicity is approximately conserved by the turbulence associated with resistive instabilities of plasmas. To generalize the application of the concept of helicity, the helicity content of an arbitrary bounded region of space will be defined. The definition has the virtues that both the helicity content and its time derivative have simple expressions in terms of the poloidal and toroidal magnetic fluxes, the average toroidal loop voltage and the electric potential on the bounding surface, and the volume integral of E-B. The application of the helicity concept to tokamak plasmas is illustrated by a discussion of so-called MHD current drive, an example of a stable tokamak q profile with q less than one in the center, and a discussion of the possibility of a natural steady-state tokamak due to the bootstrap current coupling to tearing instabilities
International Nuclear Information System (INIS)
Owada, Kimio.
1989-01-01
Helical type vacuum containers in the prior art lack in considerations for thermal expansion stresses to helical coils, and there is a possibility of coil ruptures. The object of the present invention is to avoid the rupture of helical coils wound around the outer surface of a vacuum container against heat expansion if any. That is, bellows or heat expansion absorbing means are disposed to a cross section of a helical type vacuum container. With such a constitution, thermal expansion of helical coils per se due to temperature elevation of the coils during electric supply can be absorbed by expansion of the bellows or absorption of the heat expansion absorbing means. Further, this can be attained by arranging shear pins in the direction perpendicular to the bellows axis so that the bellows are not distorted when the helical coils are wound around the helical type vacuum container. (I.S.)
Coulomb repulsion in short polypeptides.
Norouzy, Amir; Assaf, Khaleel I; Zhang, Shuai; Jacob, Maik H; Nau, Werner M
2015-01-08
Coulomb repulsion between like-charged side chains is presently viewed as a major force that impacts the biological activity of intrinsically disordered polypeptides (IDPs) by determining their spatial dimensions. We investigated short synthetic models of IDPs, purely composed of ionizable amino acid residues and therefore expected to display an extreme structural and dynamic response to pH variation. Two synergistic, custom-made, time-resolved fluorescence methods were applied in tandem to study the structure and dynamics of the acidic and basic hexapeptides Asp6, Glu6, Arg6, Lys6, and His6 between pH 1 and 12. (i) End-to-end distances were obtained from the short-distance Förster resonance energy transfer (sdFRET) from N-terminal 5-fluoro-l-tryptophan (FTrp) to C-terminal Dbo. (ii) End-to-end collision rates were obtained for the same peptides from the collision-induced fluorescence quenching (CIFQ) of Dbo by FTrp. Unexpectedly, the very high increase of charge density at elevated pH had no dynamical or conformational consequence in the anionic chains, neither in the absence nor in the presence of salt, in conflict with the common view and in partial conflict with accompanying molecular dynamics simulations. In contrast, the cationic peptides responded to ionization but with surprising patterns that mirrored the rich individual characteristics of each side chain type. The contrasting results had to be interpreted, by considering salt screening experiments, N-terminal acetylation, and simulations, in terms of an interplay of local dielectric constant and peptide-length dependent side chain charge-charge repulsion, side chain functional group solvation, N-terminal and side chain charge-charge repulsion, and side chain-side chain as well as side chain-backbone interactions. The common picture that emerged is that Coulomb repulsion between water-solvated side chains is efficiently quenched in short peptides as long as side chains are not in direct contact with each
Perlin, Pesach; Gharakhanian, Eric G; Deming, Timothy J
2018-06-12
Homoallylglycine N-carboxyanhydride, Hag NCA, monomers were synthesized and used to prepare polypeptides containing Hag segments with controllable lengths of up to 245 repeats. Poly(l-homoallylglycine), GHA, was found to adopt an α-helical conformation, which provided good solubility in organic solvents and allowed high yield functionalization of its alkene side-chains via radical promoted addition of thiols. The conformations of these derivatives were shown to be switchable between α-helical and disordered states in aqueous media using thioether alkylation or oxidation reactions. Incorporation of GHA segments into block copolymers with poly(l-methionine), M, segments provided a means to orthogonally modify thioether side-chains different ways in separate copolypeptide domains. This approach allows preparation of functional polypeptides containing discrete domains of oxidized and alkylated thioether containing residues, where chain conformation and functionality of each domain can be independently modified.
Methods for using polypeptides having cellobiohydrolase activity
Morant, Marc D; Harris, Paul
2016-08-23
The present invention relates to isolated polypeptides having cellobiohydrolase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.
NMR and rotational angles in solution conformation of polypeptides
Bystrov, V. F.
1985-01-01
Professor San-Ichiro Mizushima and Professor Yonezo Morino's classical contributions provided unique means and firm basis for understanding of conformational states and internal rotation in polypeptide molecules. Now the NMR spectroscopy is the best choice to study molecular conformation, mechanism of action and structure-functional relationships of peptide and proteins in solution under conditions approaching those of their physiological environments. Crucial details of spatial structure and interactions of these molecules in solution are revealed by using proton-proton and carbon-proton vicinal coupling constants, proton nuclear Overhauser effect and spectral perturbation techniques. The results of NMR conformational analysis are presented for valinomycin "bracelet", gramicidin A double helices, honey-bee neurotoxin apamin, scorpion insectotoxins and snake neurotoxins of long and short types.
Side-chain-controlled self-assembly of polystyrene-polypeptide miktoarm star copolymers
Junnila, Susanna
2012-03-27
We show how the self-assembly of miktoarm star copolymers can be controlled by modifying the side chains of their polypeptide arms, using A 2B and A 2B 2 type polymer/polypeptide hybrids (macromolecular chimeras). Initially synthesized PS 2PBLL and PS 2PBLL 2 (PS, polystyrene; PBLL, poly(ε-tert-butyloxycarbonyl-l-lysine) ) miktoarms were first deprotected to PS 2PLLHCl and PS 2PLLHCl 2 miktoarms (PLLHCl, poly(l-lysine hydrochloride)) and then complexed ionically with sodium dodecyl sulfonate (DS) to give the supramolecular complexes PS 2PLL(DS) and PS 2(PLL(DS)) 2. The solid-state self-assemblies of these six miktoarm systems were studied by transmission electron microscopy (TEM), Fourier transform infrared spectroscopy (FTIR), and small- and wide-angle X-ray scattering (SAXS, WAXS). The side chains of the polypeptide arms were observed to have a large effect on the solubility, polypeptide conformation, and self-assembly of the miktoarms. Three main categories were observed: (i) lamellar self-assemblies at the block copolymer length scale with packed layers of α-helices in PS 2PBLL and PS 2PBLL 2; (ii) charge-clustered polypeptide micelles with less-defined conformations in a nonordered lattice within a PS matrix in PS 2PLLHCl and PS 2PLLHCl 2; (iii) lamellar polypeptide-surfactant self-assemblies with β-sheet conformation in PS 2PLL(DS) and PS 2(PLL(DS)) 2 which dominate over the formation of block copolymer scale structures. Differences between the 3- and 4-arm systems illustrate how packing frustration between the coil-like PS arms and rigid polypeptide conformations can be relieved by the right number of arms, leading to differences in the extent of order. © 2012 American Chemical Society.
International Nuclear Information System (INIS)
Bialynicki-Birula, I.; Newmann, E.T.; Porter, J.; Winicour, J.; Lukacs, B.; Perjes, Z.; Sebestyen, A.
1981-03-01
The authors give a formal definition of the helicity operator for integral spin fields, which does not involve their momentum-space decomposition. The discussion is based upon a representation of the Pauli-Lubanski operator in terms of the action on tensor fields by the Killing vectors associated with the generators of the Poincare group. This leads to an identification of the helicity operator with the duality operator defined by the space-time alternating tensor. Helicity eigenstates then correspond to self-dual or anti-self-dual fields, in agreement with usage implicit in the literature. In addiition, the relationship between helicity eigenstates which are intrinsically non-classical, and states of right or left circular polarization in classical electrodynamics are discussed. (author)
International Nuclear Information System (INIS)
Ferrando, R.; Fiorini, G.; Beghello, A.; Cicio, G.R.; Derchi, L.E.; Consigliere, M.; Resasco, M.; Tornago, S.
1999-01-01
The purpose of this work is to investigate the possible role of Helical CT defecography in pelvic floor disorders by comparing the results of the investigations with those of conventional defecography. The series analyzed consisted of 90 patients, namely 62 women and 28 men, ranging in age 24-82 years. They were all submitted to conventional defecography, and 18 questionable cases were also studied with Helical CT defecography. The conventional examination was performed during the 4 standard phases of resting, squeezing, Valsalva and straining; it is used a remote-control unit. The parameters for Helical CT defecography were: 5 mm beam collimation, pitch 2, 120 KV, 250 m As and 18-20 degrees gantry inclination to acquire coronal images of the pelvic floor. The rectal ampulla was distended with a bolus of 300 mL nonionic iodinated contrast agent (dilution: 3g/cc). The patient wore a napkin and was seated on the table, except for those who could not hold the position and were thus examined supine. Twenty-second helical scans were performed at rest and during evacuation; multiplanar reconstructions were obtained especially on the sagittal plane for comparison with conventional defecographic images. Coronal Helical CT defecography images permitted to map the perineal floor muscles, while sagittal reconstructions provided information on the ampulla and the levator ani. To conclude, Helical CT defecography performed well in study of pelvic floor disorders and can follow conventional defecography especially in questionable cases [it
Self-assembly of a double-helical complex of sodium.
Bell, T W; Jousselin, H
1994-02-03
Spontaneous self-organization of helical and multiple-helical molecular structures occurs on several levels in living organisms. Key examples are alpha-helical polypeptides, double-helical nucleic acids and helical protein structures, including F-actin, microtubules and the protein sheath of the tobacco mosaic virus. Although the self-assembly of double-helical transition-metal complexes bears some resemblance to the molecular organization of double-stranded DNA, selection between monohelical, double-helical and triple-helical structures is determined largely by the size and geometrical preference of the tightly bound metal. Here we present an example of double-helical assembly induced by the weaker and non-directional interactions of an alkali-metal ion with an organic ligand that is pre-organized into a coil. We have characterized the resulting complex by two-dimensional NMR and fast-atom-bombardment mass spectrometry. These results provide a step toward the creation of molecular tubes or ion channels consisting of intertwined coils.
Methods for engineering polypeptide variants via somatic hypermutation and polypeptide made thereby
Tsien, Roger Y; Wang, Lei
2015-01-13
Methods using somatic hypermutation (SHM) for producing polypeptide and nucleic acid variants, and nucleic acids encoding such polypeptide variants are disclosed. Such variants may have desired properties. Also disclosed are novel polypeptides, such as improved fluorescent proteins, produced by the novel methods, and nucleic acids, vectors, and host cells comprising such vectors.
Polypeptides having catalase activity and polynucleotides encoding same
Energy Technology Data Exchange (ETDEWEB)
Liu, Ye; Duan, Junxin; Zhang, Yu; Tang, Lan
2017-05-02
Provided are isolated polypeptides having catalase activity and polynucleotides encoding the polypeptides. Also provided are nucleic acid constructs, vectors and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.
Polypeptides having xylanase activity and polynucleotides encoding same
Energy Technology Data Exchange (ETDEWEB)
Spodsberg, Nikolaj
2018-02-06
The present invention relates to isolated polypeptides having xylanase activity and polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.
He, Xun; Fan, Jingwei; Wooley, Karen L
2016-02-18
The past decade has witnessed significantly increased interest in the development of smart polypeptide-based organo- and hydrogel systems with stimuli responsiveness, especially those that exhibit sol-gel phase-transition properties, with an anticipation of their utility in the construction of adaptive materials, sensor designs, and controlled release systems, among other applications. Such developments have been facilitated by dramatic progress in controlled polymerizations of α-amino acid N-carboxyanhydrides (NCAs), together with advanced orthogonal functionalization techniques, which have enabled economical and practical syntheses of well-defined polypeptides and peptide hybrid polymeric materials. One-dimensional stacking of polypeptides or peptide aggregations in the forms of certain ordered conformations, such as α helices and β sheets, in combination with further physical or chemical cross-linking, result in the construction of three-dimensional matrices of polypeptide gel systems. The macroscopic sol-gel transitions, resulting from the construction or deconstruction of gel networks and the conformational changes between secondary structures, can be triggered by external stimuli, including environmental factors, electromagnetic fields, and (bio)chemical species. Herein, the most recent advances in polypeptide gel systems are described, covering synthetic strategies, gelation mechanisms, and stimuli-triggered sol-gel transitions, with the aim of demonstrating the relationships between chemical compositions, supramolecular structures, and responsive properties of polypeptide-based organo- and hydrogels. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
International Nuclear Information System (INIS)
Schaffer, M.J.
1997-08-01
A stabilized pinch configuration is described, consisting of a D-shaped plasma cross section wrapped tightly around a guiding axis. The open-quotes helical-Dclose quotes geometry produces a very large axial (toroidal) transform of magnetic line direction that reverses the pitch of the magnetic lines without the need of azimuthal (poloidal) plasma current. Thus, there is no need of a open-quotes dynamoclose quotes process and its associated fluctuations. The resulting configuration has the high magnetic shear and pitch reversal of the reversed field pinch (RFP). (Pitch = P = qR, where R = major radius). A helical-D pinch might demonstrate good confinement at q << 1
Glucose-dependent Insulinotropic Polypeptide
DEFF Research Database (Denmark)
Christensen, Mikkel B; Calanna, Salvatore; Holst, Jens Juul
2014-01-01
CONTEXT: Patients with type 2 diabetes mellitus (T2DM) have clinically relevant disturbances in the effects of the hormone glucose-dependent insulinotropic polypeptide (GIP). OBJECTIVE: We aimed to evaluate the importance of the prevailing plasma glucose levels for the effect of GIP on responses......: During fasting glycemia (plasma glucose ∼8 mmol/L), GIP elicited significant increments in both insulin and glucagon levels, resulting in neutral effects on plasma glucose. During insulin-induced hypoglycemia (plasma glucose ∼3 mmol/L), GIP elicited a minor early-phase insulin response and increased...... glucagon levels during the initial 30 minutes, resulting in less glucose needed to be infused to maintain the clamp (29 ± 8 vs 49 ± 12 mg × kg(-1), P glucose ∼12 mmol/L), GIP augmented insulin secretion throughout the clamp, with slightly less glucagon...
Review of the helicity formalism
International Nuclear Information System (INIS)
Barreiro, F.; Cerrada, M.; Fernandez, E.
1972-01-01
Our purpose in these notes has been to present a brief and general review of the helicity formalism. We begin by discussing Lorentz invariance, spin and helicity ideas, in section 1 . In section 2 we deal with the construction of relativistic states and scattering amplitudes in the helicity basis and we study their transformation properties under discrete symmetries. Finally we present some more sophisticated topics like kinematical singularities of helicity amplitudes, kinematical constraints and crossing relations 3, 4, 5 respectively. (Author) 8 refs
Energy Technology Data Exchange (ETDEWEB)
Beidler, C; Brakel, R; Burhenn, R; Dinklage, A; Erckmann, V; Feng, Y; Geiger, J; Hartmann, D; Hirsch, M; Jaenicke, R; Koenig, R; Laqua, H P; Maassberg, H; Wagner, F; Weller, A; Wobig, H [Max-Planck Institut fuer Plasmaphysik, EURATOM Association, Greifswald (Germany)
2012-09-15
Stellarators, conceived 1951 by Lyman Spitzer in Princeton, are toroidal devices that confine a plasma in a magnetic field which originates from currents in coils outside the plasma. A plasma current driven by external means, for example by an ohmic transformer, is not required for confinement. Supplying the desired poloidal field component by external coils leads to a helically structured plasma topology. Thus stellarators - or helical confinement devices - are fully three-dimensional in contrast to the toroidal (rotational) symmetry of tokamaks. As stellarators can be free of an inductive current, whose radial distribution depends on the plasma parameters, their equilibrium must not be established via the evolving plasma itself, but to a first order already given by the vacuum magnetic field. They do not need an active control (like positional feedback) and therefore cannot suffer from its failure. The outstanding conceptual advantage of stellarators is the potential of steady state plasma operation without current drive. As there is no need for current drive, the recirculating power is expected to be smaller than in equivalent tokamaks. The lack of a net current avoids current driven instabilities; specifically, no disruptions, no resistive wall modes and no conventional or neoclassical tearing modes appear. Second order pressure-driven currents (Pfirsch-Schlueter, bootstrap) exist but they can be modified and even minimized by the magnetic design. The magnetic configuration of helical devices naturally possesses a separatrix, which allows the implementation of a helically structured divertor for exhaust and impurity control. (author)
Coulomb double helical structure
Kamimura, Tetsuo; Ishihara, Osamu
2012-01-01
Structures of Coulomb clusters formed by dust particles in a plasma are studied by numerical simulation. Our study reveals the presence of various types of self-organized structures of a cluster confined in a prolate spheroidal electrostatic potential. The stable configurations depend on a prolateness parameter for the confining potential as well as on the number of dust particles in a cluster. One-dimensional string, two-dimensional zigzag structure and three-dimensional double helical structure are found as a result of the transition controlled by the prolateness parameter. The formation of stable double helical structures resulted from the transition associated with the instability of angular perturbations on double strings. Analytical perturbation study supports the findings of numerical simulations.
Helically linked mirror arrangement
International Nuclear Information System (INIS)
Ranjan, P.
1986-08-01
A scheme is described for helical linking of mirror sections, which endeavors to combine the better features of toroidal and mirror devices by eliminating the longitudinal loss of mirror machines, having moderately high average β and steady state operation. This scheme is aimed at a device, with closed magnetic surfaces having rotational transform for equilibrium, one or more axisymmetric straight sections for reduced radial loss, a simple geometrical axis for the links and an overall positive magnetic well depth for stability. We start by describing several other attempts at linking of mirror sections, made both in the past and the present. Then a description of our helically linked mirror scheme is given. This example has three identical straight sections connected by three sections having helical geometric axes. A theoretical analysis of the magnetic field and single-particle orbits in them leads to the conclusion that most of the passing particles would be confined in the device and they would have orbits independent of pitch angle under certain conditions. Numerical results are presented, which agree well with the theoretical results as far as passing particle orbits are concerned
Plasmoid behavior in helical plasmas
International Nuclear Information System (INIS)
Ishizaki, R.; Nakajima, N.
2009-01-01
Full text: It is well known that an ablation cloud; a high density and low temperature plasmoid, drifts to the lower field side in tokamak plasmas, which leads to a good performance on fueling in tokamak. Such a good performance, however, has not been obtained yet in the planar axis heliotron; Large Helical Device (LHD) experiments, even if a pellet has been injected from the high field side. The purpose of the study is to clarify the difference on the plasmoid motion between tokamak and LHD plasmas by using the MHD simulation including ablation processes. It is found in tokamaks that the drift motion is induced by a tire tube force and 1/R force in the major radius direction, and that the pressure and density of the plasmoid have oscillation due to fast compressional Alfven wave. On the other hand, the upper and lower portions surrounding the plasmoid center drift to the higher field side, because 1/R force by magnetic field becomes negative in the major radius direction since the magnetic field surrounding the plasmoid is accumulated by the extremely large ablation pressure and the magnetic pressure perturbation becomes positive. It is also found that the plasmoid does not drift when the perturbation of the plasmoid is small. In addition, the motion of the plasmoid is investigated in LHD plasmas in four cases that the plasmoids are initially located at the inner and outer sides of the torus on the vertically and horizontally elongated poloidal cross sections. The plasmoids drift to the lower field sides in all cases. However, in the case that it is located at the inner side of the torus on the horizontally elongated poloidal cross section, it is found that the plasmoid drifts in the negative direction of the major radius and subsequently drifts in the positive direction of it. In other words, the plasmoid finally drifts in the positive direction of the major radius the same as the plasmoid located at the outer side of the torus. This fact might be one of the
Junnila, Susanna; Hanski, Sirkku; Oakley, Richard J; Nummelin, Sami; Ruokolainen, Janne; Faul, Charl F J; Ikkala, Olli
2009-10-12
This work describes the solid-state conformational and structural properties of self-assembled polypeptide-surfactant complexes with double-tailed surfactants. Poly(L-lysine) was complexed with three dialkyl esters of phosphoric acid (i.e., phosphodiester surfactants), where the surfactant tail branching and length was varied to tune the supramolecular architecture in a facile way. After complexation with the branched surfactant bis(2-ethylhexyl) phosphate in an aqueous solution, the polypeptide chains adopted an alpha-helical conformation. These rod-like helices self-assembled into cylindrical phases with the amorphous alkyl tails pointing outward. In complexes with dioctyl phosphate and didodecyl phosphate, which have two linear n-octyl or n-dodecyl tails, respectively, the polypeptide formed antiparallel beta-sheets separated by alkyl layers, resulting in well-ordered lamellar self-assemblies. By heating, it was possible to trigger a partial opening of the beta-sheets and disruption of the lamellar phase. After repeated heating/cooling, all of these complexes also showed a glass transition between 37 and 50 degrees C. Organic solvent treatment and plasticization by overstoichiometric amount of surfactant led to structure modification in poly(L-lysine)-dioctyl phosphate complexes, PLL(diC8)(x) (x = 1.0-3.0). Here, the alpha-helical PLL is surrounded by the surfactants and these bottle-brush-like chains self-assemble in a hexagonal cylindrical morphology. As x is increased, the materials are clearly plasticized and the degree of ordering is improved: The stiff alpha-helical backbones in a softened surfactant matrix give rise to thermotropic liquid-crystalline phases. The complexes were examined by Fourier transform infrared spectroscopy, small- and wide-angle X-ray scattering, transmission electron microscopy, differential scanning calorimetry, polarized optical microscopy, and circular dichroism.
Aspects of structural landscape of human islet amyloid polypeptide
Energy Technology Data Exchange (ETDEWEB)
He, Jianfeng, E-mail: hjf@bit.edu.cn; Dai, Jin, E-mail: daijing491@gmail.com [School of Physics, Beijing Institute of Technology, Beijing 100081 (China); Li, Jing, E-mail: jinglichina@139.com [Institute of Biopharmaceutical Research, Yangtze River Pharmaceutical Group Beijing Haiyan Pharmaceutical Co., Ltd, Beijing 102206 (China); Peng, Xubiao, E-mail: xubiaopeng@gmail.com [Department of Physics and Astronomy, Uppsala University, P.O. Box 803, S-75108 Uppsala (Sweden); Niemi, Antti J., E-mail: Antti.Niemi@physics.uu.se [School of Physics, Beijing Institute of Technology, Beijing 100081 (China); Department of Physics and Astronomy, Uppsala University, P.O. Box 803, S-75108 Uppsala (Sweden); Laboratoire de Mathematiques et Physique Theorique CNRS UMR 6083, Fédération Denis Poisson, Université de Tours, Parc de Grandmont, F37200 Tours (France)
2015-01-28
The human islet amyloid polypeptide (hIAPP) co-operates with insulin to maintain glycemic balance. It also constitutes the amyloid plaques that aggregate in the pancreas of type-II diabetic patients. We have performed extensive in silico investigations to analyse the structural landscape of monomeric hIAPP, which is presumed to be intrinsically disordered. For this, we construct from first principles a highly predictive energy function that describes a monomeric hIAPP observed in a nuclear magnetic resonance experiment, as a local energy minimum. We subject our theoretical model of hIAPP to repeated heating and cooling simulations, back and forth between a high temperature regime where the conformation resembles a random walker and a low temperature limit where no thermal motions prevail. We find that the final low temperature conformations display a high level of degeneracy, in a manner which is fully in line with the presumed intrinsically disordered character of hIAPP. In particular, we identify an isolated family of α-helical conformations that might cause the transition to amyloidosis, by nucleation.
Helical Tomotherapy Quality Assurance
International Nuclear Information System (INIS)
Balog, John; Soisson, Emilie
2008-01-01
Helical tomotherapy uses a dynamic delivery in which the gantry, treatment couch, and multileaf collimator leaves are all in motion during treatment. This results in highly conformal radiotherapy, but the complexity of the delivery is partially hidden from the end-user because of the extensive integration and automation of the tomotherapy control systems. This presents a challenge to the medical physicist who is expected to be both a system user and an expert, capable of verifying relevant aspects of treatment delivery. A related issue is that a clinical tomotherapy planning system arrives at a customer's site already commissioned by the manufacturer, not by the clinical physicist. The clinical physicist and the manufacturer's representative verify the commissioning at the customer site before acceptance. Theoretically, treatment could begin immediately after acceptance. However, the clinical physicist is responsible for the safe and proper use of the machine. In addition, the therapists and radiation oncologists need to understand the important machine characteristics before treatment can proceed. Typically, treatment begins about 2 weeks after acceptance. This report presents an overview of the tomotherapy system. Helical tomotherapy has unique dosimetry characteristics, and some of those features are emphasized. The integrated treatment planning, delivery, and patient-plan quality assurance process is described. A quality assurance protocol is proposed, with an emphasis on what a clinical medical physicist could and should check. Additionally, aspects of a tomotherapy quality assurance program that could be checked automatically and remotely because of its inherent imaging system and integrated database are discussed
Silica biomineralization via the self-assembly of helical biomolecules.
Liu, Ben; Cao, Yuanyuan; Huang, Zhehao; Duan, Yingying; Che, Shunai
2015-01-21
The biomimetic synthesis of relevant silica materials using biological macromolecules as templates via silica biomineralization processes attract rapidly rising attention toward natural and artificial materials. Biomimetic synthesis studies are useful for improving the understanding of the formation mechanism of the hierarchical structures found in living organisms (such as diatoms and sponges) and for promoting significant developments in the biotechnology, nanotechnology and materials chemistry fields. Chirality is a ubiquitous phenomenon in nature and is an inherent feature of biomolecular components in organisms. Helical biomolecules, one of the most important types of chiral macromolecules, can self-assemble into multiple liquid-crystal structures and be used as biotemplates for silica biomineralization, which renders them particularly useful for fabricating complex silica materials under ambient conditions. Over the past two decades, many new silica materials with hierarchical structures and complex morphologies have been created using helical biomolecules. In this review, the developments in this field are described and the recent progress in silica biomineralization templating using several classes of helical biomolecules, including DNA, polypeptides, cellulose and rod-like viruses is summarized. Particular focus is placed on the formation mechanism of biomolecule-silica materials (BSMs) with hierarchical structures. Finally, current research challenges and future developments are discussed in the conclusion. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Salt- and pH-Triggered Helix-Coil Transition of Ionic Polypeptides under Physiology Conditions.
Yuan, Jingsong; Zhang, Yi; Sun, Yue; Cai, Zhicheng; Yang, Lijiang; Lu, Hua
2018-06-11
Controlling the helix-coil transition of polypeptides under physiological conditions is an attractive way toward smart functional materials. Here, we report the synthesis of a series of tertiary amine-functionalized ethylene glycol (EG x )-linked polypeptide electrolytes with their secondary structures tunable under physiological conditions. The resultant polymers, denoted as P(EG x DMA-Glu) ( x = 1, 2, and 3), show excellent aqueous solubility (>20 mg/mL) regardless of their charge states. Unlike poly-l-lysine that can form a helix only at pH above 10, P(EG x DMA-Glu) undergo a pH-dependent helix-coil switch with their transition points within the physiological range (pH ∼5.3-6.5). Meanwhile, P(EG x DMA-Glu) exhibit an unusual salt-induced helical conformation presumably owing to the unique properties of EG x linkers. Together, the current work highlights the importance of fine-tuning the linker chemistry in achieving conformation-switchable polypeptides and represents a facile approach toward stimuli-responsive biopolymers for advanced biological applications.
Optimization of a stellarator design including modulation of the helical winding geometry
International Nuclear Information System (INIS)
Sharp, L.E.; Petersen, L.F.; Blamey, J.W.
1979-06-01
The optimization of the helical winding geometry of the next generation of high performance stellarators is of critical importance as the current in the helical conductors must be kept to a minimum to reduce the very large electromechanical forces on the conductors. Using a modified version of the Culham computer code MAGBAT, steps towards optimization are described
Employing Helicity Amplitudes for Resummation
Moult, I.; Stewart, I.W.; Tackmann, F.J.; Waalewijn, W.J.
2015-01-01
Many state-of-the-art QCD calculations for multileg processes use helicity amplitudes as their fundamental ingredients. We construct a simple and easy-to-use helicity operator basis in soft-collinear effective theory (SCET), for which the hard Wilson coefficients from matching QCD onto SCET are
The generalized model of polypeptide chain describing the helix-coil transition in biopolymers
International Nuclear Information System (INIS)
Mamasakhlisov, E.S.; Badasyan, A.V.; Tsarukyan, A.V.; Grigoryan, A.V.; Morozov, V.F.
2005-07-01
In this paper we summarize some results of our theoretical investigations of helix-coil transition both in single-strand (polypeptides) and two-strand (polynucleotides) macromolecules. The Hamiltonian of the Generalized Model of Polypeptide Chain (GMPC) is introduced to describe the system in which the conformations are correlated over some dimensional range Δ (it equals 3 for polypeptide, because one H-bond fixes three pairs of rotation, for double strand DNA it equals to one chain rigidity because of impossibility of loop formation on the scale less than Δ). The Hamiltonian does not contain any parameter designed especially for helix-coil transition and uses pure molecular microscopic parameters (the energy of hydrogen bond formation, reduced partition function of repeated unit, the number of repeated units fixed by one hydrogen bond, the energies of interaction between the repeated units and the solvent molecules). To calculate averages we evaluate the partition function using the transfer-matrix approach. The GMPC allowed to describe the influence of a number of factors, affecting the transition, basing on a unified microscopic approach. Thus we obtained, that solvents change transition temperature and interval in different ways, depending on type of solvent and on energy of solvent- macromolecule interaction; stacking on the background of H-bonding increases stability and decreases cooperativity of melting. For heterogeneous DNA we could analytically derive well known formulae for transition temperature and interval. In the framework of GMPC we calculate and show the difference of two order parameters of helix-coil transition - the helicity degree, and the average fraction of repeated units in helical conformation. Given article has the aim to review the results obtained during twenty years in the context of GMPC. (author)
Self-assembly of hard helices: a rich and unconventional polymorphism.
Kolli, Hima Bindu; Frezza, Elisa; Cinacchi, Giorgio; Ferrarini, Alberta; Giacometti, Achille; Hudson, Toby S; De Michele, Cristiano; Sciortino, Francesco
2014-11-07
Hard helices can be regarded as a paradigmatic elementary model for a number of natural and synthetic soft matter systems, all featuring the helix as their basic structural unit, from natural polynucleotides and polypeptides to synthetic helical polymers, and from bacterial flagella to colloidal helices. Here we present an extensive investigation of the phase diagram of hard helices using a variety of methods. Isobaric Monte Carlo numerical simulations are used to trace the phase diagram; on going from the low-density isotropic to the high-density compact phases a rich polymorphism is observed, exhibiting a special chiral screw-like nematic phase and a number of chiral and/or polar smectic phases. We present full characterization of the latter, showing that they have unconventional features, ascribable to the helical shape of the constituent particles. Equal area construction is used to locate the isotropic-to-nematic phase transition, and the results are compared with those stemming from an Onsager-like theory. Density functional theory is also used to study the nematic-to-screw-nematic phase transition; within the simplifying assumption of perfectly parallel helices, we compare different levels of approximation, that is second- and third-virial expansions and a Parsons-Lee correction.
Flexible helical yarn swimmers.
Zakharov, A P; Leshansky, A M; Pismen, L M
2016-09-01
We investigate the motion of a flexible Stokesian flagellar swimmer realised as a yarn made of two intertwined elastomer fibres, one active, that can reversibly change its length in response to a local excitation causing transition to the nematic state or swelling, and the other one, a passive isotropic elastomer with identical mechanical properties. A propagating chemical wave may provide an excitation mechanism ensuring a constant length of the excited region. Generally, the swimmer moves along a helical trajectory, and the propagation and rotation velocity are very sensitive to the ratio of the excited region to the pitch of the yarn, as well as to the size of a carried load. External excitation by a moving actuating beam is less effective, unless the direction of the beam is adjusted to rotation of the swimmer.
International Nuclear Information System (INIS)
Ohyabu, N.; Watanabe, T.; Ji Hantao
1993-07-01
The Large Helical Device (LHD) now under construction is a heliotron/torsatron device with a closed divertor system. The edge LHD magnetic structure has been studied in detail. A peculiar feature of the configuration is existence of edge surface layers, a complicated three dimensional magnetic structure which does not, however, seem to hamper the expected divertor functions. Two divertor operational modes are being considered for the LHD experiment, high density, cold radiative divertor operation as a safe heat removal scheme and high temperature divertor plasma operation. In the latter operation, a divertor plasma with temperature of a few kev, generated by efficient pumping, expects to lead to significant improvement in core plasma confinement. Conceptual designs of the LHD divertor components are under way. (author)
GLYCOSYLATED YGHJ POLYPEPTIDES FROM ENTEROTOXIGENIC ESCHERICHIA COLI (ETEC)
DEFF Research Database (Denmark)
2017-01-01
The present invention relates to glycosylated YghJ polypeptides from or derived from enterotoxigenic Escherichia coli (ETEC) that are immunogenic. In particular, the present invention relates to compositions or vaccines comprising the polypeptides and their application in immunization, vaccination...
Tuning Ice Nucleation with Supercharged Polypeptides
Yang, Huige; Ma, Chao; Li, Kaiyong; Liu, Kai; Loznik, Mark; Teeuwen, Rosalie; van Hest, Jan C. M.; Zhou, Xin; Herrmann, Andreas; Wang, Jianjun
2016-01-01
Supercharged unfolded polypeptides (SUPs) are exploited for controlling ice nucleation via tuning the nature of charge and charge density of SUPs. The results show that positively charged SUPs facilitate ice nucleation, while negatively charged ones suppress it. Moreover, the charge density of the
Energy Technology Data Exchange (ETDEWEB)
Guo, Y. [School of Astronomy and Space Science and Key Laboratory of Modern Astronomy and Astrophysics in Ministry of Education, Nanjing University, Nanjing 210023 (China); Pariat, E.; Moraitis, K. [LESIA, Observatoire de Paris, PSL Research University, CNRS, Sorbonne Université, UPMC Univ. Paris 06, Univ. Paris Diderot, Sorbonne Paris Cité, F-92190 Meudon (France); Valori, G. [University College London, Mullard Space Science Laboratory, Holmbury St. Mary, Dorking, Surrey, RH5 6NT (United Kingdom); Anfinogentov, S. [Institute of Solar-Terrestrial Physics SB RAS 664033, Irkutsk, P.O. box 291, Lermontov Street, 126a (Russian Federation); Chen, F. [Max-Plank-Institut für Sonnensystemforschung, D-37077 Göttingen (Germany); Georgoulis, M. K. [Research Center for Astronomy and Applied Mathematics of the Academy of Athens, 4 Soranou Efesiou Street, 11527 Athens (Greece); Liu, Y. [W. W. Hansen Experimental Physics Laboratory, Stanford University, Stanford, CA 94305 (United States); Thalmann, J. K. [Institute of Physics, Univeristy of Graz, Universitätsplatz 5/II, A-8010 Graz (Austria); Yang, S., E-mail: guoyang@nju.edu.cn [Key Laboratory of Solar Activity, National Astronomical Observatories, Chinese Academy of Sciences, Beijing 100012 (China)
2017-05-01
We study the writhe, twist, and magnetic helicity of different magnetic flux ropes, based on models of the solar coronal magnetic field structure. These include an analytical force-free Titov–Démoulin equilibrium solution, non-force-free magnetohydrodynamic simulations, and nonlinear force-free magnetic field models. The geometrical boundary of the magnetic flux rope is determined by the quasi-separatrix layer and the bottom surface, and the axis curve of the flux rope is determined by its overall orientation. The twist is computed by the Berger–Prior formula, which is suitable for arbitrary geometry and both force-free and non-force-free models. The magnetic helicity is estimated by the twist multiplied by the square of the axial magnetic flux. We compare the obtained values with those derived by a finite volume helicity estimation method. We find that the magnetic helicity obtained with the twist method agrees with the helicity carried by the purely current-carrying part of the field within uncertainties for most test cases. It is also found that the current-carrying part of the model field is relatively significant at the very location of the magnetic flux rope. This qualitatively explains the agreement between the magnetic helicity computed by the twist method and the helicity contributed purely by the current-carrying magnetic field.
Relativistic helicity and link in Minkowski space-time
International Nuclear Information System (INIS)
Yoshida, Z.; Kawazura, Y.; Yokoyama, T.
2014-01-01
A relativistic helicity has been formulated in the four-dimensional Minkowski space-time. Whereas the relativistic distortion of space-time violates the conservation of the conventional helicity, the newly defined relativistic helicity conserves in a barotropic fluid or plasma, dictating a fundamental topological constraint. The relation between the helicity and the vortex-line topology has been delineated by analyzing the linking number of vortex filaments which are singular differential forms representing the pure states of Banach algebra. While the dimension of space-time is four, vortex filaments link, because vorticities are primarily 2-forms and the corresponding 2-chains link in four dimension; the relativistic helicity measures the linking number of vortex filaments that are proper-time cross-sections of the vorticity 2-chains. A thermodynamic force yields an additional term in the vorticity, by which the vortex filaments on a reference-time plane are no longer pure states. However, the vortex filaments on a proper-time plane remain to be pure states, if the thermodynamic force is exact (barotropic), thus, the linking number of vortex filaments conserves
Chimeric polypeptides having cellulolytic enhancing activity and polynucleotides encoding same
Wogulis, Mark; Sweeney, Matthew; Heu, Tia
2017-06-14
The present invention relates to chimeric GH61 polypeptides having cellulolytic enhancing activity. The present invention also relates to polynucleotides encoding the chimeric GH61 polypeptides; nucleic acid constructs, vectors, and host cells comprising the polynucleotides; and methods of using the chimeric GH61 polypeptides.
Polypeptides having xylanase activity and polynucleotides encoding same
Energy Technology Data Exchange (ETDEWEB)
Spodsberg, Nikolaj; Shaghasi, Tarana
2017-06-20
The present invention relates to polypeptides having xylanase activity, catalytic domains, and carbohydrate binding domains, and polynucleotides encoding the polypeptides, catalytic domains, and carbohydrate binding domains. The present invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides, catalytic domains, and carbohydrate binding domains.
Phase transitions in polypeptides: analysis of energy fluctuations
DEFF Research Database (Denmark)
Yakubovich, Alexander V.; Solov'yov, Ilia; Solov'yov, Andrey V.
2009-01-01
The helix random coil transition in alanine, valine, and leucine polypeptides consisting of 30 amino acids is studied in vacuo using the Langevin molecular dynamics approach. The influence of side chain radicals on internal energy and heat capacity of the polypeptides is discussed. The heat...... of simulation time. This study provides a comparison of methods for the description of structural transitions in polypeptides....
Polypeptides having beta-glucosidase activity and polynucleotides encoding same
Harris, Paul; Golightly, Elizabeth
2012-11-27
The present invention relates to isolated polypeptides having beta-glucosidase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods for producing and using the polypeptides.
Polypeptides having cellobiohydrolase activity and polynucleotides encoding same
Morant, Marc D.; Harris, Paul
2015-10-13
The present invention relates to isolated polypeptides having cellobiohydrolase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.
Polypeptides having cellulolytic enhancing activity and polynucleotides encoding same
Maiyuran, Suchindra; Kramer, Randall; Harris, Paul
2013-10-29
The present invention relates to isolated polypeptides having cellulolytic enhancing activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.
Polynucleotides encoding polypeptides having beta-glucosidase activity
Harris, Paul; Golightly, Elizabeth
2010-03-02
The present invention relates to isolated polypeptides having beta-glucosidase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods for producing and using the polypeptides.
Theoretical aspects of magnetic helicity
International Nuclear Information System (INIS)
Hammer, J.H.
1985-01-01
The magnetic helicity, usually defined as K=integralA.Bdv, where A is the vector potential and B the magnetic field, measures the topological linkage of magnetic fluxes. Helicity manifests itself in the twistedness and knottedness of flux tubes. Its significance is that it is an ideal MHD invariant. While the helicity formalism has proven very useful in understanding reversed field pinch and spheromak behavior, some problems exist in applying the method consistently for complex (e.g., toroidal) conductor geometries or in situations where magnetic flux penetrates conducting walls. Recent work has attempted to generalize K to allow for all possible geometries
Godbillon Vey Helicity and Magnetic Helicity in Magnetohydrodynamics
Webb, G. M.; Hu, Q.; Anco, S.; Zank, G. P.
2017-12-01
The Godbillon-Vey invariant arises in homology theory, and algebraic topology, where conditions for a layered family of 2D surfaces forms a 3D manifold were elucidated. The magnetic Godbillon-Vey helicity invariant in magnetohydrodynamics (MHD) is a helicity invariant that occurs for flows, in which the magnetic helicity density hm= A\\cdotB=0 where A is the magnetic vector potential and B is the magnetic induction. Our purpose is to elucidate the evolution of the magnetic Godbillon-Vey field η =A×B/|A|2 and the Godbillon-Vey helicity hgv}= η \\cdot∇ × η in general MHD flows in which the magnetic helicity hm≠q 0. It is shown that hm acts as a source term in the Godbillon-Vey helicity transport equation, in which hm is coupled to hgv via the shear tensor of the background flow. The transport equation for hgv depends on the electric field potential ψ , which is related to the gauge for A, which takes its simplest form for the advected A gauge in which ψ =A\\cdot u where u is the fluid velocity.
Measles virus polypeptides in purified virions and in infected cells
International Nuclear Information System (INIS)
Vainionpaeae, R.; Ziola, B.; Salmi, A.
1978-01-01
A wild-type measles virus was radiolabeled during growth in VERO cells and purified by two successive potassium tartrate gradient centrifugations. The virion polypeptide composition was determined by SDS-polyacrylamide gel electrophoresis employing two different buffer systems. Six virus-specific polypeptides were consistently detected. The largest (L) had a molecular weight (MW) of greater than 150,000. The second largest polypeptide, G (MW 79,000), was the only glycoprotein found. The proteins designated polypeptide 2 (MW 66 to 70,000) and nucleocapsid protein or NP (MW 61,000) were phosphorylated. The remaining virus-coded proteins were polypeptide 5 (MW 40,000) and the matrix or M protein (MW 37,000). Measles virions also contained a polypeptide (MW 42,000) thought to be actin due to co-migration with this component of uninfected cells. Analysis of in vitro 3 H-acetic anhydride radiolabeled virions confirmed the presence of these seven polypeptides. Acetic anhydride also labeled a protein designated polypeptide 4 (MW 53,000) which was not consistently radiolabeled in vivo, as well as several other minor proteins believed to be cellular in origin. Synthesis of the six virus-specific structural polypeptides was detected in lysates of infected cells by SDS-polyacrylamide slab gel electrophoresis. Virus specificity of polypeptide 4 could not be confirmed due to the similar MW of several cellular polypeptides. Two non-virion, but virus-specified polypeptides, of MW 38,000 and 18,000 were also detected. Synthesis of the virus structural proteins was in the same proportions as the polypeptides found in virions except for under production of polypeptide G and over production of polypeptide 2. (author)
Helicity multiplexed broadband metasurface holograms.
Wen, Dandan; Yue, Fuyong; Li, Guixin; Zheng, Guoxing; Chan, Kinlong; Chen, Shumei; Chen, Ming; Li, King Fai; Wong, Polis Wing Han; Cheah, Kok Wai; Pun, Edwin Yue Bun; Zhang, Shuang; Chen, Xianzhong
2015-09-10
Metasurfaces are engineered interfaces that contain a thin layer of plasmonic or dielectric nanostructures capable of manipulating light in a desirable manner. Advances in metasurfaces have led to various practical applications ranging from lensing to holography. Metasurface holograms that can be switched by the polarization state of incident light have been demonstrated for achieving polarization multiplexed functionalities. However, practical application of these devices has been limited by their capability for achieving high efficiency and high image quality. Here we experimentally demonstrate a helicity multiplexed metasurface hologram with high efficiency and good image fidelity over a broad range of frequencies. The metasurface hologram features the combination of two sets of hologram patterns operating with opposite incident helicities. Two symmetrically distributed off-axis images are interchangeable by controlling the helicity of the input light. The demonstrated helicity multiplexed metasurface hologram with its high performance opens avenues for future applications with functionality switchable optical devices.
Employing helicity amplitudes for resummation
International Nuclear Information System (INIS)
Moult, Ian; Stewart, Iain W.; Tackmann, Frank J.; Waalewijn, Wouter J.; Amsterdam Univ.
2015-08-01
Many state-of-the-art QCD calculations for multileg processes use helicity amplitudes as their fundamental ingredients. We construct a simple and easy-to-use helicity operator basis in soft-collinear effective theory (SCET), for which the hard Wilson coefficients from matching QCD onto SCET are directly given in terms of color-ordered helicity amplitudes. Using this basis allows one to seamlessly combine fixed-order helicity amplitudes at any order they are known with a resummation of higher-order logarithmic corrections. In particular, the virtual loop amplitudes can be employed in factorization theorems to make predictions for exclusive jet cross sections without the use of numerical subtraction schemes to handle real-virtual infrared cancellations. We also discuss matching onto SCET in renormalization schemes with helicities in 4- and d-dimensions. To demonstrate that our helicity operator basis is easy to use, we provide an explicit construction of the operator basis, as well as results for the hard matching coefficients, for pp → H+0,1,2 jets, pp → W/Z/γ+0,1,2 jets, and pp → 2,3 jets. These operator bases are completely crossing symmetric, so the results can easily be applied to processes with e + e - and e - p collisions.
Signs of helicity in solar prominences and related features
Martin, S.
This review illustrates several ways to identify the chirality (handedness) of solar prominences (filaments) from their structure and the structure of their surrounding magnetic fields in the chromosphere and corona. For prominences, these structural elements include the axial magnetic field direction, orientation of barbs, and direction of the prominence fine structure. The surrounding structures include the pattern of fibrils beneath the prominences and the pattern of coronal loops above the prominences. These ways of identifying chirality are then interpreted in terms of the formal definitions of helicity to yield a consistent set of one-to-one helicity relationships for all features. The helicity of some prominences can also be independently determined during their eruption by their fine structure, apparent crossings in the line-of-sight of different parts of the same prominence, and by large- scale twist of the prominence structure. Unlike observations of prominences (filaments) observed prior to eruption, in some cases evidence of both signs of helicity are found within the same erupting prominence. This indicates the continued application of forces on the prominences during the eruption process or the possible introduction of force(s) not present during earlier stages of their evolution.
Park, Kiwan
2017-12-01
In our conventional understanding, large-scale magnetic fields are thought to originate from an inverse cascade in the presence of magnetic helicity, differential rotation or a magneto-rotational instability. However, as recent simulations have given strong indications that an inverse cascade (transfer) may occur even in the absence of magnetic helicity, the physical origin of this inverse cascade is still not fully understood. We here present two simulations of freely decaying helical and non-helical magnetohydrodynamic (MHD) turbulence. We verified the inverse transfer of helical and non-helical magnetic fields in both cases, but we found the underlying physical principles to be fundamentally different. In the former case, the helical magnetic component leads to an inverse cascade of magnetic energy. We derived a semi-analytic formula for the evolution of large-scale magnetic field using α coefficient and compared it with the simulation data. But in the latter case, the α effect, including other conventional dynamo theories, is not suitable to describe the inverse transfer of non-helical magnetic energy. To obtain a better understanding of the physics at work here, we introduced a 'field structure model' based on the magnetic induction equation in the presence of inhomogeneities. This model illustrates how the curl of the electromotive force leads to the build up of a large-scale magnetic field without the requirement of magnetic helicity. And we applied a quasi-normal approximation to the inverse transfer of magnetic energy.
Binary polypeptide system for permanent and oriented protein immobilization
Directory of Open Access Journals (Sweden)
Bailes Julian
2010-05-01
Full Text Available Abstract Background Many techniques in molecular biology, clinical diagnostics and biotechnology rely on binary affinity tags. The existing tags are based on either small molecules (e.g., biotin/streptavidin or glutathione/GST or peptide tags (FLAG, Myc, HA, Strep-tag and His-tag. Among these, the biotin-streptavidin system is most popular due to the nearly irreversible interaction of biotin with the tetrameric protein, streptavidin. The major drawback of the stable biotin-streptavidin system, however, is that neither of the two tags can be added to a protein of interest via recombinant means (except for the Strep-tag case leading to the requirement for chemical coupling. Results Here we report a new immobilization system which utilizes two monomeric polypeptides which self-assemble to produce non-covalent yet nearly irreversible complex which is stable in strong detergents, chaotropic agents, as well as in acids and alkali. Our system is based on the core region of the tetra-helical bundle known as the SNARE (soluble N-ethylmaleimide-sensitive factor attachment protein receptor complex. This irreversible protein attachment system (IPAS uses either a shortened syntaxin helix and fused SNAP25-synaptobrevin or a fused syntaxin-synaptobrevin and SNAP25 allowing a two-component system suitable for recombinant protein tagging, capture and immobilization. We also show that IPAS is suitable for use with traditional beads and chromatography, planar surfaces and Biacore, gold nanoparticles and for protein-protein interaction in solution. Conclusions IPAS offers an alternative to chemical cross-linking, streptavidin-biotin system and to traditional peptide affinity tags and can be used for a wide range of applications in nanotechnology and molecular sciences.
TIME EVOLUTION OF CORONAL MAGNETIC HELICITY IN THE FLARING ACTIVE REGION NOAA 10930
International Nuclear Information System (INIS)
Park, Sung-Hong; Jing, Ju; Wang Haimin; Chae, Jongchul; Tan, Changyi
2010-01-01
To study the three-dimensional (3D) magnetic field topology and its long-term evolution associated with the X3.4 flare of 2006 December 13, we investigate the coronal relative magnetic helicity in the flaring active region (AR) NOAA 10930 during the time period of December 8-14. The coronal helicity is calculated based on the 3D nonlinear force-free magnetic fields reconstructed by the weighted optimization method of Wiegelmann, and is compared with the amount of helicity injected through the photospheric surface of the AR. The helicity injection is determined from the magnetic helicity flux density proposed by Pariat et al. using Solar and Heliospheric Observatory/Michelson Doppler Imager magnetograms. The major findings of this study are the following. (1) The time profile of the coronal helicity shows a good correlation with that of the helicity accumulation by injection through the surface. (2) The coronal helicity of the AR is estimated to be -4.3 x 10 43 Mx 2 just before the X3.4 flare. (3) This flare is preceded not only by a large increase of negative helicity, -3.2 x 10 43 Mx 2 , in the corona over ∼1.5 days but also by noticeable injections of positive helicity through the photospheric surface around the flaring magnetic polarity inversion line during the time period of the channel structure development. We conjecture that the occurrence of the X3.4 flare is involved with the positive helicity injection into an existing system of negative helicity.
Bai, Y.; Jia, Z. Y.; Wang, F. J.; Fu, R.; Guo, H. B.; Cheng, D.; Zhang, B. Y.
2017-06-01
Drilling is inevitable for CFRP components’ assembling process in the aviation industry. The exit damage frequently occurs and affects the load carrying capacity of components. Consequently, it is of great urgency to enhance drilling exit quality on CFRP components. The article aims to guide the reasonable choice of drill helical direction and effectively reduce exit damage. Exit observation experiments are carried out with left-hand helical, right-hand helical and straight one-shot drill drilling T800S CFRP laminates separately. The development rules of exit damage and delamination factor curves are obtained. Combined with loading conditions and fracture modes of push-out burrs, and thrust force curves, the influence of drill helical direction on exit damage development is derived. It is found that the main fracture modes for left-hand helical, right-hand helical, and straight one-shot drill are mode I, extrusive fracture, mode III respectively. Among them, mode III has the least effect on exit damage development. Meanwhile, the changing rate of thrust force is relative slow for right-hand helical and straight one-shot drill in the thrust force increasing phase of stage II, which is disadvantaged for exit damage development. Therefore, straight one-shot drill’s exit quality is the best.
Helical Birods: An Elastic Model of Helically Wound Double-Stranded Rods
Prior, Christopher
2014-03-11
© 2014, Springer Science+Business Media Dordrecht. We consider a geometrically accurate model for a helically wound rope constructed from two intertwined elastic rods. The line of contact has an arbitrary smooth shape which is obtained under the action of an arbitrary set of applied forces and moments. We discuss the general form the theory should take along with an insight into the necessary geometric or constitutive laws which must be detailed in order for the system to be complete. This includes a number of contact laws for the interaction of the two rods, in order to fit various relevant physical scenarios. This discussion also extends to the boundary and how this composite system can be acted upon by a single moment and force pair. A second strand of inquiry concerns the linear response of an initially helical rope to an arbitrary set of forces and moments. In particular we show that if the rope has the dimensions assumed of a rod in the Kirchhoff rod theory then it can be accurately treated as an isotropic inextensible elastic rod. An important consideration in this demonstration is the possible effect of varying the geometric boundary constraints; it is shown the effect of this choice becomes negligible in this limit in which the rope has dimensions similar to those of a Kirchhoff rod. Finally we derive the bending and twisting coefficients of this effective rod.
NMR structure of the glucose-dependent insulinotropic polypeptide fragment, GIP(1-30)amide
International Nuclear Information System (INIS)
Alana, Inigo; Hewage, Chandralal M.; G. Malthouse, J. Paul; Parker, Jeremy C.; Gault, Victor A.; O'Harte, Finbarr P.M.
2004-01-01
Glucose-dependent insulinotropic polypeptide is an incretin hormone that stimulates insulin secretion and reduces postprandial glycaemic excursions. The glucose-dependent action of GIP on pancreatic β-cells has attracted attention towards its exploitation as a potential drug for type 2 diabetes. Use of NMR or X-ray crystallography is vital to determine the three-dimensional structure of the peptide. Therefore, to understand the basic structural requirements for the biological activity of GIP, the solution structure of the major biologically active fragment, GIP(1-30)amide, was investigated by proton NMR spectroscopy and molecular modelling. The structure is characterised by a full length α-helical conformation between residues F 6 and A 28 . This structural information could play an important role in the design of therapeutic agents based upon GIP receptor agonists
Transport barrier in Helical system
International Nuclear Information System (INIS)
Ida, Katsumi
1998-01-01
Experiments on the transport barrier in Helical plasmas are reviewed. There are two mechanisms of transport improvement, that results in the formation of the transport barrier. One is the improvement of neoclassical transport by reducing the ripple loss with radial electric field, which exist only in helical plasma. The other is the improvement of anomalous transport due to the suppression of fluctuations associated with a radial electric field shear both in tokamak and helical plasma. The formation of the transport barrier can be triggered by the radial electric field shear associated with the transition of the radial electric field (L/H transition or ion-electron root transition) or the peaked density or the optimization of magnetic field shear. The mechanisms of transport barrier formation are also discussed. (author). 60 refs
Generalized helicity and Beltrami fields
Energy Technology Data Exchange (ETDEWEB)
Buniy, Roman V., E-mail: roman.buniy@gmail.com [Schmid College of Science, Chapman University, Orange, CA 92866 (United States); Isaac Newton Institute, University of Cambridge, Cambridge, CB3 0EH (United Kingdom); Kephart, Thomas W., E-mail: tom.kephart@gmail.com [Department of Physics and Astronomy, Vanderbilt University, Nashville, TN 37235 (United States); Isaac Newton Institute, University of Cambridge, Cambridge, CB3 0EH (United Kingdom)
2014-05-15
We propose covariant and non-abelian generalizations of the magnetic helicity and Beltrami equation. The gauge invariance, variational principle, conserved current, energy–momentum tensor and choice of boundary conditions elucidate the subject. In particular, we prove that any extremal of the Yang–Mills action functional 1/4 ∫{sub Ω}trF{sub μν}F{sup μν}d{sup 4}x subject to the local constraint ε{sup μναβ}trF{sub μν}F{sub αβ}=0 satisfies the covariant non-abelian Beltrami equation. -- Highlights: •We introduce the covariant non-abelian helicity and Beltrami equation. •The Yang–Mills action and instanton term constraint lead to the Beltrami equation. •Solutions of the Beltrami equation conserve helicity.
Generalized helicity and Beltrami fields
International Nuclear Information System (INIS)
Buniy, Roman V.; Kephart, Thomas W.
2014-01-01
We propose covariant and non-abelian generalizations of the magnetic helicity and Beltrami equation. The gauge invariance, variational principle, conserved current, energy–momentum tensor and choice of boundary conditions elucidate the subject. In particular, we prove that any extremal of the Yang–Mills action functional 1/4 ∫ Ω trF μν F μν d 4 x subject to the local constraint ε μναβ trF μν F αβ =0 satisfies the covariant non-abelian Beltrami equation. -- Highlights: •We introduce the covariant non-abelian helicity and Beltrami equation. •The Yang–Mills action and instanton term constraint lead to the Beltrami equation. •Solutions of the Beltrami equation conserve helicity
Toroidal helical quartz forming machine
International Nuclear Information System (INIS)
Hanks, K.W.; Cole, T.R.
1977-01-01
The Scyllac fusion experimental machine used 10 cm diameter smooth bore discharge tubes formed into a simple toroidal shape prior to 1974. At about that time, it was discovered that a discharge tube was required to follow the convoluted shape of the load coil. A machine was designed and built to form a fused quartz tube with a toroidal shape. The machine will accommodate quartz tubes from 5 cm to 20 cm diameter forming it into a 4 m toroidal radius with a 1 to 5 cm helical displacement. The machine will also generate a helical shape on a linear tube. Two sets of tubes with different helical radii and wavelengths have been successfully fabricated. The problems encountered with the design and fabrication of this machine are discussed
Helical instability in film blowing process: Analogy to buckling instability
Lee, Joo Sung; Kwon, Ilyoung; Jung, Hyun Wook; Hyun, Jae Chun
2017-12-01
The film blowing process is one of the most important polymer processing operations, widely used for producing bi-axially oriented film products in a single-step process. Among the instabilities observed in this film blowing process, i.e., draw resonance and helical motion occurring on the inflated film bubble, the helical instability is a unique phenomenon portraying the snake-like undulation motion of the bubble, having the period on the order of few seconds. This helical instability in the film blowing process is commonly found at the process conditions of a high blow-up ratio with too low a freezeline position and/or too high extrusion temperature. In this study, employing an analogy to the buckling instability for falling viscous threads, the compressive force caused by the pressure difference between inside and outside of the film bubble is introduced into the simulation model along with the scaling law derived from the force balance between viscous force and centripetal force of the film bubble. The simulation using this model reveals a close agreement with the experimental results of the film blowing process of polyethylene polymers such as low density polyethylene and linear low density polyethylene.
Helical axis stellarator equilibrium model
International Nuclear Information System (INIS)
Koniges, A.E.; Johnson, J.L.
1985-02-01
An asymptotic model is developed to study MHD equilibria in toroidal systems with a helical magnetic axis. Using a characteristic coordinate system based on the vacuum field lines, the equilibrium problem is reduced to a two-dimensional generalized partial differential equation of the Grad-Shafranov type. A stellarator-expansion free-boundary equilibrium code is modified to solve the helical-axis equations. The expansion model is used to predict the equilibrium properties of Asperators NP-3 and NP-4. Numerically determined flux surfaces, magnetic well, transform, and shear are presented. The equilibria show a toroidal Shafranov shift
Resonant helical fields in tokamaks
International Nuclear Information System (INIS)
Okano, V.
1990-01-01
Poincare maps of magnetic field lines of a toroidal helical system were made. The magnetic field is a linear superposition of the magnetic fields produced by a toroidal plasma in equilibrium and by external helical currents. Analytical expression for the Poincare maps was no obtained since the magnetic field do not have symmetry. In order to obtain the maps, the equation minus derivative of l vector times B vector = 0 was numerically integrated. In the Poincare maps, the principal and the secondary magnetic island were observed. (author)
Helical system. History and current state of helical research
International Nuclear Information System (INIS)
Yokoyama, Masayuki
2017-01-01
This paper described the following: (1) history of nuclear fusion research of Japan's original heliotron method, (2) worldwide development of nuclear fusion research based on helical system such as stellarator, and (3) worldwide meaning of large helical device (LHD) aiming to demonstrate the steady-state performance of heliotron type in the parameter area extrapolable to the core plasma, and research results of LHD. LHD demonstrated that the helical system is excellent in steady operation performance at the world's most advanced level. In an experiment using deuterium gas in 2017, LHD achieved to reach 120 million degrees of ion temperature, which is one index of nuclear fusion condition, demonstrated the realization of high-performance plasma capable of extrapolating to future nuclear fusion reactors, and established the foundation for full-scale research toward the realization of nuclear fusion reactor. Besides experimental research, this paper also described the helical-type stationary nuclear fusion prototype reactor, FFHR-d1, which was based on progress of large-scale simulation at the world's most advanced level. A large-scale superconducting stellarator experimental device, W7-X, with the same scale as LHD, started experiment in December 2015, whose current state is also touched on here. (A.O.)
Helicity and evanescent waves. [Energy transport velocity, helicity, Lorentz transformation
Energy Technology Data Exchange (ETDEWEB)
Agudin, J L; Platzeck, A M [La Plata Univ. Nacional (Argentina); Albano, J R [Instituto de Astronomia y Fisica del Espacio, Buenos Aires, Argentina
1978-02-20
It is shown that the projection of the angular momentum of a circularly polarized electromagnetic evanescent wave along the mean velocity of energy transport (=helicity) can be reverted by a Lorentz transformation, in spite of the fact that this velocity is c.
[New drug developments of snake venom polypeptides and progress].
Fu, Sihai; Feng, Mei; Xiong, Yan
2017-11-28
The value of snake venom polypeptides in clinical application has drawn extensive attention, and the development of snake polypeptides into new drugs with anti-tumor, anti-inflammatory, antithrombotic, analgesic or antihypertensive properties has become the recent research hotspot. With the rapid development of molecular biology and biotechnology, the mechanisms of snake venom polypeptides are also gradually clarified. Numerous studies have demonstrated that snake venom polypeptides exert their pharmacological effects by regulating ion channels, cell proliferation, apoptosis, intracellular signaling pathway, and expression of cytokine as well as binding to relevant active sites or receptors.
Helical wire stress analysis of unbonded flexible riser under irregular response
Wang, Kunpeng; Ji, Chunyan
2017-06-01
A helical wire is a critical component of an unbonded flexible riser prone to fatigue failure. The helical wire has been the focus of much research work in recent years because of the complex multilayer construction of the flexible riser. The present study establishes an analytical model for the axisymmetric and bending analyses of an unbonded flexible riser. The interlayer contact under axisymmetric loads in this model is modeled by setting radial dummy springs between adjacent layers. The contact pressure is constant during the bending response and applied to determine the slipping friction force per unit helical wire. The model tracks the axial stress around the angular position at each time step to calculate the axial force gradient, then compares the axial force gradient with the slipping friction force to judge the helical wire slipping region, which would be applied to determine the bending stiffness for the next time step. The proposed model is verified against the experimental data in the literature. The bending moment-curvature relationship under irregular response is also qualitatively discussed. The stress at the critical point of the helical wire is investigated based on the model by considering the local flexure. The results indicate that the present model can well simulate the bending stiffness variation during irregular response, which has significant effect on the stress of helical wire.
Parameterization and measurements of helical magnetic fields
International Nuclear Information System (INIS)
Fischer, W.; Okamura, M.
1997-01-01
Magnetic fields with helical symmetry can be parameterized using multipole coefficients (a n , b n ). We present a parameterization that gives the familiar multipole coefficients (a n , b n ) for straight magnets when the helical wavelength tends to infinity. To measure helical fields all methods used for straight magnets can be employed. We show how to convert the results of those measurements to obtain the desired helical multipole coefficients (a n , b n )
Applications of 2D helical vortex dynamics
DEFF Research Database (Denmark)
Okulov, Valery; Sørensen, Jens Nørkær
2010-01-01
In the paper, we show how the assumption of helical symmetry in the context of 2D helical vortices can be exploited to analyse and to model various cases of rotating flows. From theory, examples of three basic applications of 2D dynamics of helical vortices embedded in flows with helical symmetry...... of the vorticity field are addressed. These included some of the problems related to vortex breakdown, instability of far wakes behind rotors and vortex theory of ideal rotors....
ICRF heating on helical devices
International Nuclear Information System (INIS)
Rasmussen, D.A.; Lyon, J.F.; Hoffman, D.J.; Murakami, M.; England, A.C.; Wilgen, J.B.; Jaeger, E.F.; Wang, C.; Batchelor, D.B.
1995-01-01
Ion cyclotron range of frequency (ICRF) heating is currently in use on CHS and W7-AS and is a major element of the heating planned for steady state helical devices. In helical devices, the lack of a toroidal current eliminates both disruptions and the need for ICRF current drive, simplifying the design of antenna structures as compared to tokamak applications. However the survivability of plasma facing components and steady state cooling issues are directly applicable to tokamak devices. Results from LHD steady state experiments should be available on a time scale to strongly influence the next generation of steady state tokamak experiments. The helical plasma geometry provides challenges not faced with tokamak ICRF heating, including the potential for enhanced fast ion losses, impurity accumulation, limited access for antenna structures, and open magnetic field lines in the plasma edge. The present results and near term plans provide the basis for steady state ICRF heating of larger helical devices. An approach which includes direct electron, mode conversion, ion minority and ion Bernstein wave heating addresses these issues
ICRF heating on helical devices
International Nuclear Information System (INIS)
Rasmussen, D.A.; Lyon, J.F.; Hoffman, D.J.
1995-01-01
Ion cyclotron range of frequency (ICRF) heating is currently in use on CHS and W7AS and is a major element of the heating planned for steady state helical devices. In helical devices, the lack of a toroidal current eliminates both disruptions and the need for ICRF current drive, simplifying the design of antenna structures as compared to tokamak applications. However the survivability of plasma facing components and steady state cooling issues are directly applicable to tokamak devices. Results from LHD steady state experiments should be available on a time scale to strongly influence the next generation of steady state tokamak experiments. The helical plasma geometry provides challenges not faced with tokamak ICRF heating, including the potential for enhanced fast ion losses, impurity accumulation, limited access for antenna structures, and open magnetic field lines in the plasma edge. The present results and near term plans provide the basis for steady state ICRF heating of larger helical devices. An approach which includes direct electron, mode conversion, ion minority and ion Bernstein wave heating addresses these issues
The helical tomotherapy thread effect
International Nuclear Information System (INIS)
Kissick, M.W.; Fenwick, J.; James, J.A.; Jeraj, R.; Kapatoes, J.M.; Keller, H.; Mackie, T.R.; Olivera, G.; Soisson, E.T.
2005-01-01
Inherent to helical tomotherapy is a dose variation pattern that manifests as a 'ripple' (peak-to-trough relative to the average). This ripple is the result of helical beam junctioning, completely unique to helical tomotherapy. Pitch is defined as in helical CT, the couch travel distance for a complete gantry rotation relative to the axial beam width at the axis of rotation. Without scattering or beam divergence, an analytical posing of the problem as a simple integral predicts minima near a pitch of 1/n where n is an integer. A convolution-superposition dose calculator (TomoTherapy, Inc.) included all the physics needed to explore the ripple magnitude versus pitch and beam width. The results of the dose calculator and some benchmark measurements demonstrate that the ripple has sharp minima near p=0.86(1/n). The 0.86 factor is empirical and caused by a beam junctioning of the off-axis dose profiles which differ from the axial profiles as well as a long scatter tail of the profiles at depth. For very strong intensity modulation, the 0.86 factor may vary. The authors propose choosing particular minima pitches or using a second delivery that starts 180 deg off-phase from the first to reduce these ripples: 'Double threading'. For current typical pitches and beam widths, however, this effect is small and not clinically important for most situations. Certain extremely large field or high pitch cases, however, may benefit from mitigation of this effect
Badasyan, A. V.; Hayrapetyan, G. N.; Tonoyan, Sh. A.; Mamasakhlisov, Y. Sh.; Benight, A. S.; Morozov, V. F.
2009-09-01
The generalized model of polypeptide chains is extended to describe the helix-coil transition in a system comprised of two chains interacting side-by-side. The Hamiltonian of the model takes into account four possible types of interactions between repeated units of the two chains, i.e., helix-helix, helix-coil, coil-helix, and coil-coil. Analysis reveals when the energy Ihh+Icc of (h-h, c-c) interactions overwhelms the energy Ihc+Ich of mixed (h-c, c-h) interactions, the correlation length rises substantially, resulting in narrowing of the transition interval. In the opposite case, when Ihh+Icc
Effect of Sequence Blockiness on the Morphologies of Surface-grafted Elastin-like Polypeptides
Albert, Julie; Sintavanon, Kornkanok; Mays, Robin; MacEwan, Sarah; Chilkoti, Ashutosh; Genzer, Jan
2014-03-01
The inter- and intra- molecular interactions among monomeric units of copolymers and polypeptides depend strongly on monomer sequence distribution and dictate the phase behavior of these species both in solution and on surfaces. To study the relationship between sequence and phase behavior, we have designed a series of elastin-like polypeptides (ELPs) with controlled monomer sequences that mimic copolymers with various co-monomer sequence distributions and attached them covalently to silicon substrates from buffer solutions at temperatures below and above the bulk ELPs' lower critical solution temperatures (LCSTs). The dependence of ELP grafting density on solution temperature was examined by ellipsometry and the resultant surface morphologies were examined in air and under water with atomic force microscopy. Depositions performed above the LCST resulted in higher grafting densities and greater surface roughness of ELPs relative to depositions carried out below the LCST. In addition, we are using gradient substrates to examine the effect of ELP grafting density on temperature responsiveness.
Unsteady Helical Flows of a Size-Dependent Couple-Stress Fluid
Rubbab, Qammar; Mirza, Itrat Abbas; Siddique, Imran; Irshad, Saadia
2017-01-01
The helical flows of couple-stress fluids in a straight circular cylinder are studied in the framework of the newly developed, fully determinate linear couple-stress theory. The fluid flow is generated by the helical motion of the cylinder with time-dependent velocity. Also, the couple-stress vector is given on the cylindrical surface and the nonslip condition is considered. Using the integral transform method, analytical solutions to the axial velocity, azimuthal velocity, nonsymmetric force...
Measles virus-specified polypeptides in infected cells
International Nuclear Information System (INIS)
Vainionpaepae, R.
1979-01-01
The synthesis of wild-type measles virus-specified polypeptides in Vero cells in pulse-chase experiments, in cells with synchronized protein synthesis by high salt concentration, and in the presence of proteolytic enzyme inhibitors was analyzed by polyacrylamide slab-gel electrophoresis. Six major (L, G, 2, NP, 5 and M) structural polypeptides were identified in infected cells. The results of pulse-chase experiments suggested that most of the structural polypeptides were synthesized at their final length. Polypeptide M was found to be sensitive to trypsin. In TLCK-treated cells its molecular weight was about 1000-2000 daltons higher than in untreated cells. A minor virus-specific polypeptide with a molecular weight of about 23,000 was found as a very faint and diffuse band. In addition, three nonstructural polypeptides with molecular weights of 65,000, 38,000 and 18,000 were also detected. The experiments with proteolytic enzyme inhibitors and with synchronized protein synthesis suggested that the polypeptide with a molecular weight of 65,000 might be a precursor of the structural polypeptide 5. (author)
Caffeine-water-polypeptide interaction in aqueous solution
Ghabi, Habib; Dhahbi, Mahmoud
1999-04-01
The interaction of caffeine monomer with the synthetic polypeptides polyasparagine (pAg) and polyaspartic acid (pAsp) was studied by UV spectrophotometry. The results show that different types of interactions are possible depending on the nature of polypeptide. The form of the complex was discussed.
Chirality-selected phase behaviour in ionic polypeptide complexes
Perry, Sarah L.; Leon, Lorraine; Hoffmann, Kyle Q.; Kade, Matthew J.; Priftis, Dimitrios; Black, Katie A.; Wong, Derek; Klein, Ryan A.; Pierce, Charles F.; Margossian, Khatcher O.; Whitmer, Jonathan K.; Qin, Jian; de Pablo, Juan J.; Tirrell, Matthew
2015-01-01
Polyelectrolyte complexes present new opportunities for self-assembled soft matter. Factors determining whether the phase of the complex is solid or liquid remain unclear. Ionic polypeptides enable examination of the effects of stereochemistry on complex formation. Here we demonstrate that chirality determines the state of polyelectrolyte complexes, formed from mixing dilute solutions of oppositely charged polypeptides, via a combination of electrostatic and hydrogen-bonding interactions. Fluid complexes occur when at least one of the polypeptides in the mixture is racemic, which disrupts backbone hydrogen-bonding networks. Pairs of purely chiral polypeptides, of any sense, form compact, fibrillar solids with a β-sheet structure. Analogous behaviour occurs in micelles formed from polypeptide block copolymers with polyethylene oxide, where assembly into aggregates with either solid or fluid cores, and eventually into ordered phases at high concentrations, is possible. Chirality is an exploitable tool for manipulating material properties in polyelectrolyte complexation. PMID:25586861
International Nuclear Information System (INIS)
Takaghi, T.; Miya, K.; Yamada, H.; Takagi, T.
1984-01-01
The magnetomechanical behavior of superconducting helical coils for a magnetic fusion reactor was investigated experimentally and theoretically. Deformations of straight and torus type helical coils were caused due to static electromagnetic forces in the liquid helium cryostat and were analysed with the finite element computer code made here. Despite of a large scatter of experimental data due to a non-uniform friction force between the helical coil and the torus of stainless steel, the numerical results are very close to the mean value of the data. Numerical analysis of the force distribution acting on the helical coils was also performed for a Heliotron's coil system to characterize its nature. The force could be categorized conveniently as an extensional force, a tangential force and a toroidal force which correspond respectively to the kind of forces acting on toroidal field coils. Additionally, the effect of mechanical constraint on the magnetomechanical behavior is discussed and shows that the location of the constraint significantly affects the stress distributions in the coils. (orig.)
Generalized helicity and its time derivative
International Nuclear Information System (INIS)
Jarboe, T.R.; Marklin, G.J.
1985-01-01
Spheromaks can be sustained against resistive decay by helicity injection because they tend to obey the minimum energy principle. This principle states that a plasma-laden magnetic configuration will relax to a state of minimum energy subject to the constraint that the magnetic helicity is conserved. Use of helicity as a constraint on the minimization of energy was first proposed by Woltjer in connection with astrophysical phenomena. Helicity does decay on the resistive diffusion time. However, if helicity is created and made to flow continuoiusly into a confinement geometry, these additional linked fluxes can relax and sustain the configuration indefinitely against the resistive decay. In this paper we will present an extension of the definition of helicity to include systems where B vector can penetrate the boundary and the penetration can be varying in time. We then discuss the sustainment of RFPs and spheromaks in terms of helicity injection
Fibrillar dimer formation of islet amyloid polypeptides
Energy Technology Data Exchange (ETDEWEB)
Chiu, Chi-cheng [Univ. of Chicago, IL (United States); Argonne National Lab. (ANL), Argonne, IL (United States); de Pablo, Juan J. [Univ. of Chicago, IL (United States); Argonne National Lab. (ANL), Argonne, IL (United States)
2015-05-08
Amyloid deposits of human islet amyloid polypeptide (hIAPP), a 37-residue hormone co-produced with insulin, have been implicated in the development of type 2 diabetes. Residues 20 – 29 of hIAPP have been proposed to constitute the amyloidogenic core for the aggregation process, yet the segment is mostly unstructured in the mature fibril, according to solid-state NMR data. Here we use molecular simulations combined with bias-exchange metadynamics to characterize the conformational free energies of hIAPP fibrillar dimer and its derivative, pramlintide. We show that residues 20 – 29 are involved in an intermediate that exhibits transient β-sheets, consistent with recent experimental and simulation results. By comparing the aggregation of hIAPP and pramlintide, we illustrate the effects of proline residues on inhibition of the dimerization of IAPP. The mechanistic insights presented here could be useful for development of therapeutic inhibitors of hIAPP amyloid formation.
Tissue polypeptide antigen activity in cerebrospinal fluid
DEFF Research Database (Denmark)
Bach, F; Söletormos, Georg; Dombernowsky, P
1991-01-01
Tissue polypeptide antigen (TPpA) in the cerebrospinal fluid (CSF) was measured in 59 consecutive breast cancer patients with suspected central nervous system (CNS) metastases. Subsequently, we determined that 13 patients had parenchymal brain metastases, 10 had leptomeningeal carcinomatosis......, and 36 had no CNS involvement. The concentration of TPpA, which is a nonspecific marker for cell proliferation, was significantly higher in patients with CNS metastases than in those without it (P less than .0001; Mann-Whitney test). A tentative cutoff value for CNS metastases was set at 95 U/L TPp...... metastases, no correlation was found between TPpA activity in corresponding CSF and blood samples (correlation coefficient, Spearman's rho = .4; P greater than .1). In three patients treated for leptomeningeal carcinomatosis, the measurements of CSF TPpA showed correlation between the presence of tumor cells...
Smart systems related to polypeptide sequences
Directory of Open Access Journals (Sweden)
Lourdes Franco
2016-03-01
Full Text Available Increasing interest for the application of polypeptide-based smart systems in the biomedical field has developed due to the advantages given by the peptidic sequence. This is due to characteristics of these systems, which include: biocompatibility, potential control of degradation, capability to provide a rich repertoire of biologically specific interactions, feasibility to self-assemble, possibility to combine different functionalities, and capability to give an environmentally responsive behavior. Recently, applications concerning the development of these systems are receiving greater attention since a targeted and programmable release of drugs (e.g. anti-cancer agents can be achieved. Block copolymers are discussed due to their capability to render differently assembled architectures. Hybrid systems based on silica nanoparticles are also discussed. In both cases, the selected systems must be able to undergo fast changes in properties like solubility, shape, and dissociation or swelling capabilities. This review is structured in different chapters which explain the most recent advances on smart systems depending on the stimuli to which they are sensitive. Amphiphilic block copolymers based on polyanionic or polycationic peptides are, for example, typically employed for obtaining pH-responsive systems. Elastin-like polypeptides are usually used as thermoresponsive polymers, but performance can be increased by using techniques which utilize layer-by-layer electrostatic self-assembly. This approach offers a great potential to create multilayered systems, including nanocapsules, with different functionality. Recent strategies developed to get redox-, magnetic-, ultrasound-, enzyme-, light- and electric-responsive systems are extensively discussed. Finally, some indications concerning the possibilities of multi-responsive systems are discussed.
A helical scintillating fiber hodoscope
Altmeier, M; Bisplinghoff, J; Bissel, T; Bollmann, R; Busch, M; Büsser, K; Colberg, T; Demiroers, L; Diehl, O; Dohrmann, F; Engelhardt, H P; Eversheim, P D; Felden, O; Gebel, R; Glende, M; Greiff, J; Gross, A; Gross-Hardt, R; Hinterberger, F; Jahn, R; Jeske, M; Jonas, E; Krause, H; Lahr, U; Langkau, R; Lindemann, T; Lindlein, J; Maier, R; Maschuw, R; Mayer-Kuckuck, T; Meinerzhagen, A; Naehle, O; Pfuff, M; Prasuhn, D; Rohdjess, H; Rosendaal, D; Von Rossen, P; Sanz, B; Schirm, N; Schulz-Rojahn, M; Schwarz, V; Scobel, W; Thomas, S; Trelle, H J; Weise, E; Wellinghausen, A; Wiedmann, W; Woller, K; Ziegler, R
1999-01-01
A novel scintillating fiber hodoscope in helically cylindric geometry has been developed for detection of low multiplicity events of fast protons and other light charged particles in the internal target experiment EDDA at the Cooler Synchrotron COSY. The hodoscope consists of 640 scintillating fibers (2.5 mm diameter), arranged in four layers surrounding the COSY beam pipe. The fibers are helically wound in opposing directions and read out individually using 16-channel photomultipliers connected to a modified commercial encoding system. The detector covers an angular range of 9 deg. <= THETA<=72 deg. and 0 deg. <=phi (cursive,open) Greek<=360 deg. in the lab frame. The detector length is 590 mm, the inner diameter 161 mm. Geometry and granularity of the hodoscope afford a position resolution of about 1.3 mm. The detector design took into consideration a maximum of reliability and a minimum of maintenance. An LED array may be used for monitoring purposes. (author)
Helical CT of ureteral disease
International Nuclear Information System (INIS)
Cikman, Pablo; Bengio, Ruben; Bulacio, Javier; Zirulnik, Esteban; Garimaldi, Jorge
2000-01-01
Among the new applications of helical CT is the study of the ureteral pathology. The objective of this paper was to evaluate patients with suspected pathology of this organ and the repercussion in the therapeutic plans. We studied 23 patients with a helical CT protocol, without IV contrast injection and performed multiplanar reconstruction (MPR). We called this procedure Pielo CT. Thirteen ureteral stones were detected, 6 calculi, 2 urinary tract tumors, dilatation of the system in a patient with neo-bladder. In 2 patients, in whom ureteral pathology was ruled out, we found other alterations that explained the symptoms, (gallbladder stones, disk protrusion). The Pielo CT let decide a therapeutical approach in 20 or 21 patients with ureteral pathology. (author)
Cylindrical Taylor states conserving total absolute magnetic helicity
Low, B. C.; Fang, F.
2014-09-01
The Taylor state of a three-dimensional (3D) magnetic field in an upright cylindrical domain V is derived from first principles as an extremum of the total magnetic energy subject to a conserved, total absolute helicity Habs. This new helicity [Low, Phys. Plasmas 18, 052901 (2011)] is distinct from the well known classical total helicity and relative total helicity in common use to describe wholly-contained and anchored fields, respectively. A given field B, tangential along the cylindrical side of V, may be represented as a unique linear superposition of two flux systems, an axially extended system along V and a strictly transverse system carrying information on field-circulation. This specialized Chandrasekhar-Kendall representation defines Habs and permits a neat formulation of the boundary-value problem (BVP) for the Taylor state as a constant-α force-free field, treating 3D wholly-contained and anchored fields on the same conceptual basis. In this formulation, the governing equation is a scalar integro-partial differential equation (PDE). A family of series solutions for an anchored field is presented as an illustration of this class of BVPs. Past treatments of the constant-α field in 3D cylindrical geometry are based on a scalar Helmholtz PDE as the governing equation, with issues of inconsistency in the published field solutions discussed over time in the journal literature. The constant-α force-free equation reduces to a scalar Helmholtz PDE only as special cases of the 3D integro-PDE derived here. In contrast, the constant-α force-free equation and the scalar Helmholtz PDE are absolutely equivalent in the spherical domain as discussed in Appendix. This theoretical study is motivated by the investigation of the Sun's corona but the results are also relevant to laboratory plasmas.
Helicity formalism and spin effects
International Nuclear Information System (INIS)
Anselmino, M.; Caruso, F.; Piovano, U.
1990-01-01
The helicity formalism and the technique to compute amplitudes for interaction processes involving leptons, quarks, photons and gluons are reviewed. Explicit calculations and examples of exploitation of symmetry properties are shown. The formalism is then applied to the discussion of several hadronic processes and spin effects: the experimental data, when related to the properties of the elementary constituent interactions, show many not understood features. Also the nucleon spin problem is briefly reviewed. (author)
Radiation characteristics of helical tomotherapy
International Nuclear Information System (INIS)
Jeraj, Robert; Mackie, Thomas R.; Balog, John; Olivera, Gustavo; Pearson, Dave; Kapatoes, Jeff; Ruchala, Ken; Reckwerdt, Paul
2004-01-01
Helical tomotherapy is a dedicated intensity modulated radiation therapy (IMRT) system with on-board imaging capability (MVCT) and therefore differs from conventional treatment units. Different design goals resulted in some distinctive radiation field characteristics. The most significant differences in the design are the lack of flattening filter, increased shielding of the collimators, treatment and imaging operation modes and narrow fan beam delivery. Radiation characteristics of the helical tomotherapy system, sensitivity studies of various incident electron beam parameters and radiation safety analyses are presented here. It was determined that the photon beam energy spectrum of helical tomotherapy is similar to that of more conventional radiation treatment units. The two operational modes of the system result in different nominal energies of the incident electron beam with approximately 6 MeV and 3.5 MeV in the treatment and imaging modes, respectively. The off-axis mean energy dependence is much lower than in conventional radiotherapy units with less than 5% variation across the field, which is the consequence of the absent flattening filter. For the same reason the transverse profile exhibits the characteristic conical shape resulting in a 2-fold increase of the beam intensity in the center. The radiation leakage outside the field was found to be negligible at less than 0.05% because of the increased shielding of the collimators. At this level the in-field scattering is a dominant source of the radiation outside the field and thus a narrow field treatment does not result in the increased leakage. The sensitivity studies showed increased sensitivity on the incident electron position because of the narrow fan beam delivery and high sensitivity on the incident electron energy, as common to other treatment systems. All in all, it was determined that helical tomotherapy is a system with some unique radiation characteristics, which have been to a large extent
Banerjee, Raja; Sheet, Tridip
2017-11-01
Circular dichroism (CD) spectroscopy represents an important tool for characterization of the peptide and protein secondary structures that mainly arise from the conformational disposition of the peptide backbone in solution. In 1991 Manning and Woody proposed that, in addition to the signal intensity, the ratio between [θ]nπ* and [θ]ππ*ǁ ((R 2 ) ≅ [θ] 222 /[θ] 208 ), along with [θ]ππ*⊥ and [θ]ππ*ǁ ((R 1 ) ≅ [θ] 192 /[θ] 208 ), may be utilized towards identifying the peptide/protein conformation (especially 3 10 - and α-helices). However, till date the use of the ratiometric ellipticity component for helical structure analysis of peptides and proteins has not been reported. We studied a series of temperature dependent CD spectra of a thermally stable, model helical peptide and its related analogs in water as a function of added 2,2,2-trifluoroethanol (TFE) in order to explore their landscape of helicity. For the first time, we have experimentally shown here that the R 1 parameter can characterize better the individual helices, while the other parameter R 2 and the signal intensity do not always converge. We emphasize the use of the R 1 ratio of ellipticities for helical characterization because of the common origin of these two bands (exciton splitting of the amide π→ π* transition in a helical polypeptide). This approach may become worthwhile and timely with the increasing accessibility of CD synchrotron sources. © 2017 Wiley Periodicals, Inc.
Helical Antimicrobial Sulfono- {gamma} -AApeptides
Energy Technology Data Exchange (ETDEWEB)
Li, Yaqiong; Wu, Haifan; Teng, Peng; Bai, Ge; Lin, Xiaoyang; Zuo, Xiaobing; Cao, Chuanhai; Cai, Jianfeng
2015-06-11
Host-defense peptides (HDPs) such as magainin 2 have emerged as potential therapeutic agents combating antibiotic resistance. Inspired by their structures and mechanism of action, herein we report the fi rst example of antimicrobial helical sulfono- γ - AApeptide foldamers. The lead molecule displays broad-spectrum and potent antimicrobial activity against multi-drug-resistant Gram- positive and Gram-negative bacterial pathogens. Time-kill studies and fl uorescence microscopy suggest that sulfono- γ -AApeptides eradicate bacteria by taking a mode of action analogous to that of HDPs. Clear structure - function relationships exist in the studied sequences. Longer sequences, presumably adopting more-de fi ned helical structures, are more potent than shorter ones. Interestingly, the sequence with less helical propensity in solution could be more selective than the stronger helix-forming sequences. Moreover, this class of antimicrobial agents are resistant to proteolytic degradation. These results may lead to the development of a new class of antimicrobial foldamers combating emerging antibiotic-resistant pathogens.
Magnetic helicity and active filament configuration
Romano, P.; Zuccarello, F.; Poedts, S.; Soenen, A.; Zuccarello, F. P.
2009-11-01
Context: The role of magnetic helicity in active filament formation and destabilization is still under debate. Aims: Although active filaments usually show a sigmoid shape and a twisted configuration before and during their eruption, it is unclear which mechanism leads to these topologies. In order to provide an observational contribution to clarify these issues, we describe a filament evolution whose characteristics seem to be directly linked to the magnetic helicity transport in corona. Methods: We applied different methods to determine the helicity sign and the chirality of the filament magnetic field. We also computed the magnetic helicity transport rate at the filament footpoints. Results: All the observational signatures provided information on the positive helicity and sinistral chirality of the flux rope containing the filament material: its forward S shape, the orientation of its barbs, the bright and dark threads at 195 Å. Moreover, the magnetic helicity transport rate at the filament footpoints showed a clear accumulation of positive helicity. Conclusions: The study of this event showed a correspondence between several signatures of the sinistral chirality of the filament and several evidences of the positive magnetic helicity of the filament magnetic field. We also found that the magnetic helicity transported along the filament footpoints showed an increase just before the change of the filament shape observed in Hα images. We argued that the photospheric regions where the filament was rooted might be the preferential ways where the magnetic helicity was injected along the filament itself and where the conditions to trigger the eruption were yielded.
Evaluation of mechanical integrity for helical coil hold-down spring of PLUS7TM fuel
International Nuclear Information System (INIS)
Choi, Ki Sung; Kim, Yong Hwan; Kwon, Jung Tack; Kim, Kyu Tae
2004-01-01
Nuclear fuel assembly is subject to hydraulic forces generated by primary coolant flow during reactor operation. These forces may be sufficient to overcome the fuel assembly weight thereby allowing the fuel assembly to lift off of its support. To provide a positive hold-down margin against the upward coolant flow forces, helical coil springs or leaf springs are installed in the fuel assemblies. An advanced fuel for Korean Standard Nuclear Power Plants (KSNP), PLUS7 fuel has developed to get the thermal margin increase, failure free and high seismic resistance, etc. And the new designed helical coil hold-down spring was introduced into PLUS7 fuel assembly. The purpose of this paper is to evaluate the mechanical integrity for the helical coil hold-down spring of PLUS7 fuel assembly
New formulae for magnetic relative helicity and field line helicity
Aly, Jean-Jacques
2018-01-01
We consider a magnetic field {B} occupying the simply connected domain D and having all its field lines tied to the boundary S of D. We assume here that {B} has a simple topology, i.e., the mapping {M} from positive to negative polarity areas of S associating to each other the two footpoints of any magnetic line, is continuous. We first present new formulae for the helicity H of {B} relative to a reference field {{B}}r having the same normal component {B}n on S, and for its field line helicity h relative to a reference vector potential {{C}}r of {{B}}r. These formulae make immediately apparent the well known invariance of these quantities under all the ideal MHD deformations that preserve the positions of the footpoints on S. They express indeed h and H either in terms of {M} and {B}n, or in terms of the values on S of a pair of Euler potentials of {B}. We next show that, for a specific choice of {{C}}r, the field line helicity h of {B} fully characterizes the magnetic mapping {M} and then the topology of the lines. Finally, we give a formula that describes the rate of change of h in a situation where the plasma moves on the perfectly conducting boundary S without changing {B}n and/or non-ideal processes, described by an unspecified term {N} in Ohm’s law, are at work in some parts of D.
Folding and self-assembly of polypeptides: Dynamics and thermodynamics from molecular simulation
Fluitt, Aaron Michael
Empowered by their exquisite three-dimensional structures, or "folds," proteins carry out biological tasks with high specificity, efficiency, and fidelity. The fold that optimizes biological function represents a stable configuration of the constituent polypeptide molecule(s) under physiological conditions. Proteins and polypeptides are not static, however: battered by thermal motion, they explore a distribution of folds that is determined by the sequence of amino acids, the presence and identity of other molecules, and the thermodynamic conditions. In this dissertation, we apply molecular simulation techniques to the study of two polypeptides that have unusually diffuse distributions of folds under physiological conditions: polyglutamine (polyQ) and islet amyloid polypeptide (IAPP). Neither polyQ nor IAPP adopts a predominant fold in dilute aqueous solution, but at sufficient concentrations, both are prone to self-assemble into stable, periodic, and highly regular aggregate structures known as amyloid. The appearance of amyloid deposits of polyQ in the brain, and of IAPP in the pancreas, are associated with Huntington's disease and type 2 diabetes, respectively. A molecular view of the mechanism(s) by which polyQ and IAPP fold and self-assemble will enhance our understanding of disease pathogenesis, and it has the potential to accelerate the development of therapeutics that target early-stage aggregates. Using molecular simulations with spatial and temporal resolution on the atomic scale, we present analyses of the structural distributions of polyQ and IAPP under various conditions, both in and out of equilibrium. In particular, we examine amyloid fibers of polyQ, the IAPP dimer in solution, and single IAPP fragments at a lipid bilayer. We also benchmark the molecular models, or "force fields," available for such studies, and we introduce a novel simulation algorithm.
Helical Root Buckling: A Transient Mechanism for Stiff Interface Penetration
Silverberg, Jesse; Noar, Roslyn; Packer, Michael; Harrison, Maria; Cohen, Itai; Henley, Chris; Gerbode, Sharon
2011-03-01
Tilling in agriculture is commonly used to loosen the topmost layer of soil and promote healthy plant growth. As roots navigate this mechanically heterogeneous environment, they encounter interfaces between the compliant soil and the underlying compacted soil. Inspired by this problem, we used 3D time-lapse imaging of Medicago Truncatula plants to study root growth in two-layered transparent hydrogels. The layers are mechanically distinct; the top layer is more compliant than the bottom. We observe that the roots form a transient helical structure as they attempt to penetrate the bi-layer interface. Interpreting this phenotype as a form of buckling due to root elongation, we measured the helix size as a function of the surrounding gel modulus. Our measurements show that by twisting the root tip during growth, the helical structure recruits the surrounding medium for an enhanced penetration force allowing the plants access to the lower layer of gel.
Selective decay in a helicity-injected spheromak
International Nuclear Information System (INIS)
MartInez, P L Garcia; Farengo, R
2009-01-01
The non-linear evolution of several unstable equilibria, representative of helicity-injected spheromak configurations inside a cylindrical flux conserver, is studied by means of three dimensional resistive MHD simulations. These equilibria are force-free (∇ x B = λ(ψ)B) but do not correspond to minimum energy states, having linear λ(ψ) profiles with negative slope. Several aspects of this process are studied (magnetic energy relaxation, selective helicity decay, relaxed profiles) for different initial A slopes. The stability threshold predicted by linear theory is recovered. The results show that complete plasma relaxation leading to a uniform A, is achieved only if the initial profile is hollow enough. The evolution for cases just above the stability threshold is more gentle and does not end in a Taylor state. The final state in these cases has a linear λ(ψ) profile, as the initial condition, but with a smaller slope.
Analysis of Eyring-Powell Fluid in Helical Screw Rheometer
Directory of Open Access Journals (Sweden)
A. M. Siddiqui
2014-01-01
Full Text Available This paper aims to study the flow of an incompressible, isothermal Eyring-Powell fluid in a helical screw rheometer. The complicated geometry of the helical screw rheometer is simplified by “unwrapping or flattening” the channel, lands, and the outside rotating barrel, assuming the width of the channel is larger as compared to the depth. The developed second order nonlinear differential equations are solved by using Adomian decomposition method. Analytical expressions are obtained for the velocity profiles, shear stresses, shear at wall, force exerted on fluid, volume flow rates, and average velocity. The effect of non-Newtonian parameters, pressure gradients, and flight angle on the velocity profiles is noticed with the help of graphical representation. The observation confirmed the vital role of involved parameters during the extrusion process.
MHD stability analysis of helical system plasmas
International Nuclear Information System (INIS)
Nakamura, Yuji
2000-01-01
Several topics of the MHD stability studies in helical system plasmas are reviewed with respect to the linear and ideal modes mainly. Difference of the method of the MHD stability analysis in helical system plasmas from that in tokamak plasmas is emphasized. Lack of the cyclic (symmetric) coordinate makes an analysis more difficult. Recent topic about TAE modes in a helical system is also described briefly. (author)
Employing helicity amplitudes for resummation in SCET
International Nuclear Information System (INIS)
Moult, Ian; Stewart, Iain W.; Tackmann, Frank J.; Waalewijn, Wouter J.; Nikhef, Amsterdam
2016-05-01
Helicity amplitudes are the fundamental ingredients of many QCD calculations for multi-leg processes. We describe how these can seamlessly be combined with resummation in Soft-Collinear Effective Theory (SCET), by constructing a helicity operator basis for which the Wilson coefficients are directly given in terms of color-ordered helicity amplitudes. This basis is crossing symmetric and has simple transformation properties under discrete symmetries.
Turbulent convective heat transfer of methane at supercritical pressure in a helical coiled tube
Wang, Chenggang; Sun, Baokun; Lin, Wei; He, Fan; You, Yingqiang; Yu, Jiuyang
2018-02-01
The heat transfer of methane at supercritical pressure in a helically coiled tube was numerically investigated using the Reynolds Stress Model under constant wall temperature. The effects of mass flux ( G), inlet pressure ( P in) and buoyancy force on the heat transfer behaviors were discussed in detail. Results show that the light fluid with higher temperature appears near the inner wall of the helically coiled tube. When the bulk temperature is less than or approach to the pseudocritical temperature ( T pc ), the combined effects of buoyancy force and centrifugal force make heavy fluid with lower temperature appear near the outer-right of the helically coiled tube. Beyond the T pc , the heavy fluid with lower temperature moves from the outer-right region to the outer region owing to the centrifugal force. The buoyancy force caused by density variation, which can be characterized by Gr/ Re 2 and Gr/ Re 2.7, enhances the heat transfer coefficient ( h) when the bulk temperature is less than or near the T pc , and the h experiences oscillation due to the buoyancy force. The oscillation is reduced progressively with the increase of G. Moreover, h reaches its peak value near the T pc . Higher G could improve the heat transfer performance in the whole temperature range. The peak value of h depends on P in. A new correlation was proposed for methane at supercritical pressure convective heat transfer in the helical tube, which shows a good agreement with the present simulated results.
International Nuclear Information System (INIS)
Veranda, M; Bonfiglio, D; Cappello, S; Chacón, L; Escande, D F
2013-01-01
Helical self-organized reversed-field pinch (RFP) regimes emerge both numerically—in 3D visco-resistive magnetohydrodynamic (MHD) simulations—and experimentally, as in the RFX-mod device at high current (I P above 1 MA). These states, called quasi-single helicity (QSH) states, are characterized by the action of a MHD mode that impresses a quasi-helical symmetry to the system, thus allowing a high degree of magnetic chaos healing. This is in contrast with the multiple helicity (MH) states, where magnetic fluctuations create a chaotic magnetic field degrading the confinement properties of the RFP. This paper reports an extensive numerical study performed in the frame of 3D visco-resistive MHD which considers the effect of helical magnetic boundary conditions, i.e. of a finite value of the radial magnetic field at the edge (magnetic perturbation, MP). We show that the system can be driven to a selected QSH state starting from both spontaneous QSH and MH regimes. In particular, a high enough MP can force a QSH helical self-organization with a helicity different from the spontaneous one. Moreover, MH states can be turned into QSH states with a selected helicity. A threshold in the amplitude of MP is observed above which is able to influence the system. Analysis of the magnetic topology of these simulations indicates that the dominant helical mode is able to temporarily sustain conserved magnetic structures in the core of the plasma. The region occupied by conserved magnetic surfaces increases reducing secondary modes' amplitude to experimental-like values. (paper)
Target organs for avian pancreatic polypeptide
International Nuclear Information System (INIS)
Kimmel, J.R.; Pollock, H.G.
1981-01-01
The problem of the physiological function of pancreatic polypeptide (PP) has been approached by attempting to identify target organs. Avian PP (aPP) labeled with 125I at either the C-terminus (aPP-C) or the N-terminus (aPP-N) was injected into fasted chickens and allowed to circulate for 3-120 min. At the end of the equilibration period, the anesthetized bird was perfused first with saline, then with Buoin's solution. Samples of fixed tissue from various organs were collected, weighed, and counted. Control experiments consisted of coinjection of unlabeled aPP to compete for receptors. The rate of disappearance of aPP-N from plasma was greater than that of aPP-C. Binding of aPP-N by spleen, duodenum, ileum, pancreas, and bone marrow was markedly reduced by coinjection of unlabeled aPP. A similar but less marked reduction in binding was found in liver and proventriculus. aPP-C gave less conclusive results. The maximal competitive effect of unlabeled PP could be achieved in most cases with 30 microgram unlabeled aPP. It is concluded that pancreas, duodenum, ileum, spleen, and bone marrow, and probably liver and proventriculus, are target organs for aPP in the chicken and that the C-terminal region of aPP is involved in receptor binding
Fibrillar dimer formation of islet amyloid polypeptides
Directory of Open Access Journals (Sweden)
Chi-cheng Chiu
2015-09-01
Full Text Available Amyloid deposits of human islet amyloid polypeptide (hIAPP, a 37-residue hormone co-produced with insulin, have been implicated in the development of type 2 diabetes. Residues 20 – 29 of hIAPP have been proposed to constitute the amyloidogenic core for the aggregation process, yet the segment is mostly unstructured in the mature fibril, according to solid-state NMR data. Here we use molecular simulations combined with bias-exchange metadynamics to characterize the conformational free energies of hIAPP fibrillar dimer and its derivative, pramlintide. We show that residues 20 – 29 are involved in an intermediate that exhibits transient β-sheets, consistent with recent experimental and simulation results. By comparing the aggregation of hIAPP and pramlintide, we illustrate the effects of proline residues on inhibition of the dimerization of IAPP. The mechanistic insights presented here could be useful for development of therapeutic inhibitors of hIAPP amyloid formation.
Islet Amyloid Polypeptide: Structure, Function, and Pathophysiology
Directory of Open Access Journals (Sweden)
Rehana Akter
2016-01-01
Full Text Available The hormone islet amyloid polypeptide (IAPP, or amylin plays a role in glucose homeostasis but aggregates to form islet amyloid in type-2 diabetes. Islet amyloid formation contributes to β-cell dysfunction and death in the disease and to the failure of islet transplants. Recent work suggests a role for IAPP aggregation in cardiovascular complications of type-2 diabetes and hints at a possible role in type-1 diabetes. The mechanisms of IAPP amyloid formation in vivo or in vitro are not understood and the mechanisms of IAPP induced β-cell death are not fully defined. Activation of the inflammasome, defects in autophagy, ER stress, generation of reactive oxygen species, membrane disruption, and receptor mediated mechanisms have all been proposed to play a role. Open questions in the field include the relative importance of the various mechanisms of β-cell death, the relevance of reductionist biophysical studies to the situation in vivo, the molecular mechanism of amyloid formation in vitro and in vivo, the factors which trigger amyloid formation in type-2 diabetes, the potential role of IAPP in type-1 diabetes, the development of clinically relevant inhibitors of islet amyloidosis toxicity, and the design of soluble, bioactive variants of IAPP for use as adjuncts to insulin therapy.
Tunable drug loading and release from polypeptide multilayer nanofilms
Jiang, Bingbing; Li, Bingyun
2009-01-01
Polypeptide multilayer nanofilms were prepared using electrostatic layer-by-layer self-assembly nanotechnology. Small charged drug molecules (eg, cefazolin, gentamicin, and methylene blue) were loaded in polypeptide multilayer nanofilms. Their loading and release were found to be pH-dependent and could also be controlled by changing the number of film layers and drug incubation time, and applying heat-treatment after film formation. Antibioticloaded polypeptide multilayer nanofilms showed controllable antibacterial properties against Staphylococcus aureus. The developed biodegradable polypeptide multilayer nanofilms are capable of loading both positively- and negatively-charged drug molecules and promise to serve as drug delivery systems on biomedical devices for preventing biomedical device-associated infection, which is a significant clinical complication for both civilian and military patients. PMID:19421369
Directory of Open Access Journals (Sweden)
Xiaodong Wu
2016-10-01
Full Text Available Downhole vortex drainage gas recovery is a new gas production technology. So far, however, the forces and motions of liquid phase in the swirling flow field of wellbores during its field application have not been figured out. In this paper, the forces of liquid droplets in the swirling flow field of wellbores were analyzed on the basis of two-phase fluid dynamics theories. Then, the motion equations of fluid droplets along axial and radical directions were established. Magnitude comparison was performed on several typical acting forces, including Basset force, virtual mass force, Magnus force, Saffman force and Stokes force. Besides, the formula for calculating the optimal helical angle of vortex tools was established according to the principle that the vertical resultant force on fluid droplets should be the maximum. And afterwards, each acting force was comprehensively analyzed in terms of its origin, characteristics and direction based on the established force analysis model. Magnitude comparison indicates that the forces with less effect can be neglected, including virtual mass force, Basset force and convection volume force. Moreover, the vertically upward centrifugal force component occurs on the fluid droplets in swirling flow field instead of those in the conventional flow field of wellbores, which is favorable for the fluid droplets to move upward. The reliability of optimal helical angle calculation formula was verified by means of case analysis. It is demonstrated that with the decrease of well depth, the fluid-carrying capability of gas and the optimal helical angle increase. The research results in this paper have a guiding significance to the optimization design of downhole vortex tools and the field application of downhole vortex drainage gas recovery technology.
Sanborn, Tracy Joella
Due to the unique 3D structures of proteins, these biopolymers are able to perform a myriad of vital functions and activities in vivo. Peptidomimetic oligomers are being synthesized to mimic the structure and function of natural peptides. We have examined the stability of secondary structure of a poly-N-substituted glycine (peptoid) and developed synthetic substrates for transglutaminase enzymes. We synthesized an amphipathic, helical, 36 residue peptoid to study the stability of peptoid secondary structure using circular dichroism. We saw no significant dependence of helical structure on concentration, solvent, or temperature. The extraordinary resistance of these peptoid helices to denaturation is consistent with a dominant role, of steric forces in their structural stabilization. The structured polypeptoids studied here have potential as robust mimics of helical polypeptides of therapeutic interest. The ability of transglutaminases to crosslink peptidomimetic substrates was also investigated. There is a medical need for robust, biocompatible hydrogels that can be rapidly crosslinked in situ, for application as surgical adhesives, bone-inductive materials, or for drug delivery. We have taken an enzymatic approach to the creation of a novel gelation system that fits these requirements, utilizing transglutaminase enzymes, thermo-responsive liposomes, and a biomimetic enzyme substrate based on a peptide-polymer conjugate. At room temperature, the hydrogel system is a solution. Upon heating to 37°C, the calcium-loaded liposomes release calcium that activates Factor XIII in the presence of thrombin, producing a gel within 9 minutes. Rheological studies demonstrated that the hydrogel behaves as a robust, elastic solid, while scanning electron microscopy studies revealed that the hydrogel has a very dense morphology overall. We also investigated the ability of transglutaminases to crosslink non-natural, peptoid-based substrates. The activity of five lysine
Pahovnik, David; Hadjichristidis, Nikolaos
2015-01-01
Different synthetic approaches utilizing ring-opening polymerization of N-carboxyanhydrides for preparation of polypeptide and polypeptide-based hybrid materials with various molecular architectures are described. An overview of polymerization
Beta-helical polymers from isocyanopeptides
Cornelissen, J.J.L.M.; Donners, J.J.J.M.; Gelder, de R.; Graswinckel, W.S.; Metselaar, G.A.; Rowan, A.E.; Sommerdijk, N.A.J.M.; Nolte, R.J.M.
2001-01-01
Polymerization of isocyanopeptides results in the formation of high molecular mass polymers that fold in a proteinlike fashion to give helical strands in which the peptide chains are arranged in ß-sheets. The ß-helical polymers retain their structure in water and unfold in a cooperative process at
Magnetic islands created by resonant helical windings
International Nuclear Information System (INIS)
Fernandes, A.S.; Heller, M.V.; Caldas, I.L.
1986-01-01
The triggering of disruptive instabilities by resonant helical windings in large aspect-ratio tokamaks is associated to destruction of magnetic surfaces. The Chirikov condition is applied to estimate analytically the helical winding current thresholds for ergodization of the magnetic field lines. (Autor) [pt
Helicity amplitudes for matter-coupled gravity
International Nuclear Information System (INIS)
Aldrovandi, R.; Novaes, S.F.; Spehler, D.
1992-07-01
The Weyl-van der Waerden spinor formalism is applied to the evaluation of helicity invariant amplitudes in the framework of linearized gravitation. The graviton couplings to spin-0, 1 - 2 , 1, and 3 - 2 particles are given, and, to exhibit the reach of this method, the helicity amplitudes for the process electron + positron → photon + graviton are obtained. (author)
Stiffness versus architecture of single helical polyisocyanopeptides
Buul, van A.M.; Schwartz, E.; Brocorens, P.; Koepf, M.; Beljonne, D.; Maan, J.C.; Christianen, P.C.M.; Kouwer, P.H.J.; Nolte, R.J.M.; Engelkamp, H.; Blank, K.; Rowan, A.E.
2013-01-01
Helical structures play a vital role in nature, offering mechanical rigidity, chirality and structural definition to biological systems. Little is known about the influence of the helical architecture on the intrinsic properties of polymers. Here, we offer an insight into the nano architecture of
Architecture effects on multivalent interactions by polypeptide-based multivalent ligands
Liu, Shuang
protein materials, including structural as well as functional proteins. Therefore, polypeptide-based multivalent scaffolds are used to display ligands to assess the contribution of different architectural parameters to the multivalent binding events. In this work, a family of alanine-rich alpha-helical glycopolypeptides was designed and synthesized by a combination of protein engineering and chemical coupling, to display two types of saccharide ligands for two different multivalent binding systems. The valencies, chain length and spacing between adjacent ligands of these multivalent ligands were designed in order to study architecture effects on multivalent interactions. The polypeptides and their glycoconjugates were characterized via various methods, including SDS-PAGE, NMR, HPLC, amino acid analysis (AAA), MALDI, circular dichroism (CD) and GPC. In the first multivalent binding system, cholera toxin B pentamer (CT B5) was chosen to be the protein receptor due to its well-characterized structure, lack of significant steric interference of binding to multiple binding sites, and requirement of only simple monosaccharide as ligands. Galactopyranoside was incorporated into polypeptide scaffolds through amine-carboxylic acid coupling to the side chains of glutamic acid residues. The inhibition and binding to CT B5 of these glycopolypeptide ligands were evaluated by direct enzyme-linked assay (DELA). As a complement method, weak affinity chromatography (WAC) was also used to evaluate glycopolypeptides binding to a CT B5 immobilized column. The architecture effects on CT B 5 inhibition are discussed. In the second system, cell surface receptor L-selectin was targeted by polypeptide-based multivalent ligands containing disulfated galactopyranoside ligands, due to its important roles in various immunological activities. The effects of glycopolypeptide architectural variables L-selectin shedding were evaluated via ELISA-based assays. These polypeptide-based multivalent ligands
Dynamics of zonal flows in helical systems.
Sugama, H; Watanabe, T-H
2005-03-25
A theory for describing collisionless long-time behavior of zonal flows in helical systems is presented and its validity is verified by gyrokinetic-Vlasov simulation. It is shown that, under the influence of particles trapped in helical ripples, the response of zonal flows to a given source becomes weaker for lower radial wave numbers and deeper helical ripples while a high-level zonal-flow response, which is not affected by helical-ripple-trapped particles, can be maintained for a longer time by reducing their bounce-averaged radial drift velocity. This implies a possibility that helical configurations optimized for reducing neoclassical ripple transport can simultaneously enhance zonal flows which lower anomalous transport.
Influence of Helical Cell Shape on Motility of Helicobacter Pylori
Hardcastle, Joseph; Martinez, Laura; Salama, Nina; Bansil, Rama; Boston University Collaboration; University of Washington Collaboration
2014-03-01
Bacteria's body shape plays an important role in motility by effecting chemotaxis, swimming mechanisms, and swimming speed. A prime example of this is the bacteria Helicobacter Pylori;whose helical shape has long been believed to provide an advantage in penetrating the viscous mucus layer protecting the stomach lining, its niche environment. To explore this we have performed bacteria tracking experiments of both wild-type bacteria along with mutants, which have a straight rod shape. A wide distribution of speeds was found. This distribution reflects both a result of temporal variation in speed and different shape morphologies in the bacterial population. Our results show that body shape plays less role in a simple fluid. However, in a more viscous solution the helical shape results in increased swimming speeds. In addition, we use experimentally obtained cell shape measurements to model the hydrodynamic influence of cell shape on swimming speed using resistive force theory. The results agree with the experiment, especially when we fold in the temporal distribution. Interestingly, our results suggest distinct wild-type subpopulations with varying number of half helices can lead to different swimming speeds. NSF PHY
Properties of the electrostatically driven helical plasma state
Akçay, Cihan; Finn, John M.; Nebel, Richard A.; Barnes, Daniel C.; Martin, Neal
2018-02-01
A novel plasma state has been found [Akçay et al., Phys. Plasmas 24, 052503 (2017)] in the presence of a uniform applied axial magnetic field in periodic cylindrical geometry. This state is driven by external electrostatic fields provided by helical electrodes with a (m =1 ,n =1 ) (helical) symmetry where m and n represent the poloidal and axial harmonics. The resulting plasma is a function of the cylinder radius r safety factor q0(r ) just above the pitch of the electrodes m /n =1 in the interior, where the plasma is nearly force-free. However, at the edge the current density has a component perpendicular to the magnetic field B. This perpendicular current density drives nearly Alfvénic helical plasma flows, a notable feature of these states. This state is being studied for its possible application in DC electrical transformers. We present results on several issues of importance for these applications: the transient leading to the steady state; the twist and writhe of the field lines and their relation with the current density; the properties of the current density streamlines and length of the current density lines connected to the electrodes; the sensitivity to changes in the velocity boundary conditions; the effect of varying the radial resistivity profile; and the effects of a concentrated electrode potential.
Mechanics of patterned helical Si springs on Si substrate.
Liu, D L; Ye, D X; Khan, F; Tang, F; Lim, B K; Picu, R C; Wang, G C; Lu, T M
2003-12-01
The elastic response, including the spring constant, of individual Si helical-shape submicron springs, was measured using a tip-cantilever assembly attached to a conventional atomic force microscope. The isolated, four-turn Si springs were fabricated using oblique angle deposition with substrate rotation, also known as the glancing angle deposition, on a templated Si substrate. The response of the structures was modeled using finite elements, and it was shown that the conventional formulae for the spring constant required modifications before they could be used for the loading scheme used in the present experiment.
Topology of helical fluid flow
DEFF Research Database (Denmark)
Andersen, Morten; Brøns, Morten
2014-01-01
function for the topology of the streamline pattern in incompressible flows. On this basis, we perform a comprehensive study of the topology of the flow field generated by a helical vortex filament in an ideal fluid. The classical expression for the stream function obtained by Hardin (Hardin, J. C. 1982...... the zeroes of a single real function of one variable, and we show that three different flow topologies can occur, depending on a single dimensionless parameter. By including the self-induced velocity on the vortex filament by a localised induction approximation, the stream function is slightly modified...... and an extra parameter is introduced. In this setting two new flow topologies arise, but not more than two critical points occur for any combination of parameters....
Helically coiled tube heat exchanger
International Nuclear Information System (INIS)
Harris, A.M.
1981-01-01
In a heat exchanger such as a steam generator for a nuclear reactor, two or more bundles of helically coiled tubes are arranged in series with the tubes in each bundle integrally continuing through the tube bundles arranged in series therewith. Pitch values for the tubing in any pair of tube bundles, taken transverse to the path of the reactor coolant flow about the tubes, are selected as a ratio of two unequal integers to permit efficient operation of each tube bundle while maintaining the various tube bundles of the heat exchanger within a compact envelope. Preferably, the helix angle and tube pitch parallel to the path of coolant flow are constant for all tubes in a single bundle so that the tubes are of approximately the same length within each bundle
The quantum Hall effect helicity
Energy Technology Data Exchange (ETDEWEB)
Shrivastava, Keshav N., E-mail: keshav1001@yahoo.com [Department of Physics, University of Malaya, Kuala Lumpur 50603 (Malaysia); School of Physics, University of Hyderabad, Hyderabad 500046 (India)
2015-04-16
The quantum Hall effect in semiconductor heterostructures is explained by two signs in the angular momentum j=l±s and g=(2j+1)/(2l+1) along with the Landau factor (n+1/2). These modifications in the existing theories explain all of the fractional charges. The helicity which is the sign of the product of the linear momentum with the spin p.s plays an important role for the understanding of the data at high magnetic fields. In particular it is found that particles with positive sign in the spin move in one direction and those with negative sign move in another direction which explains the up and down stream motion of the particles.
Von Bargen, Christopher D; MacDermaid, Christopher M; Lee, One-Sun; Deria, Pravas; Therien, Michael J; Saven, Jeffery G
2013-10-24
The highly charged, conjugated polymer poly[p-{2,5-bis(3-propoxysulfonicacidsodiumsalt)}phenylene]ethynylene (PPES) has been shown to wrap single-wall carbon nanotubes (SWNTs), adopting a robust helical superstructure. Surprisingly, PPES adopts a helical rather than a linear conformation when adhered to SWNTs. The complexes formed by PPES and related polymers upon helical wrapping of a SWNT are investigated using atomistic molecular dynamics (MD) simulations in the presence and absence of aqueous solvent. In simulations of the PPES/SWNT system in an aqueous environment, PPES spontaneously takes on a helical conformation. A potential of mean force, ΔA(ξ), is calculated as a function of ξ, the component of the end-to-end vector of the polymer chain projected on the SWNT axis; ξ is a monotonic function of the polymer's helical pitch. ΔA(ξ) provides a means to quantify the relative free energies of helical conformations of the polymer when wrapped about the SWNT. The aqueous system possesses a global minimum in ΔA(ξ) at the experimentally observed value of the helical pitch. The presence of this minimum is associated with preferred side chain conformations, where the side chains adopt conformations that provide van der Waals contact between the tubes and the aliphatic components of the side chains, while exposing the anionic sulfonates for aqueous solvation. The simulations provide a free energy estimate of a 0.2 kcal/mol/monomer preference for the helical over the linear conformation of the PPES/SWNT system in an aqueous environment.
Directory of Open Access Journals (Sweden)
Ricardo Vera Bravo
2011-12-01
Full Text Available A new strategy is presented for the designand synthesis of peptides that exhibitice-binding and antifreeze activity. Apennant-type dendrimer polypeptidescaffold combining an α-helical backbonewith four short β-strand branches wassynthesized in solid phase using Fmocchemistry in a divergent approach. The51-residue dendrimer was characterizedby reverse phase high performance liquidchromatography, mass spectrometry andcircular dichroism. Each β-strand branchcontained three overlapping TXT aminoacid repeats, an ice-binding motif foundin the ice-binding face of the sprucebudworm (Choristoneura fumiferanaand beetle (Tenebrio molitor antifreezeproteins. Ice crystals in the presence ofthe polypeptide monomer displayed flat,hexagonal plate morphology, similar tothat produced by weakly active antifreezeproteins. An oxidized dimeric form of thedendrimer polypeptide also produced flathexagonal ice crystals and was capableof inhibiting ice crystal growth upontemperature reduction, a phenomenontermed thermal hysteresis, a definingproperty of antifreeze proteins. Linkageof the pennant-type dendrimer to a trifunctionalcascade-type polypeptideproduced a trimeric macromolecule thatgave flat hexagonal ice crystals withhigher thermal hysteresis activity thanthe dimer or monomer and an ice crystal burst pattern similar to that producedby samples containing insect antifreezeproteins. This macromolecule was alsocapable of inhibiting ice recrystallization.
Directory of Open Access Journals (Sweden)
Dimitrios Skoulas
2017-06-01
Full Text Available The development of multifunctional polymeric materials for biological applications is mainly guided by the goal of achieving the encapsulation of pharmaceutical compounds through a self-assembly process to form nanoconstructs that control the biodistribution of the active compounds, and therefore minimize systemic side effects. Micelles are formed from amphiphilic polymers in a selective solvent. In biological applications, micelles are formed in water, and their cores are loaded with hydrophobic pharmaceutics, where they are solubilized and are usually delivered through the blood compartment. Even though a large number of polymeric materials that form nanocarrier delivery systems has been investigated, a surprisingly small subset of these technologies has demonstrated potentially curative preclinical results, and fewer have progressed towards commercialization. One of the most promising classes of polymeric materials for drug delivery applications is polypeptides, which combine the properties of the conventional polymers with the 3D structure of natural proteins, i.e., α-helices and β-sheets. In this article, the synthetic pathways followed to develop well-defined polymeric micelles based on polypeptides prepared through ring-opening polymerization (ROP of N-carboxy anhydrides are reviewed. Among these works, we focus on studies performed on micellar delivery systems to treat cancer. The review is limited to systems presented from 2000–2017.
A semi-analytical study on helical springs made of shape memory polymer
International Nuclear Information System (INIS)
Baghani, M; Naghdabadi, R; Arghavani, J
2012-01-01
In this paper, the responses of shape memory polymer (SMP) helical springs under axial force are studied both analytically and numerically. In the analytical solution, we first derive the response of a cylindrical tube under torsional loadings. This solution can be used for helical springs in which both the curvature and pitch effects are negligible. This is the case for helical springs with large ratios of the mean coil radius to the cross sectional radius (spring index) and also small pitch angles. Making use of this solution simplifies the analysis of the helical springs to that of the torsion of a straight bar with circular cross section. The 3D phenomenological constitutive model recently proposed for SMPs is also reduced to the 1D shear case. Thus, an analytical solution for the torsional response of SMP tubes in a full cycle of stress-free strain recovery is derived. In addition, the curvature effect is added to the formulation and the SMP helical spring is analyzed using the exact solution presented for torsion of curved SMP tubes. In this modified solution, the effect of the direct shear force is also considered. In the numerical analysis, the 3D constitutive equations are implemented in a finite element program and a full cycle of stress-free strain recovery of an SMP (extension or compression) helical spring is simulated. Analytical and numerical results are compared and it is shown that the analytical solution gives accurate stress distributions in the cross section of the helical SMP spring besides the global load–deflection response. Some case studies are presented to show the validity of the presented analytical method. (paper)
Numerical simulation of helical-vortex effects in Rayleigh-Bénard convection
Directory of Open Access Journals (Sweden)
G. V. Levina
2006-01-01
Full Text Available A numerical approach is substantiated for searching for the large-scale alpha-like instability in thermoconvective turbulence. The main idea of the search strategy is the application of a forcing function which can have a physical interpretation. The forcing simulates the influence of small-scale helical turbulence generated in a rotating fluid with internal heat sources and is applied to naturally induced fully developed convective flows. The strategy is tested using the Rayleigh-Bénard convection in an extended horizontal layer of incompressible fluid heated from below. The most important finding is an enlargement of the typical horizontal scale of the forming helical convective structures accompanied by a cells merging, an essential increase in the kinetic energy of flows and intensification of heat transfer. The results of modeling allow explaining how the helical feedback can work providing the non-zero mean helicity generation and the mutual intensification of horizontal and vertical circulation, and demonstrate how the energy of the additional helical source can be effectively converted into the energy of intensive large-scale vortex flow.
Evidence for Mixed Helicity in Erupting Filaments
Muglach, K.; Wang, Y.-M.; Kliem, B.
2009-09-01
Erupting filaments are sometimes observed to undergo a rotation about the vertical direction as they rise. This rotation of the filament axis is generally interpreted as a conversion of twist into writhe in a kink-unstable magnetic flux rope. Consistent with this interpretation, the rotation is usually found to be clockwise (as viewed from above) if the post-eruption arcade has right-handed helicity, but counterclockwise if it has left-handed helicity. Here, we describe two non-active-region filament events recorded with the Extreme-Ultraviolet Imaging Telescope on the Solar and Heliospheric Observatory in which the sense of rotation appears to be opposite to that expected from the helicity of the post-event arcade. Based on these observations, we suggest that the rotation of the filament axis is, in general, determined by the net helicity of the erupting system, and that the axially aligned core of the filament can have the opposite helicity sign to the surrounding field. In most cases, the surrounding field provides the main contribution to the net helicity. In the events reported here, however, the helicity associated with the filament "barbs" is opposite in sign to and dominates that of the overlying arcade.
HEMISPHERIC HELICITY TREND FOR SOLAR CYCLE 24
International Nuclear Information System (INIS)
Hao Juan; Zhang Mei
2011-01-01
Using vector magnetograms obtained with the Spectro-polarimeter (SP) on board Hinode satellite, we studied two helicity parameters (local twist and current helicity) of 64 active regions that occurred in the descending phase of solar cycle 23 and the ascending phase of solar cycle 24. Our analysis gives the following results. (1) The 34 active regions of the solar cycle 24 follow the so-called hemispheric helicity rule, whereas the 30 active regions of the solar cycle 23 do not. (2) When combining all 64 active regions as one sample, they follow the hemispheric helicity sign rule as in most other observations. (3) Despite the so-far most accurate measurement of vector magnetic field given by SP/Hinode, the rule is still weak with large scatters. (4) The data show evidence of different helicity signs between strong and weak fields, confirming previous result from a large sample of ground-based observations. (5) With two example sunspots we show that the helicity parameters change sign from the inner umbra to the outer penumbra, where the sign of penumbra agrees with the sign of the active region as a whole. From these results, we speculate that both the Σ-effect (turbulent convection) and the dynamo have contributed in the generation of helicity, whereas in both cases turbulence in the convection zone has played a significant role.
Directory of Open Access Journals (Sweden)
Mojie Duan
Full Text Available The amyloid fibrils formed by islet amyloid polypeptide (IAPP are associated with type II diabetes. One of the proposed mechanisms of the toxicity of IAPP is that it causes membrane damage. The fatal mutation of S20G human IAPP was reported to lead to early onset of type II diabetes and high tendency of amyloid formation in vitro. Characterizing the structural features of the S20G mutant in its monomeric state is experimentally difficult because of its unusually fast aggregation rate. Computational work complements experimental studies. We performed a series of molecular dynamics simulations of the monomeric state of human variants in the membrane. Our simulations are validated by extensive comparisons with experimental data. We find that a helical disruption at His18 is common to both human variants. An L-shaped motif of S20G mutant is observed in one of the conformational families. This motif that bends at His18 resembles the overall topology of IAPP fibrils. The conformational preorganization into the fibril-like topology provides a possible explanation for the fast aggregation rate of S20G IAPP.
Polymorphic transformation of helical flagella of bacteria
Lim, Sookkyung; Howard Berg Collaboration; William Ko Collaboration; Yongsam Kim Collaboration; Wanho Lee Collaboration; Charles Peskin Collaboration
2016-11-01
Bacteria such as E. coli swim in an aqueous environment by utilizing the rotation of flagellar motors and alternate two modes of motility, runs and tumbles. Runs are steady forward swimming driven by bundles of flagellar filaments whose motors are turning CCW; tumbles involve a reorientation of the direction of swimming triggered by motor reversals. During tumbling, the helical flagellum undergoes polymorphic transformations, which is a local change in helical pitch, helical radius, and handedness. In this work, we investigate the underlying mechanism of structural conformation and how this polymorphic transition plays a role in bacterial swimming. National Science Foundation.
Modelling simple helically delivered dose distributions
International Nuclear Information System (INIS)
Fenwick, John D; Tome, Wolfgang A; Kissick, Michael W; Mackie, T Rock
2005-01-01
In a previous paper, we described quality assurance procedures for Hi-Art helical tomotherapy machines. Here, we develop further some ideas discussed briefly in that paper. Simple helically generated dose distributions are modelled, and relationships between these dose distributions and underlying characteristics of Hi-Art treatment systems are elucidated. In particular, we describe the dependence of dose levels along the central axis of a cylinder aligned coaxially with a Hi-Art machine on fan beam width, couch velocity and helical delivery lengths. The impact on these dose levels of angular variations in gantry speed or output per linear accelerator pulse is also explored
Polypeptide profiles of human oocytes and preimplantation embryos.
Capmany, G; Bolton, V N
1993-11-01
The polypeptides that direct fertilization and early development until activation of the embryonic genome occurs, at the 4-8 cell stage in the human, are exclusively maternal in origin, and are either synthesized during oogenesis or translated later from maternal mRNA. Using sodium dodecyl sulphate-polyacrylamide gel electrophoresis and silver stain, we have visualized and compared the polypeptides present in different populations of human oocytes and cleavage stage embryos obtained after superovulation and insemination in vitro. Two polypeptide patterns were resolved, differing in the region of mol. wt 69 kDa. The distribution of these patterns showed no correlation with the ability of individual oocytes to achieve fertilization and develop normally to the 8-cell stage.
Guan, Y H; van den Heuvel, Remco
2011-08-05
Unlike the existing 2-D pseudo-ring model for helical columns undergoing synchronous type-J planetary motion of counter-current chromatograph (CCC), the 3-D "helix" model developed in this work shows that there is a second normal force (i.e. the binormal force) applied virtually in the axial direction of the helical column. This force alternates in the two opposite directions and intensifies phase mixing with increasing the helix angle. On the contrary, the 2-D spiral column operated on the same CCC device lacks this third-dimensional mixing force. The (principal) normal force quantified by this "helix" model has been the same as that by the pseudo-ring model. With β>0.25, this normal centrifugal force has been one-directional and fluctuates cyclically. Different to the spiral column, this "helix" model shows that the centrifugal force (i.e. the hydrostatic force) does not contribute to stationary phase retention in the helical column. Between the popular helical columns and the emerging spiral columns for type-J synchronous CCC, this work has thus illustrated that the former is associated with better phase mixing yet poor retention for the stationary phase whereas the latter has potential for better retention for the stationary phase yet poor phase mixing. The methodology developed in this work may be regarded as a new platform for designing optimised CCC columns for analytical and engineering applications. Copyright © 2011 Elsevier B.V. All rights reserved.
Helicity and Filament Channels? The Straight Twist!
Antiochos, Spiro K.
2010-01-01
One of the most important and most puzzling features of the coronal magnetic field is that it appears to have smooth magnetic structure with little evidence for non-potentiality except at special locations, photospheric polarity inversions lines where the non-potentiality is observed as a filament channel. This characteristic feature of the closed-field corona is highly unexpected given that photospheric motions continuously tangle its magnetic field. Although reconnection can eliminate some of the injected structure, it cannot destroy the helicity, which should build up to produce observable complexity. We propose that an inverse cascade process transports the injected helicity from the interior of closed flux regions to their boundaries, polarity inversion lines, creating filament channels. We describe how the helicity is injected and transported and calculate the relevant rates. We argue that one process, helicity transport, can explain both the observed lack and presence of structure in the coronal magnetic field.
Spin versus helicity in processes involving transversity
Mekhfi, Mustapha
2011-01-01
We construct the spin formalism in order to deal in a direct and natural way with processes involving transversity which are now of increasing popularity. The helicity formalism which is more appropriate for collision processes of definite helicity has been so far used also to manage processes with transversity, but at the price of computing numerous helicity amplitudes generally involving unnecessary kinematical variables.In a second step we work out the correspondence between both formalisms and retrieve in another way all results of the helicity formalism but in simpler forms.We then compute certain processes for comparison.A special process:the quark dipole magnetic moment is shown to be exclusively treated within the spin formalism as it is directly related to the transverse spin of the quark inside the baryon.
Helical magnetized wiggler for synchrotron radiation laser
International Nuclear Information System (INIS)
Wang Mei; Park, S.Y.; Hirshfield, J.L.
1999-01-01
A helical magnetized iron wiggler has been built for a novel infrared synchrotron radiation laser (SRL) experiment. The wiggler consists of four periods of helical iron structure immersed in a solenoid field. This wiggler is to impart transverse velocity to a prebunched 6 MeV electron beam, and thus to obtain a desired high orbit pitch ratio for the SRL. Field tapering at beam entrance is considered and tested on a similar wiggler. Analytic and simulated characteristics of wigglers of this type are discussed and the performance of the fabricated wigglers is demonstrated experimentally. A 4.7 kG peak field was measured for a 6.4 mm air gap and a 5.4 cm wiggler period at a 20 kG solenoid field. The measured helical fields compare favorably with the analytical solution. This type of helical iron wigglers has the potential to be scaled to small periods with strong field amplitude
Helical magnetized wiggler for synchrotron radiation laser
Wang Mei; Hirshfield, J L
1999-01-01
A helical magnetized iron wiggler has been built for a novel infrared synchrotron radiation laser (SRL) experiment. The wiggler consists of four periods of helical iron structure immersed in a solenoid field. This wiggler is to impart transverse velocity to a prebunched 6 MeV electron beam, and thus to obtain a desired high orbit pitch ratio for the SRL. Field tapering at beam entrance is considered and tested on a similar wiggler. Analytic and simulated characteristics of wigglers of this type are discussed and the performance of the fabricated wigglers is demonstrated experimentally. A 4.7 kG peak field was measured for a 6.4 mm air gap and a 5.4 cm wiggler period at a 20 kG solenoid field. The measured helical fields compare favorably with the analytical solution. This type of helical iron wigglers has the potential to be scaled to small periods with strong field amplitude.
Using helical compressors for coke gas condensation
Energy Technology Data Exchange (ETDEWEB)
Privalov, V E; Rezunenko, Yu I; Lelyanov, N V; Zarnitzkii, G Eh; Gordienko, A A; Derebenko, I F; Venzhega, A G; Leonov, N P; Gorokhov, N N
1982-08-01
Coke oven gas compression is discussed. Presently used multilevel piston compressors are criticized. The paper recommends using helical machines which combine advantages of using volume condensing compressors and compact high-efficiency centrifugal machines. Two kinds of helical compressors are evaluated: dry and oil-filled; their productivities and coke oven gas chemical composition are analyzed. Experiments using helical compressors were undertaken at the Yasinovskii plant. Flowsheet of the installation is shown. Performance results are given in a table. For all operating conditions content of insolubles in oil compounds is found to be lower than the acceptable value (0.08%). Compressor productivity measurements with variable manifold pressure are evaluated. Figures obtained show that efficient condensation of raw coke oven gas is possible. Increasing oil-filled compressor productivity is recommended by decreasing amount of oil injected and simultaneously increasing rotation speed. The dry helical compressor with water seal is found to be most promising for raw coke oven gas condensation. (10 refs.)
International Nuclear Information System (INIS)
Kovchegov, Yuri V.; Pitonyak, Daniel; Sievert, Matthew D.
2016-01-01
We construct small-x evolution equations which can be used to calculate quark and anti-quark helicity TMDs and PDFs, along with the g 1 structure function. These evolution equations resum powers of α s ln 2 (1/x) in the polarization-dependent evolution along with the powers of α s ln (1/x) in the unpolarized evolution which includes saturation effects. The equations are written in an operator form in terms of polarization-dependent Wilson line-like operators. While the equations do not close in general, they become closed and self-contained systems of non-linear equations in the large-N c and large-N c N f limits. As a cross-check, in the ladder approximation, our equations map onto the same ladder limit of the infrared evolution equations for the g 1 structure function derived previously by Bartels, Ermolaev and Ryskin http://dx.doi.org/10.1007/s002880050285.
Dynamics of helicity transport and Taylor relaxation
International Nuclear Information System (INIS)
Diamond, P.H.; Malkov, M.
2003-01-01
A simple model of the dynamics of Taylor relaxation is derived using symmetry principles alone. No statistical closure approximations are invoked or detailed plasma model properties assumed. Notably, the model predicts several classes of nondiffusive helicity transport phenomena, including traveling nonlinear waves and superdiffusive turbulent pulses. A universal expression for the scaling of the effective magnetic Reynolds number of a system undergoing Taylor relaxation is derived. Some basic properties of intermittency in helicity transport are examined
Multiple helical modes of vortex breakdown
DEFF Research Database (Denmark)
Sørensen, Jens Nørkær; Naumov, I. V.; Okulov, Valery
2011-01-01
Experimental observations of vortex breakdown in a rotating lid-driven cavity are presented. The results show that vortex breakdown for cavities with high aspect ratios is associated with the appearance of stable helical vortex multiplets. By using results from stability theory generalizing Kelvi......’s problem on vortex polygon stability, and systematically exploring the cavity flow, we succeeded in identifying two new stable vortex breakdown states consisting of triple and quadruple helical multiplets....
On the helicity of open magnetic fields
International Nuclear Information System (INIS)
Prior, C.; Yeates, A. R.
2014-01-01
We reconsider the topological interpretation of magnetic helicity for magnetic fields in open domains, and relate this to the relative helicity. Specifically, our domains stretch between two parallel planes, and each of these ends may be magnetically open. It is demonstrated that, while the magnetic helicity is gauge-dependent, its value in any gauge may be physically interpreted as the average winding number among all pairs of field lines with respect to some orthonormal frame field. In fact, the choice of gauge is equivalent to the choice of reference field in the relative helicity, meaning that the magnetic helicity is no less physically meaningful. We prove that a particular gauge always measures the winding with respect to a fixed frame, and propose that this is normally the best choice. For periodic fields, this choice is equivalent to measuring relative helicity with respect to a potential reference field. However, for aperiodic fields, we show that the potential field can be twisted. We prove by construction that there always exists a possible untwisted reference field.
Analysis of impacting phenomena in a helically wound heat exchanger
International Nuclear Information System (INIS)
Whiston, G.S.; Jordan, R.W.
1986-01-01
During commissioning tests on a helically wound heat exchanger at Heysham Nuclear Power Station, evidence of impacting was observed on accelerometer responses. Impacting greatly enhances wear and methods have been developed to determine whether the operating lifetime of plant may be limited by tube failures. A theoretical frequency response function based on Timoshenko beam theory has been derived which relates an impact force to the acceleration field which propagates away from the impact site and is detected by remote accelerometers. The accuracy of this function has been verified experimentally and its suitability for the analysis of boiler responses has been demonstrated following investigations into the nature of impacting. Examples of the analysis of impact forces are given and methods of estimating wear are discussed. (author)
Helical Propensity Affects the Conformational Properties of the Denatured State of Cytochrome c'.
Danielson, Travis A; Bowler, Bruce E
2018-01-23
Changing the helical propensity of a polypeptide sequence might be expected to affect the conformational properties of the denatured state of a protein. To test this hypothesis, alanines at positions 83 and 87 near the center of helix 3 of cytochrome c' from Rhodopseudomonas palustris were mutated to serine to decrease the stability of this helix. A set of 13 single histidine variants in the A83S/A87S background were prepared to permit assessment of the conformational properties of the denatured state using histidine-loop formation in 3 M guanidine hydrochloride. The data are compared with previous histidine-heme loop formation data for wild-type cytochrome c'. As expected, destabilization of helix 3 decreases the global stabilities of the histidine variants in the A83S/A87S background relative to the wild-type background. Loop stability versus loop size data yields a scaling exponent of 2.1 ± 0.2, similar to the value of 2.3 ± 0.2 obtained for wild-type cytochrome c'. However, the stabilities of all histidine-heme loops, which contain the helix 3 sequence segment, are increased in the A83S/A87S background compared to the wild-type background. Rate constants for histidine-heme loop breakage are similar for the wild-type and A83S/A87S variants. However, for histidine-heme loops that contain the helix 3 sequence segment, the rate constants for loop formation increase in the A83S/A87S background compared to the wild-type background. Thus, residual helical structure appears to stiffen the polypeptide chain slowing loop formation in the denatured state. The implications of these results for protein folding mechanisms are discussed. Copyright © 2017 Biophysical Society. Published by Elsevier Inc. All rights reserved.
Diffusion in a tokamak with helical magnetic cells
International Nuclear Information System (INIS)
Wakatani, Masahiro
1975-05-01
In a tokamak with helical magnetic cells produced by a resonant helical magnetic field, diffusion in the collisional regime is studied. The diffusion coefficient is greatly enhanced near the resonant surface even for a weak helical magnetic field. A theoretical model for disruptive instabilities based on the enhanced transport due to helical magnetic cells is discussed. This may explain experiments of the tokamak with resonant helical fields qualitatively. (author)
Using Magnetic Helicity Diagnostics to Determine the Nature of Solar Active-Region Formation
Georgoulis, Manolis K.
Employing a novel nonlinear force-free (NLFF) method that self-consistently infers instantaneous free magnetic-energy and relative magnetic-helicity budgets from single photospheric vector magnetograms, we recently constructed the magnetic energy-helicity (EH) diagram of solar active regions. The EH diagram implies dominant relative helicities of left-handed or right-handed chiralities for the great majority of active regions. The amplitude (budget) of these helicities scales monotonically with the free magnetic energy. This constructive, strongly preferential accumulation of a certain sense of magnetic helicity seems to disqualify recently proposed mechanisms relying on a largely random near-surface convection for the formation of the great majority of active regions. The existing qualitative formation mechanism for these regions remains the conventional Omega-loop emergence following a buoyant ascension from the bottom of the convection zone. However, exceptions to this rule include even eruptive active regions: NOAA AR 11283 is an obvious outlier to the EH diagram, involving significant free magnetic energy with a small relative magnetic helicity. Relying on a timeseries of vector magnetograms of this region, our methodology shows nearly canceling amounts of both senses of helicity and an overall course from a weakly left-handed to a weakly right-handed structure, in the course of which a major eruption occurs. For this and similarly behaving active regions the latest near-surface formation scenario might conceivably be employed successfully. Research partially supported by the EU Seventh Framework Programme under grant agreement No. PIRG07-GA-2010-268245 and by the European Union Social Fund (ESF) and Greek national funds through the Operational Program "Education and Lifelong Learning" of the National Strategic Reference Framework (NSRF) - Research Funding Program: Thales. Investing in knowledge society through the European Social Fund.
Polypeptides having beta-glucosidase activity and polynucleotides encoding the same
Brown, Kimberly; Harris, Paul
2013-12-17
The present invention relates to isolated polypeptides having beta-glucosidase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.
Directory of Open Access Journals (Sweden)
A. H. ELBATRAN
2015-07-01
Full Text Available Helical channels have a wide range of applications in petroleum engineering, nuclear, heat exchanger, chemical, mineral and polymer industries. They are used in the separation processes for fluids of different densities. The centrifugal force, free surface and geometrical effects of the helical channel make the flow pattern more complicated; hence it is very difficult to perform physical experiment to predict channel performance. Computational Fluid Dynamics (CFD can be suitable alternative for studying the flow pattern characteristics in helical channels. The different ranges of dimensional parameters, such as curvature and torsion, often cause various flow regimes in the helical channels. In this study, the effects of physical parameters such as curvature, torsion, Reynolds number, Froude number and Dean Number on the characteristics of the turbulent flow in helical rectangular channels have been investigated numerically, using a finite volume RANSE code Fluent of Ansys workbench 10.1 UTM licensed. The physical parameters were reported for range of curvature (δ of 0.16 to 0.51 and torsion (λ of 0.032 to 0.1 .The numerical results of this study showed that the decrease in the channel curvature and the increase in the channel torsion numbers led to the increase of the flow velocity inside the channel and the change in the shape of water free surface at given Dean, Reynolds and Froude numbers.
Boiling heat transfer and dryout in helically coiled tubes under different pressure conditions
International Nuclear Information System (INIS)
Chung, Young-Jong; Bae, Kyoo-Hwan; Kim, Keung Koo; Lee, Won-Jae
2014-01-01
Highlights: • Heat transfer characteristics and dryout for helically coiled tube are performed. • A boiling heat transfer tends to increase with a pressure increase. • Dryout occurs at high quality test conditions investigated. • Steiner–Taborek’s correlation is predicted well based on the experimental results. - Abstract: A helically coiled once-through steam generator has been used widely during the past several decades for small nuclear power reactors. The heat transfer characteristics and dryout conditions are important to optimal design a helically coiled steam generator. Various experiments with the helically coiled tubes are performed to investigate the heat transfer characteristics and occurrence condition of a dryout. For the investigated experimental conditions, Steiner–Taborek’s correlation is predicted reasonably based on the experimental results. The pressure effect is important for the boiling heat transfer correlation. A boiling heat transfer tends to increase with a pressure increase. However, it is not affected by the pressure change at a low power and low mass flow rate. Dryout occurs at high quality test conditions investigated because a liquid film on the wall exists owing to a centrifugal force of the helical coil
DEFF Research Database (Denmark)
Ottesen, B; Fahrenkrug, J
1995-01-01
Vasoactive intestinal polypeptide, a neuropeptide with wide distribution in the central and peripheral nervous system, has a broad spectrum of biologic actions. The demonstration of vasoactive intestinal polypeptide containing nerve fibers within the female and male genital tract 17 years ago...... indicated a putative role for this peptide in the local nervous control of reproductive functions. The genes encoding the preprovasoactive intestinal polypeptide precursor molecule and the vasoactive intestinal polypeptide receptor have been identified. The gene expression has been studied by the use...... in the genital tracts (i.e., blood flow and nonvascular smooth muscle relaxation). In the ovary vasoactive intestinal polypeptide seems to play an important role as regulator and/or modulator of folliculogenesis and steroidogenesis. In the male genital tract vasoactive intestinal polypeptide seems to participate...
Dynamic helical CT mammography of breast cancer
International Nuclear Information System (INIS)
Yamamoto, Akira; Fukushima, Hitoshi; Okamura, Ryuji; Nakamura, Yoshiaki; Morimoto, Taisuke; Urata, Yoji; Mukaihara, Sumio; Hayakawa, Katsumi
2006-01-01
The purpose of this study was to determine whether dynamic helical computed tomography (CT)-mammography could assist in selecting the most appropriate surgical method in women with breast cancer. Preoperative contrast-enhanced helical CT scanning of the breast was performed on 133 female patients with suspicion of breast cancer at the same time as clinical, mammographic, and/or ultrasonographic examinations. The patients were scanned in the prone position with a specially designed CT-compatible device. A helical scan was made with rapid intravenous bolus injection (3 ml/s) of 100 ml of iodine contrast material. Three-dimensional maximum intensity projection (MIP) images were reconstructed, and CT findings were correlated with surgical and histopathological findings. Histopathological analysis revealed 84 malignant lesions and seven benign lesions. The sensitivity, specificity, and accuracy levels of the CT scanning were 94.6%, 58.6%, and 78.9%. Helical scanning alone revealed additional contralateral carcinomas in three of four patients and additional ipsilateral carcinomas in three of five patients. However, the technique gave false-positive readings in 24 patients. The preoperative CT-mammogram altered the surgical method in six patients. Dynamic helical CT-mammography in the prone position may be one of the choices of adjunct imaging in patients with suspected breast cancer scheduled for surgery. (author)
Introduction to the m = 1 helicity source
International Nuclear Information System (INIS)
Platts, D.A.; Jarboe, T.R.; Wright, B.L.
1985-01-01
The m = 1 Helicity Source, formerly called the Kinked Z-pinch, was developed as part of the Electrode Studies program at Los Alamos. The Electrode Studies program was initiated to study the control of electrode erosion in long discharge duration spheromak sources. Erosion control is necessary to reduce plasma impurities and to obtain adequate electrode lifetimes. The first task of the Electrode Studies program is to determine, from among a variety of configurations including the coaxial one, a helicity source geometry with good prospects for erosion control. The more efficient the helicity source the easier it will be to control erosion, but the source most also be easy to diagnose and modify if it is to be a useful test bed. The various erosion control techniques which have been proposed will require extensive experimentation to evaluate and optimize. Proposed techniques include, using refractory metals, profiling of the electrodes and magnetic fields, and various gas injection schemes including porous electrodes. It is considered necessary to do these experiments on an optimized helicity source so that the electrode geometries and plasma properties will be relevant. Therefore the present Electrode Studies program is aimed at developing an improved helicity source design
Clinical application of helical CT colonography
International Nuclear Information System (INIS)
Zeng Huiliang; Zhu Xinjin; Liang Rujian; Liang Jianhao; Ou Weiqian; Wen Haomao
2009-01-01
Objective: To investigate the clinical value of 16-slice helical CT colonography in the diagnosis of colon tumor and polypus. Methods: 16-slice helical CT volumetric scanning was performed in 18 patients with colonic disease, including colonic tumor (n=16) and colonic polypus (n=2). 3D images, virtual endoscopy and multiplanar reformation were obtained in the AW4.1 workstation. CT appearances were compared with operation and fiberoptic colonoscopy. Results: Satisfied results were achieved from 18 patients, no difference found in results between CT colonography and operation in 16 patients with colonic tumor. Conclusion: 16-slice helical CT colonography is of great value in preoperative staging of colonic tumor and have a high value in clinical application. (authors)
Helicity antenna showers for hadron colliders
Energy Technology Data Exchange (ETDEWEB)
Fischer, Nadine; Skands, Peter [Monash University, School of Physics and Astronomy, Clayton, VIC (Australia); Lifson, Andrew [Monash University, School of Physics and Astronomy, Clayton, VIC (Australia); ETH Zuerich, Zurich (Switzerland)
2017-10-15
We present a complete set of helicity-dependent 2 → 3 antenna functions for QCD initial- and final-state radiation. The functions are implemented in the Vincia shower Monte Carlo framework and are used to generate showers for hadron-collider processes in which helicities are explicitly sampled (and conserved) at each step of the evolution. Although not capturing the full effects of spin correlations, the explicit helicity sampling does permit a significantly faster evaluation of fixed-order matrix-element corrections. A further speed increase is achieved via the implementation of a new fast library of analytical MHV amplitudes, while matrix elements from Madgraph are used for non-MHV configurations. A few examples of applications to QCD 2 → 2 processes are given, comparing the newly released Vincia 2.200 to Pythia 8.226. (orig.)
Manipulation of wavefront using helical metamaterials.
Yang, Zhenyu; Wang, Zhaokun; Tao, Huan; Zhao, Ming
2016-08-08
Helical metamaterials, a kind of 3-dimensional structure, has relatively strong coupling effect among the helical nano-wires. Therefore, it is expected to be a good candidate for generating phase shift and controlling wavefront with high efficiency. In this paper, using the finite-difference time-domain (FDTD) method, we studied the phase shift properties in the helical metamaterials. It is found that the phase shift occurs for both transmitted and reflected light waves. And the maximum of reflection coefficients can reach over 60%. In addition, the phase shift (φ) is dispersionless in the range of 600 nm to 860 nm, that is, it is only dominated by the initial angle (θ) of the helix. The relationship between them is φ = ± 2θ. Using Jones calculus we give a further explanation for these properties. Finally, by arranging the helixes in an array with a constant phase gradient, the phenomenon of anomalous refraction was also observed in a broad wavelength range.
Helicity antenna showers for hadron colliders
Fischer, Nadine; Lifson, Andrew; Skands, Peter
2017-10-01
We present a complete set of helicity-dependent 2→ 3 antenna functions for QCD initial- and final-state radiation. The functions are implemented in the Vincia shower Monte Carlo framework and are used to generate showers for hadron-collider processes in which helicities are explicitly sampled (and conserved) at each step of the evolution. Although not capturing the full effects of spin correlations, the explicit helicity sampling does permit a significantly faster evaluation of fixed-order matrix-element corrections. A further speed increase is achieved via the implementation of a new fast library of analytical MHV amplitudes, while matrix elements from Madgraph are used for non-MHV configurations. A few examples of applications to QCD 2→ 2 processes are given, comparing the newly released Vincia 2.200 to Pythia 8.226.
Neutrino's helicity in a gravitational field
International Nuclear Information System (INIS)
Pansart, J.P.
1996-01-01
By using approximated solutions of Dirac's equation, we show that there is no helicity reversal for light neutrinos in the Schwarzschild metric nor in an expanding universe. The actual coupling between a particle spin and the angular momentum of a heavy rotating body induces a possible helicity reversal but with an unobservable probability proportional to m 2 p / E 2 , where m p is the particle mass and E its energy. In these calculations, the helicity is defined through the spin orientation with respect to the current and not with respect to the linear momentum. This definition gives simple expressions and is equal to the usual definition in the case of a flat space. (N.T.)
Single-superfield helical-phase inflation
Energy Technology Data Exchange (ETDEWEB)
Ketov, Sergei V., E-mail: ketov@tmu.ac.jp [Department of Physics, Tokyo Metropolitan University, Minami-ohsawa 1-1, Hachioji-shi, Tokyo 192-0397 (Japan); Kavli Institute for the Physics and Mathematics of the Universe (IPMU), The University of Tokyo, Chiba 277-8568 (Japan); Institute of Physics and Technology, Tomsk Polytechnic University, 30 Lenin Ave., Tomsk 634050 (Russian Federation); Terada, Takahiro, E-mail: takahiro@hep-th.phys.s.u-tokyo.ac.jp [Department of Physics, The University of Tokyo, Tokyo 113-0033 (Japan); Deutsches Elektronen-Synchrotron (DESY), 22607 Hamburg (Germany)
2016-01-10
Large-field inflation in supergravity requires the approximate global symmetry needed to protect flatness of the scalar potential. In helical-phase inflation, the U(1) symmetry of the Kähler potential is assumed, the phase part of the complex scalar of a chiral superfield plays the role of inflaton, and the radial part is strongly stabilized. The original model of helical phase inflation, proposed by Li, Li and Nanopoulos (LLN), employs an extra (stabilizer) superfield. We propose a more economical new class of the helical phase inflationary models without a stabilizer superfield. As the specific examples, the quadratic, the natural, and the Starobinsky-type inflationary models are studied in our approach.
Resonant helical fields in the TBR tokamak
International Nuclear Information System (INIS)
Bender, O.W.
1986-01-01
The influence of external resonant helical fields (RHF) in the tokamak TBR plasma discharges was investigated. These fields were created by helical windings wounded on the TBR vessel with the same helicity of rational magnetic surfaces, producing resonant efects on these surfaces. The characteristics of the MHZ activity (amplitude, frequency and poloidal and toroidal wave numbers, m=2,3,4 and n=1, respectively) during the plasma discharges were modified by eletrical winding currents of the order of 2% of the plasma current. These characterisitics were measured for diferent discharges safety factors at the limiter (q) between 3 and 4, with and without the RHF, with the atenuation of the oscillation amplitudes and the increasing of their frequencies. The existente of expontaneous and induced magnetic islands were investigated. The data were compared with results obtained in other tokamaks. (author) [pt
The helical structure of DNA facilitates binding
International Nuclear Information System (INIS)
Berg, Otto G; Mahmutovic, Anel; Marklund, Emil; Elf, Johan
2016-01-01
The helical structure of DNA imposes constraints on the rate of diffusion-limited protein binding. Here we solve the reaction–diffusion equations for DNA-like geometries and extend with simulations when necessary. We find that the helical structure can make binding to the DNA more than twice as fast compared to a case where DNA would be reactive only along one side. We also find that this rate advantage remains when the contributions from steric constraints and rotational diffusion of the DNA-binding protein are included. Furthermore, we find that the association rate is insensitive to changes in the steric constraints on the DNA in the helix geometry, while it is much more dependent on the steric constraints on the DNA-binding protein. We conclude that the helical structure of DNA facilitates the nonspecific binding of transcription factors and structural DNA-binding proteins in general. (paper)
Suppression and control of leakage field in electromagnetic helical microwiggler
Energy Technology Data Exchange (ETDEWEB)
Ohigashi, N. [Kansai Univ., Osaka (Japan); Tsunawaki, Y. [Osaka Sangyo Univ. (Japan); Imasaki, K. [Institute for Laser Technology, Osaka (Japan)] [and others
1995-12-31
Shortening the period of electromagnetic wiggler introduces both the radical increase of the leakage field and the decrease of the field in the gap region. The leakage field is severer problem in planar electromagnetic wiggler than in helical wiggler. Hence, in order to develop a short period electromagnetic wiggler, we have adopted {open_quotes}three poles per period{close_quotes} type electromagnetic helical microwiggler. In this work, we inserted the permanent magnet (PM) blocks with specific magnetized directions in the space between magnetic poles, for suppressing the leakage field flowing out from a pole face to the neighboring pole face. These PM-blocks must have higher intrinsic coersive force than saturation field of pole material. The gap field due to each pole is adjustable by controlling the leakage fields, that is, controlling the position of each iron screw set in each retainer fixing the PM-blocks. At present time, a test wiggler with period 7.8mm, periodical number 10 and gap length 4.6mm has been manufactured. Because the ratio of PM-block aperture to gap length is important parameter to suppress the leakage field, the parameter has been surveyed experimentally for PM-blocks with several dimensions of aperture. The field strength of 3-5kG (K=0.2-0.4) would be expected in the wiggler.
Studies on positive conveying in helically channeled single screw extruders
Directory of Open Access Journals (Sweden)
L. Pan
2012-07-01
Full Text Available A solids conveying theory called double-flight driving theory was proposed for helically channeled single screw extruders. In the extruder, screw channel rotates against static barrel channel, which behaves as cooperative embedded twin-screws for the positive conveying. They turn as two parallel arc plates, between which an arc-plate solid-plug was assumed. By analyzing the forces on the solid-plug in the barrel channel and screw channel, the boundary conditions when the solid-plug is waived of being cut off on barrel wall, were found to have the capacity of the positive conveying. Experimental data were obtained using a specially designed extruder with a helically channeled barrel in the feeding zone and a pressure-adjustable die. The effects of the barrel channel geometry and friction coefficients on the conveying mechanism were presented and compared with the experimental results. The simulations showed that the positive conveying could be achieved after optimizing extruder designs. Compared with the traditional design with the friction-drag conveying, the throughput is higher while screw torque and energy consumption are decreased. Besides, the design criteria of the barrel channel were also discussed.
Turbulent Helicity in the Atmospheric Boundary Layer
Chkhetiani, Otto G.; Kurgansky, Michael V.; Vazaeva, Natalia V.
2018-05-01
We consider the assumption postulated by Deusebio and Lindborg (J Fluid Mech 755:654-671, 2014) that the helicity injected into the Ekman boundary layer undergoes a cascade, with preservation of its sign (right- or alternatively left-handedness), which is a signature of the system rotation, from large to small scales, down to the Kolmogorov microscale of turbulence. At the same time, recent direct field measurements of turbulent helicity in the steppe region of southern Russia near Tsimlyansk Reservoir show the opposite sign of helicity from that expected. A possible explanation for this phenomenon may be the joint action of different scales of atmospheric flows within the boundary layer, including the sea-breeze circulation over the test site. In this regard, we consider a superposition of the classic Ekman spiral solution and Prandtl's jet-like slope-wind profile to describe the planetary boundary-layer wind structure. The latter solution mimics a hydrostatic shallow breeze circulation over a non-uniformly heated surface. A 180°-wide sector on the hodograph plane exists, within which the relative orientation of the Ekman and Prandtl velocity profiles favours the left rotation with height of the resulting wind velocity vector in the lowermost part of the boundary layer. This explains the negative (left-handed) helicity cascade toward small-scale turbulent motions, which agrees with the direct field measurements of turbulent helicity in Tsimlyansk. A simple turbulent relaxation model is proposed that explains the measured positive values of the relatively minor contribution to turbulent helicity from the vertical components of velocity and vorticity.
Nonideal, helical, vortical magnetohydrodynamic steady states
International Nuclear Information System (INIS)
Agim, Y.Z.; Montgomery, D.
1991-01-01
The helically-deformed profiles of driven, dissipative magnetohydrodynamic equilibria are constructed through second order in helical amplitude. The resultant plasma configurations are presented in terms of contour plots of magnetic flux function, pressure, current flux function and the mass flux function, along with the stability boundary at which they are expected to appear. For the Wisconsin Phaedrus-T Tokamak, plasma profiles with significant m = 3, n = 1 perturbation seem feasible; for these, the plasma pressure peaks off-axis. For the smaller aspect ratio case, the configuration with m 1,n =1 is thought to be relevant to the density perturbation observed in JET after a pellet injection. (author)
Equilibrium calculations for helical axis stellarators
International Nuclear Information System (INIS)
Hender, T.C.; Carreras, B.A.
1984-04-01
An average method based on a vacuum flux coordinate system is presented. This average method permits the study of helical axis stellarators with toroidally dominated shifts. An ordering is introduced, and to lowest order the toroidally averaged equilibrium equations are reduced to a Grad-Shafranov equation. Also, to lowest order, a Poisson-type equation is obtained for the toroidally varying corrections to the equilibium. By including these corrections, systems that are toroidally dominated, but with significant helical distortion to the equilibrium, may be studied. Numerical solutions of the average method equations are shown to agree well with three-dimensional calculations
Helical post stellarator. Part 1: Vacuum configuration
International Nuclear Information System (INIS)
Moroz, P.E.
1997-08-01
Results on a novel type of stellarator configuration, the Helical Post Stellarator (HPS), are presented. This configuration is different significantly from all previously known stellarators due to its unique geometrical characteristics and unique physical properties. Among those are: the magnetic field has only one toroidal period (M = 1), the plasma has an extremely low aspect ratio, A ∼ 1, and the variation of the magnetic field, B, along field lines features a helical ripple on the inside of the torus. Among the main advantages of a HPS for a fusion program are extremely compact, modular, and simple design compatible with significant rotational transform, large plasma volume, and improved particle transport characteristics
Equilibrium studies of helical axis stellarators
International Nuclear Information System (INIS)
Hender, T.C.; Carreras, B.A.; Garcia, L.; Harris, J.H.; Rome, J.A.; Cantrell, J.L.; Lynch, V.E.
1984-01-01
The equilibrium properties of helical axis stellarators are studied with a 3-D equilibrium code and with an average method (2-D). The helical axis ATF is shown to have a toroidally dominated equilibrium shift and good equilibria up to at least 10% peak beta. Low aspect ratio heliacs, with relatively large toroidal shifts, are shown to have low equilibrium beta limits (approx. 5%). Increasing the aspect ratio and number of field periods proportionally is found to improve the equilibrium beta limit. Alternatively, increasing the number of field periods at fixed aspect ratio which raises and lowers the toroidal shift improves the equilibrium beta limit
Conversion from mutual helicity to self-helicity observed with IRIS
Li, L. P.; Peter, H.; Chen, F.; Zhang, J.
2014-10-01
Context. In the upper atmosphere of the Sun observations show convincing evidence for crossing and twisted structures, which are interpreted as mutual helicity and self-helicity. Aims: We use observations with the new Interface Region Imaging Spectrograph (IRIS) to show the conversion of mutual helicity into self-helicity in coronal structures on the Sun. Methods: Using far UV spectra and slit-jaw images from IRIS and coronal images and magnetograms from SDO, we investigated the evolution of two crossing loops in an active region, in particular, the properties of the Si IV line profile in cool loops. Results: In the early stage two cool loops cross each other and accordingly have mutual helicity. The Doppler shifts in the loops indicate that they wind around each other. As a consequence, near the crossing point of the loops (interchange) reconnection sets in, which heats the plasma. This is consistent with the observed increase of the line width and of the appearance of the loops at higher temperatures. After this interaction, the two new loops run in parallel, and in one of them shows a clear spectral tilt of the Si IV line profile. This is indicative of a helical (twisting) motion, which is the same as to say that the loop has self-helicity. Conclusions: The high spatial and spectral resolution of IRIS allowed us to see the conversion of mutual helicity to self-helicity in the (interchange) reconnection of two loops. This is observational evidence for earlier theoretical speculations. Movie associated with Fig. 1 and Appendix A are available in electronic form at http://www.aanda.org
Organic anion transporting polypeptide 1B transporters modulate hydroxyurea pharmacokinetics
Walker, Aisha L.; Lancaster, Cynthia S.; Finkelstein, David; Ware, Russell E.; Sparreboom, Alex
2013-01-01
Hydroxyurea is currently the only FDA-approved drug that ameliorates the pathophysiology of sickle cell anemia. Unfortunately, substantial interpatient variability in the pharmacokinetics (PK) of hydroxyurea may result in variation of the drug's efficacy. However, little is known about mechanisms that modulate hydroxyurea PK. Recent in vitro studies identifying hydroxyurea as a substrate for organic anion transporting polypeptide (OATP1B) transporters prompted the current investigation assess...
Functional Modification of Thioether Groups in Peptides, Polypeptides, and Proteins
Deming, TJ
2017-01-01
Recent developments in the modification of methionine and other thioether-containing residues in peptides, polypeptides, and proteins are reviewed. Properties and potential applications of the resulting functionalized products are also discussed. While much of this work is focused on natural Met residues, modifications at other side-chain residues have also emerged as new thioether-containing amino acids have been incorporated into peptidic materials. Functional modification of thioether-cont...
Generation of polypeptide-templated gold nanoparticles using ionizing radiation.
Walker, Candace Rae; Pushpavanam, Karthik; Nair, Divya Geetha; Potta, Thrimoorthy; Sutiyoso, Caesario; Kodibagkar, Vikram D; Sapareto, Stephen; Chang, John; Rege, Kaushal
2013-08-13
Ionizing radiation, including γ rays and X-rays, are high-energy electromagnetic radiation with diverse applications in nuclear energy, astrophysics, and medicine. In this work, we describe the use of ionizing radiation and cysteine-containing elastin-like polypeptides (C(n)ELPs, where n = 2 or 12 cysteines in the polypeptide sequence) for the generation of gold nanoparticles. In the presence of C(n)ELPs, ionizing radiation doses higher than 175 Gy resulted in the formation of maroon-colored gold nanoparticle dispersions, with maximal absorbance at 520 nm, from colorless metal salts. Visible color changes were not observed in any of the control systems, indicating that ionizing radiation, gold salt solution, and C(n)ELPs were all required for nanoparticle formation. The hydrodynamic diameters of nanoparticles, determined using dynamic light scattering, were in the range of 80-150 nm, while TEM imaging indicated the formation of gold cores 10-20 nm in diameter. Interestingly, C2ELPs formed 1-2 nm diameter gold nanoparticles in the absence of radiation. Our results describe a facile method of nanoparticle formation in which nanoparticle size can be tailored based on radiation dose and C(n)ELP type. Further improvements in these polypeptide-based systems can lead to colorimetric detection of ionizing radiation in a variety of applications.
Cotranslational structure acquisition of nascent polypeptides monitored by NMR spectroscopy.
Eichmann, Cédric; Preissler, Steffen; Riek, Roland; Deuerling, Elke
2010-05-18
The folding of proteins in living cells may start during their synthesis when the polypeptides emerge gradually at the ribosomal exit tunnel. However, our current understanding of cotranslational folding processes at the atomic level is limited. We employed NMR spectroscopy to monitor the conformation of the SH3 domain from alpha-spectrin at sequential stages of elongation via in vivo ribosome-arrested (15)N,(13)C-labeled nascent polypeptides. These nascent chains exposed either the entire SH3 domain or C-terminally truncated segments thereof, thus providing snapshots of the translation process. We show that nascent SH3 polypeptides remain unstructured during elongation but fold into a compact, native-like beta-sheet assembly when the entire sequence information is available. Moreover, the ribosome neither imposes major conformational constraints nor significantly interacts with exposed unfolded nascent SH3 domain moieties. Our data provide evidence for a domainwise folding of the SH3 domain on ribosomes without significant population of folding intermediates. The domain follows a thermodynamically favorable pathway in which sequential folding units are stabilized, thus avoiding kinetic traps during the process of cotranslational folding.
Reversible end-to-end assembly of gold nanorods using a disulfide-modified polypeptide
International Nuclear Information System (INIS)
Walker, David A; Gupta, Vinay K
2008-01-01
Directing the self-assembly of colloidal particles into nanostructures is of great interest in nanotechnology. Here, reversible end-to-end assembly of gold nanorods (GNR) is induced by pH-dependent changes in the secondary conformation of a disulfide-modified poly(L-glutamic acid) (SSPLGA). The disulfide anchoring group drives chemisorption of the polyacid onto the end of the gold nanorods in an ethanolic solution. A layer of poly(vinyl pyrrolidone) is adsorbed on the positively charged, surfactant-stabilized GNR to screen the surfactant bilayer charge and provide stability for dispersion of the GNR in ethanol. For comparison, irreversible end-to-end assembly using a bidentate ligand, namely 1,6-hexanedithiol, is also performed. Characterization of the modified GNR and its end-to-end linking behavior using SSPLGA and hexanedithiol is performed using dynamic light scattering (DLS), UV-vis absorption spectroscopy and transmission electron microscopy (TEM). Experimental results show that, in a colloidal solution of GNR-SSPLGA at a pH∼3.5, where the PLGA is in an α-helical conformation, the modified GNR self-assemble into one-dimensional nanostructures. The linking behavior can be reversed by increasing the pH (>8.5) to drive the conformation of the polypeptide to a random coil and this reversal with pH occurs rapidly within minutes. Cycling the pH multiple times between low and high pH values can be used to drive the formation of the nanostructures of the GNR and disperse them in solution.
Energy Technology Data Exchange (ETDEWEB)
Sahu, Nityananda; Gadre, Shridhar R., E-mail: gadre@iitk.ac.in [Department of Chemistry, Indian Institute of Technology Kanpur, Kanpur 208 016 (India)
2016-03-21
The present work reports the calculation of vibrational infrared (IR) and Raman spectra of large molecular systems employing molecular tailoring approach (MTA). Further, it extends the grafting procedure for the accurate evaluation of IR and Raman spectra of large molecular systems, employing a new methodology termed as Fragments-in-Fragments (FIF), within MTA. Unlike the previous MTA-based studies, the accurate estimation of the requisite molecular properties is achieved without performing any full calculations (FC). The basic idea of the grafting procedure is implemented by invoking the nearly basis-set-independent nature of the MTA-based error vis-à-vis the respective FCs. FIF has been tested out for the estimation of the above molecular properties for three isomers, viz., β-strand, 3{sub 10}- and α-helix of acetyl(alanine){sub n}NH{sub 2} (n = 10, 15) polypeptides, three conformers of doubly protonated gramicidin S decapeptide and trpzip2 protein (PDB id: 1LE1), respectively, employing BP86/TZVP, M06/6-311G**, and M05-2X/6-31G** levels of theory. For most of the cases, a maximum difference of 3 cm{sup −1} is achieved between the grafted-MTA frequencies and the corresponding FC values. Further, a comparison of the BP86/TZVP level IR and Raman spectra of α-helical (alanine){sub 20} and its N-deuterated derivative shows an excellent agreement with the existing experimental spectra. In view of the requirement of only MTA-based calculations and the ability of FIF to work at any level of theory, the current methodology provides a cost-effective solution for obtaining accurate spectra of large molecular systems.
International Nuclear Information System (INIS)
Santosh, Mogurampelly; Maiti, Prabal K
2009-01-01
When pulled along the axis, double-strand DNA undergoes a large conformational change and elongates by roughly twice its initial contour length at a pulling force of about 70 pN. The transition to this highly overstretched form of DNA is very cooperative. Applying a force perpendicular to the DNA axis (unzipping), double-strand DNA can also be separated into two single-stranded DNA, this being a fundamental process in DNA replication. We study the DNA overstretching and unzipping transition using fully atomistic molecular dynamics (MD) simulations and argue that the conformational changes of double-strand DNA associated with either of the above mentioned processes can be viewed as force induced DNA melting. As the force at one end of the DNA is increased the DNA starts melting abruptly/smoothly above a critical force depending on the pulling direction. The critical force f m , at which DNA melts completely decreases as the temperature of the system is increased. The melting force in the case of unzipping is smaller compared to the melting force when the DNA is pulled along the helical axis. In the case of melting through unzipping, the double-strand separation has jumps which correspond to the different energy minima arising due to sequence of different base pairs. The fraction of Watson-Crick base pair hydrogen bond breaking as a function of force does not show smooth and continuous behavior and consists of plateaus followed by sharp jumps.
Mezö, G; Hudecz, F; Kajtár, J; Szókán, G; Szekerke, M
1989-10-01
New branched polypeptides were synthesized for a detailed study of the influence of the side-chain structure on the conformation and biological properties. The first subset of polypeptides were prepared by coupling of tetrapeptides to poly[L-Lys]. These polymers contain either DL-Ala3-X [poly[Lys-(X-DL-Ala3)n
Dynamics and deformability of α-, 310- and π-helices
Directory of Open Access Journals (Sweden)
Narwani Tarun Jairaj
2018-01-01
Full Text Available Protein structures are often represented as seen in crystals as (i rigid macromolecules (ii with helices, sheets and coils. However, both definitions are partial because (i proteins are highly dynamic macromolecules and (ii the description of protein structures could be more precise. With regard to these two points, we analyzed and quantified the stability of helices by considering α-helices as well as 310- and π-helices. Molecular dynamic (MD simulations were performed on a large set of 169 representative protein domains. The local protein conformations were followed during each simulation and analyzed. The classical flexibility index (B-factor was confronted with the MD root mean square flexibility (RMSF index. Helical regions were classified according to their level of helicity from high to none. For the first time, a precise quantification showed the percentage of rigid and flexible helices that underlie unexpected behaviors. Only 76.4% of the residues associated with α-helices retain the conformation, while this tendency drops to 40.5% for 310-helices and is never observed for π-helices. α-helix residues that do not remain as an α-helix have a higher tendency to assume β-turn conformations than 310- or π-helices. The 310-helices that switch to the α-helix conformation have a higher B-factor and RMSF values than the average 310-helix but are associated with a lower accessibility. Rare π-helices assume a β-turn, bend and coil conformations, but not α- or 310-helices. The view on π-helices drastically changes with the new DSSP (Dictionary of Secondary Structure of Proteins assignment approach, leading to behavior similar to 310-helices, thus underlining the importance of secondary structure assignment methods.
Review of the helicity formalism; Revision del formalismo de helicidad
Energy Technology Data Exchange (ETDEWEB)
Barreiro, F; Cerrada, M; Fernandez, E
1972-07-01
Our purpose in these notes has been to present a brief and general review of the helicity formalism. We begin by discussing Lorentz invariance, spin and helicity ideas, in section 1 . In section 2 we deal with the construction of relativistic states and scattering amplitudes in the helicity basis and we study their transformation properties under discrete symmetries. Finally we present some more sophisticated topics like kinematical singularities of helicity amplitudes, kinematical constraints and crossing relations 3, 4, 5 respectively. (Author) 8 refs.
Exabyte helical scan devices at Fermilab
International Nuclear Information System (INIS)
Constanta-Fanourakis, P.; Kaczar, K.; Oleynik, G.; Petravick, D.; Votava, M.; White, V.; Hockney, G.; Bracker, S.; de Miranda, J.M.
1989-05-01
Exabyte 8mm helical scan storage devices are in use at Fermilab in a number of applications. These devices have the functionality of magnetic tape, but use media which is much more economical and much more dense than conventional 9 track tape. 6 refs., 3 figs
Helical axial injection concept for cyclotrons
Energy Technology Data Exchange (ETDEWEB)
Hudson, E.D.
1981-01-01
A concept for an external beam injection system using a helical beam path centered on the cyclotron axis is described. This system could be used to couple two accelerator stages, with or without intermediate stripping, in cases where conventional axial injection or radial injection are not practical.
Helical axial injection concept for cyclotrons
International Nuclear Information System (INIS)
Hudson, E.D.
1981-01-01
A concept for an external beam injection system using a helical beam path centered on the cyclotron axis is described. This system could be used to couple two accelerator stages, with or without intermediate stripping, in cases where conventional axial injection or radial injection are not practical
Electron image reconstruction of helical protein assemblies
International Nuclear Information System (INIS)
Cremers, A.F.M.
1980-01-01
The analysis of projections of large ordered biological systems obtained by electron microscopy of negatively stained specimens is described. The biological structures amenable to this approach are constructed from a large number of identical protein molecules, which are arranged according to helical symmetry. Electron images of these structures generally contain sufficient information in order to calculate a three-dimensional density map. (Auth.)
Adaptive radiotherapy using helical tomotherapy system
International Nuclear Information System (INIS)
Jeswani, Sam; Ruchala, Kenneth; Olivera, Gustavo; Mackie, T.R.
2008-01-01
As commonly known in the field, adaptive radiation therapy (ART) is the use of feedback to modify a radiotherapy treatment. There are numerous ways in which this feedback can be received and used, and this presentation will discuss some of the implementations of ART being investigated with a helical TomoTherapy system
Topological characteristics of helical repeat proteins
Groves, M R; Barford, D
The recent elucidation of protein structures based upon repeating amino acid motifs, including the armadillo motif, the HEAT motif and tetratricopeptide repeats, reveals that they belong to the class of helical repeat proteins. These proteins share the common property of being assembled from tandem
A Prospective Evaluation of Helical Tomotherapy
International Nuclear Information System (INIS)
Bauman, Glenn; Yartsev, Slav; Rodrigues, George; Lewis, Craig; Venkatesan, Varagur M.; Yu, Edward; Hammond, Alex; Perera, Francisco; Ash, Robert; Dar, A. Rashid; Lock, Michael; Baily, Laura; Coad, Terry C; Trenka, Kris C.; Warr, Barbara; Kron, Tomas; Battista, Jerry; Van Dyk, Jake
2007-01-01
Purpose: To report results from two clinical trials evaluating helical tomotherapy (HT). Methods and Materials: Patients were enrolled in one of two prospective trials of HT (one for palliative and one for radical treatment). Both an HT plan and a companion three-dimensional conformal radiotherapy (3D-CRT) plan were generated. Pretreatment megavoltage computed tomography was used for daily image guidance. Results: From September 2004 to January 2006, a total of 61 sites in 60 patients were treated. In all but one case, a clinically acceptable tomotherapy plan for treatment was generated. Helical tomotherapy plans were subjectively equivalent or superior to 3D-CRT in 95% of plans. Helical tomotherapy was deemed equivalent or superior in two thirds of dose-volume point comparisons. In cases of inferiority, differences were either clinically insignificant and/or reflected deliberate tradeoffs to optimize the HT plan. Overall imaging and treatment time (median) was 27 min (range, 16-91 min). According to a patient questionnaire, 78% of patients were satisfied to very satisfied with the treatment process. Conclusions: Helical tomotherapy demonstrated clear advantages over conventional 3D-CRT in this diverse patient group. The prospective trials were helpful in deploying this technology in a busy clinical setting
International Nuclear Information System (INIS)
Hanecak, R.; Semler, B.L.; Anderson, C.W.; Wimmer, E.
1982-01-01
Proteolytic processing of poliovirus polypeptides was examined by the addition of antibodies directed against the viral proteins P3-7c and P2-X to a cell-free translation extract prepared from infected HeLa cells. Antisera to P3-7c specifically inhibited in vitro processing at Gln-Gly pairs. Partial amino acid sequence analysis revealed a second Tyr-Gly pair that is utilized in protein processing. Neither Tyr-Gly cleavage is affected by antibody to P3-7C. Anti-P3-7c antibodies react not only with P3-7c but also with P3-6a and P3-2, two viral polypeptides NH 2 -coterminal with P3-7c. Preimmune and anti-P2-X antibodies had no effect on the processing of poliovirus proteins in vitro. The authors conclude that the activity responsible for processing poliovirus polypeptides at Gln-Gly pairs resides in the primary structure of P3-7c and not in P2-X
Helicity-flip in particle production on nuclei
International Nuclear Information System (INIS)
Faeldt, G.
1977-01-01
Coherent nuclear production processes are generally analyzed assuming helicity conserving production amplitudes. In view of the uncertainties of the actual helicity structure this could be a dangerous assumption. It is shown that helicity-flip contributions might be part of the explanation of the small effective (pππ)-nucleon cross sections observed in coherent production. (Auth.)
A real-scale helical coil winding trial of the Large Helical Device
International Nuclear Information System (INIS)
Senba, T.; Yamamoto, T.; Tamaki, T.; Asano, K.; Suzuki, S.; Yamauchi, T.; Uchida, K.; Nakanishi, K.; Yamagiwa, T.; Suzuki, S.; Miyoshi, R.; Sasa, H.; Watanabe, S.; Tatemura, M.; Hatada, N.; Yamaguchi, S.; Imagawa, S.; Yanagi, N.; Satow, T.; Yamamoto, J.; Motojima, O.
1995-01-01
A real-scale helical coil winding trial of the Large Helical Device (LHD) has been conducted for a study of coil winding configuration and winding methods and for exhibiting the state of the art. It includes construction and test run of a specifically designed winding machine and development of various manufacturing methods for accurate coil winding. It has been carried out in Hitachi Works before in situ winding, and has provided much needed engineering data for construction of the LHD. (orig.)
Steady-state MreB helices inside bacteria: dynamics without motors
Allard, Jun F.; Rutenberg, Andrew D.
2007-01-01
Within individual bacteria, we combine force-dependent polymerization dynamics of individual MreB protofilaments with an elastic model of protofilament bundles buckled into helical configurations. We use variational techniques and stochastic simulations to relate the pitch of the MreB helix, the total abundance of MreB, and the number of protofilaments. By comparing our simulations with mean-field calculations, we find that stochastic fluctuations are significant. We examine the quasi-static ...
Fatnanta, F.; Satibi, S.; Muhardi
2018-03-01
In an area dominated by thick peat soil layers, driven piles foundation is often used. These piles are generally skin friction piles where the pile tips do not reach hard stratum. Since the bearing capacity of the piles rely on the resistance of their smooth skin, the bearing capacity of the piles are generally low. One way to increase the bearing capacity of the piles is by installing helical plates around the pile tips. Many research has been performed on helical pile foundation. However, literature on the use of helical pile foundation on peat soil is still hardly found. This research focus on the study of axial bearing capacity of helical pile foundation in peat soil, especially in Riau Province. These full-scale tests on helical pile foundation were performed in a rectangular box partially embedded into the ground. The box is filled with peat soil, which was taken from Rimbo Panjang area in the district of Kampar, Riau Province. Several helical piles with different number, diameter and spacing of the helical plates have been tested and analysed. The tests result show that helical pile with three helical plates of uniform diameter has better bearing capacity compared to other helical piles with varying diameter and different number of helical plates. The bearing capacity of helical pile foundation is affected by the spacing between helical plates. It is found that the effective helical plates spacing for helical pile foundation with diameter of 15cm to 35cm is between 20cm to 30cm. This behaviour may be considered to apply to other type of helical pile foundations in peat soil.
Energy Technology Data Exchange (ETDEWEB)
Izawa, S.; Kiya, M.; Mochizuki, O. [Hokkaido University, Sapporo (Japan)
1998-09-25
The evolution of vortical structure in an impulsively started round jet has been studied numerically by means of a three-dimensional vortex blob method. The viscous diffusion of vorticity is approximated by a core spreading model originally proposed by Leonard (1980). The jet is forced by axisymmetric, helical and multiple disturbances. The multiple disturbances are combinations of two helical disturbances of the same mode rotating in the opposite directions. The multiple disturbances are found to enhance both the generation of small-scale structures and the growth rate of the jet. The small-scale structures have highly organized spatial distributions. The core spreading method is effective in aquiring the core overlapping in regions of high extensional rate of strain. 21 refs., 12 figs.
Hirai, Kenji; Yeom, Bongjun; Sada, Kazuki
2017-06-27
Fabrication of chiroptical materials with broadband response in the visible light region is vital to fully realize their potential applications. One way to achieve broadband chiroptical activity is to fabricate chiral nanostructures from materials that exhibit broadband absorption in the visible light region. However, the compounds used for chiroptical materials have predominantly been limited to materials with narrowband spectral response. Here, we synthesize Ag 2 S-based nanohelices derived from helical coordination polymers. The right- and left-handed coordination helices used as precursors are prepared from l- and d-glutathione with Ag + and a small amount of Cu 2+ . The pyrolysis of the coordination helices yields right- and left-handed helices of Cu 0.12 Ag 1.94 S/C, which exhibit chiroptical activity spanning the entire visible light region. Finite element method simulations substantiate that the broadband chiroptical activity is attributed to synergistic broadband light absorption and light scattering. Furthermore, another series of Cu 0.10 Ag 1.90 S/C nanohelices are synthesized by choosing the l- or d-Glu-Cys as starting materials. The pitch length of nanohelicies is controlled by changing the peptides, which alters their chiroptical properties. The pyrolysis of coordination helices enables one to fabricate helical Ag 2 S-based materials that enable broadband chiroptical activity but have not been explored owing to the lack of synthetic routes.
Lerch, Mirjam; Gafner, Verena; Bader, Reto; Christen, Barbara; Folkers, Gerd; Zerbe, Oliver
2002-10-04
The pancreatic polypeptide (PP), a 36-residue, C-terminally amidated polypeptide hormone is a member of the neuropeptide Y (NPY) family. Here, we have studied the structure and dynamics of bovine pancreatic polypeptide (bPP) when bound to DPC-micelles as a membrane-mimicking model as well as the dynamics of bPP in solution. The comparison of structure and dynamics of bPP in both states reveals remarkable differences. The overall correlation time of 5.08ns derived from the 15N relaxation data proves unambiguously that bPP in solution exists as a dimer. Therein, intermolecular as well as intramolecular hydrophobic interactions from residues of both the amphiphilic helix and of the back-folded N terminus contribute to the stability of the PP fold. The overall rigidity is well-reflected in positive values for the heteronuclear NOE for residues 4-34. The membrane-bound species displays a partitioning into a more flexible N-terminal region and a well-defined alpha-helical region comprising residues 17-31. The average RMSD value for residues 17-31 is 0.22(+/-0.09)A. The flexibility of the N terminus is compatible with negative values of the heteronuclear NOE observed for the N-terminal residues 4-12 and low values of the generalized order parameter S(2). The membrane-peptide interface was investigated by micelle-integrating spin-labels and H,2H exchange measurements. It is formed by those residues which make contacts between the C-terminal alpha-helix and the polyproline helix. In contrast to pNPY, also residues from the N terminus display spatial proximity to the membrane interface. Furthermore, the orientation of the C terminus, that presumably contains residues involved in receptor binding, is different in the two environments. We speculate that this pre-positioning of residues could be an important requirement for receptor activation. Moreover, we doubt that the PP fold is of functional relevance for binding at the Y(4) receptor.
Morphological variation of stimuli-responsive polypeptide at air–water interface
International Nuclear Information System (INIS)
Shin, Sungchul; Ahn, Sungmin; Cheng, Jie; Chang, Hyejin; Jung, Dae-Hong; Hyun, Jinho
2016-01-01
Graphical abstract: - Highlights: • It is the first report on the interfacial properties of ELP monolayers formed at the air–water interface. • ELP monolayers could be prepared with high stability at the air–water interface. • The compressive behavior of thermo-sensitive ELP monolayers was imaged. • The SERS spectra showed a change in the ELP secondary structure at different preparation conditions. - Abstract: The morphological variation of stimuli-responsive polypeptide molecules at the air–water interface as a function of temperature and compression was described. The surface pressure–area (π–A) isotherms of an elastin-like polypeptide (ELP) monolayer were obtained under variable external conditions, and Langmuir–Blodgett (LB) monolayers were deposited onto a mica substrate for characterization. As the compression of the ELP monolayer increased, the surface pressure increased gradually, indicating that the ELP monolayer could be prepared with high stability at the air–water interface. The temperature in the subphase of the ELP monolayer was critical in the preparation of LB monolayers. The change in temperature induced a shift in the π–A isotherms as well as a change in ELP secondary structures. Surprisingly, the compression of the ELP monolayer influenced the ELP secondary structure due to the reduction in the phase transition temperature with decreasing temperature. The change in the ELP secondary structure formed at the air–water interface was investigated by surface-enhanced Raman scattering. Moreover, the morphology of the ELP monolayer was subsequently imaged using atomic force microscopy. The temperature responsive behavior resulted in changes in surface morphology from relatively flat structures to rugged labyrinth structures, which suggested conformational changes in the ELP monolayers.
Morphological variation of stimuli-responsive polypeptide at air–water interface
Energy Technology Data Exchange (ETDEWEB)
Shin, Sungchul; Ahn, Sungmin; Cheng, Jie [Department of Biosystems and Biomaterials Science and Engineering, Seoul National University, Seoul 151-921 (Korea, Republic of); Chang, Hyejin; Jung, Dae-Hong [Department of Chemical Education, Seoul National University, Seoul 151-741 (Korea, Republic of); Hyun, Jinho, E-mail: jhyun@snu.ac.kr [Department of Biosystems and Biomaterials Science and Engineering, Seoul National University, Seoul 151-921 (Korea, Republic of); Research Institute of Agriculture and Life Sciences, Seoul National University, Seoul 151-921 (Korea, Republic of); Center for Food and Bioconvergence, Seoul National University, Seoul 151-921, Republic of Korea. (Korea, Republic of)
2016-12-01
Graphical abstract: - Highlights: • It is the first report on the interfacial properties of ELP monolayers formed at the air–water interface. • ELP monolayers could be prepared with high stability at the air–water interface. • The compressive behavior of thermo-sensitive ELP monolayers was imaged. • The SERS spectra showed a change in the ELP secondary structure at different preparation conditions. - Abstract: The morphological variation of stimuli-responsive polypeptide molecules at the air–water interface as a function of temperature and compression was described. The surface pressure–area (π–A) isotherms of an elastin-like polypeptide (ELP) monolayer were obtained under variable external conditions, and Langmuir–Blodgett (LB) monolayers were deposited onto a mica substrate for characterization. As the compression of the ELP monolayer increased, the surface pressure increased gradually, indicating that the ELP monolayer could be prepared with high stability at the air–water interface. The temperature in the subphase of the ELP monolayer was critical in the preparation of LB monolayers. The change in temperature induced a shift in the π–A isotherms as well as a change in ELP secondary structures. Surprisingly, the compression of the ELP monolayer influenced the ELP secondary structure due to the reduction in the phase transition temperature with decreasing temperature. The change in the ELP secondary structure formed at the air–water interface was investigated by surface-enhanced Raman scattering. Moreover, the morphology of the ELP monolayer was subsequently imaged using atomic force microscopy. The temperature responsive behavior resulted in changes in surface morphology from relatively flat structures to rugged labyrinth structures, which suggested conformational changes in the ELP monolayers.
Ion temperature gradient modes in toroidal helical systems
Energy Technology Data Exchange (ETDEWEB)
Kuroda, T. [Graduate University for Advanced Studies, Toki, Gifu (Japan); Sugama, H.; Kanno, R.; Okamoto, M.
2000-04-01
Linear properties of ion temperature gradient (ITG) modes in helical systems are studied. The real frequency, growth rate, and eigenfunction are obtained for both stable and unstable cases by solving a kinetic integral equation with proper analytic continuation performed in the complex frequency plane. Based on the model magnetic configuration for toroidal helical systems like the Large Helical Device (LHD), dependences of the ITG mode properties on various plasma equilibrium parameters are investigated. Particularly, relative effects of {nabla}B-curvature drifts driven by the toroidicity and by the helical ripples are examined in order to compare the ITG modes in helical systems with those in tokamaks. (author)
Ion temperature gradient modes in toroidal helical systems
International Nuclear Information System (INIS)
Kuroda, T.; Sugama, H.; Kanno, R.; Okamoto, M.
2000-04-01
Linear properties of ion temperature gradient (ITG) modes in helical systems are studied. The real frequency, growth rate, and eigenfunction are obtained for both stable and unstable cases by solving a kinetic integral equation with proper analytic continuation performed in the complex frequency plane. Based on the model magnetic configuration for toroidal helical systems like the Large Helical Device (LHD), dependences of the ITG mode properties on various plasma equilibrium parameters are investigated. Particularly, relative effects of ∇B-curvature drifts driven by the toroidicity and by the helical ripples are examined in order to compare the ITG modes in helical systems with those in tokamaks. (author)
Biot-Savart helicity versus physical helicity: A topological description of ideal flows
Sahihi, Taliya; Eshraghi, Homayoon
2014-08-01
For an isentropic (thus compressible) flow, fluid trajectories are considered as orbits of a family of one parameter, smooth, orientation-preserving, and nonsingular diffeomorphisms on a compact and smooth-boundary domain in the Euclidian 3-space which necessarily preserve a finite measure, later interpreted as the fluid mass. Under such diffeomorphisms the Biot-Savart helicity of the pushforward of a divergence-free and tangent to the boundary vector field is proved to be conserved and since these circumstances present an isentropic flow, the conservation of the "Biot-Savart helicity" is established for such flows. On the other hand, the well known helicity conservation in ideal flows which here we call it "physical helicity" is found to be an independent constant with respect to the Biot-Savart helicity. The difference between these two helicities reflects some topological features of the domain as well as the velocity and vorticity fields which is discussed and is shown for simply connected domains the two helicities coincide. The energy variation of the vorticity field is shown to be formally the same as for the incompressible flow obtained before. For fluid domains consisting of several disjoint solid tori, at each time, the harmonic knot subspace of smooth vector fields on the fluid domain is found to have two independent base sets with a special type of orthogonality between these two bases by which a topological description of the vortex and velocity fields depending on the helicity difference is achieved since this difference is shown to depend only on the harmonic knot parts of velocity, vorticity, and its Biot-Savart vector field. For an ideal magnetohydrodynamics (MHD) flow three independent constant helicities are reviewed while the helicity of magnetic potential is generalized for non-simply connected domains by inserting a special harmonic knot field in the dynamics of the magnetic potential. It is proved that the harmonic knot part of the vorticity
Basal serum pancreatic polypeptide is dependent on age and gender in an adult population
DEFF Research Database (Denmark)
Brimnes Damholt, M; Rasmussen, B K; Hilsted, L
1997-01-01
This study is the first epidemiologically based study of basal levels of serum pancreatic polypeptide (s-PP). The basal level of serum PP has become a field of interest mainly due to the role of PP as an endocrine tumour marker, and as a marker of pancreatic neuroendocrine function after pancreas...... a monospecific radioimmunoassay. Fasting serum pancreatic polypeptide depended on age and gender. The results demonstrated that fasting pancreatic polypeptide levels increase exponentially with age. Fitted separately for each sex, basal serum pancreatic polypeptide was found to increase by approximately 3% per...... reports on the fasting levels of serum pancreatic polypeptide are most likely due to lack of adjustment for age and gender. Thus, variation due to age and gender should be considered in evaluating fasting levels of serum pancreatic polypeptide. Whether similar considerations are important when evaluating...
Magnetic helicity balance in the Sustained Spheromak Plasma Experiment
International Nuclear Information System (INIS)
Stallard, B.W.; Hooper, E.B.; Woodruff, S.; Bulmer, R.H.; Hill, D.N.; McLean, H.S.; Wood, R.D.
2003-01-01
The magnetic helicity balance between the helicity input injected by a magnetized coaxial gun, the rate-of-change in plasma helicity content, and helicity dissipation in electrode sheaths and Ohmic losses have been examined in the Sustained Spheromak Plasma Experiment (SSPX) [E. B. Hooper, L. D. Pearlstein, and R. H. Bulmer, Nucl. Fusion 39, 863 (1999)]. Helicity is treated as a flux function in the mean-field approximation, allowing separation of helicity drive and losses between closed and open field volumes. For nearly sustained spheromak plasmas with low fluctuations, helicity balance analysis implies a decreasing transport of helicity from the gun input into the spheromak core at higher spheromak electron temperature. Long pulse discharges with continuously increasing helicity and larger fluctuations show higher helicity coupling from the edge to the spheromak core. The magnitude of the sheath voltage drop, inferred from cathode heating and a current threshold dependence of the gun voltage, shows that sheath losses are important and reduce the helicity injection efficiency in SSPX
Biochemical map of polypeptides specified by foot-and-mouth disease virus.
Grubman, M J; Robertson, B H; Morgan, D O; Moore, D M; Dowbenko, D
1984-01-01
Pulse-chase labeling of foot-and-mouth disease virus-infected bovine kidney cells revealed stable and unstable viral-specific polypeptides. To identify precursor-product relationships among these polypeptides, antisera against a number of structural and nonstructural viral-specific polypeptides were used. Cell-free translations programmed with foot-and-mouth disease virion RNA or foot-and-mouth disease virus-infected bovine kidney cell lysates, which were shown to contain almost identical pol...
Primary structure, gene organization and polypeptide expression of poliovirus RNA
Energy Technology Data Exchange (ETDEWEB)
Kitamura, N. (State Univ. of New York, Stony Brook); Semler, B.L.; Rothberg, P.G.
1981-06-18
The primary structure of the poliovirus genome has been determined. The RNA molecule is 7433 nucleotides long, polyadenylated at the 3' terminus, and covalently linked to a small protein (VPg) at the 5' terminus. An open reading frame of 2207 consecutive triplets spans over 89% of the nucleotide sequence and codes for the viral polyprotein NCVPOO. Twelve viral polypeptides have been mapped by amino acid sequence analysis and were found to be proteolytic cleavage products of the polyprotein, cleavages occurring predominantly at Gln-Gly pairs.
Reaction mechanisms in the radiolysis of peptides, polypeptides and proteins
Energy Technology Data Exchange (ETDEWEB)
Garrison, W.M.
1985-01-01
The purpose of this review is to bring together and to correlate the wide variety of experimental studies that provide information on the reaction products and reaction mechanisms involved in the radiolysis of peptides, polypeptides and proteins (including chromosomal proteins) in both aqueous and solid-state systems. The comparative radiation chemistry of these systems is developed in terms of specific reactions of the peptide main-chain and the aliphatic, aromatic-unsaturated and sulfur-containing side-chains. Information obtained with the various experimental techniques of product analysis, competition kinetics, spin-trapping, pulse radiolysis and ESR spectroscopy is included. 147 refs.
Reaction mechanisms in the radiolysis of peptides, polypeptides and proteins
International Nuclear Information System (INIS)
Garrison, W.M.
1985-01-01
The purpose of this review is to bring together and to correlate the wide variety of experimental studies that provide information on the reaction products and reaction mechanisms involved in the radiolysis of peptides, polypeptides and proteins (including chromosomal proteins) in both aqueous and solid-state systems. The comparative radiation chemistry of these systems is developed in terms of specific reactions of the peptide main-chain and the aliphatic, aromatic-unsaturated and sulfur-containing side-chains. Information obtained with the various experimental techniques of product analysis, competition kinetics, spin-trapping, pulse radiolysis and ESR spectroscopy is included. 147 refs
NMR study of the cooperative behavior of thermotropic model polypeptides
Czech Academy of Sciences Publication Activity Database
Kurková, Dana; Kříž, Jaroslav; Rodríguez-Cabello, J. C.; Arias, F. J.
2007-01-01
Roč. 56, č. 2 (2007), s. 186-194 ISSN 0959-8103 R&D Projects: GA AV ČR IAA400500604 Grant - others:Spanish Ministry of Science and Culture(ES) A002/02; MAT2000-1764-C02; MAT2001-1853-C02-01; MAT2003- Institutional research plan: CEZ:AV0Z40500505 Keywords : thermotropic polymers * cooperativity * synthetic polypeptides Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.557, year: 2007
Well-defined (co)polypeptides bearing pendant alkyne groups
Zhao, Wei
2016-03-18
A novel metal-free strategy, using hydrogen-bonding catalytic ring opening polymerization of acetylene-functionalized N-carboxy anhydrites of α-amino acids, was developed for the synthesis of well-defined polypeptides bearing pendant alkyne groups. This method provides an efficient way to synthesize novel alkyne-functionalized homopolypeptides (A) and copolypeptides, such as AB diblock (B: non-functionalized), ABA triblock and star-AB diblock, as well as linear and star random copolypeptides, precursors of a plethora complex macromolecular architectures by click chemistry.
Functional Modification of Thioether Groups in Peptides, Polypeptides, and Proteins.
Deming, Timothy J
2017-03-15
Recent developments in the modification of methionine and other thioether-containing residues in peptides, polypeptides, and proteins are reviewed. Properties and potential applications of the resulting functionalized products are also discussed. While much of this work is focused on natural Met residues, modifications at other side-chain residues have also emerged as new thioether-containing amino acids have been incorporated into peptidic materials. Functional modification of thioether-containing amino acids has many advantages and is a complementary methodology to the widely utilized methods for modification at cysteine residues.
Well-defined (co)polypeptides bearing pendant alkyne groups
Zhao, Wei; Gnanou, Yves; Hadjichristidis, Nikolaos
2016-01-01
A novel metal-free strategy, using hydrogen-bonding catalytic ring opening polymerization of acetylene-functionalized N-carboxy anhydrites of α-amino acids, was developed for the synthesis of well-defined polypeptides bearing pendant alkyne groups. This method provides an efficient way to synthesize novel alkyne-functionalized homopolypeptides (A) and copolypeptides, such as AB diblock (B: non-functionalized), ABA triblock and star-AB diblock, as well as linear and star random copolypeptides, precursors of a plethora complex macromolecular architectures by click chemistry.
Helical CT of congenital ossicular anomalies
International Nuclear Information System (INIS)
Osada, Hisato; Machida, Kikuo; Honda, Norinari
2001-01-01
Since January 1996 to December 2000, 26 cases of congenital ossicular anomaly could be diagnosed with helical CT. All cases were unilateral. In 8 patients with malformation of the external ear, CT showed malleoincudal fixation (n=5), malleoincudal fixation and deformed incuts long process (n=1), deformed incus long process (n=1), and partial fusion of malleus neck and incus long process (n=1). In 18 patients with normal external ear, CT showed defect of the incus long process (n=5), defect of both the incus long process and stapes superstructure (n=8, 2 patients with congenital cholesteatoma, 1 with hypoplastic oval window), defect of the stapes superstructure (n=2, 1 patient with oval window absence), defect of the malleus manubrium (n=1), ossification of the stampede's tendon (n=1), and monopod stapes (n=1). Helical CT can evaluate the auditory ossicular chain in detail and is useful for diagnosing congenital ossicular anomaly. (author)
Weaving Knotted Vector Fields with Tunable Helicity.
Kedia, Hridesh; Foster, David; Dennis, Mark R; Irvine, William T M
2016-12-30
We present a general construction of divergence-free knotted vector fields from complex scalar fields, whose closed field lines encode many kinds of knots and links, including torus knots, their cables, the figure-8 knot, and its generalizations. As finite-energy physical fields, they represent initial states for fields such as the magnetic field in a plasma, or the vorticity field in a fluid. We give a systematic procedure for calculating the vector potential, starting from complex scalar functions with knotted zero filaments, thus enabling an explicit computation of the helicity of these knotted fields. The construction can be used to generate isolated knotted flux tubes, filled by knots encoded in the lines of the vector field. Lastly, we give examples of manifestly knotted vector fields with vanishing helicity. Our results provide building blocks for analytical models and simulations alike.
Vacuum systems for the ILC helical undulator
Malyshev, O B; Clarke, J A; Bailey, I R; Dainton, J B; Malysheva, L I; Barber, D P; Cooke, P; Baynham, E; Bradshaw, T; Brummitt, A; Carr, S; Ivanyushenkov, Y; Rochford, J; Moortgat-Pick, G A
2007-01-01
The International Linear Collider (ILC) positron source uses a helical undulator to generate polarized photons of ∼10MeV∼10MeV at the first harmonic. Unlike many undulators used in synchrotron radiation sources, the ILC helical undulator vacuum chamber will be bombarded by photons, generated by the undulator, with energies mostly below that of the first harmonic. Achieving the vacuum specification of ∼100nTorr∼100nTorr in a narrow chamber of 4–6mm4–6mm inner diameter, with a long length of 100–200m100–200m, makes the design of the vacuum system challenging. This article describes the vacuum specifications and calculations of the flux and energy of photons irradiating the undulator vacuum chamber and considers possible vacuum system design solutions for two cases: cryogenic and room temperature.
SUPERCONDUCTING HELICAL SNAKE MAGNETS: CONSTRUCTION AND MEASUREMENTS
International Nuclear Information System (INIS)
Mackay, W.W.; Anerella, M.; Courant, E.
1999-01-01
In order to collide polarized protons, the RHIC project will have two snakes in each ring and four rotators around each of two interaction regions. Two snakes on opposite sides of each ring can minimize depolarization during acceleration by keeping the spin tune at a half. Since the spin direction is normally along the vertical direction in a flat ring, spin rotators must be used around an interaction point to have longitudinal polarization in a collider experiment. Each snake or rotator will be composed of four helical dipoles to provide the required rotation of spin with minimal transverse orbit excursions in a compact length of 10m. The basic helical dipole is a superconducting magnet producing a transverse dipole field which is twisted about the magnet axis through 360 o in a length of 2.4 m. The design and construction of the magnets is described in this paper
ON THE STRENGTH OF THE HEMISPHERIC RULE AND THE ORIGIN OF ACTIVE-REGION HELICITY
International Nuclear Information System (INIS)
Wang, Y.-M.
2013-01-01
Vector magnetograph and morphological observations have shown that the solar magnetic field tends to have negative (positive) helicity in the northern (southern) hemisphere, although only ∼60%-70% of active regions appear to obey this 'hemispheric rule'. In contrast, at least ∼80% of quiescent filaments and filament channels that form during the decay of active regions follow the rule. We attribute this discrepancy to the difficulty in determining the helicity sign of newly emerged active regions, which are dominated by their current-free component; as the transverse field is canceled at the polarity inversion lines, however, the axial component becomes dominant there, allowing a more reliable determination of the original active-region chirality. We thus deduce that the hemispheric rule is far stronger than generally assumed, and cannot be explained by stochastic processes. Earlier studies have shown that the twist associated with the axial tilt of active regions is too small to account for the observed helicity; here, both tilt and twist are induced by the Coriolis force acting on the diverging flow in the emerging flux tube. However, in addition to this east-west expansion about the apex of the loop, each of its legs must expand continually in cross section during its rise through the convection zone, thereby acquiring a further twist through the Coriolis force. Since this transverse pressure effect is not limited by drag or tension forces, the final twist depends mainly on the rise time, and may be large enough to explain the observed active-region helicity
Numerical Analysis of Small Deformation of Flexible Helical Flagellum of Swimming Bacteria
Takano, Yasunari; Goto, Tomonobu
Formulations are conducted to numerically analyze the effect of flexible flagellum of swimming bacteria. In the present model, a single-flagellate bacterium is assumed to consist of a rigid cell body of the prolate spheroidal shape and a flexible flagellum of the helical form. The resistive force theory is applied to estimate the force exerted on the flagellum. The torsional as well as the bending moments determine the curvature and the torsion of the deformed flagellum according to the Kirchhoff model for an elastic rod. The unit tangential vector along the deformed flagellum is calculated by applying evolution equations for space curves, and also a deformed shape of the flagellum is obtained.
Buoyant Helical Twin-Axial Wire Antenna
2016-11-15
February 2017 The below identified patent application is available for licensing. Requests for information should be addressed to...300169 1 of 9 BUOYANT HELICAL TWIN-AXIAL WIRE ANTENNA CROSS REFERENCE TO OTHER PATENT APPLICATIONS [0001] This application is a divisional...application and claims the benefit of the filing date of United States Patent Application No. 14/280,889; filed on May 19, 2014; and entitled “Twin-Axial
Molecular Dynamics with Helical Periodic Boundary Conditions
Czech Academy of Sciences Publication Activity Database
Kessler, Jiří; Bouř, Petr
2014-01-01
Roč. 35, č. 21 (2014), s. 1552-1559 ISSN 0192-8651 R&D Projects: GA ČR GAP208/11/0105; GA MŠk(CZ) LH11033 Grant - others:GA AV ČR(CZ) M200551205; GA MŠk(CZ) LM2010005 Institutional support: RVO:61388963 Keywords : periodic boundary conditions * helical symmetry * molecular dynamics * protein structure * amyloid fibrils Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.589, year: 2014
Simplification of the helical TEN2 laser
Krahn, K.-H.
1980-04-01
The observation that the helical TEN2 laser can effectively be simplified by giving up the use of decoupling elements as well as by abolishing the segmentation of the electrode structure is examined. Although, as a consequence of this simplification, the operating pressure range was slightly decreased, the output power could be improved by roughly 30%, a result which is attributed to the new electrode geometry exhibiting lower inductance and lower damping losses.
Field of a helical Siberian Snake
Energy Technology Data Exchange (ETDEWEB)
Luccio, A. [Brookhaven National Lab., Upton, NY (United States)
1995-02-01
To preserve the spin polarization of a beam of high energy protons in a circular accelerator, magnets with periodic magnetic field, called Siberian Snakes are being used. Recently, it was proposed to build Siberian Snakes with superconducting helical dipoles. In a helical, or twisted dipole, the magnetic field is perpendicular to the axis of the helix and rotates around it as one proceeds along the magnet. In an engineering study of a 4 Tesla helical snake, the coil geometry is derived, by twisting, from the geometry of a cosine superconducting dipole. While waiting for magnetic measurement data on such a prototype, an analytical expression for the field of the helice is important, to calculate the particle trajectories and the spin precession in the helix. This model will also allow to determine the optical characteristics of the snake, as an insertion in the lattice of the accelerator. In particular, one can calculate the integrated multipoles through the magnet and the equivalent transfer matrix. An expression for the field in the helix body, i.e., excluding the fringe field was given in a classical paper. An alternate expression can be found by elaborating on the treatment of the field of a transverse wiggler obtained under the rather general conditions that the variables are separable. This expression exactly satisfies Maxwell`s div and curl equations for a stationary field, {del} {center_dot} B = 0, {del} x B = 0. This approach is useful in that it will allow one to use much of the work already done on the problem of inserting wigglers and undulators in the lattice of a circular accelerator.
Zhong, Sheng
uniform structural parameters, including the width of the micelles, width of the helix, and the pitch distance. There is no preference to the handedness, and both handednesses are observed, which is understandable since there are no chiral molecules or specific binding effects applied during the assembly. The helical structure is a product of kinetic process. Cryogenic transmission electron microscopy has been employed to monitor the morphological transformation. The study indicates there are two complicated but reproducible kinetic pathways to form the helices. One pathway involves the stacks of bended cylinders at early stages and the subsequent interconnection of these bended cylinders. Spherical micelles bud off of the interconnected nanostructure as the final step towards a defect-free helix. Another kinetic pathway shows very short helices are formed at first and aligned via head-to-tail style in the solution, and the subsequent sequential addition of these short helices results in prolonged mature helices. By using a ninhydrin-staining technique, amine molecules within the micellar corona are visualized and confirmed to preferentially locate in the inner side of the helical turns. The aggregation of amine molecules provides a strong attraction force due to electrostatic association between oppositely charged amine and acid groups and accumulation of hydrogen bonding among amine molecules to coil the cylindrical micelles into helical twisting features which are stabilized by the repulsion forces due to the chain packing frustration within the hydrophobic core, steric hindrance of amine molecules as well as the Coulomb repulsion of the excess charged amine groups. The formation mechanism of the helix offers the feasibility to manipulate the helical pitch distance and formation kinetics. The helical pitch distance can be enlarged or shrunk by varying the type and amount of amine molecules used in assembly, introducing inorganic salts, and changing pH. Luckily, the
Helical waves in easy-plane antiferromagnets
Semenov, Yuriy G.; Li, Xi-Lai; Xu, Xinyi; Kim, Ki Wook
2017-12-01
Effective spin torques can generate the Néel vector oscillations in antiferromagnets (AFMs). Here, it is theoretically shown that these torques applied at one end of a normal AFM strip can excite a helical type of spin wave in the strip whose properties are drastically different from characteristic spin waves. An analysis based on both a Néel vector dynamical equation and the micromagnetic simulation identifies the direction of magnetic anisotropy and the damping factor as the two key parameters determining the dynamics. Helical wave propagation requires the hard axis of the easy-plane AFM to be aligned with the traveling direction, while the damping limits its spatial extent. If the damping is neglected, the calculation leads to a uniform periodic domain wall structure. On the other hand, finite damping decelerates the helical wave rotation around the hard axis, ultimately causing stoppage of its propagation along the strip. With the group velocity staying close to spin-wave velocity at the wave front, the wavelength becomes correspondingly longer away from the excitation point. In a sufficiently short strip, a steady-state oscillation can be established whose frequency is controlled by the waveguide length as well as the excitation energy or torque.
Helical CT in acute lower gastrointestinal bleeding
International Nuclear Information System (INIS)
Ernst, Olivier; Leroy, Christophe; Sergent, Geraldine; Bulois, Philippe; Saint-Drenant, Sophie; Paris, Jean-Claude
2003-01-01
The purpose of this study was to assess the usefulness of helical CT in depicting the location of acute lower gastrointestinal bleeding. A three-phase helical CT of the abdomen was performed in 24 patients referred for acute lower gastrointestinal bleeding. The diagnosis of the bleeding site was established by CT when there was at least one of the following criteria: spontaneous hyperdensity of the peribowel fat; contrast enhancement of the bowel wall; vascular extravasation of the contrast medium; thickening of the bowel wall; polyp or tumor; or vascular dilation. Diverticula alone were not enough to locate the bleeding site. The results of CT were compared with the diagnosis obtained by colonoscopy, enteroscopy, or surgery. A definite diagnosis was made in 19 patients. The bleeding site was located in the small bowel in 5 patients and the colon in 14 patients. The CT correctly located 4 small bowel hemorrhages and 11 colonic hemorrhages. Diagnosis of the primary lesion responsible for the bleeding was made in 10 patients. Our results suggest that helical CT could be a good diagnostic tool in acute lower gastrointestinal bleeding to help the physician to diagnose the bleeding site. (orig.)
Superconducting Helical Snake Magnet for the AGS
Willen, Erich; Escallier, John; Ganetis, George; Ghosh, Arup; Gupta, Ramesh C; Harrison, Michael; Jain, Animesh K; Luccio, Alfredo U; MacKay, William W; Marone, Andrew; Muratore, Joseph F; Okamura, Masahiro; Plate, Stephen R; Roser, Thomas; Tsoupas, Nicholaos; Wanderer, Peter
2005-01-01
A superconducting helical magnet has been built for polarized proton acceleration in the Brookhaven AGS. This "partial Snake" magnet will help to reduce the loss of polarization of the beam due to machine resonances. It is a 3 T magnet some 1940 mm in magnetic length in which the dipole field rotates with a pitch of 0.2053 degrees/mm for 1154 mm in the center and a pitch of 0.3920 degrees/mm for 393 mm in each end. The coil cross-section is made of two slotted cylinders containing superconductor. In order to minimize residual offsets and deflections of the beam on its orbit through the Snake, a careful balancing of the coil parameters was necessary. In addition to the main helical coils, a solenoid winding was built on the cold bore tube inside the main coils to compensate for the axial component of the field that is experienced by the beam when it is off-axis in this helical magnet. Also, two dipole corrector magnets were placed on the same tube with the solenoid. A low heat leak cryostat was built so that t...
Total scalp irradiation using helical tomotherapy
International Nuclear Information System (INIS)
Orton, Nigel; Jaradat, Hazim; Welsh, James; Tome, Wolfgang
2005-01-01
Homogeneous irradiation of the scalp poses technical and dosimetric challenges due to the extensive, superficial, curved treatment volume. Conventional treatments on a linear accelerator use multiple matched electron fields or a combination of electron and photon fields. Problems with these techniques include dose heterogeneity in the target due to varying source-to-skin distance (SSD) and angle of beam incidence, significant dose to the brain, and the potential for overdose or underdose at match lines between the fields. Linac-based intensity-modulated radiation therapy (IMRT) plans have similar problems. This work presents treatment plans for total scalp irradiation on a helical tomotherapy machine. Helical tomotherapy is well-suited for scalp irradiation because it has the ability to deliver beamlets that are tangential to the scalp at all points. Helical tomotherapy also avoids problems associated with field matching and use of more than one modality. Tomotherapy treatment plans were generated and are compared to plans for treatment of the same patient on a linac. The resulting tomotherapy plans show more homogeneous target dose and improved critical structure dose when compared to state-of-the-art linac techniques. Target equivalent uniform dose (EUD) for the best tomotherapy plan was slightly higher than for the linac plan, while the volume of brain tissue receiving over 30 Gy was reduced by two thirds. Furthermore, the tomotherapy plan can be more reliably delivered than linac treatments, because the patient is aligned prior to each treatment based on megavoltage computed tomography (MVCT)
Energy Technology Data Exchange (ETDEWEB)
Ocker, Stella Koch [Department of Physics, Oberlin College, Oberlin, OH 44074 (United States); Petrie, Gordon, E-mail: socker@oberlin.edu, E-mail: gpetrie@nso.edu [National Solar Observatory, Boulder, CO 80303 (United States)
2016-12-01
The hemispheric preference for negative/positive helicity to occur in the northern/southern solar hemisphere provides clues to the causes of twisted, flaring magnetic fields. Previous studies on the hemisphere rule may have been affected by seeing from atmospheric turbulence. Using Hinode /SOT-SP data spanning 2006–2013, we studied the effects of two spatial smoothing tests that imitate atmospheric seeing: noise reduction by ignoring pixel values weaker than the estimated noise threshold, and Gaussian spatial smoothing. We studied in detail the effects of atmospheric seeing on the helicity distributions across various field strengths for active regions (ARs) NOAA 11158 and NOAA 11243, in addition to studying the average helicities of 179 ARs with and without smoothing. We found that, rather than changing trends in the helicity distributions, spatial smoothing modified existing trends by reducing random noise and by regressing outliers toward the mean, or removing them altogether. Furthermore, the average helicity parameter values of the 179 ARs did not conform to the hemisphere rule: independent of smoothing, the weak-vertical-field values tended to be negative in both hemispheres, and the strong-vertical-field values tended to be positive, especially in the south. We conclude that spatial smoothing does not significantly affect the overall statistics for space-based data, and thus seeing from atmospheric turbulence seems not to have significantly affected previous studies’ ground-based results on the hemisphere rule.
International Nuclear Information System (INIS)
Wang, Shih-Ting; Lin, Yiyang; Spencer, Ryan K.; Thomas, Michael R.; Nguyen, Andy I.
2017-01-01
Determining the structural origins of amyloid fibrillation is essential for understanding both the pathology of amyloidosis and the rational design of inhibitors to prevent or reverse amyloid formation. In this work, the decisive roles of peptide structures on amyloid self-assembly and morphological diversity were investigated by the design of eight amyloidogenic peptides derived from islet amyloid polypeptide. Among the segments, two distinct morphologies were highlighted in the form of twisted and planar (untwisted) ribbons with varied diameters, thicknesses, and lengths. In particular, transformation of amyloid fibrils from twisted ribbons into untwisted structures was triggered by substitution of the C-terminal serine with threonine, where the side chain methyl group was responsible for the distinct morphological change. This effect was confirmed following serine substitution with alanine and valine and was ascribed to the restriction of intersheet torsional strain through the increased hydrophobic interactions and hydrogen bonding. We also studied the variation of fibril morphology (i.e., association and helicity) and peptide aggregation propensity by increasing the hydrophobicity of the peptide side group, capping the N-terminus, and extending sequence length. Lastly, we anticipate that our insights into sequence-dependent fibrillation and morphological diversity will shed light on the structural interpretation of amyloidogenesis and development of structure-specific imaging agents and aggregation inhibitors.
CDNA encoding a polypeptide including a hevein sequence
Raikhel, Natasha V.; Broekaert, Willem F.; Chua, Nam-Hai; Kush, Anil
1995-03-21
A cDNA clone (HEV1) encoding hevein was isolated via polymerase chain reaction (PCR) using mixed oligonucleotides corresponding to two regions of hevein as primers and a Hevea brasiliensis latex cDNA library as a template. HEV1 is 1018 nucleotides long and includes an open reading frame of 204 amino acids. The deduced amino acid sequence contains a putative signal sequence of 17 amino acid residues followed by a 187 amino acid polypeptide. The amino-terminal region (43 amino acids) is identical to hevein and shows homology to several chitin-binding proteins and to the amino-termini of wound-induced genes in potato and poplar. The carboxyl-terminal portion of the polypeptide (144 amino acids) is 74-79% homologous to the carboxyl-terminal region of wound-inducible genes of potato. Wounding, as well as application of the plant hormones abscisic acid and ethylene, resulted in accumulation of hevein transcripts in leaves, stems and latex, but not in roots, as shown by using the cDNA as a probe. A fusion protein was produced in E. coli from the protein of the present invention and maltose binding protein produced by the E. coli.
cDNA encoding a polypeptide including a hevein sequence
Energy Technology Data Exchange (ETDEWEB)
Raikhel, N.V.; Broekaert, W.F.; Chua, N.H.; Kush, A.
2000-07-04
A cDNA clone (HEV1) encoding hevein was isolated via polymerase chain reaction (PCR) using mixed oligonucleotides corresponding to two regions of hevein as primers and a Hevea brasiliensis latex cDNA library as a template. HEV1 is 1018 nucleotides long and includes an open reading frame of 204 amino acids. The deduced amino acid sequence contains a putative signal sequence of 17 amino acid residues followed by a 187 amino acid polypeptide. The amino-terminal region (43 amino acids) is identical to hevein and shows homology to several chitin-binding proteins and to the amino-termini of wound-induced genes in potato and poplar. The carboxyl-terminal portion of the polypeptide (144 amino acids) is 74--79% homologous to the carboxyl-terminal region of wound-inducible genes of potato. Wounding, as well as application of the plant hormones abscisic acid and ethylene, resulted in accumulation of hevein transcripts in leaves, stems and latex, but not in roots, as shown by using the cDNA as a probe. A fusion protein was produced in E. coli from the protein of the present invention and maltose binding protein produced by the E. coli.
Light Scattering Characterization of Elastin-Like Polypeptide Trimer Micelles
Tsuper, Ilona; Terrano, Daniel; Maraschky, Adam; Holland, Nolan; Streletzky, Kiril
The elastin-like polypeptides (ELP) nanoparticles are composed of three-armed star polypeptides connected by a negatively charged foldon. Each of the three arms extending from the foldon domain includes 20 repeats of the (GVGVP) amino acid sequence. The ELP polymer chains are soluble at room temperature and become insoluble at the transition temperature (close to 50 ° C), forming micelles. The size and shape of the micelle are dependent on the temperature and the pH of the solution, and on the concentration of the phosphate buffered saline (PBS). The depolarized dynamic light scattering (DDLS) was employed to study the structure and dynamics of micelles at 62 ° C. The solution was maintained at an approximate pH level of 7.3 - 7.5, while varying PBS concentration. At low salt concentrations (60 mM) displayed an apparent elongation of the micelles evident by a significant VH signal, along with a surge in the apparent Rh. A model of micelle growth (and potential elongation) with increase in salt concentration is considered.
cDNA encoding a polypeptide including a hevein sequence
Energy Technology Data Exchange (ETDEWEB)
Raikhel, N.V.; Broekaert, W.F.; Chua, N.H.; Kush, A.
1999-05-04
A cDNA clone (HEV1) encoding hevein was isolated via polymerase chain reaction (PCR) using mixed oligonucleotides corresponding to two regions of hevein as primers and a Hevea brasiliensis latex cDNA library as a template. HEV1 is 1018 nucleotides long and includes an open reading frame of 204 amino acids. The deduced amino acid sequence contains a putative signal sequence of 17 amino acid residues followed by a 187 amino acid polypeptide. The amino-terminal region (43 amino acids) is identical to hevein and shows homology to several chitin-binding proteins and to the amino-termini of wound-induced genes in potato and poplar. The carboxyl-terminal portion of the polypeptide (144 amino acids) is 74--79% homologous to the carboxyl-terminal region of wound-inducible genes of potato. Wounding, as well as application of the plant hormones abscisic acid and ethylene, resulted in accumulation of hevein transcripts in leaves, stems and latex, but not in roots, as shown by using the cDNA as a probe. A fusion protein was produced in E. coli from the protein of the present invention and maltose binding protein produced by the E. coli. 12 figs.
cDNA encoding a polypeptide including a hevein sequence
Energy Technology Data Exchange (ETDEWEB)
Raikhel, Natasha V. (Okemos, MI); Broekaert, Willem F. (Dilbeek, BE); Chua, Nam-Hai (Scarsdale, NY); Kush, Anil (New York, NY)
1999-05-04
A cDNA clone (HEV1) encoding hevein was isolated via polymerase chain reaction (PCR) using mixed oligonucleotides corresponding to two regions of hevein as primers and a Hevea brasiliensis latex cDNA library as a template. HEV1 is 1018 nucleotides long and includes an open reading frame of 204 amino acids. The deduced amino acid sequence contains a putative signal sequence of 17 amino acid residues followed by a 187 amino acid polypeptide. The amino-terminal region (43 amino acids) is identical to hevein and shows homology to several chitin-binding proteins and to the amino-termini of wound-induced genes in potato and poplar. The carboxyl-terminal portion of the polypeptide (144 amino acids) is 74-79% homologous to the carboxyl-terminal region of wound-inducible genes of potato. Wounding, as well as application of the plant hormones abscisic acid and ethylene, resulted in accumulation of hevein transcripts in leaves, stems and latex, but not in roots, as shown by using the cDNA as a probe. A fusion protein was produced in E. coli from the protein of the present invention and maltose binding protein produced by the E. coli.
cDNA encoding a polypeptide including a hevein sequence
Energy Technology Data Exchange (ETDEWEB)
Raikhel, N.V.; Broekaert, W.F.; Chua, N.H.; Kush, A.
1995-03-21
A cDNA clone (HEV1) encoding hevein was isolated via polymerase chain reaction (PCR) using mixed oligonucleotides corresponding to two regions of hevein as primers and a Hevea brasiliensis latex cDNA library as a template. HEV1 is 1,018 nucleotides long and includes an open reading frame of 204 amino acids. The deduced amino acid sequence contains a putative signal sequence of 17 amino acid residues followed by a 187 amino acid polypeptide. The amino-terminal region (43 amino acids) is identical to hevein and shows homology to several chitin-binding proteins and to the amino-termini of wound-induced genes in potato and poplar. The carboxyl-terminal portion of the polypeptide (144 amino acids) is 74--79% homologous to the carboxyl-terminal region of wound-inducible genes of potato. Wounding, as well as application of the plant hormones abscisic acid and ethylene, resulted in accumulation of hevein transcripts in leaves, stems and latex, but not in roots, as shown by using the cDNA as a probe. A fusion protein was produced in E. coli from the protein of the present invention and maltose binding protein produced by the E. coli. 11 figures.
Cryo-EM Structure Determination Using Segmented Helical Image Reconstruction.
Fromm, S A; Sachse, C
2016-01-01
Treating helices as single-particle-like segments followed by helical image reconstruction has become the method of choice for high-resolution structure determination of well-ordered helical viruses as well as flexible filaments. In this review, we will illustrate how the combination of latest hardware developments with optimized image processing routines have led to a series of near-atomic resolution structures of helical assemblies. Originally, the treatment of helices as a sequence of segments followed by Fourier-Bessel reconstruction revealed the potential to determine near-atomic resolution structures from helical specimens. In the meantime, real-space image processing of helices in a stack of single particles was developed and enabled the structure determination of specimens that resisted classical Fourier helical reconstruction and also facilitated high-resolution structure determination. Despite the progress in real-space analysis, the combination of Fourier and real-space processing is still commonly used to better estimate the symmetry parameters as the imposition of the correct helical symmetry is essential for high-resolution structure determination. Recent hardware advancement by the introduction of direct electron detectors has significantly enhanced the image quality and together with improved image processing procedures has made segmented helical reconstruction a very productive cryo-EM structure determination method. © 2016 Elsevier Inc. All rights reserved.
Hydrodynamic studies of CNT nanofluids in helical coil heat exchanger
Babita; Sharma, S. K.; Mital Gupta, Shipra; Kumar, Arinjay
2017-12-01
Helical coils are extensively used in several industrial processes such as refrigeration systems, chemical reactors, recovery processes etc to accommodate a large heat transfer area within a smaller space. Nanofluids are getting great attention due to their enhanced heat transfer capability. In heat transfer equipments, pressure drop is one of the major factors of consideration for pumping power calculations. So, the present work is aimed to study hydrodynamics of CNT nanofluids in helical coils. In this study, pressure drop characteristics of CNT nanofluid flowing inside horizontal helical coils are investigated experimentally. The helical coil to tube diameter was varied from 11.71 to 27.34 keeping pitch of the helical coil constant. Double distilled water was used as basefluid. SDBS and GA surfactants were added to stablilize CNT nanofluids. The volumetric fraction of CNT nanofluid was varied from 0.003 vol% to 0.051 vol%. From the experimental data, it was analyzed that the friction factor in helical coils is greater than that of straight tubes. Concentration of CNT in nanofluids also has a significant influence on the pressure drop/friction factor of helical coils. At a constant concentration of CNT, decreasing helical coil to tube diameter from 27.24 to 11.71, fanning friction factor of helical coil; f c increases for a constant value of p/d t. This increase in the value of fanning friction factor can be attributed to the secondary flow of CNT nanofluid in helical coils.
Ksiezak-Reding, H.; Tracz, E.; Yang, L. S.; Dickson, D. W.; Simon, M.; Wall, J. S.
1996-01-01
Paired helical filaments (PHFs) accumulate in the brains of subjects affected with Alzheimer's disease (AD) and certain other neurodegenerative disorders, including corticobasal degeneration (CBD). Electron microscope studies have shown that PHFs from CBD differ from those of AD by being wider and having a longer periodicity of the helical twist. Moreover, PHFs from CBD have been shown to be primarily composed of two rather than three highly phosphorylated polypeptides of tau (PHF-tau), with these polypeptides expressing no exons 3 and 10. To further explore the relationship between the heterogeneity of PHF-tau and the appearance of abnormal filaments, the ultrastructure and physical parameters such as mass per unit length and dimensions were compared in filaments from CBD and AD using high resolution scanning transmission electron microscopy (STEM). Filament-enriched fractions were isolated as Sarcosyl-insoluble pellets and for STEM studies, samples were freeze-dried without prior fixation or staining. Ultrastructurally, PHFs from CBD were shown to be a heterogeneous population as double- and single-stranded filaments could be identified based on their width and physical mass per unit length expressed in kilodaltons (kd) per nanometer (nm). Less abundant, double-stranded filaments had a maximal width of 29 nm and a mass per unit length of 133 kd/nm, whereas three times more abundant single-stranded filaments were 15 nm wide and bad a mass per unit length of 62 kd/nm. Double-stranded filaments also displayed a distinct axial region of less dense mass, which appeared to divide the PHFs into two protofilament-like strands. Furthermore, these filaments were frequently observed to physically separate along the long axis into two single strands or to break longitudinally. In contrast, PHFs from AD were ultrastructurally stable and uniform both in their width (22 nm) and physical mass per unit length (104 kd/nm). The ultrastructural features indicate that filaments of
Elbow helical axes of motion are not the same in physiologic and kinetic joint simulators.
Muriuki, Muturi G; Mohagheh-Motlagh, Amin; Smolinski, Patrick J; Miller, Mark Carl
2012-08-31
Physiologic and kinetic joint simulators have been widely used for investigations of joint mechanics. The two types of simulator differ in the way joint motion is achieved; through prescribed motions and/or forces in kinetic joint simulators and by tendon loads in physiologic joint simulators. These two testing modalities have produced important insights, as in elucidating the importance of soft tissue structures to joint stability. However, the equivalence of the modalities has not been tested. This study sequentially tested five cadaveric elbows using both a physiologic simulator and a robot/6DOF system. Using position data from markers on the humerus and ulna, we calculated and compared the helical axes of motion of the specimens as the elbows were flexed from full extension. Six step size increments were used in the helical axis calculation. Marker position data at each test's full extension and full flexion point were also used to calculate a datum (overall) helical axis. The angles between the datum axis and step-wise movements were computed and stored. Increasing step size monotonically decreased the variability and the average conical angle encompassing the helical axes; a repeated measures ANOVA using test type (robot or physiologic simulator) and step size found that both type and step caused statistically significant differences (p<0.001). The large changes in helical axis angle observed for small changes in elbow flexion angle, especially in the robot tests, are a caveat for investigators using similar control algorithms. Controllers may need to include increased joint compliance and/or C(1) continuity to reduce variability. Copyright © 2012 Elsevier Ltd. All rights reserved.
Chirality-specific lift forces of helix under shear flows: Helix perpendicular to shear plane.
Zhang, Qi-Yi
2017-02-01
Chiral objects in shear flow experience a chirality-specific lift force. Shear flows past helices in a low Reynolds number regime were studied using slender-body theory. The chirality-specific lift forces in the vorticity direction experienced by helices are dominated by a set of helix geometry parameters: helix radius, pitch length, number of turns, and helix phase angle. Its analytical formula is given. The chirality-specific forces are the physical reasons for the chiral separation of helices in shear flow. Our results are well supported by the latest experimental observations. © 2016 Wiley Periodicals, Inc.
Helical muon beam cooling channel engineering design
International Nuclear Information System (INIS)
Johnson, Rolland
2015-01-01
The Helical Cooling Channel (HCC) achieves effective ionization cooling of the six-dimensional (6d) phase space of a muon beam by means of a series of 21st century inventions. In the HCC, hydrogen-pressurized RF cavities enable high RF gradients in strong external magnetic fields. The theory of the HCC, which requires a magnetic field with solenoid, helical dipole, and helical quadrupole components, demonstrates that dispersion in the gaseous hydrogen energy absorber provides effective emittance exchange to enable longitudinal ionization cooling. The 10-year development of a practical implementation of a muon-beam cooling device has involved a series of technical innovations and experiments that imply that an HCC of less than 300 m length can cool the 6d emittance of a muon beam by six orders of magnitude. We describe the design and construction plans for a prototype HCC module based on oxygen-doped hydrogen-pressurized RF cavities that are loaded with dielectric, fed by magnetrons, and operate in a superconducting helical solenoid magnet. The first phase of this project saw the development of a conceptual design for the integration of 805 MHz RF cavities into a 10 T Nb 3 Sn-based HS test section. Two very novel ideas are required to realize the design. The first idea is the use of dielectric inserts in the RF cavities to make them smaller for a given frequency so that the cavities and associated plumbing easily fit inside the magnet cryostat. Calculations indicate that heat loads will be tolerable, while RF breakdown of the dielectric inserts will be suppressed by the pressurized hydrogen gas. The second new idea is the use of a multi-layer Nb 3 Sn helical solenoid. The technology demonstrations for the two aforementioned key components of a 10T, 805 MHz HCC were begun in this project. The work load in the Fermilab Technical Division made it difficult to test a multi-layer Nb 3 Sn solenoid as originally planned. Instead, a complementary project was approved by the
Helical muon beam cooling channel engineering design
Energy Technology Data Exchange (ETDEWEB)
Johnson, Rolland [Muons, Inc., Batavia, IL (United States)
2015-08-07
The Helical Cooling Channel (HCC) achieves effective ionization cooling of the six-dimensional (6d) phase space of a muon beam by means of a series of 21st century inventions. In the HCC, hydrogen-pressurized RF cavities enable high RF gradients in strong external magnetic fields. The theory of the HCC, which requires a magnetic field with solenoid, helical dipole, and helical quadrupole components, demonstrates that dispersion in the gaseous hydrogen energy absorber provides effective emittance exchange to enable longitudinal ionization cooling. The 10-year development of a practical implementation of a muon-beam cooling device has involved a series of technical innovations and experiments that imply that an HCC of less than 300 m length can cool the 6d emittance of a muon beam by six orders of magnitude. We describe the design and construction plans for a prototype HCC module based on oxygen-doped hydrogen-pressurized RF cavities that are loaded with dielectric, fed by magnetrons, and operate in a superconducting helical solenoid magnet. The first phase of this project saw the development of a conceptual design for the integration of 805 MHz RF cavities into a 10 T Nb3Sn-based HS test section. Two very novel ideas are required to realize the design. The first idea is the use of dielectric inserts in the RF cavities to make them smaller for a given frequency so that the cavities and associated plumbing easily fit inside the magnet cryostat. Calculations indicate that heat loads will be tolerable, while RF breakdown of the dielectric inserts will be suppressed by the pressurized hydrogen gas. The second new idea is the use of a multi-layer Nb3Sn helical solenoid. The technology demonstrations for the two aforementioned key components of a 10T, 805 MHz HCC were begun in this project. The work load in the Fermilab Technical Division made it difficult to test a multi-layer Nb3Sn solenoid as originally planned. Instead, a complementary
Directory of Open Access Journals (Sweden)
Hussain Alamin
2016-01-01
Full Text Available Due to their ease of manufacture, high heat transfer efficiency and compact design, helically coiled heat exchangers are increasingly being adopted in a number of industries. The higher heat transfer efficiency over straight pipes is due to the secondary flow that develops as a result of the centrifugal force. In spite of the widespread use of helically coiled heat exchangers, and the presence of bubbly two-phase flow in a number of systems, very few studies have investigated the resultant flow characteristics. This paper will therefore present the results of CFD simulations for the two-phase bubbly flow in helically coiled heat exchangers as a function of the volumetric void fraction and the tube cross-section design. The CFD results are compared to the scarce flow visualisation experimental results available in the open literature.
Hussain, Alamin; Fsadni, Andrew M.
2016-03-01
Due to their ease of manufacture, high heat transfer efficiency and compact design, helically coiled heat exchangers are increasingly being adopted in a number of industries. The higher heat transfer efficiency over straight pipes is due to the secondary flow that develops as a result of the centrifugal force. In spite of the widespread use of helically coiled heat exchangers, and the presence of bubbly two-phase flow in a number of systems, very few studies have investigated the resultant flow characteristics. This paper will therefore present the results of CFD simulations for the two-phase bubbly flow in helically coiled heat exchangers as a function of the volumetric void fraction and the tube cross-section design. The CFD results are compared to the scarce flow visualisation experimental results available in the open literature.
International Nuclear Information System (INIS)
Tziotziou, Kostas; Georgoulis, Manolis K.; Liu Yang
2013-01-01
In previous works, we introduced a nonlinear force-free method that self-consistently calculates the instantaneous budgets of free magnetic energy and relative magnetic helicity in solar active regions (ARs). Calculation is expedient and practical, using only a single vector magnetogram per computation. We apply this method to a time series of 600 high-cadence vector magnetograms of the eruptive NOAA AR 11158 acquired by the Helioseismic and Magnetic Imager on board the Solar Dynamics Observatory over a five-day observing interval. Besides testing our method extensively, we use it to interpret the dynamical evolution in the AR, including eruptions. We find that the AR builds large budgets of both free magnetic energy and relative magnetic helicity, sufficient to power many more eruptions than the ones it gave within the interval of interest. For each of these major eruptions, we find eruption-related decreases and subsequent free-energy and helicity budgets that are consistent with the observed eruption (flare and coronal mass ejection (CME)) sizes. In addition, we find that (1) evolution in the AR is consistent with the recently proposed (free) energy-(relative) helicity diagram of solar ARs, (2) eruption-related decreases occur before the flare and the projected CME-launch times, suggesting that CME progenitors precede flares, and (3) self terms of free energy and relative helicity most likely originate from respective mutual terms, following a progressive mutual-to-self conversion pattern that most likely stems from magnetic reconnection. This results in the non-ideal formation of increasingly helical pre-eruption structures and instigates further research on the triggering of solar eruptions with magnetic helicity firmly placed in the eruption cadre
International Nuclear Information System (INIS)
Richardson, M.A.; Boulton, R.W.; Raghow, R.S.; Dalgarno, L.
1980-01-01
Polypeptide synthesis was examined in mosquito cells during the establishment of a persistent infection with two alphaviruses, Ross River virus (RRV) and Semliki Forest virus (SFV), and in vertebrate cells cytopathically-infected with the same viruses. In Aedes albopictus cells, RRV reached peak titres at 34-48 hours p.i. At 12 hours 85 per cent of cells assayed as infected by infective centre assay; by 48 hours when persistence was established, virus production was reduced and <5 per cent of cells assayed as infected. There was not shutdown of host polypeptide synthesis during infection. Viral polypeptide synthesis was maximal between 10 and 24 hours p.i. The major viral polypeptides labelled were nucleocapsid protein and envelope protein(s).The precursor polypeptide p95 which was prominent in infected BHK cells was not detected in mosquito cells. Similar results were obtained on SFV infection. During the establishment of persistence there was a coordinate decline in the synthesis of RRV polypeptides, reaching undetectable levels by 72 hours p.i. Subculturing persistently-infected cells led to a small increase in viral polypeptide synthesis and virus titre. In contrast, during RRV growth in BHK cells host protein synthesis was severely inhibited and by 9-11 hours p.i. virus-specific polypeptide synthesis represented more than 90 per cent of total protein synthetic activity. (author)
The design construction and installation of the helical winding for the CLEO stellarator
International Nuclear Information System (INIS)
Hunt, R.R.; Bayes, D.V.
1979-03-01
The CLEO stellarator has a torus 900mm major radius and 166mm minor radius, fitted externally with a 7 field period, l = 3, 120kAT helical winding of 179mm mean radius. The winding and torus have to withstand the large forces produced by the interaction of the current flowing in the winding with the toroidal magnetic field of 2 tesla produced by 24 coils spaced around the torus. To allow the torus to be divided the winding has to be split requiring a total of 240 demountable current-carrying joints at the torus vacuum joint positions. The design, development, manufacture, installation and operation of the helical winding is discussed. From the early development stages to installation took four years. When completed this was the largest installation of its type in Europe. (author)
Steady-state helices of the actin homolog MreB inside bacteria: Dynamics without motors
Allard, Jun F.; Rutenberg, Andrew D.
2007-09-01
Within individual bacteria, we combine force-dependent polymerization dynamics of individual MreB protofilaments with an elastic model of protofilament bundles buckled into helical configurations. We use variational techniques and stochastic simulations to relate the pitch of the MreB helix, the total abundance of MreB, and the number of protofilaments. By comparing our simulations with mean-field calculations, we find that stochastic fluctuations are significant. We examine the quasistatic evolution of the helical pitch with cell growth, as well as time scales of helix turnover and de novo establishment. We find that while the body of a polarized MreB helix treadmills toward its slow-growing end, the fast-growing tips of laterally associated protofilaments move toward the opposite fast-growing end of the MreB helix. This offers a possible mechanism for targeted polar localization without cytoplasmic motor proteins.
System assessment of helical reactors in comparison with tokamaks
International Nuclear Information System (INIS)
Yamazaki, K.; Imagawa, S.; Muroga, T.; Sagara, A.; Okamura, S.
2002-10-01
A comparative assessment of tokamak and helical reactors has been performed using equivalent physics/engineering model and common costing model. Higher-temperature plasma operation is required in tokamak reactors to increase bootstrap current fraction and to reduce current-drive (CD) power. In helical systems, lower-temperature operation is feasible and desirable to reduce helical ripple transport. The capital cost of helical reactor is rather high, however, the cost of electricity (COE) is almost same as that of tokamak reactor because of smaller re-circulation power (no CD power) and less-frequent blanket replacement (lower neutron wall loading). The standard LHD-type helical reactor with 5% beta value is economically equivalent to the standard tokamak with 3% beta. The COE of lower-aspect ratio helical reactor is on the same level of high-β N tokamak reactors. (author)
Missimer, John H; Steinmetz, Michel O; van Gunsteren, Wilfred F; Dolenc, Jožica
2012-10-23
Phosphorylation is an important mechanism regulating protein-protein interactions involving intrinsically disordered protein regions. Stathmin, an archetypical example of an intrinsically disordered protein, is a key regulator of microtubule dynamics in which phosphorylation of 63Ser within the helical nucleation sequence strongly down-regulates the tubulin binding and microtubule destabilizing activities of the protein. Experimental studies on a peptide encompassing the 19-residue helical nucleation sequence of stathmin (residues 55-73) indicate that phosphorylation of 63Ser destabilizes the peptide's secondary structure by disrupting the salt bridges supporting its helical conformation. In order to investigate this hypothesis at atomic resolution, we performed molecular dynamics simulations of nonphosphorylated and phosphorylated stathmin-[55-73] at room temperature and pressure, neutral pH, and explicit solvation using the recently released GROMOS force field 54A7. In the simulations of nonphosphorylated stathmin-[55-73] emerged salt bridges associated with helical configurations. In the simulations of 63Ser phosphorylated stathmin-[55-73] these configurations dispersed and were replaced by a proliferation of salt bridges yielding disordered configurations. The transformation of the salt bridges was accompanied by emergence of numerous interactions between main and side chains, involving notably the oxygen atoms of the phosphorylated 63Ser. The loss of helical structure induced by phosphorylation is reversible, however, as a final simulation showed. The results extend the hypothesis of salt bridge derangement suggested by experimental observations of the stathmin nucleation sequence, providing new insights into regulation of intrinsically disordered protein systems mediated by phosphorylation.
International Nuclear Information System (INIS)
Wu Shuangying; Chen Sujun; Li Yourong; Li Longjian
2009-01-01
A numerical method for simulating three-dimensional laminar forced convective heat transfer in a helical coiled passage with annular cross section under uniform wall temperature condition is presented. The helical coiled passage is fabricated by bending a 0.03 m inner diameter and 0.05 m outer diameter straight tube into a helical-coil of two turns. The results presented in this paper cover a Reynolds number range of 200 ∼ 1000, a pitch range of 0.1 ∼ 0.2 and a curvature ratio range of 0.1 ∼ 0.3. The numerical computations reveal the development and distribution of heat transfer and flow fields in the helical coiled passage when the inner annular wall is heated and the outer annular wall is insulated. In addition, the effects of Reynolds number, curvature ratio, and coil pitch on the average friction factor, average Nusselt number at different axial cross-section have been discussed. The results show that the secondary flow is weak and can be neglected at the entrance region, but the effect of the secondary flow is enhanced, the maximum velocity perpendicular to axial cross section shifts toward the outer side of helical coiled passage. Furthermore, the average Nusselt number and friction factor at every different axial location present different characteristics when the Reynolds number, curvature ratio and pitch change. Compared with the curvature ratio, the pitch has relatively little influence on the heat transfer and flow performance. (authors)
Energy Technology Data Exchange (ETDEWEB)
Sangeetha, C. R.; Rajaguru, S. P., E-mail: crsangeetha@iiap.res.in [Indian Institute of Astrophysics, Bangalore-34 (India)
2016-06-20
We derive horizontal fluid motions on the solar surface over large areas covering the quiet-Sun magnetic network from local correlation tracking of convective granules imaged in continuum intensity and Doppler velocity by the Helioseismic and Magnetic Imager (HMI) on board the Solar Dynamics Observatory . From these we calculate the horizontal divergence, the vertical component of vorticity, and the kinetic helicity of fluid motions. We study the correlations between fluid divergence and vorticity, and between vorticity (kinetic helicity) and the magnetic field. We find that the vorticity (kinetic helicity) around small-scale fields exhibits a hemispherical pattern (in sign) similar to that followed by the magnetic helicity of large-scale active regions (containing sunspots). We identify this pattern to be a result of the Coriolis force acting on supergranular-scale flows (both the outflows and inflows), consistent with earlier studies using local helioseismology. Furthermore, we show that the magnetic fields cause transfer of vorticity from supergranular inflow regions to outflow regions, and that they tend to suppress the vortical motions around them when magnetic flux densities exceed about 300 G (from HMI). We also show that such an action of the magnetic fields leads to marked changes in the correlations between fluid divergence and vorticity. These results are speculated to be of importance to local dynamo action (if present) and to the dynamical evolution of magnetic helicity at the small-scale.
Pahovnik, David
2015-09-01
Different synthetic approaches utilizing ring-opening polymerization of N-carboxyanhydrides for preparation of polypeptide and polypeptide-based hybrid materials with various molecular architectures are described. An overview of polymerization mechanisms using conventional (various amines) as well as some recently developed initiators (hexamethyldisilazane, N-heterocyclic persistent carbenes, etc.) is presented, and their benefits and drawbacks for preparation of polypeptides with well-defined chain lengths and chain-end functionality are discussed. Recent examples from literature are used to illustrate different possibilities for synthesis of pure polypeptide materials with different molecular architectures bearing various functional groups, which are introduced either by modification of amino acids, before they are transformed into corresponding Ncarboxyanhydrides, or by post-polymerization modifications using protective groups and/or orthogonal functional groups. Different approaches for preparation of polypeptide-based hybrid materials are discussed as well using examples from recent literature. Syntheses of simple block copolymers or copolymers with more complex molecular architectures (graft and star copolymers) as well as modifications of nanoparticles and other surfaces with polypeptides are described.
Force-free electromagnetic pulses in a laboratory plasma
Stenzel, R. L.; Urrutia, J. M.
1990-01-01
A short, intense current pulse is drawn from an electrode immersed in a magnetized afterglow plasma. The induced magnetic field B(r,t) assumes the shape of a helical double vortex which propagates along B(0) through the uniform plasma as a whistler mode. The observations support a prediction of force-free (J x B + neE = 0) electromagnetic fields and solitary waves. Energy and helicity are approximately conserved.
DEFF Research Database (Denmark)
Amin, Faisal Mohammad; Hougaard, Anders; Schytz, Henrik W
2014-01-01
Pituitary adenylate cyclase-activating polypeptide-38 (PACAP38) and vasoactive intestinal polypeptide are structurally and functionally closely related but show differences in migraine-inducing properties. Mechanisms responsible for the difference in migraine induction are unknown. Here, for the ...
Alteration of helical vortex core without change in flow topology
DEFF Research Database (Denmark)
Velte, Clara Marika; Okulov, Valery; Hansen, Martin Otto Laver
2011-01-01
topology. The helical symmetry as such is preserved, although the characteristic parameters of helical symmetry of the vortex core transfer from a smooth linear variation to a different trend under the influence of a non-uniform pressure gradient, causing an increase in helical pitch without changing its......The abrupt expansion of the slender vortex core with changes in flow topology is commonly known as vortex breakdown. We present new experimental observations of an alteration of the helical vortex core in wall bounded turbulent flow with abrupt growth in core size, but without change in flow...
Helicity conservation under quantum reconnection of vortex rings.
Zuccher, Simone; Ricca, Renzo L
2015-12-01
Here we show that under quantum reconnection, simulated by using the three-dimensional Gross-Pitaevskii equation, self-helicity of a system of two interacting vortex rings remains conserved. By resolving the fine structure of the vortex cores, we demonstrate that the total length of the vortex system reaches a maximum at the reconnection time, while both writhe helicity and twist helicity remain separately unchanged throughout the process. Self-helicity is computed by two independent methods, and topological information is based on the extraction and analysis of geometric quantities such as writhe, total torsion, and intrinsic twist of the reconnecting vortex rings.
Superposition of helical beams by using a Michelson interferometer.
Gao, Chunqing; Qi, Xiaoqing; Liu, Yidong; Weber, Horst
2010-01-04
Orbital angular momentum (OAM) of a helical beam is of great interests in the high density optical communication due to its infinite number of eigen-states. In this paper, an experimental setup is realized to the information encoding and decoding on the OAM eigen-states. A hologram designed by the iterative method is used to generate the helical beams, and a Michelson interferometer with two Porro prisms is used for the superposition of two helical beams. The experimental results of the collinear superposition of helical beams and their OAM eigen-states detection are presented.
A radioimmunoassay of gastric inhibitory polypeptide in human plasma
International Nuclear Information System (INIS)
Sarson, D.L.; Bryant, M.G.; Bloom, S.R.
1980-01-01
A sensitive radioimmunoassay for the measurement of human gastric inhibitory polypeptide (GIP), using pure porcine GIP, has been developed. Cross-reactivity of the antiserum with all available mammalian gut peptide preparations was negligible with the exception of glucagon when it was approximately 1%. Two major molecular forms of GIP were detectable in plasma and tissue extracts, one of large molecular size and the other corresponding to the elution coefficient of pure porcine standard. Concentrations of GIP in plasma from 50 normal subjects after overnight fasting were 9+-1.0(S.E.M.) pmol/1 rising to a peak of 34+-2.8 pmol/1 following the ingestion of a small mixed test meal. Ingestion of glucose or fat resulted in a similar rise of plasma GIP, whereas no change was observed after the ingestion of protein. (author)
Gastric inhibitory polypeptide does not inhibit gastric emptying in humans
DEFF Research Database (Denmark)
Meier, Juris J; Goetze, Oliver; Anstipp, Jens
2004-01-01
) = 0.15, P = 0.15 for intact GIP; r(2) = 0.21, P = 0.086 for total GIP). We conclude that gastric emptying does not appear to be influenced by GIP. The secretion of GIP after meal ingestion is not suppressed by its exogenous administration. The lack of effect of GIP on gastric emptying underlines......The insulinotropic gut hormone gastric inhibitory polypeptide (GIP) has been demonstrated to inhibit gastric acid secretion and was proposed to possess "enterogastrone" activity. GIP effects on gastric emptying have not yet been studied. Fifteen healthy male volunteers (23.9 +/- 3.3 yr, body mass....... Gastric emptying was calculated from the (13)CO(2) exhalation rates in breath samples collected over 360 min. Venous blood was drawn in 30-min intervals for the determination of glucose, insulin, C-peptide, and GIP (total and intact). Statistical calculations were made by use of repeated-measures ANOVA...
Vasoactive intestinal polypeptide (VIP) in the pig pancreas
DEFF Research Database (Denmark)
Poulsen, Steen Seier
1984-01-01
Vasoactive intestinal polypeptide (VIP) in the pig pancreas is localized to nerves, many of which travel along the pancreatic ducts. VIP stimulates pancreatic fluid and bicarbonate secretion like secretin. Electrical vagal stimulation in the pig causes an atropine-resistant profuse secretion...... of bicarbonate-rich pancreatic juice. In an isolated perfused preparation of the pig pancreas with intact vagal nerve supply, electrical vagal stimulation caused an atropine-resistant release of VIP, which accurately parallelled the exocrine secretion of juice and bicarbonate. Perfusion of the pancreas...... with a potent VIP-antiserum inhibited the effect of vagal stimulation on the exocrine secretion. It is concluded, that VIP is responsible for (at least part of) the neurally controlled fluid and bicarbonate secretion from the pig pancreas....
Progress with helicity injection current drive
International Nuclear Information System (INIS)
Jarboe, T.R.; Raman, R.; Nelson, B.A.
2003-01-01
Coaxial Helicity Injection (CHI) experiments in the NSTX and HIT-II devices are reported. NSTX has produced toroidal currents of 0.4 MA and pulse lengths of up to 0.33 s. These discharges nearly fill the NSTX main chamber, and show the n=1 rotating distortion characteristic of high-performance CHI plasmas. CHI has been used in HIT-II to provide a closed flux startup plasma for inductive drive. The CHI startup method saves transformer volt-seconds and greatly improves reproducibility and reliability of inductively driven discharges, even in the presence of diminishing wall conditions. (author)
Heat loss by helicity injection in spheromaks
International Nuclear Information System (INIS)
Fowler, T.K.
1994-01-01
A model is presented for spheromak buildup and decay including thermal diffusivity associated with magnetic turbulence during helicity injection. It is shown that heat loss by magnetic turbulence scales more favorably than gyroBohm transport. Thus gyroBohm scaling for the proposed ignition experiment would be the conservative choice, though present experiments may be dominated by magnetic turbulence. Because of a change in boundary conditions when the gun is turned off, the model may account for the observed increase in electron temperature in CTX after turnoff
Rotation influence on the plasma helical instability
International Nuclear Information System (INIS)
Gutkin, T.I.; Tsypin, V.S.; Boleslavskaya, G.I.
1980-01-01
The influence of the rotation on helical instability of a plasma with the fixed boundaries (HIFB) is investigated taking into account the compressibility. A case of infinitely long cylinder with distributed current is considered. Cases when a rotating plasma is confined by current magnetic field are analytically considered. It is shown that in the case of the fixed boundary taking into account the compressibility in the HIFB increment increases and the picture of the rotation influence on HIFB considerably changes. Besides, it is shown that in the case of high plasma pressures HIFB can stabilize as a result of the rotation
Biosynthesis of human sialophorins and analysis of the polypeptide core
International Nuclear Information System (INIS)
Remold-O'Donnell, E.; Kenney, D.; Rosen, F.S.
1987-01-01
Biosynthesis was examined of sialophorin (formerly called gpL115) which is altered in the inherited immunodeficiency Wiskott-Aldrich syndrome. Sialophorin is greater than 50% carbohydrate, primarily O-linked units of sialic acid, galactose, and galactosamine. Pulse-labeling with [ 35 S]methionine and chase incubation established that sialophorin is synthesized in CEM lymphoblastoid cells as an Mr 62,000 precursor which is converted within 45 min to mature glycosylated sialophorin, a long-lived molecule. Experiments with tunicamycin and endoglycosidase H demonstrated that sialophorin contains N-linked carbohydrate (approximately two units per molecule) and is therefore an N,O-glycoprotein. Pulse-labeling of tunicamycin-treated CEM cells together with immunoprecipitation provided the means to isolate the [ 35 S]-methionine-labeled polypeptide core of sialophorin and determine its molecular weight (58,000). This datum allowed us to express the previously established composition on a per molecule basis and determine that sialophorin molecules contain approximately 520 amino acid residues and greater than or equal to 100 O-linked carbohydrate units. A recent study showed that various blood cells express sialophorin and that there are two molecular forms: lymphocyte/monocyte sialophorin and platelet/neutrophil sialophorin. Biosynthesis of the two forms was compared by using sialophorin of CEM cells and sialophorin of MOLT-4 cells (another lymphoblastoid line) as models for lymphocyte/monocyte sialophorin and platelet/neutrophil sialophorin, respectively. The time course of biosynthesis and the content of N units were found to be identical for the two sialophorin species. [ 35 S]Methionine-labeled polypeptide cores of CEM sialophorin and MOLT sialophorin were isolated and compared by electrophoresis, isoelectrofocusing, and a newly developed peptide mapping technique
Energy Technology Data Exchange (ETDEWEB)
Kundu, Sourav, E-mail: sourav.kunduphy@gmail.com; Karmakar, S.N.
2016-07-15
We propose a tight-binding model to investigate electronic transport properties of single helical protein molecules incorporating both the helical symmetry and the possibility of multiple charge transfer pathways. Our study reveals that due to existence of both the multiple charge transfer pathways and helical symmetry, the transport properties are quite rigid under influence of environmental fluctuations which indicates that these biomolecules can serve as better alternatives in nanoelectronic devices than its other biological counterparts e.g., single-stranded DNA.
CURRENT AND KINETIC HELICITY OF LONG-LIVED ACTIVITY COMPLEXES
International Nuclear Information System (INIS)
Komm, Rudolf; Gosain, Sanjay
2015-01-01
We study long-lived activity complexes and their current helicity at the solar surface and their kinetic helicity below the surface. The current helicity has been determined from synoptic vector magnetograms from the NSO/SOLIS facility, and the kinetic helicity of subsurface flows has been determined with ring-diagram analysis applied to full-disk Dopplergrams from NSO/GONG and SDO/HMI. Current and kinetic helicity of activity complexes follow the hemispheric helicity rule with mainly positive values (78%; 78%, respectively, with a 95% confidence level of 31%) in the southern hemisphere and negative ones (80%; 93%, respectively, with a 95% confidence level of 22% and 14%, respectively) in the northern hemisphere. The locations with the dominant sign of kinetic helicity derived from Global Oscillation Network Group (GONG) and SDO/HMI data are more organized than those of the secondary sign even if they are not part of an activity complex, while locations with the secondary sign are more fragmented. This is the case for both hemispheres even for the northern one where it is not as obvious visually due to the large amount of magnetic activity present as compared to the southern hemisphere. The current helicity shows a similar behavior. The dominant sign of current helicity is the same as that of kinetic helicity for the majority of the activity complexes (83% with a 95% confidence level of 15%). During the 24 Carrington rotations analyzed here, there is at least one longitude in each hemisphere where activity complexes occur repeatedly throughout the epoch. These ''active'' longitudes are identifiable as locations of strong current and kinetic helicity of the same sign
Mirecka, Ewa Agnieszka; Gremer, Lothar; Schiefer, Stephanie; Oesterhelt, Filipp; Stoldt, Matthias; Willbold, Dieter; Hoyer, Wolfgang
2014-12-10
Human islet amyloid polypeptide (IAPP) is the major component of pancreatic amyloid deposits in type 2 diabetes. The structural conversion of IAPP from a monomeric state into amyloid assemblies is the subject of intense research. Recombinant production of IAPP is, however, difficult due to its extreme aggregation propensity. Here we describe a novel strategy for expression of IAPP in Escherichia coli, based on an engineered protein tag, which sequesters IAPP monomers and prevents IAPP aggregation. The IAPP-binding protein HI18 was selected by phage display from a β-wrapin library. Fusion of HI18 to IAPP enabled the soluble expression of the construct. IAPP was cleaved from the fusion construct and purified to homogeneity with a yield of 3mg of isotopically labeled peptide per liter of culture. In the monomeric state, IAPP was largely disordered as evidenced by far-UV CD and liquid-state NMR spectroscopy but competent to form amyloid fibrils according to atomic force microscopy. These results demonstrate the ability of the engineered β-wrapin HI18 for shielding the hydrophobic sequence of IAPP during expression and purification. Fusion of aggregation-inhibiting β-wrapins is a suitable approach for the recombinant production of aggregation-prone proteins. Copyright © 2014 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Myoung Sook Kim
2010-02-01
Full Text Available Aerobic glycolysis and mitochondrial dysfunction are common features of aggressive cancer growth. We observed promoter methylation and loss of expression in neurofilament heavy polypeptide (NEFH in a significant proportion of primary esophageal squamous cell carcinoma (ESCC samples that were of a high tumor grade and advanced stage. RNA interference-mediated knockdown of NEFH accelerated ESCC cell growth in culture and increased tumorigenicity in vivo, whereas forced expression of NEFH significantly inhibited cell growth and colony formation. Loss of NEFH caused up-regulation of pyruvate kinase-M2 type and down-regulation of pyruvate dehydrogenase, via activation of the Akt/beta-catenin pathway, resulting in enhanced aerobic glycolysis and mitochondrial dysfunction. The acceleration of glycolysis and mitochondrial dysfunction in NEFH-knockdown cells was suppressed in the absence of beta-catenin expression, and was decreased by the treatment of 2-Deoxyglucose, a glycolytic inhibitor, or API-2, an Akt inhibitor. Loss of NEFH activates the Akt/beta-catenin pathway and increases glycolysis and mitochondrial dysfunction. Cancer cells with methylated NEFH can be targeted for destruction with specific inhibitors of deregulated downstream pathways.
Neutrino helicity flips via electroweak interactions
International Nuclear Information System (INIS)
Gaemers, K.J.F.; Gandhi, R.; Lattimer, J.M.; Department of Earth and Space Sciences, State University of New York, Stony Brook, New York 11794)
1989-01-01
Electroweak mechanisms via which neutrinos may flip helicity are examined in detail. Exact and approximate expressions for a variety of flip processes relevant in astrophysics and cosmology, mediated by W, Z, and γ exchange, including their interference, are derived for both Dirac and Majorana neutrinos (with emphasis on the former). It is shown that in general flip and nonflip cross sections differ by more than just a multiplicative factor of m/sub ν/ 2 /4E/sub ν/ 2 contrary to what might be expected and that this additional dependence on helicities can be significant. It is also shown that within the context of the standard model with massive neutrinos, for νe yields νe scattering, σ/sub Z//sup flip//σ/sub γ//sup flip/ ∼ 10 4 , independent of particle masses and energies to a good approximation. As an application, using some general considerations and the fact that the observed bar nu/sub e/ burst from SN 1987A lasted several seconds, these weak-interaction flip cross sections are used to rule out μ and tau neutrino masses above 30 keV. Finally, some other consequences for astrophysics in general and supernovae in particular are briefly discussed
Helical type thermonuclear device and control method
International Nuclear Information System (INIS)
Ishigaki, Yukio.
1990-01-01
In a conventional helical type thermonuclear device, electric current flows in the toroidal direction under magnetic fields of helical coils and vertical magnetic coils, by which a circulating electric field is caused. Therefore, there is a problem that electrons as a seed are generated by cosmic rays, etc., the electrons are confined in a magnetic field boundary, are accelerated by the circulating electric field, to reach a high energy level, collide against structures in a vacuum vessel and emit a great amount of X-rays. Then, compensation coils for offsetting the magnetic fields generated upon energization and deenergization of the vertical magnetic coils and the power source therefor are disposed at the positions opposing to each other on both sides of the vertical magnetic coils for controlling the variation coefficient rate of electric current upon energization and deenergization of the vertical magnetic coils. Since the compensation coils also offset the magnetic field generated upon energization and deenergization of the vertical magnetic field coils by this control, the circulating magnetic field is not caused in the vacuum vessel to reduce the X-ray radiation by electrons at high energy level. (N.H.)
Determining How Magnetic Helicity Injection Really Works
International Nuclear Information System (INIS)
Paul M Bellan
2001-01-01
OAK-B135 The goal of the Caltech program is to determine how helicity injection works by investigating the actual dynamics and topological evolution associated with magnetic relaxation. A new coaxial helicity injection source has been constructed and brought into operation. The key feature of this source is that it has maximum geometric simplicity. Besides being important for fusion research, this work also has astrophysical implications. Photos obtained using high-speed cameras show a clear sequence of events in the formation process. In particular, they show initial merging/reconnection processes, jet-like expansion, kinking, and separation of the plasma from the source. Various diagnostics have been developed, including laser induced fluorescence and soft x-ray detection using high speed diodes. Gas valves have been improved and a patent disclosure relating to puffed gas valves has been filed. Presentations on this work have been given in the form of invited talks at several university physics departments that were previously unfamiliar with laboratory plasma experiments
On the motion of multiple helical vortices
Wood, D. H.; Boersma, J.
2001-11-01
The analysis of the self-induced velocity of a single helical vortex (Boersma & Wood 1999) is extended to include equally spaced multiple vortices. This arrangement approximates the tip vortices in the far wake of multi-bladed wind turbines, propellers, or rotors in ascending, descending, or hovering flight. The problem is reduced to finding, from the Biot Savart law, the additional velocity of a helix due to an identical helix displaced azimuthally. The resulting Biot Savart integral is further reduced to a Mellin Barnes integral representation which allows the asymptotic expansions to be determined for small and for large pitch. The Biot Savart integral is also evaluated numerically for a total of two, three and four vortices over a range of pitch values. The previous finding that the self-induced velocity at small pitch is dominated by a term inversely proportional to the pitch carries over to multiple vortices. It is shown that a far wake dominated by helical tip vortices is consistent with the one-dimensional representation that leads to the Betz limit on the power output of wind turbines. The small-pitch approximation then allows the determination of the blade&s bound vorticity for optimum power extraction. The present analysis is shown to give reasonable estimates for the vortex circulation in experiments using a single hovering rotor and a four-bladed propeller.
Perspectives on confinement in helical systems
International Nuclear Information System (INIS)
Itoh, Kimitaka; Itoh, Sanae
1989-01-01
A review on recent experimental results and theoretical models on anomalous transport and density limit in toroidal helical devices is presented. Importance of transport problems is discussed. Experiments on Heliotron-E, Wendelstein-VIIA and new devices, i.e., ATF, Wendelstein-VIIAS and CHS, are reviewed and an overview on confinement property is given. From recent experimental results one sees that there are anomalous transport, which increases with temperature, and density limit, and that they limit the energy confinement time as well as the attainable beta value. The confinement characteristics of the scrape off layer plasma and loss cone loss are discussed, and perspectives on the high temperature plasma are given. These anomalous transport and density limit will be difficult obstacles in realizing a reactor grade plasma in helical systems. It is an urgent task to draw a realistic picture of the confinement based on the present data base. The relevant knowledge now would be critically essential for the successful development of the research in 1990's. (author) 102 refs
Neutrino helicity reversal and fundamental symmetries
International Nuclear Information System (INIS)
Jentschura, U D; Wundt, B J
2014-01-01
A rather elusive helicity reversal occurs in a gedanken experiment in which a massive left-handed Dirac neutrino, traveling at a velocity u < c, is overtaken on a highway by a speeding vehicle (traveling at velocity v with u < v < c). Namely, after passing the neutrino, looking back, one would see a right-handed neutrino (which has never been observed in nature). The Lorentz-invariant mass of the right-handed neutrino is still the same as before the passing. The gedanken experiment thus implies the existence of right-handed, light neutrinos, which are not completely sterile. Furthermore, overtaking a bunch of massive right-handed Dirac neutrinos leads to gradual de-sterilization. We discuss the helicity reversal and the concomitant sterilization and de-sterilization mechanisms by way of an illustrative example calculation, with a special emphasis on massive Dirac and Majorana neutrinos. We contrast the formalism with a modified Dirac neutrino described by a Dirac equation with a pseudoscalar mass term proportional to the fifth current. (paper)
Quality assurance of a helical tomotherapy machine
International Nuclear Information System (INIS)
Fenwick, J D; Tome, W A; Jaradat, H A; Hui, S K; James, J A; Balog, J P; DeSouza, C N; Lucas, D B; Olivera, G H; Mackie, T R; Paliwal, B R
2004-01-01
Helical tomotherapy has been developed at the University of Wisconsin, and 'Hi-Art II' clinical machines are now commercially manufactured. At the core of each machine lies a ring-gantry-mounted short linear accelerator which generates x-rays that are collimated into a fan beam of intensity-modulated radiation by a binary multileaf, the modulation being variable with gantry angle. Patients are treated lying on a couch which is translated continuously through the bore of the machine as the gantry rotates. Highly conformal dose-distributions can be delivered using this technique, which is the therapy equivalent of spiral computed tomography. The approach requires synchrony of gantry rotation, couch translation, accelerator pulsing and the opening and closing of the leaves of the binary multileaf collimator used to modulate the radiation beam. In the course of clinically implementing helical tomotherapy, we have developed a quality assurance (QA) system for our machine. The system is analogous to that recommended for conventional clinical linear accelerator QA by AAPM Task Group 40 but contains some novel components, reflecting differences between the Hi-Art devices and conventional clinical accelerators. Here the design and dosimetric characteristics of Hi-Art machines are summarized and the QA system is set out along with experimental details of its implementation. Connections between this machine-based QA work, pre-treatment patient-specific delivery QA and fraction-by-fraction dose verification are discussed
Energy fluxes in helical magnetohydrodynamics and dynamo action
Indian Academy of Sciences (India)
... large-scale magnetic field arising due to non-helical interactions and (2) inverse energy flux of magnetic energy caused by helical interactions. Based on our flux results, a primitive model for galactic dynamo has been constructed. Our calculations yield dynamo time-scale for a typical galaxy to be of the order of 108 years.
Alpha-Effect, Current and Kinetic Helicities for Magnetically Driven ...
Indian Academy of Sciences (India)
tribpo
Key words. Sun—dynamo, helicity, turbulent convection. Extended abstract. Recent numerical simulations lead to the result that turbulence is much more mag- netically driven than believed. ... positive (and negative in the northern hemisphere), this being just opposite to what occurs for the current helicity which is negative ...
Space vehicle electromechanical system and helical antenna winding fixture
Judd, Stephen; Dallmann, Nicholas; Guenther, David; Enemark, Donald; Seitz, Daniel; Martinez, John; Storms, Steven
2017-12-26
A space vehicle electromechanical system may employ an architecture that enables convenient and practical testing, reset, and retesting of solar panel and antenna deployment on the ground. A helical antenna winding fixture may facilitate winding and binding of the helical antenna.
Low-energy properties of fractional helical Luttinger liquids
Meng, T.; Fritz, L.|info:eu-repo/dai/nl/371569559; Schuricht, D.|info:eu-repo/dai/nl/369284690; Loss, D.
2014-01-01
We investigate the low-energy properties of (quasi) helical and fractional helical Luttinger liquids. In particular, we calculate the Drude peak of the optical conductivity, the density of states, as well as charge transport properties of the interacting system with and without attached Fermi liquid
A helical naphthopyran dopant for photoresponsive cholesteric liquid crystals
Kim, Yuna; Frigoli, Michel; Vanthuyne, Nicolas; Tamaoki, Nobuyuki
2017-01-01
The first photoresponsive cholesteric liquid crystal comprising a photoisomerizable helical naphthopyran derivative dopant and a nematic liquid crystal is reported. An unprecedented helical twisting power switching ratio of over 90% allowed us to demonstrate multi-cycle rotational motion of micro-objects by UV light irradiation.
Helical modes generate antimagnetic rotational spectra in nuclei
Malik, Sham S.
2018-03-01
A systematic analysis of the antimagnetic rotation band using r -helicity formalism is carried out for the first time. The observed octupole correlation in a nucleus is likely to play a role in establishing the antimagnetic spectrum. Such octupole correlations are explained within the helical orbits. In a rotating field, two identical fermions (generally protons) with paired spins generate these helical orbits in such a way that its positive (i.e., up) spin along the axis of quantization refers to one helicity (right-handedness) while negative (down) spin along the same quantization-axis decides another helicity (left-handedness). Since the helicity remains invariant under rotation, therefore, the quantum state of a fermion is represented by definite angular momentum and helicity. These helicity represented states support a pear-shaped structure of a rotating system having z axis as the symmetry axis. A combined operation of parity, time-reversal, and signature symmetries ensures an absence of one of the signature partner band from the observed antimagnetic spectrum. This formalism has also been tested for the recently observed negative parity Δ I =2 antimagnetic spectrum in odd-A 101Pd nucleus and explains nicely its energy spectrum as well as the B (E 2 ) values. Further, this formalism is found to be fully consistent with twin-shears mechanism popularly known for such type of rotational bands. It also provides significant clue for extending these experiments in various mass regions spread over the nuclear chart.
Experimental investigation of solar powered diaphragm and helical pumps
For several years, many types of solar powered water pumping systems were evaluated, and in this paper, diaphragm and helical solar photovoltaic (PV) powered water pumping systems are discussed. Data were collected on diaphragm and helical pumps which were powered by different solar PV arrays at mul...
The helical ventricular myocardial band of Torrent-Guasp.
Kocica, Mladen J; Corno, Antonio F; Lackovic, Vesna; Kanjuh, Vladimir I
2007-01-01
We live in an era of substantial progress in understanding myocardial structure and function at genetic, molecular, and microscopic levels. Yet, ventricular myocardium has proven remarkably resistant to macroscopic analyses of functional anatomy. Pronounced and practically indefinite global and local structural anisotropy of its fibers and other ventricular wall constituents produces electrical and mechanical properties that are nonlinear, anisotropic, time varying, and spatially inhomogeneous. The helical ventricular myocardial band of Torrent-Guasp is a revolutionary new concept in understanding global, 3-dimensional, functional architecture of the ventricular myocardium. This concept defines the principal, cumulative vectors, integrating the tissue architecture (ie, form) and net forces developed (ie, function) within the ventricular mass. The primary purpose of this review is to emphasize the importance of this concept, in the light of collaborative efforts to establish an integrative approach, defining ventricular form and function by linking across multiple scales of biological organization, as explained in the ongoing Physiome project. Because one of the most important scientific missions in this century is integration of basic research with clinical medicine, we believe that this knowledge is not of merely academic importance, but is also the essential prerequisite in clinical evaluation and treatment of different heart diseases.
Hou, Hu; Li, Bafang; Zhang, Zhaohui; Xue, Changhu; Yu, Guangli; Wang, Jingfeng; Bao, Yuming; Bu, Lin; Sun, Jiang; Peng, Zhe; Su, Shiwei
2012-12-01
Collagen polypeptides were prepared from cod skin. Moisture absorption and retention properties of collagen polypeptides were determined at different relative humidities. In addition, the protective effects of collagen polypeptide against UV-induced damage to mouse skin were evaluated. Collagen polypeptides had good moisture absorption and retention properties and could alleviate the damage induced by UV radiation. The action mechanisms of collagen polypeptide mainly involved enhancing immunity, reducing the loss of moisture and lipid, promoting anti-oxidative properties, inhibiting the increase of glycosaminoglycans, repairing the endogenous collagen and elastin protein fibres, and maintaining the ratio of type III to type I collagen. Copyright © 2012 Elsevier Ltd. All rights reserved.
Conlon, J M; Schmidt, W E; Gallwitz, B; Falkmer, S; Thim, L
1986-12-30
The primary structure of pancreatic polypeptide from the teleostean fish, Cottus scorpius (daddy sculpin) was established as: YPPQPESPGGNASPEDWAKYHAAVRHYVNLITRQRYNH2 The presence of a COOH-terminally alpha-amidated amino acid was established using an HPLC method of general applicability. Although the peptide shows strong homology towards anglerfish pancreatic polypeptide (86%), homology towards porcine peptide YY (PYY) (61%) and porcine neuropeptide Y (NPY) (61%) was greater than towards porcine pancreatic polypeptide (PP) (47%). This result supports suggestions that the gene duplication events which led to PP, NPY and PYY formation took place after the time of divergence of fish and mammals.
The Research on the Impact of Maca Polypeptide on Sport Fatigue.
Miao, Hua
2015-01-01
In order to study the effect of maca polypeptide on sport fatigue, this paper selected 40 male mice, and they were randomly divided into group A, B, C and D. group A, B and C were fed food with different concentrations of maca polypeptide, and group D was control group. After two weeks of feeding, measured physiological indexes of mice, including blood glucose, urea nitrogen and creatinine. At last gived the experimental results, as well as the analysis. Experimental results show that maca polypeptide can improve the ability of anti-fatigue mice, and in a certain concentration range, the higher the concentration, the better the resistance to fatigue.
DEFF Research Database (Denmark)
2016-01-01
The present invention generally relates to the field of biotechnology as it applies to the production of hydroxycinnamic acids using polypeptides having tyrosine ammonia lyase activity. More particularly, the present invention pertains to polypeptides having tyrosine ammonia lyase activity and high...... substrate specificity towards tyrosine, which makes them particularly suitable in the production of p-coumaric acid and other hydroxycinnamic acids. The present invention thus provides processes for the production of p-coumaric acid and other hydroxycinnamic acids employing these polypeptides as well...
Stimuli-Directed Helical Chirality Inversion and Bio-Applications
Directory of Open Access Journals (Sweden)
Ziyu Lv
2016-08-01
Full Text Available Helical structure is a sophisticated ubiquitous motif found in nature, in artificial polymers, and in supramolecular assemblies from microscopic to macroscopic points of view. Significant progress has been made in the synthesis and structural elucidation of helical polymers, nevertheless, a new direction for helical polymeric materials, is how to design smart systems with controllable helical chirality, and further use them to develop chiral functional materials and promote their applications in biology, biochemistry, medicine, and nanotechnology fields. This review summarizes the recent progress in the development of high-performance systems with tunable helical chirality on receiving external stimuli and discusses advances in their applications as drug delivery vesicles, sensors, molecular switches, and liquid crystals. Challenges and opportunities in this emerging area are also presented in the conclusion.
Helicity conservation and twisted Seifert surfaces for superfluid vortices.
Salman, Hayder
2017-04-01
Starting from the continuum definition of helicity, we derive from first principles its different contributions for superfluid vortices. Our analysis shows that an internal twist contribution emerges naturally from the mathematical derivation. This reveals that the spanwise vector that is used to characterize the twist contribution must point in the direction of a surface of constant velocity potential. An immediate consequence of the Seifert framing is that the continuum definition of helicity for a superfluid is trivially zero at all times. It follows that the Gauss-linking number is a more appropriate definition of helicity for superfluids. Despite this, we explain how a quasi-classical limit can arise in a superfluid in which the continuum definition for helicity can be used. This provides a clear connection between a microscopic and a macroscopic description of a superfluid as provided by the Hall-Vinen-Bekarevich-Khalatnikov equations. This leads to consistency with the definition of helicity used for classical vortices.
High performance operational limits of tokamak and helical systems
International Nuclear Information System (INIS)
Yamazaki, Kozo; Kikuchi, Mitsuru
2003-01-01
The plasma operational boundaries of tokamak and helical systems are surveyed and compared with each other. Global confinement scaling laws are similar and gyro-Bohm like, however, local transport process is different due to sawtooth oscillations in tokamaks and ripple transport loss in helical systems. As for stability limits, achievable tokamak beta is explained by ideal or resistive MHD theories. On the other hand, beta values obtained so far in helical system are beyond ideal Mercier mode limits. Density limits in tokamak are often related to the coupling between radiation collapse and disruptive MHD instabilities, but the slow radiation collapse is dominant in the helical system. The pulse length of both tokamak and helical systems is on the order of hours in small machines, and the longer-pulsed good-confinement plasma operations compatible with radiative divertors are anticipated in both systems in the future. (author)
On Helical Projection and Its Application in Screw Modeling
Directory of Open Access Journals (Sweden)
Riliang Liu
2014-04-01
Full Text Available As helical surfaces, in their many and varied forms, are finding more and more applications in engineering, new approaches to their efficient design and manufacture are desired. To that end, the helical projection method that uses curvilinear projection lines to map a space object to a plane is examined in this paper, focusing on its mathematical model and characteristics in terms of graphical representation of helical objects. A number of interesting projective properties are identified in regard to straight lines, curves, and planes, and then the method is further investigated with respect to screws. The result shows that the helical projection of a cylindrical screw turns out to be a Jordan curve, which is determined by the screw's axial profile and number of flights. Based on the projection theory, a practical approach to the modeling of screws and helical surfaces is proposed and illustrated with examples, and its possible application in screw manufacturing is discussed.
Goyal, Bhupesh; Srivastava, Kinshuk Raj; Durani, Susheel
2017-06-01
Protein folding problem remains a formidable challenge as main chain, side chain and solvent interactions remain entangled and have been difficult to resolve. Alanine-based short peptides are promising models to dissect protein folding initiation and propagation structurally as well as energetically. The effect of N-terminal diproline and charged side chains is assessed on the stabilization of helical conformation in alanine-based short peptides using circular dichroism (CD) with water and methanol as solvent. A1 (Ac-Pro-Pro-Ala-Lys-Ala-Lys-Ala-Lys-Ala-NH 2 ) is designed to assess the effect of N-terminal homochiral diproline and lysine side chains to induce helical conformation. A2 (Ac-Pro-Pro-Glu-Glu-Ala-Ala-Lys-Lys-Ala-NH 2 ) and A3 (Ac-dPro-Pro-Glu-Glu-Ala-Ala-Lys-Lys-Ala-NH 2 ) with N-terminal homochiral and heterochiral diproline, respectively, are designed to assess the effect of Glu...Lys (i, i + 4) salt bridge interactions on the stabilization of helical conformation. The CD spectra of A1, A2 and A3 in water manifest different amplitudes of the observed polyproline II (PPII) signals, which indicate different conformational distributions of the polypeptide structure. The strong effect of solvent substitution from water to methanol is observed for the peptides, and CD spectra in methanol evidence A2 and A3 as helical folds. Temperature-dependent CD spectra of A1 and A2 in water depict an isodichroic point reflecting coexistence of two conformations, PPII and β-strand conformation, which is consistent with the previous studies. The results illuminate the effect of N-terminal diproline and charged side chains in dictating the preferences for extended-β, semi-extended PPII and helical conformation in alanine-based short peptides. The results of the present study will enhance our understanding on stabilization of helical conformation in short peptides and hence aid in the design of novel peptides with helical structures. Copyright © 2017 European Peptide
Internal transport barrier physics in helical systems
International Nuclear Information System (INIS)
Yokoyama, M.; Minami, T.; Fujisawa, A.; Herranz, J.; Ida, K.; Yamagishi, O.; Yamada, H.; Maaberg, H.; Beidler, C.D.; Dinklage, A.; Estrada, T.; Castejon, F.; Murakami, S.
2005-01-01
The electron internal transport barrier (eITB) has been observed in wide range of helical systems, such as CHS [eg.,1], LHD [eg., 2], TJ-II [eg., 3] and W7-AS [eg., 4]. The eITB isA defined as highly peaked electron temperature (Te) profile with strongly positive radial electric field (Er) in the central region. These observations are reviewed in this paper to understand the device-independent common findings and also to draw the main differences. This is the first report from the International Stellarator Profile Database Activity. The formation of the strong central positive Er has been understood mainly as a result of the ambipolarity of neoclassical electron and ion fluxes, although some additional convective electron flux such as driven by ECRH is required in some situations. This 'neoclassical' physics peculiar to low collisional regime of helical plasmas provides the commonly observed existence of the ECRH power threshold (which is also depending on the density). This is contrastive characteristics to the ITB observed in tokamaks. The dependence of the ECRH power threshold on the magnetic configuration and on the heating scenario among these devices are currently being examined by taking the effective ripple and the trapped particle fraction as parameters to achieve the comprehensive understanding. The roles of low order rational surfaces on the onset of eITB formation and also on its radial size (location of the footpoint of the eITB) have been indicated in inward shifted configurations in LHD (depending on the relative locations of heating position and 2/1 island) and TJ-II (eITB becomes possible at higher density when 3/2 rational is introduced in the plasma core region). It is speculated that, for the latter case, the resonance causes an extra electron flux to trigger the positive Er. The interplay between low order rational surfaces and the formation of eITB still waits for the systematic experiment and theoretical analysis. The external controllability
Patterns of uterine enhancement with helical CT
Energy Technology Data Exchange (ETDEWEB)
Kaur, H.; Loyer, E.M.; Charnsangavej, C. [Department of Diagnostic Radiology, Box 57, The University of Texas, M.D. Anderson Cancer Center, 1515 Holcombe Blvd. Houston, TX 77030 (United States); Minami, M. [Department of Radiology, Faculty of Medicine, University of Tokyo, 7-3-1 Hongo, Bunkyo-Ku, Tokyo 113 (Japan)
1998-10-01
Objective: The purpose of this study was to evaluate the enhancement characteristics of the normal uterine body and cervix using dynamic contrast-enhanced helical CT. Methods: Thirty-eight women scheduled for pelvic CT for non-gynecologic malignancies underwent dynamic contrast-enhanced helical CT of the pelvis. Data acquisition was during the arterial phase (30-45 s after the start of injection), the parenchymal phase (90-120 s after the start of injection), and delayed phase (3-9 min after the start of injection). The images were evaluated by four radiologists for the pattern of myometrial and cervical enhancement. Correlation was made with the age and menstrual status of the patients. Results: In the uterine body, three types of enhancement were observed. Type 1 enhancement, seen in 16 patients (42%), was characterized by the visualization of a subendometrial zone of enhancement, 30-120 s after the start of injection. Eight of these patients also showed an enhancing zone in the outer myometrium. Both zones were transitory, and in all cases, the uterus became homogeneous in the delayed phase. This pattern was seen predominantly in premenopausal women with a mean age of 34 years. Type 2 enhancement, seen in 17 cases (45%), was defined by the absence of subendometrial enhancement in the early phase. Enhancement was either diffuse from the outset or originated in the outer myometrium. This pattern was seen nearly equally in premenopausal and postmenopausal women with a mean age of 40 years. Type 3 enhancement was seen in five postmenopausal patients (13%) with a mean age of 53 years and was characterized by faint diffuse enhancement. In the cervix, a zonal pattern of enhancement defining inner and outer stroma was seen in 23 patients (61%). Fifteen patients were premenopausal and eight were postmenopausal. Conclusion: In this study, we have shown a transitory zonal distribution of the contrast in the myometrium and cervix using dynamic contrast-enhanced helical CT
Patterns of uterine enhancement with helical CT
International Nuclear Information System (INIS)
Kaur, H.; Loyer, E.M.; Charnsangavej, C.; Minami, M.
1998-01-01
Objective: The purpose of this study was to evaluate the enhancement characteristics of the normal uterine body and cervix using dynamic contrast-enhanced helical CT. Methods: Thirty-eight women scheduled for pelvic CT for non-gynecologic malignancies underwent dynamic contrast-enhanced helical CT of the pelvis. Data acquisition was during the arterial phase (30-45 s after the start of injection), the parenchymal phase (90-120 s after the start of injection), and delayed phase (3-9 min after the start of injection). The images were evaluated by four radiologists for the pattern of myometrial and cervical enhancement. Correlation was made with the age and menstrual status of the patients. Results: In the uterine body, three types of enhancement were observed. Type 1 enhancement, seen in 16 patients (42%), was characterized by the visualization of a subendometrial zone of enhancement, 30-120 s after the start of injection. Eight of these patients also showed an enhancing zone in the outer myometrium. Both zones were transitory, and in all cases, the uterus became homogeneous in the delayed phase. This pattern was seen predominantly in premenopausal women with a mean age of 34 years. Type 2 enhancement, seen in 17 cases (45%), was defined by the absence of subendometrial enhancement in the early phase. Enhancement was either diffuse from the outset or originated in the outer myometrium. This pattern was seen nearly equally in premenopausal and postmenopausal women with a mean age of 40 years. Type 3 enhancement was seen in five postmenopausal patients (13%) with a mean age of 53 years and was characterized by faint diffuse enhancement. In the cervix, a zonal pattern of enhancement defining inner and outer stroma was seen in 23 patients (61%). Fifteen patients were premenopausal and eight were postmenopausal. Conclusion: In this study, we have shown a transitory zonal distribution of the contrast in the myometrium and cervix using dynamic contrast-enhanced helical CT
Cancer Nano technology Using Elastin-Like Polypeptides
International Nuclear Information System (INIS)
Siti Najila Mohd Janib
2014-01-01
Despite progress in understanding cancer biology, this knowledge has not translated into comparable advances in the clinic. Two fundamental problems currently stalling the efficient treatment of cancer have been detecting cancer early enough for successful treatment and avoiding excessive toxicity to normal tissues. In view of this, cancer still remains one of the leading causes of mortality worldwide, affecting over 10 million new patients every year. Clearly the development of novel approaches for early detection and treatment of cancer is urgently needed to increase patient survival. Recently, nano technology-based systems have emerged as novel therapeutic modalities for cancer treatment. Tiny man made nanoparticles, much smaller than a virus, are being developed to package, transport, and deliver imaging and therapeutic agents. Co-inclusion of these agents, into nano carriers might be advantageous because they increase solubility of hydrophobic drugs, enhance permeability across physiological barriers, alter drug biodistribution, increase local bioavailability and reduce side effects. Initial findings have been promising and nanoparticles have been shown to deliver therapeutic agents to target cells and effect tumor growth. To this end our lab is investigating a class of biodegradable and biocompatible polymers known as elastin-like polypeptides (ELP). Elastin like polypeptide is a bio polymer derived from the structural motif found in mammalian elastin protein and has a sequence dependent transition temperature that can be used as nano carriers to treat diseases. ELPs are characterized by the pentameric repeat VPGXG, where X can be any amino acid. All functional ELPs undergo inverse phase transition whereby below its transition temperature, they exist in a solubilized form while above its transition temperature they undergo phase separation which leads to their aggregation in solution. This process is reversible. Phase transition can also be triggered by other
International Nuclear Information System (INIS)
Toi, K; Ohdachi, S; Watanabe, F; Narihara, K; Morisaki, T; Sakakibara, S; Morita, S; Goto, M; Ida, K; Masuzaki, S; Miyazawa, K; Tanaka, K; Tokuzawa, T; Watanabe, K W; Yoshinuma, M
2006-01-01
On the Large Helical Device (LHD), low to high confinement (L-H) transition and edge transport barrier (ETB) formation were observed in the low beta regime ((β dia ) dia ): volume-averaged beta derived from diamagnetic measurement) as well as in relatively high beta regime (>1.5%). In most of ETB plasmas electron density preferentially increases in the edge region without a substantial rise of the edge electron temperature. The ETB zone develops inside the ergodic field layer calculated in the vacuum field. The ETB formation strongly destabilizes edge coherent modes such as m/n = 2/3 or 1/2 (m, n: poloidal and toroidal mode numbers), because the plasma edge region is in the magnetic hill. The ETB is partially destroyed by the combination of these edge MHD modes and ELM-like activities. For a particular experimental condition, the forced generation of a sizable m/n = 1/1 magnetic island near the edge by application of external field perturbations facilitates the L-H transition at a lower electron density and suppresses edge MHD modes and ELM-like activities to lower levels
Twist and Stretch of Helices Explained via the Kirchhoff-Love Rod Model of Elastic Filaments
Đuričković, Bojan
2013-09-05
In various single-molecule experiments, a chiral polymer, such as DNA, is simultaneously pulled and twisted. We address an elementary but fundamental question raised by various authors: does the molecule overwind or unwind under tension? We show that within the context of the classic Kirchhoff-Love rod model of elastic filaments, both behaviors are possible, depending on the precise constitutive relations of the polymer. More generally, our analysis provides an effective linear response theory for helical structures that relates axial force and axial torque to axial translation and rotation. © 2013 American Physical Society.
Numerical Study of Flow Motion and Patterns Driven by a Rotating Permanent Helical Magnetic Field
Yang, Wenzhi; Wang, Xiaodong; Wang, Bo; Baltaretu, Florin; Etay, Jacqueline; Fautrelle, Yves
2016-10-01
Liquid metal magnetohydrodynamic flow driven by a rotating permanent helical magnetic field in a cylindrical container is numerically studied. A three-dimensional numerical simulation provides insight into the visualization of the physical fields, including the magnetic field, the Lorentz force density, and the flow structures, especially the flow patterns in the meridional plane. Because the screen parameter is sufficiently small, the model is decoupled into electromagnetic and hydrodynamic components. Two flow patterns in the meridional plane, i.e., the global flow and the secondary flow, are discovered and the impact of several system parameters on their transition is investigated. Finally, a verifying model is used for comparison with the previous experiment.
The supernova-regulated ISM. III. Generation of vorticity, helicity, and mean flows
Käpylä, M. J.; Gent, F. A.; Väisälä, M. S.; Sarson, G. R.
2018-03-01
Context. The forcing of interstellar turbulence, driven mainly by supernova (SN) explosions, is irrotational in nature, but the development of significant amounts of vorticity and helicity, accompanied by large-scale dynamo action, has been reported. Aim. Several earlier investigations examined vorticity production in simpler systems; here all the relevant processes can be considered simultaneously. We also investigate the mechanisms for the generation of net helicity and large-scale flow in the system. Methods: We use a three-dimensional, stratified, rotating and shearing local simulation domain of the size 1 × 1 × 2 kpc3, forced with SN explosions occurring at a rate typical of the solar neighbourhood in the Milky Way. In addition to the nominal simulation run with realistic Milky Way parameters, we vary the rotation and shear rates, but keep the absolute value of their ratio fixed. Reversing the sign of shear vs. rotation allows us to separate the rotation- and shear-generated contributions. Results: As in earlier studies, we find the generation of significant amounts of vorticity, the rotational flow comprising on average 65% of the total flow. The vorticity production can be related to the baroclinicity of the flow, especially in the regions of hot, dilute clustered supernova bubbles. In these regions, the vortex stretching acts as a sink of vorticity. In denser, compressed regions, the vortex stretching amplifies vorticity, but remains sub-dominant to baroclinicity. The net helicities produced by rotation and shear are of opposite signs for physically motivated rotation laws, with the solar neighbourhood parameters resulting in the near cancellation of the total net helicity. We also find the excitation of oscillatory mean flows, the strength and oscillation period of which depend on the Coriolis and shear parameters; we interpret these as signatures of the anisotropic-kinetic-α (AKA) effect. We use the method of moments to fit for the turbulent transport
Chaotic coordinates for the Large Helical Device
Energy Technology Data Exchange (ETDEWEB)
Hudson, S. R., E-mail: shudson@pppl.gov [Princeton Plasma Physics Laboratory, P.O. Box 451, Princeton, New Jersey 08543 (United States); Suzuki, Y. [National Institute for Natural Sciences, National Institute for Fusion Sciences, 322-6 Oroshi, Toki, 509-5292 (Japan)
2014-10-15
The theory of quadratic-flux-minimizing (QFM) surfaces is reviewed, and numerical techniques that allow high-order QFM surfaces to be efficiently constructed for experimentally relevant, non-integrable magnetic fields are described. As a practical example, the chaotic edge of the magnetic field in the Large Helical Device (LHD) is examined. A precise technique for finding the boundary surface is implemented, the hierarchy of partial barriers associated with the near-critical cantori is constructed, and a coordinate system, which we call chaotic coordinates, that is based on a selection of QFM surfaces is constructed that simplifies the description of the magnetic field, so that flux surfaces become “straight” and islands become “square.”.
Helical spin rotators and snakes for RHIC
International Nuclear Information System (INIS)
Ptitsin, V.I.; Shatunov, Yu.M.; Peggs, S.
1995-01-01
The RHIC collider, now under construction at BNL, will have the possibility of polarized proton-proton collisions up to a beam energy of 250 Gev. Polarized proton beams of such high energy can be only obtained with the use of siberian snakes, a special kind of spin rotator that rotates the particle spin by 180 degree around an axis lying in the horizontal plane. Siberian snakes help to preserve the beam polarization while numerous spin depolarizing resonances are crossed, during acceleration. In order to collide longitudinally polarized beams, it is also planned to install spin rotators around two interaction regions. This paper discusses snake and spin rotator designs based on sequences of four helical magnets. The schemes that were chosen to be applied at RHIC are presented
ATLAS helicity analyses in beauty hadron decays
Smizanska, M
2000-01-01
The ATLAS detector will allow a precise spatial reconstruction of the kinematics of B hadron decays. In combination with the efficient lepton identification applied already at trigger level, ATLAS is expected to provide large samples of exclusive decay channels cleanly separable from background. These data sets will allow spin-dependent analyses leading to the determination of production and decay parameters, which are not accessible if the helicity amplitudes are not separated. Measurement feasibility studies for decays B/sub s //sup 0/ to J/ psi phi and Lambda /sub b//sup 0/ to Lambda J/ psi , presented in this document, show the experimental precisions that can be achieved in determination of B/sub s//sup 0/ and Lambda /sub b //sup 0/ characteristics. (19 refs).
Conditioner for a helically transported electron beam
International Nuclear Information System (INIS)
Wang, Changbiao.
1992-05-01
The kinetic theory is developed to investigate a conditioner for a helically transported electron beam. Linear expressions for axial velocity spread are derived. Numerical simulation is used to check the theoretical results and examine nonlinear aspects of the conditioning process. The results show that in the linear regime the action of the beam conditioner on a pulsed beam mainly depends on the phase at which the beam enters the conditioner and depends only slightly on the operating wavelength. In the nonlinear regime, however, the action of the conditioner strongly depends on the operating wavelength and only slightly upon the entrance phase. For a properly chosen operating wavelength, a little less than the electron's relativistic cyclotron wavelength, the conditioner can decrease the axial velocity spread of a pulsed beam down to less than one-third of its initial value
Conditioner for a helically transported electron beam
International Nuclear Information System (INIS)
Wang, C.
1992-05-01
The kinetic theory is developed to investigate a conditioner for a helically imported electron beam. Linear expressions for axial velocity spread are derived. Numerical simulation is used to check the theoretical results and examine nonlinear aspects of the conditioning process. The results show that in the linear regime the action of the beam conditioner on a pulsed beam mainly depends on the phase at which the beam enters the conditioner and depends only slightly on the operating wavelength. In the nonlinear regime, however, the action of the conditioner strongly depends on the operating wavelength and only slightly upon the entrance phase. For a properly chosen operating wavelength, a little less than the electron's relativistic cyclotron wavelength, the conditioner can decrease the axial velocity spread of a pulsed beam down to less than one-third of its initial value
Microinstability Studies for the Large Helical Device
International Nuclear Information System (INIS)
Rewoldt, G.; Ku, L.-P.; Tang, W.M.; Sugama, H.; Nakajima, N.; Watanabe, K.Y.; Murakami, S.; Yamada, H.; Cooper, W.A.
2002-01-01
Fully kinetic assessments of the stability properties of toroidal drift modes have been obtained for cases for the Large Helical Device (LHD). This calculation employs the comprehensive linear microinstability code FULL, as recently extended for nonaxisymmetric systems. The code retains the important effects in the linearized gyrokinetic equation, using the lowest-order ''ballooning representation'' for high toroidal mode number instabilities in the electrostatic limit. These effects include trapped particles, FLR, transit and bounce and magnetic drift frequency resonances, etc., for any number of plasma species. Results for toroidal drift waves destabilized by trapped electrons and ion temperature gradients are presented, using numerically-calculated three-dimensional MHD equilibria. These are reconstructed from experimental measurements. Quasilinear fluxes of particles and energy for each species are also calculated. Pairs of LHD discharges with different magnetic axis positions and with and without pellet injection are compared
Lerdsirisopon, Sopon; Frisella, Margaret M; Matthews, Brent D; Deeken, Corey R
2011-12-01
This study aimed to determine whether the strength and extensibility of hernia repair materials are negatively influenced by the application of helical titanium tacks. This study evaluated 14 meshes including bare polypropylene, macroporous polytetrafluoroethylene, absorbable barrier, partially absorbable mesh, and expanded polytetrafluoroethylene materials. Each mesh provided 15 specimens, which were prepared in 7.5 × 7.5-cm squares. Of these, 5 "undamaged" specimens were subjected to ball-burst testing to determine their biomechanical properties before application of helical titanium tacks (ProTack). To 10 "damaged" specimens 7 tacks were applied 1 cm apart in a 3.5-cm-diameter circle using a tacking force of 25 to 28 N. The tacks were removed from five of the specimens before ball-burst testing and left intact in the remaining five specimens. The application of tacks had no effect on the tensile strength of Dualmesh, ProLite Ultra, Infinit, Ultrapro, C-QUR Lite (6 in.). Most of the meshes did not exhibit significantly different tensile strengths between removal of tacks and tacks left intact. Exceptions included C-QUR, Prolene, Ultrapro, and Bard Soft Mesh, which were weaker with removal of tacks than with tacks left intact during the test. Damage due to the application of helical titanium tacks also caused increased strain at a stress of 16 N/cm for all the meshes except C-QUR Lite (>6 in.) and Physiomesh. Many of the meshes evaluated in this study exhibited damage in the form of reduced tensile strength and increased extensibility after the application of tacks compared with the corresponding "undamaged" meshes. Meshes with smaller interstices and larger filaments were influenced negatively by the application of helical titanium tacks, whereas mesh designs with larger interstices and smaller filaments tended to maintain their baseline mechanical properties.
Direct measurement of helical cell motion of the spirochete leptospira.
Nakamura, Shuichi; Leshansky, Alexander; Magariyama, Yukio; Namba, Keiichi; Kudo, Seishi
2014-01-07
Leptospira are spirochete bacteria distinguished by a short-pitch coiled body and intracellular flagella. Leptospira cells swim in liquid with an asymmetric morphology of the cell body; the anterior end has a long-pitch spiral shape (S-end) and the posterior end is hook-shaped (H-end). Although the S-end and the coiled cell body called the protoplasmic cylinder are thought to be responsible for propulsion together, most observations on the motion mechanism have remained qualitative. In this study, we analyzed the swimming speed and rotation rate of the S-end, protoplasmic cylinder, and H-end of individual Leptospira cells by one-sided dark-field microscopy. At various viscosities of media containing different concentrations of Ficoll, the rotation rate of the S-end and protoplasmic cylinder showed a clear correlation with the swimming speed, suggesting that these two helical parts play a central role in the motion of Leptospira. In contrast, the H-end rotation rate was unstable and showed much less correlation with the swimming speed. Forces produced by the rotation of the S-end and protoplasmic cylinder showed that these two helical parts contribute to propulsion at nearly equal magnitude. Torque generated by each part, also obtained from experimental motion parameters, indicated that the flagellar motor can generate torque >4000 pN nm, twice as large as that of Escherichia coli. Furthermore, the S-end torque was found to show a markedly larger fluctuation than the protoplasmic cylinder torque, suggesting that the unstable H-end rotation might be mechanically related to changes in the S-end rotation rate for torque balance of the entire cell. Variations in torque at the anterior and posterior ends of the Leptospira cell body could be transmitted from one end to the other through the cell body to coordinate the morphological transformations of the two ends for a rapid change in the swimming direction. Copyright © 2014 Biophysical Society. Published by Elsevier Inc
International Nuclear Information System (INIS)
Toi, K.; Ohdachi, S.; Watanabe, F.
2006-10-01
In a helical divertor configuration of the Large Helical Device (LHD), transport barrier was formed through low to high confinement (L-H) transition in the plasma edge region including ergodic field layer of which region is in the magnetic hill. The plasma stored energy or the averaged bulk plasma beta dia > (derived from diamagnetic measurement) starts to increase just after the transition. In the case that both dia > and line-averaged electron density e > at the transition are relatively high as dia >≥1.5% and e >≥2x10 19 m -3 , the increase is hampered by rapid growth of edge MHD modes and/or small ELM like activities just after the transition. On the other hand, the transition at lower e > (≤1.5x10 19 m -3 ) and dia > (<2%) leads to a continuous increase in the stored energy with a time scale longer than the global energy confinement time, without suffering from these MHD activities near the edge. The ETB typically formed in electron density profile extends into ergodic field layer defined in the vacuum field. The width of ETB is almost independent of the toroidal field strength from 0.5T to 1.5T and is much larger than the poloidal ion gyro-radius. When resonant helical field perturbations are applied to expand a magnetic island size at the rational surface of the rotational transform ι/2π=1 near the edge, the L-H transition is triggered at lower electron density compared with the case without the field perturbations. The application of large helical field perturbations also suppresses edge MHD modes and ELM like activities. (author)
Świerszcz, Iwona; Skurski, Piotr; Simons, Jack
2012-02-23
Ab initio electronic structure calculations were performed on a doubly charged polypeptide model H(+)-Lys(Ala)(19)-CO-CH(NH(2))-CH(2)-SS-CH(2)-(NH(2))CH-CO-(Ala)(19)-Lys-H(+) consisting of a C-terminal protonated Lys followed by a 19-Ala α-helix with a 20th Ala-like unit whose side chain is linked by a disulfide bond to a corresponding Ala-like unit connected to a second 19-Ala α-helix terminated by a second C-terminal-protonated Lys. The Coulomb potentials arising from the two charged Lys residues and dipole potentials arising from the two oppositely directed 72 D dipoles of the α-helices act to stabilize the SS bond's σ* orbital. The Coulomb potentials provide stabilization of 1 eV, while the two large dipoles generate an additional 4 eV. Such stabilization allows the SS σ* orbital to attach an electron and thereby generate disulfide bond cleavage products. Although calculations are performed only on SS bond cleavage, discussion of N-C(α) bond cleavage caused by electron attachment to amide π* orbitals is also presented. The magnitudes of the stabilization energies as well as the fact that they arise from Coulomb and dipole potentials are supported by results on a small model system consisting of a H(3)C-SS-CH(3) molecule with positive and negative fractional point charges to its left and right designed to represent (i) two positive charges ca. 32 Å distant (i.e., the two charged Lys sites of the peptide model) and (ii) two 72 D dipoles (i.e., the two α-helices). Earlier workers suggested that internal dipole forces in polypeptides could act to guide incoming free electrons (i.e., in electron capture dissociation (ECD)) toward the positive end of the dipole and thus affect the branching ratios for cleaving various bonds. Those workers argued that, because of the huge mass difference between an anion donor and a free electron, internal dipole forces would have a far smaller influence over the trajectory of a donor (i.e., in electron transfer dissociation
Molecular Dynamics Simulation of Cholera Toxin A-1 Polypeptide
Directory of Open Access Journals (Sweden)
Badshah Syed Lal
2016-01-01
Full Text Available A molecular dynamics (MD simulation study of the enzymatic portion of cholera toxin; cholera toxin A-1 polypeptide (CTA1 was performed at 283, 310 and 323 K. From total energy analysis it was observed that this toxin is stable thermodynamically and these outcomes were likewise confirmed by root mean square deviations (RMSD investigations. The Cα root mean square fluctuation (RMSF examinations revealed that there are a number of residues inside CTA1, which can be used as target for designing and synthesizing inhibitory drugs, in order to inactivate cholera toxin inside the human body. The fluctuations in the radius of gyration and hydrogen bonding in CTA1 proved that protein unfolding and refolding were normal routine phenomena in its structure at all temperatures. Solvent accessible surface area study identified the hydrophilic nature of the CTA1, and due to this property it can be a potential biological weapon. The structural identification (STRIDE algorithm for proteins was successfully used to determine the partially disordered secondary structure of CTA1. On account of this partially disordered secondary structure, it can easily deceive the proteolytic enzymes of the endoplasmic reticulum of host cells.
Vasoactive intestinal polypeptide (VIP) innervation of the human eyelid glands.
Seifert, P; Spitznas, M
1999-06-01
This study was conducted to obtain morphological proof of innervating nerve fibres in the glands of the human eyelid (accessory lacrimal glands of Wolfring, meibomian glands, goblet cells, glands of Zeis, glands of Moll, sweat glands, glands of lanugo hair follicles) and identification of the secretomotorically active neuropeptide vasoactive intestinal polypeptide (VIP) as a common transmitter. Epoxy-embedded ultrathin sections of tissue samples from human eyelids were studied using electron microscopy. Paraffin sections fixed in Bouin-Hollande solution were immunostained with rabbit antiserum against VIP. With the electron microscope we were able to identify nerves in the glandular stroma of all the glands examined with the exception of goblet cells. Intraepithelial single axons were only seen in the parenchyma of Wolfring glands. The morphological findings corresponded with the immunological finding of VIP-positive, nerve-like structures in the same locations, with the exception of lanugo hair follicle glands, and goblet cells. Our findings indicate that the glands of the eyelids and main lacrimal gland represent a functional unit with VIP as a possible common stimulating factor. Copyright 1999 Academic Press.
Bovine pancreatic polypeptide as an antagonist of muscarinic cholinergic receptors
International Nuclear Information System (INIS)
Pan, G.Z.; Lu, L.; Qian, J.; Xue, B.G.
1987-01-01
In dispersed acini from rat pancreas, it was found that bovine pancreatic polypeptide (BPP) and its C-fragment hexapeptide amide (PP-6), at concentrations of 0.1 and 30 μM, respectively, could significantly inhibit amylase secretion stimulated by carbachol, and this inhibition by BPP was dose dependent. 45 Ca outflux induced by carbachol was also inhibited by BPP or PP-6, but they had no effect on cholecystokinin octapeptide- (CCK-8) or A23187-stimulated 45 Ca outflux. BPP was also capable of displacing the specific binding of [ 3 H]-quinuclidinyl benzilate to its receptors, and it possessed a higher affinity (K/sub i/35nM) than carbachol (K/sub i/ 1.8 μM) in binding with M-receptors. It is concluded from this study that BPP acts as an antagonist of muscarinic cholinergic receptors in rat pancreatic acini. In addition, BPP inhibited the potentiation of amylase secretion caused by the combination of carbachol plus secretin or vasoactive intestinal peptide. This may be a possible explanation of the inhibitory effect of BPP on secretin-induced pancreatic enzyme secretion shown in vivo, since pancreatic enzyme secretion stimulated by secretin under experimental conditions may be the result of potentiation of enzyme release produced by the peptide in combination with a cholinergic stimulant
Intestinal mucosa is a target tissue for pancreatic polypeptide
International Nuclear Information System (INIS)
Gilbert, W.R.; Kramer, J.L.; Frank, B.H.; Gingerich, R.L.
1986-01-01
Studies were carried out to identify mammalian tissues capable of specifically binding mammalian pancreatic polypeptide (PP). Bovine PP (bPP) radiolabeled with 125 I was purified by HPLC to yield [ 125 I]iodo-(Tyr-27) bPP. The label was injected into three pairs of fasted littermate dogs and allowed to circulate for 5 min. One of the dogs was a control which received an excess of unlabeled porcine PP to provide competition for receptor binding. Unbound bPP was removed by perfusion with Krebs-Ringer bicarbonate and the tissue fixed in situ with Karnovsky's fixative. Tissue samples from various organs were removed, weighed, and counted. The entire gastrointestinal tract demonstrated high levels of 125 I after injection of the labeled peptide. The duodenum, jejunum, ileum, and colon were the only tissues to exhibit specific binding of bPP. These tissues (mucosal and muscle layers) from experimental animals exhibited 31-76% higher binding than the corresponding tissues from the control animals. Sections of the gastrointestinal tract were scraped to separate the mucosal layer from the underlying muscle layer. The mucosal layer of the duodenum, jejunum, and ileum exhibited 145-162% increases in binding compared to the control animals. The muscle layer of these tissues demonstrated no significant increase. These findings demonstrate that mucosal layer of the small intestine is a target tissue for mammalian PP
Star-Shaped Polypeptides: Synthesis and Opportunities for Delivery of Therapeutics.
Byrne, Mark; Murphy, Robert; Kapetanakis, Antonios; Ramsey, Joanne; Cryan, Sally-Ann; Heise, Andreas
2015-09-17
Significant advances in the synthesis of polypeptides by N-carboxyanhydride (NCA) polymerisation over the last decade have enabled the design of advanced polypeptide architectures such as star-shaped polypeptides. These materials combine the functionality offered by amino acids with the flexibility of creating stable nanoparticles with adjustable cargo space for therapeutic delivery. This review highlights recent advances in the synthesis of star polypeptides by NCA polymerisation followed by a critical review of the applications of this class of polymer in the delivery of therapeutic agents. This includes examples of traditional small-molecule drugs as well as the emerging class of biologics such as genetic therapeutics (gene delivery). © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Simultaneous Polymerization and Polypeptide Particle Production via Reactive Spray-Drying.
Glavas, Lidija; Odelius, Karin; Albertsson, Ann-Christine
2016-09-12
A method for producing polypeptide particles via in situ polymerization of N-carboxyanhydrides during spray-drying has been developed. This method was enabled by the development of a fast and robust synthetic pathway to polypeptides using 1,8-diazabicyclo[5.4.0]undec-7-ene (DBU) as an initiator for the ring-opening polymerization of N-carboxyanhydrides. The polymerizations finished within 5 s and proved to be very tolerant toward impurities such as amino acid salts and water. The formed particles were prepared by mixing the monomer, N-carboxyanhydride of l-glutamic acid benzyl ester (NCAGlu) and the initiator (DBU) during the atomization process in the spray-dryer and were spherical with a size of ∼1 μm. This method combines two steps; making it a straightforward process that facilitates the production of polypeptide particles. Hence, it furthers the use of spray-drying and polypeptide particles in the pharmaceutical industry.
DEFF Research Database (Denmark)
Wang, Yin-Qiu; Qian, Ya-Ping; Yang, Su
2005-01-01
Pituitary adenylate cyclase-activating polypeptide (PACAP) is a neuropeptide abundantly expressed in the central nervous system and involved in regulating neurogenesis and neuronal signal transduction. The amino acid sequence of PACAP is extremely conserved across vertebrate species, indicating a...
Induction of protein body formation in plant leaves by elastin-like polypeptide fusions
Directory of Open Access Journals (Sweden)
Joensuu Jussi J
2009-08-01
Full Text Available Abstract Background Elastin-like polypeptides are synthetic biopolymers composed of a repeating pentapeptide 'VPGXG' sequence that are valuable for the simple non-chromatographic purification of recombinant proteins. In addition, elastin-like polypeptide fusions have been shown to enhance the accumulation of a range of different recombinant proteins in plants, thus addressing the major limitation of plant-based expression systems, which is a low production yield. This study's main objectives were to determine the general utility of elastin-like polypeptide protein fusions in various intracellular compartments and to elucidate elastin-like polypeptide's mechanism of action for increasing recombinant protein accumulation in the endoplasmic reticulum of plants. Results The effect of elastin-like polypeptide fusions on the accumulation of green fluorescent protein targeted to the cytoplasm, chloroplasts, apoplast, and endoplasmic reticulum was evaluated. The endoplasmic reticulum was the only intracellular compartment in which an elastin-like polypeptide tag was shown to significantly enhance recombinant protein accumulation. Interestingly, endoplasmic reticulum-targeted elastin-like polypeptide fusions induced the formation of a novel type of protein body, which may be responsible for elastin-like polypeptide's positive effect on recombinant protein accumulation by excluding the heterologous protein from normal physiological turnover. Although expressed in the leaves of plants, these novel protein bodies appeared similar in size and morphology to the prolamin-based protein bodies naturally found in plant seeds. The elastin-like polypeptide-induced protein bodies were highly mobile organelles, exhibiting various dynamic patterns of movement throughout the cells, which were dependent on intact actin microfilaments and a functional actomyosin motility system. Conclusion An endoplasmic reticulum-targeted elastin-like polypeptide fusion approach
General architecture of the alpha-helical globule.
Murzin, A G; Finkelstein, A V
1988-12-05
A model is presented for the arrangement of alpha-helices in globular proteins. In the model, helices are placed on certain ribs of "quasi-spherical" polyhedra. The polyhedra are chosen so as to allow the close packing of helices around a hydrophobic core and to stress the collective interactions of the individual helices. The model predicts a small set of stable architectures for alpha-helices in globular proteins and describes the geometries of the helix packings. Some of the predicted helix arrangements have already been observed in known protein structures; others are new. An analysis of the three-dimensional structures of all proteins for which co-ordinates are available shows that the model closely approximates the arrangements and packing of helices actually observed. The average deviations of the real helix axes from those in the model polyhedra is +/- 20 degrees in orientation and +/- 2 A in position (1 A = 0.1 nm). We also show that for proteins that are not homologous, but whose helix arrangements are described by the same polyhedron, the root-mean-square difference in the position of the C alpha atoms in the helices is 1.6 to 3.0 A.
MAGNETIC HELICITY FLUX IN THE PRESENCE OF SHEAR
International Nuclear Information System (INIS)
Hubbard, Alexander; Brandenburg, Axel
2011-01-01
Magnetic helicity has risen to be a major player in dynamo theory, with the helicity of the small-scale field being linked to the dynamo saturation process for the large-scale field. It is a nearly conserved quantity, which allows its evolution equation to be written in terms of production and flux terms. The flux term can be decomposed in a variety of fashions. One particular contribution that has been expected to play a significant role in dynamos in the presence of mean shear was isolated by Vishniac and Cho. Magnetic helicity fluxes are explicitly gauge dependent however, and the correlations that have come to be called the Vishniac-Cho flux were determined in the Coulomb gauge, which turns out to be fraught with complications in shearing systems. While the fluxes of small-scale helicity are explicitly gauge dependent, their divergences can be gauge independent. We use this property to investigate magnetic helicity fluxes of the small-scale field through direct numerical simulations in a shearing-box system and find that in a numerically usable gauge the divergence of the small-scale helicity flux vanishes, while the divergence of the Vishniac-Cho flux remains finite. We attribute this seeming contradiction to the existence of horizontal fluxes of small-scale magnetic helicity with finite divergences.
Magnetic Helicity Flux in the Presence of Shear
Hubbard, Alexander; Brandenburg, Axel
2011-01-01
Magnetic helicity has risen to be a major player in dynamo theory, with the helicity of the small-scale field being linked to the dynamo saturation process for the large-scale field. It is a nearly conserved quantity, which allows its evolution equation to be written in terms of production and flux terms. The flux term can be decomposed in a variety of fashions. One particular contribution that has been expected to play a significant role in dynamos in the presence of mean shear was isolated by Vishniac & Cho. Magnetic helicity fluxes are explicitly gauge dependent however, and the correlations that have come to be called the Vishniac-Cho flux were determined in the Coulomb gauge, which turns out to be fraught with complications in shearing systems. While the fluxes of small-scale helicity are explicitly gauge dependent, their divergences can be gauge independent. We use this property to investigate magnetic helicity fluxes of the small-scale field through direct numerical simulations in a shearing-box system and find that in a numerically usable gauge the divergence of the small-scale helicity flux vanishes, while the divergence of the Vishniac-Cho flux remains finite. We attribute this seeming contradiction to the existence of horizontal fluxes of small-scale magnetic helicity with finite divergences.
Magnetic Helicities and Dynamo Action in Magneto-rotational Turbulence
Energy Technology Data Exchange (ETDEWEB)
Bodo, G.; Rossi, P. [INAF/Osservatorio Astrofisico di Torino, Strada Osservatorio 20, I-10025 Pino Torinese (Italy); Cattaneo, F. [Department of Astronomy and Astrophysics, The University of Chicago, 5640 S. Ellis Avenue, Chicago IL 60637 (United States); Mignone, A., E-mail: bodo@oato.inaf.it [Dipartimento di Fisica, Università degli Studi di Torino, Via Pietro Giuria 1, 10125 Torino (Italy)
2017-07-10
We examine the relationship between magnetic flux generation, taken as an indicator of large-scale dynamo action, and magnetic helicity, computed as an integral over the dynamo volume, in a simple dynamo. We consider dynamo action driven by magneto-rotational turbulence (MRT) within the shearing-box approximation. We consider magnetically open boundary conditions that allow a flux of helicity in or out of the computational domain. We circumvent the problem of the lack of gauge invariance in open domains by choosing a particular gauge—the winding gauge—that provides a natural interpretation in terms of the average winding number of pairwise field lines. We use this gauge precisely to define and measure the helicity and the helicity flux for several realizations of dynamo action. We find in these cases that the system as a whole does not break reflectional symmetry and that the total helicity remains small even in cases when substantial magnetic flux is generated. We find no particular connection between the generation of magnetic flux and the helicity or the helicity flux through the boundaries. We suggest that this result may be due to the essentially nonlinear nature of the dynamo processes in MRT.
α-Helix Unwinding as Force Buffer in Spectrins.
Takahashi, Hirohide; Rico, Felix; Chipot, Christophe; Scheuring, Simon
2018-03-27
Spectrins are cytoskeletal proteins located at the inner face of the plasma membrane, making connections between membrane anchors and the actin cortex, and between actin filaments. Spectrins share a common structure forming a bundle of 3 α-helices and play a major role during cell deformation. Here, we used high-speed force spectroscopy and steered molecular dynamics simulations to understand the mechanical stability of spectrin, revealing a molecular force buffering function. We find that spectrin acts as a soft spring at short extensions (70-100 Å). Under continuous external stretching, its α-helices unwind, leading to a viscous mechanical response over larger extensions (100-300 Å), represented by a constant-force plateau in force/extension curves. This viscous force buffering emerges from a quasi-equilibrium competition between disruption and re-formation of α-helical hydrogen bonds. Our results suggest that, in contrast to β-sheet proteins, which unfold in a catastrophic event, α-helical spectrins dominantly unwind, providing a viscous force buffer over extensions about 5 times their folded length.
High-n helicity-induced shear Alfven eigenmodes
International Nuclear Information System (INIS)
Nakajima, N.; Cheng, C.Z.; Okamoto, M.
1992-05-01
The high-n Helicity-induced shear Alfven Eigenmodes (HAE) are considered both analytically and numerically for the straight helical magnetic system, where n is the toroidal mode number. The eigenmode equation for the high-n HAE modes is derived along the field line and with the aid of the averaging method is shown to reduce to the Mathieu equation asymptotically. The discrete HAE modes are shown to exist inside the continuum spectrum gaps. The continuous spectrum gaps appear around ω 2 = ω A 2 [N(lι-m)/2] 2 for N = 1,2,.., where ω A is the toroidal Alfven transit frequency, and l, m, and ι are the polarity of helical coils, the toroidal pitch number of helical coils, and the rotational transform, respectively. For the same ω A and ι, the frequency of the helical continuum gap is larger than that of the continuum gap in tokamak plasmas by |l-ι -1 m|. The polarity of helical coils l plays a crucial role in determining the spectrum gaps and the properties of the high-n HAE modes. The spectrum gaps near the magnetic axis are created by the helical ripple with circular flux surfaces for l = 1, and ≥ 3 helicals. For l = 2 helical systems, the spectrum gaps are created by the ellipticity of the flux surfaces. These analytical results for the continuum gaps and the existence of the high-n HAE modes in the continuum gaps are confirmed numerically for the l = 2 case, and we find that the HAE modes exist for mode structures with the even and the odd parities. (author)
A de novo designed 11 kDa polypeptide: model for amyloidogenic intrinsically disordered proteins.
Topilina, Natalya I; Ermolenkov, Vladimir V; Sikirzhytski, Vitali; Higashiya, Seiichiro; Lednev, Igor K; Welch, John T
2010-07-01
A de novo polypeptide GH(6)[(GA)(3)GY(GA)(3)GE](8)GAH(6) (YE8) has a significant number of identical weakly interacting beta-strands with the turns and termini functionalized by charged amino acids to control polypeptide folding and aggregation. YE8 exists in a soluble, disordered form at neutral pH but is responsive to changes in pH and ionic strength. The evolution of YE8 secondary structure has been successfully quantified during all stages of polypeptide fibrillation by deep UV resonance Raman (DUVRR) spectroscopy combined with other morphological, structural, spectral, and tinctorial characterization. The YE8 folding kinetics at pH 3.5 are strongly dependent on polypeptide concentration with a lag phase that can be eliminated by seeding with a solution of folded fibrillar YE8. The lag phase of polypeptide folding is concentration dependent leading to the conclusion that beta-sheet folding of the 11-kDa amyloidogenic polypeptide is completely aggregation driven.
Radiation Field of a Square, Helical Beam Antenna
DEFF Research Database (Denmark)
Knudsen, Hans Lottrup
1952-01-01
square helices are used. Further, in connection with corresponding rigorous formulas for the field from a circular, helical antenna with a uniformly progressing current wave of constant amplitude the present formulas may be used for an investigation of the magnitude of the error introduced in Kraus......' approximate calculation of the field from a circular, helical antenna by replacing this antenna with an ``equivalent'' square helix. This investigation is carried out by means of a numerical example. The investigation shows that Kraus' approximate method of calculation yields results in fair agreement...
Theoretical modeling of transport barriers in helical plasmas
International Nuclear Information System (INIS)
Toda, S.; Itoh, K.; Ohyabu, N.
2008-10-01
A unified transport modelling to explain electron Internal Transport Barriers (e-ITB) in helical plasmas and Internal Diffusion Barriers (IDB) observed in Large Helical Device (LHD) is proposed. The e-ITB can be predicted with the effect of zonal flows to obtain the e-ITB in the low collisional regime when the radial variation of the particle anomalous diffusivity is included. Transport analysis in this article can newly show that the particle fuelling induces the IDB formation when this unified transport modelling is used in the high collisional regime. The density limit for the IDB in helical plasmas is also examined including the effect of the radiation loss. (author)
Drift mode calculations for the Large Helical Device
International Nuclear Information System (INIS)
Rewoldt, G.; Ku, L.-P.; Tang, W.M.; Sugama, H.; Nakajima, N.; Watanabe, K.Y.; Murakami, S.; Yamada, H.; Cooper, W.A.
2000-01-01
A fully kinetic assessment of the stability properties of toroidal drift modes has been obtained for a case for the Large Helical Device (LHD) [A.Iiyoshi, et al., Plasma Physics and Controlled Nuclear Fusion Research, 1998, Nucl.Fusion 39, 1245 (1999)]. This calculation retains the important effects in the linearized gyrokinetic equation, using the lowest-order ''ballooning representation'' for high toroidal mode number instabilities in the electrostatic limit. Results for toroidal drift waves destabilized by trapped particle dynamics and ion temperature gradients are presented, using three-dimensional magnetohydrodynamics equilibria reconstructed from experimental measurements. The effects of helically-trapped particles and helical curvature are investigated
Experimental Evidence of Helical Flow in Porous Media
DEFF Research Database (Denmark)
Ye, Yu; Chiogna, Gabriele; Cirpka, Olaf A.
2015-01-01
Helical flow leads to deformation of solute plumes and enhances transverse mixing in porous media. We present experiments in which macroscopic helical flow is created by arranging different materials to obtain an anisotropic macroscopic permeability tensor with spatially variable orientation....... The resulting helical flow entails twisting streamlines which cause a significant increase in lateral mass exchange and thus a large enhancement of plume dilution (up to 235%) compared to transport in homogenous media. The setup may be used to effectively mix solutes in parallel streams similarly to static...... mixers, but in porous media....
Linear local stability of electrostatic drift modes in helical systems
International Nuclear Information System (INIS)
Yamagishi, O.; Nakajima, N.; Sugama, H.; Nakamura, Y.
2003-01-01
We investigate the stability of the drift wave in helical systems. For this purpose, we solve the linear local gyrokinetic-Poisson equation, in the electrostatic regime. As a model of helical plasmas, Large helical Device (LHD) is considered. The equation we apply is rather exact in the framework of linear gyrokinetic theory, where only the approximation is the ballooning representation. In this paper, we consider only collisionless cases. All the frequency regime can be naturally reated without any assumptions, and in such cases, ion temperature gradient modes (ITG), trapped electron modes (TEM), and electron temperature gradient modes (ETG) are expected to become unstable linearly independently. (orig.)
Magnetic Helical Micro- and Nanorobots: Toward Their Biomedical Applications
Directory of Open Access Journals (Sweden)
Famin Qiu
2015-03-01
Full Text Available Magnetic helical micro- and nanorobots can perform 3D navigation in various liquids with a sub-micrometer precision under low-strength rotating magnetic fields (<10 mT. Since magnetic fields with low strengths are harmless to cells and tissues, magnetic helical micro/nanorobots are promising tools for biomedical applications, such as minimally invasive surgery, cell manipulation and analysis, and targeted therapy. This review provides general information on magnetic helical micro/nanorobots, including their fabrication, motion control, and further functionalization for biomedical applications.
Andrzejczyk, Rafał; Muszyński, Tomasz
2016-12-01
The shell and coil heat exchangers are commonly used in heating, ventilation, nuclear industry, process plant, heat recovery and air conditioning systems. This type of recuperators benefits from simple construction, the low value of pressure drops and high heat transfer. In helical coil, centrifugal force is acting on the moving fluid due to the curvature of the tube results in the development. It has been long recognized that the heat transfer in the helical tube is much better than in the straight ones because of the occurrence of secondary flow in planes normal to the main flow inside the helical structure. Helical tubes show good performance in heat transfer enhancement, while the uniform curvature of spiral structure is inconvenient in pipe installation in heat exchangers. Authors have presented their own construction of shell and tube heat exchanger with intensified heat transfer. The purpose of this article is to assess the influence of the surface modification over the performance coefficient and effectiveness. The experiments have been performed for the steady-state heat transfer. Experimental data points were gathered for both laminar and turbulent flow, both for co current- and countercurrent flow arrangement. To find optimal heat transfer intensification on the shell-side authors applied the number of transfer units analysis.
Organic anion transporting polypeptide 1B transporters modulate hydroxyurea pharmacokinetics.
Walker, Aisha L; Lancaster, Cynthia S; Finkelstein, David; Ware, Russell E; Sparreboom, Alex
2013-12-15
Hydroxyurea is currently the only FDA-approved drug that ameliorates the pathophysiology of sickle cell anemia. Unfortunately, substantial interpatient variability in the pharmacokinetics (PK) of hydroxyurea may result in variation of the drug's efficacy. However, little is known about mechanisms that modulate hydroxyurea PK. Recent in vitro studies identifying hydroxyurea as a substrate for organic anion transporting polypeptide (OATP1B) transporters prompted the current investigation assessing the role of OATP1B transporters in modulating hydroxyurea PK. Using wild-type and Oatp1b knockout (Oatp1b(-/-)) mice, hydroxyurea PK was analyzed in vivo by measuring [(14)C]hydroxyurea distribution in plasma, kidney, liver, urine, or the exhaled (14)CO2 metabolite. Plasma levels were significantly reduced by 20% in Oatp1b(-/-) mice compared with wild-type (area under the curve of 38.64 or 48.45 μg·h(-1)·ml(-1), respectively) after oral administration, whereas no difference was observed between groups following intravenous administration. Accumulation in the kidney was significantly decreased by twofold in Oatp1b(-/-) mice (356.9 vs. 748.1 pmol/g), which correlated with a significant decrease in urinary excretion. Hydroxyurea accumulation in the liver was also decreased (136.6 vs. 107.3 pmol/g in wild-type or Oatp1b(-/-) mice, respectively) correlating with a decrease in exhaled (14)CO2. These findings illustrate that deficiency of Oatp1b transporters alters the absorption, distribution, and elimination of hydroxyurea thus providing the first in vivo evidence that cell membrane transporters may play a significant role in modulating hydroxyurea PK. Future studies to investigate other transporters and their role in hydroxyurea disposition are warranted for understanding the sources of variation in hydroxyurea's PK.
Quantifying polypeptide conformational space: sensitivity to conformation and ensemble definition.
Sullivan, David C; Lim, Carmay
2006-08-24
Quantifying the density of conformations over phase space (the conformational distribution) is needed to model important macromolecular processes such as protein folding. In this work, we quantify the conformational distribution for a simple polypeptide (N-mer polyalanine) using the cumulative distribution function (CDF), which gives the probability that two randomly selected conformations are separated by less than a "conformational" distance and whose inverse gives conformation counts as a function of conformational radius. An important finding is that the conformation counts obtained by the CDF inverse depend critically on the assignment of a conformation's distance span and the ensemble (e.g., unfolded state model): varying ensemble and conformation definition (1 --> 2 A) varies the CDF-based conformation counts for Ala(50) from 10(11) to 10(69). In particular, relatively short molecular dynamics (MD) relaxation of Ala(50)'s random-walk ensemble reduces the number of conformers from 10(55) to 10(14) (using a 1 A root-mean-square-deviation radius conformation definition) pointing to potential disconnections in comparing the results from simplified models of unfolded proteins with those from all-atom MD simulations. Explicit waters are found to roughen the landscape considerably. Under some common conformation definitions, the results herein provide (i) an upper limit to the number of accessible conformations that compose unfolded states of proteins, (ii) the optimal clustering radius/conformation radius for counting conformations for a given energy and solvent model, (iii) a means of comparing various studies, and (iv) an assessment of the applicability of random search in protein folding.
International Nuclear Information System (INIS)
Sutton, C.
1989-01-01
Inside the atom, particles interact through two forces which are never felt in the everyday world. But they may hold the key to the Universe. These ideas on subatomic forces are discussed with respect to the strong force, the electromagnetic force and the electroweak force. (author)
Jana, Asis K; Tiwari, Mrityunjay K; Vanka, Kumar; Sengupta, Neelanjana
2016-02-17
Emerging nanotechnology has rapidly broadened interfacial prospects of biological molecules with carbon nanomaterials (CNs). A prerequisite for effectively harnessing such hybrid materials is a multi-faceted understanding of their complex interfacial interactions as functions of the physico-chemical characteristics and the surface topography of the individual components. In this article, we address the origins of the curvature dependence of polypeptide adsorption on CN surfaces (CNSs), a phenomenon bearing an acute influence upon the behavior and activity of CN-protein conjugates. Our benchmark molecular dynamics (MD) simulations with the amphiphilic full-length amyloid beta (Aβ) peptide demonstrate that protein adsorption is strongest on the concave (inner) CN surface, weakest on the convex (outer) surface, and intermediary on the planar surface, in agreement with recent experimental reports. The curvature effects, however, are found to manifest non-uniformly between the amino acid subtypes. To understand the underlying interplay of the chemical nature of the amino acids and surface topography of the CNs, we performed high-level quantum chemical (QM) calculations with amino acid analogs (AAA) representing their five prominent classes, and convex, concave and planar CN fragments. Molecular electrostatic potential maps reveal pronounced curvature dependence in the mixing of electron densities, and a resulting variance in the stabilization of the non-covalently bound molecular complexes. Interestingly, our study revealed that the interaction trends of the high-level QM calculations were captured well by the empirical force field. The findings in this study have important bearing upon the design of carbon based bio-nanomaterials, and additionally, provide valuable insights into the accuracy of various computational techniques for probing non-bonded interfacial interactions.
Design study of a normal conducting helical snake for AGS
Takano, Junpei; Okamura, Masahiro; Roser, Thomas; MacKay, William W; Luccio, Alfredo U; Takano, Koji
2004-01-01
A new normal conducting snake magnet is being fabricated for the Alternate Gradient Synchrotron (AGS) at Brookhaven National Laboratory (BNL). In the Relativistic Heavy Ion Collider (RHIC) project, a superconducting type helical dipole magnets had been developed and it performed successfully in high-energy polarized proton acceleration. The new AGS helical snake has the same basic magnetic structure but is more complicated. To achieve no beam shift and no beam deflection in one magnetic device, helical pitches and rotating angles were carefully calculated. Compared to a superconducting magnet, a normal warm magnet must have a large cross- sectional area of conductors which make it difficult to design a magnet with large helical pitch. We developed a modified window frame structure to accommodate the large number of conductors. Its three dimensional magnetic field was simulated by using OPERA3D/TOSCA. 3 Refs.
A 3D printed helical antenna with integrated lens
Farooqui, Muhammad Fahad; Shamim, Atif
2015-01-01
A novel antenna configuration comprising a helical antenna with an integrated lens is demonstrated in this work. The antenna is manufactured by a unique combination of 3D printing of plastic material (ABS) and inkjet printing of silver nano
Particle orbit analysis for LHD helical axis configurations
International Nuclear Information System (INIS)
Guasp, J.; Yamazaki, K.; Motojima, O.
1993-04-01
Fast ion orbits for helical magnetic axis configurations in LHD (Large Helical Device) are analyzed and compared with the standard circular axis case. Boundaries between passing and helically trapped particle regions show clear differences: in the non-planar axis case the helically trapped region spreads, near the magnetic axis, over a much wider band across the 90deg pitch angle value and shows a very marked asymmetry. The locally trapped particle region is also wider than in the standard case. The differences in the loss cone boundaries of the two cases are rather small, however, the effects of re-entering criteria are very important in both cases. On the contrary, effects of finite coil size are not significant. (author)
Metallic and 3D-printed dielectric helical terahertz waveguides.
Vogt, Dominik Walter; Anthony, Jessienta; Leonhardt, Rainer
2015-12-28
We investigate guidance of Terahertz (THz) radiation in metallic and 3D-printed dielectric helical waveguides in the frequency range from 0.2 to 1 THz. Our experimental results obtained from THz time-domain spectroscopy (THz-TDS) measurements are in very good agreement with finite-difference time-domain (FDTD) simulations. We observe single-mode, low loss and low dispersive propagation of THz radiation in metallic helical waveguides over a broad bandwidth. The 3D-printed dielectric helical waveguides have substantially extended the bandwidth of a low loss dielectric tube waveguide as observed from the experimental and simulation results. The high flexibility of the helical design allows an easy incorporation into bench top THz devices.
Helical-axis stellarators with noninterlocking planar coils
International Nuclear Information System (INIS)
Reiman, A.; Boozer, A.
1983-08-01
The properties of helical axis stellarator fields generated by unlinked, planar coils are described. It is shown that such fields can have a magnetic well and large rotational transform, implying large equilibrium and stability beta limits
Helical-axis stellarators with noninterlocking planar coils
Energy Technology Data Exchange (ETDEWEB)
Reiman, A.; Boozer, A.
1983-08-01
The properties of helical axis stellarator fields generated by unlinked, planar coils are described. It is shown that such fields can have a magnetic well and large rotational transform, implying large equilibrium and stability beta limits.
Energy and helicity of magnetic torus knots and braids
Oberti, Chiara; Ricca, Renzo L.
2018-02-01
By considering steady magnetic fields in the shape of torus knots and unknots in ideal magnetohydrodynamics, we compute some fundamental geometric and physical properties to provide estimates for magnetic energy and helicity. By making use of an appropriate parametrization, we show that knots with dominant toroidal coils that are a good model for solar coronal loops have negligible total torsion contribution to magnetic helicity while writhing number provides a good proxy. Hence, by the algebraic definition of writhe based on crossing numbers, we show that the estimated values of writhe based on image analysis provide reliable information for the exact values of helicity. We also show that magnetic energy is linearly related to helicity, and the effect of the confinement of magnetic field can be expressed in terms of geometric information. These results can find useful application in solar and plasma physics, where braided structures are often present.
Investigation into the heat transfer performance of helically ribbed surfaces
International Nuclear Information System (INIS)
Firth, R.J.
1981-12-01
The first part of an investigation into flow and heat transfer in annular channels and seven pin clusters is described. One of the main aims of the project is to improve cluster heat transfer prediction codes for helically ribbed surfaces. A study is made of the heat transfer and flow characteristics of a helically ribbed pin in an annular channel. It is shown that the swirling flow, which is induced by the helical ribs, gives rise to substantially enhanced diffusivity levels. This phenomenon had not been taken into account by previous analysis techniques. The methods for analysing heat transfer and pressure drop data from annular channels which were originally developed for non-swirling flow are generalised to accommodate swirling flow. The new methods are shown to be consistent with empirical data. Roughness parameter data is presented for helically ribbed surfaces with an axial rib pitch into height ratio of about 7. (author)
Interaction of 18-residue peptides derived from amphipathic helical ...
Indian Academy of Sciences (India)
Madhsudhan
interaction of proteins and peptides with membranes (Segrest ... favour surface activity have been described by Eisenberg et ... amphipathicity and propensity for α-helical conformation ..... Membrane destabilisation occurs due to electrostatic.
Energy fluxes in helical magnetohydrodynamics and dynamo action
Indian Academy of Sciences (India)
Kinetic and magnetic helicities do not affect the renormalized parameters, ... Generation of magnetic field in plasma, usually referred to as 'dynamo', is one of the ..... energy fluxes for the inertial-range wave numbers where the same power.
The Pressure and Magnetic Flux Density Analysis of Helical-Type DC Electromagnetic Pump
International Nuclear Information System (INIS)
Lee, Geun Hyeong; Kim, Hee Reyoung
2016-01-01
The developed pressure was made by only electromagnetic force eliminating probability of impurities contact, therefore the high reactivity materials such as alkali were best match to electromagnetic pump. The heavy ion accelerator facility by Rare Isotope Science Project (RISP) in Korea is trying to construct accelerator using liquid lithium for high efficiency of acceleration by decreasing charge state. The helical-type DC electromagnetic pump was employed to make a charge stripper that decrease charge state of heavy ion. The specification of electromagnetic pump was developed pressure of 15 bar with flowrate of 6 cc/s in the condition of 200℃. The pressure of DC electromagnetic pump was analyzed in the aspects of current and number of duct turns. The developed pressure was almost proportional to input current because relatively low flowrate made negligible of the electromotive force and hydraulic pressure drop. The pressure and magnetic flux density of helical-type DC electromagnetic pump were analyzed. The pressure was proportion to input current and number of duct turns, and magnetic flux density was higher when ferromagnet was applied at electromagnetic pump. It seems that number of duct turns could be increase and ferromagnet could be applied in order to increase pressure of DC electromagnetic pump with constant input current
Helical beating of an actuated elastic filament
International Nuclear Information System (INIS)
Coq, Nais; Roure, Olivia du; Fermigier, Marc; Bartolo, Denis
2009-01-01
We investigate the propulsive force resulting from the rotation of a flexible filament in the low Reynolds number regime. Using a simple linear model, we establish the nonlinear torque-force relations for two torque-driven actuation modes. When the rotation of the filament is induced by two perpendicular transverse oscillating torques, the propulsive force increases monotonically with the torque amplitude. Conversely, when a constant axial torque is applied, the torque-force characteristics displays an unstable branch, related to a discontinuous transition in the shape of the filament. We characterize this shape transition using two geometrical parameters, quantifying the wrapping around and the collapse on the axis of the filament. The proposed theoretical description correctly accounts for our experimental observations and reveals a strong dependence of the filament dynamics on the anchoring conditions.
Acute pulmonary embolism in helical computed tomography
International Nuclear Information System (INIS)
Paslawski, M.
2005-01-01
Pulmonary embolism is a common condition in which diagnostic and therapeutic delays contribute to substantial morbidity and mortality. Clinical diagnosis is difficult because the signs and symptoms re unspecific, and a differential diagnosis is extensive, including pneumonia or bronchitis, asthma, myocardial infraction, pulmonary edema, anxiety, dissection of the aorta, pericardial tamponade, lung cancer, primary pulmonary hypertension, rib fracture, and pneumothorax. The purpose of the study was to present the use of CT in diagnosing acute pulmonary embolism. A group of 23 patients with clinically suspected pulmonary embolism underwent CT examination with a helical CT scanner (Somatom Emotion, Siemens) before and after administration of 150 ml of Ultravist. Pulmonary embolism was found in the CT examinations of 13 patients. In two of these it was a central filling defect. Amputation of the artery was found in one. Parietal filling defect in three patients formed an acute angle with the vessel walls. Saddle emboli appearing as filling defects in the contrast column that hung over vessel bifurcations was found in two patients. In five patients,emboli were found in small segmental arteries. CT provides information not only on the pulmonary arteries, but also on the lung parenchyma, hila, mediastinum, and the heart. Alternative findings may be identified by CT chest examination, stablishing alternative diagnoses, including pulmonary disorders (such as pneumonia or fibrosis), pleural abnormalities, and cardiovascular disease (such as aortic dissection or pericardial tamponade). Another advantage of the CT is its widespread availability.(author)
Polymer dynamics driven by a helical filament
Balin, Andrew; Shendruk, Tyler; Zoettl, Andreas; Yeomans, Julia
Microbial flagellates typically inhabit complex suspensions of extracellular polymeric material which can impact the swimming speed of motile microbes, filter-feeding of sessile cells, and the generation of biofilms. There is currently a need to better understand how the fundamental dynamics of polymers near active cells or flagella impacts these various phenomena. We study the hydrodynamic and steric influence of a rotating helical filament on suspended polymers using Stokesian Dynamics simulations. Our results show that as a stationary rotating helix pumps fluid along its long axis, nearby polymers migrate radially inwards and are elongated in the process. We observe that the actuation of the helix tends to increase the probability of finding polymeric material within its pervaded volume. At larger Weissenberg numbers, this accumulation of polymers within the vicinity of the helix is greater. Further, we have analysed the stochastic work performed by the helix on the polymers and we show that this quantity is positive on average and increases with polymer contour length. Our results provide a basis for understanding the microscopic interactions that govern cell dynamics in complex media. This work was supported through funding from the ERC Advanced Grant 291234 MiCE and we acknowledge EMBO funding to TNS (ALTF181-2013).
Electronic Band Structure of Helical Polyisocyanides.
Champagne, Benoît; Liégeois, Vincent; Fripiat, Joseph G; Harris, Frank E
2017-10-19
Restricted Hartree-Fock computations are reported for a methyl isocyanide polymer (repeating unit -C═N-CH 3 ), whose most stable conformation is expected to be a helical chain. The computations used a standard contracted Gaussian orbital set at the computational levels STO-3G, 3-21G, 6-31G, and 6-31G**, and studies were made for two line-group configurations motivated by earlier work and by studies of space-filling molecular models: (1) A structure of line-group symmetry L9 5 , containing a 9-fold screw axis with atoms displaced in the axial direction by 5/9 times the lattice constant, and (2) a structure of symmetry L4 1 that had been proposed, containing a 4-fold screw axis with translation by 1/4 of the lattice constant. Full use of the line-group symmetry was employed to cause most of the computational complexity to depend only on the size of the asymmetric repeating unit. Data reported include computed bond properties, atomic charge distribution, longitudinal polarizability, band structure, and the convoluted density of states. Most features of the description were found to be insensitive to the level of computational approximation. The work also illustrates the importance of exploiting line-group symmetry to extend the range of polymer structural problems that can be treated computationally.
Pulmonary artery aneurysm in Bechcet's disease: helical computed tomography study
International Nuclear Information System (INIS)
Munoz, J.; Caballero, P.; Olivera, M. J.; Cajal, M. L.; Caniego, J. L.
2000-01-01
Behcet's disease is a vasculitis of unknown etiology that affects arteries and veins of different sizes and can be associated with pulmonary artery aneurysms. We report the case of a patient with Behcet's disease and a pulmonary artery aneurysm who was studied by means of plain chest X ray, helical computed tomography and pulmonary arteriography. Helical computed tomography is a reliable technique for the diagnosis and follow-up of these patients. (Author) 9 refs
ADDITIVE SELF-HELICITY AS A KINK MODE THRESHOLD
International Nuclear Information System (INIS)
Malanushenko, A.; Longcope, D. W.; Fan, Y.; Gibson, S. E.
2009-01-01
In this paper, we propose that additive self-helicity, introduced by Longcope and Malanushenko, plays a role in the kink instability for complex equilibria, similar to twist helicity for thin flux tubes. We support this hypothesis by a calculation of additive self-helicity of a twisted flux tube from the simulation of Fan and Gibson. As more twist gets introduced, the additive self-helicity increases, and the kink instability of the tube coincides with the drop of additive self-helicity, after the latter reaches the value of H A /Φ 2 ∼ 1.5 (where Φ is the flux of the tube and H A is the additive self-helicity). We compare the additive self-helicity to twist for a thin subportion of the tube to illustrate that H A /Φ 2 is equal to the twist number, studied by Berger and Field, when the thin flux tube approximation is applicable. We suggest that the quantity H A /Φ 2 could be treated as a generalization of a twist number, when the thin flux tube approximation is not applicable. A threshold on a generalized twist number might prove extremely useful studying complex equilibria, just as the twist number itself has proven useful studying idealized thin flux tubes. We explicitly describe a numerical method for calculating additive self-helicity, which includes an algorithm for identifying a domain occupied by a flux bundle and a method of calculating potential magnetic field confined to this domain. We also describe a numerical method to calculate twist of a thin flux tube, using a frame parallelly transported along the axis of the tube.
Design windows and cost analysis on helical reactors
International Nuclear Information System (INIS)
Kozaki, Y.; Imagawa, S.; Sagara, A.
2007-01-01
The LHD type helical reactors are characterized by a large major radius but slender helical coil, which give us different approaches for power plants from tokamak reactors. For searching design windows of helical reactors and discussing their potential as power plants, we have developed a mass-cost estimating model linked with system design code (HeliCos), thorough studying the relationships between major plasma parameters and reactor parameters, and weight of major components. In regard to cost data we have much experience through preparing ITER construction. To compare the weight and cost of magnet systems between tokamak and helical reactors, we broke down magnet systems and cost factors, such as weights of super conducting strands, conduits, support structures, and winding unit costs, through estimating ITER cost data basis. Based on FFHR2m1 deign we considered a typical 3 GWth helical plant (LHD type) with the same magnet size, coil major radius Rc 14 m, magnetic energy 120 GJ, but increasing plasma densities. We evaluated the weight and cost of magnet systems of 3 GWth helical plant, the total magnet weights of 16,000ton and costs of 210 BYen, which are similar values of tokamak reactors (10,200 ton, 110 BYen in ITER 2002 report, and 21,900 ton, 275 BYen in ITER FDR1999). The costs of strands and winding occupy 70% of total magnet costs, and influence entire power plants economics. The design windows analysis and comparative economics studies to optimize the main reactor parameters have been carried out. Economics studies show that it is misunderstanding to consider helical coils are too large and too expensive to achieve power plants. But we should notice that the helical reactor design windows and economics are very sensitive to allowable blanket space (depend on ergodic layer conditions) and diverter configuration for decreasing heat loads. (orig.)
Tokamak startup using point-source dc helicity injection.
Battaglia, D J; Bongard, M W; Fonck, R J; Redd, A J; Sontag, A C
2009-06-05
Startup of a 0.1 MA tokamak plasma is demonstrated on the ultralow aspect ratio Pegasus Toroidal Experiment using three localized, high-current density sources mounted near the outboard midplane. The injected open field current relaxes via helicity-conserving magnetic turbulence into a tokamaklike magnetic topology where the maximum sustained plasma current is determined by helicity balance and the requirements for magnetic relaxation.
Comparison between helical computed tomography angiography and intraoperative findings
Directory of Open Access Journals (Sweden)
Abijit Shetty
2014-01-01
Conclusions: Helical CT is important in delineating the arterial, venous, and ureteral anatomy and can show the important incidental findings. Left renal donors and males have more variations in their renal anatomy. Technically challenging laparoscopic nephrectomy on the multiple-vessel-side donor is possible with the aid of helical CT. The importance of the CT in evaluating donor renal anatomy for a technically challenging laparoscopic donor nephrectomy is commendable.
Scale Dependence of Magnetic Helicity in the Solar Wind
Brandenburg, Axel; Subramanian, Kandaswamy; Balogh, Andre; Goldstein, Melvyn L.
2011-01-01
We determine the magnetic helicity, along with the magnetic energy, at high latitudes using data from the Ulysses mission. The data set spans the time period from 1993 to 1996. The basic assumption of the analysis is that the solar wind is homogeneous. Because the solar wind speed is high, we follow the approach first pioneered by Matthaeus et al. by which, under the assumption of spatial homogeneity, one can use Fourier transforms of the magnetic field time series to construct one-dimensional spectra of the magnetic energy and magnetic helicity under the assumption that the Taylor frozen-in-flow hypothesis is valid. That is a well-satisfied assumption for the data used in this study. The magnetic helicity derives from the skew-symmetric terms of the three-dimensional magnetic correlation tensor, while the symmetric terms of the tensor are used to determine the magnetic energy spectrum. Our results show a sign change of magnetic helicity at wavenumber k approximately equal to 2AU(sup -1) (or frequency nu approximately equal to 2 microHz) at distances below 2.8AU and at k approximately equal to 30AU(sup -1) (or nu approximately equal to 25 microHz) at larger distances. At small scales the magnetic helicity is positive at northern heliographic latitudes and negative at southern latitudes. The positive magnetic helicity at small scales is argued to be the result of turbulent diffusion reversing the sign relative to what is seen at small scales at the solar surface. Furthermore, the magnetic helicity declines toward solar minimum in 1996. The magnetic helicity flux integrated separately over one hemisphere amounts to about 10(sup 45) Mx(sup 2) cycle(sup -1) at large scales and to a three times lower value at smaller scales.
International Nuclear Information System (INIS)
Tsujioka, Katsumi; Ida, Yoshihiro; Ohtsubo, Hironori; Takahashi, Yasukata; Niwa, Masayoshi
2000-01-01
We focused on the time element contained in a single CT image, and devised the concept of a time-sensitivity profile (TSP) describing how the time element is translated into an image. We calculated the data collection time range when the helical pitch is changed in non helical scans, single slice helical scans, and multi slice helical scans. We then calculated the time sensitivity profile (TSP) from the weighting applied when the data collection time range is translated into an image. TSP was also measured for each scanning method using our self-made moving phantom. TSPs obtained from the calculation and the experiments were very close. TSP showed interesting characteristics with each scanning method, especially in the case of multi slice helical scanning, in which TSP became shorter as helical pitch increased. We referred to the TSP's FWHM as the effective scanning time. When we conducted multi slice helical scanning at helical pitch 3, the effective scanning time increased to about 24% longer than that of a non helical scan. When we conducted multi slice helical scanning at helical pitch 5 or 6, the effective scanning time was about half that of a non helical scan. The time sensitivity profile (TSP) is a totally new concept that we consider an important element in discussing the time resolution of a CT scanner. The results of this review will provide significant data in determining the scanning parameters when scanning a moving object. (author)
UV cross-linking of polypeptides associated with 3'-terminal exons
International Nuclear Information System (INIS)
Stolow, D.T.; Berget, S.M.
1990-01-01
Association of nuclear proteins with chimeric vertebrate precursor RNAs containing both polyadenylation signals and an intron was examined by UV cross-linking. One major difference in cross-linking pattern was observed between this chimeric precursor RNA and precursors containing only polyadenylation or splicing signals. The heterogeneous nuclear ribonucleoprotein (hnRNP) polypeptide C cross-linked strongly to sequences downstream of the A addition site in polyadenylation precursor RNA containing only the polyadenylation signal from the simian virus 40 (SV40) late transcription unit. In contrast, the hnRNP C polypeptide cross-linked to chimeric RNA containing the same SV40 late poly(A) cassette very poorly, at a level less than 5% of that observed with the precursor RNA containing just the poly(A) site. Observation that cross-linking of the hnRNP C polypeptide to elements within the SV40 late poly(A) site was altered by the presence of an upstream intron suggests differences in the way nuclear factors associate with poly(A) sites in the presence and absence of an upstream intron. Cross-linking of C polypeptide to chimeric RNA increased with RNAs mutated for splicing or polyadenylation consensus sequences and under reaction conditions (high magnesium) that inhibited polyadenylation. Furthermore, cross-linking of hnRNP C polypeptide to precursors containing just the SV40 late poly(A) site was eliminated in the presence of competing poly(U); polyadenylation, however, was unaffected. Correlation of loss of activity with high levels of hnRNP C polypeptide cross-linking raises questions about the specificity of the interaction between the hnRNP C polypeptide and polyadenylation precursor RNAs in vitro
The mining of toxin-like polypeptides from EST database by single residue distribution analysis.
Kozlov, Sergey; Grishin, Eugene
2011-01-31
Novel high throughput sequencing technologies require permanent development of bioinformatics data processing methods. Among them, rapid and reliable identification of encoded proteins plays a pivotal role. To search for particular protein families, the amino acid sequence motifs suitable for selective screening of nucleotide sequence databases may be used. In this work, we suggest a novel method for simplified representation of protein amino acid sequences named Single Residue Distribution Analysis, which is applicable both for homology search and database screening. Using the procedure developed, a search for amino acid sequence motifs in sea anemone polypeptides was performed, and 14 different motifs with broad and low specificity were discriminated. The adequacy of motifs for mining toxin-like sequences was confirmed by their ability to identify 100% toxin-like anemone polypeptides in the reference polypeptide database. The employment of novel motifs for the search of polypeptide toxins in Anemonia viridis EST dataset allowed us to identify 89 putative toxin precursors. The translated and modified ESTs were scanned using a special algorithm. In addition to direct comparison with the motifs developed, the putative signal peptides were predicted and homology with known structures was examined. The suggested method may be used to retrieve structures of interest from the EST databases using simple amino acid sequence motifs as templates. The efficiency of the procedure for directed search of polypeptides is higher than that of most currently used methods. Analysis of 39939 ESTs of sea anemone Anemonia viridis resulted in identification of five protein precursors of earlier described toxins, discovery of 43 novel polypeptide toxins, and prediction of 39 putative polypeptide toxin sequences. In addition, two precursors of novel peptides presumably displaying neuronal function were disclosed.
The mining of toxin-like polypeptides from EST database by single residue distribution analysis
Directory of Open Access Journals (Sweden)
Grishin Eugene
2011-01-01
Full Text Available Abstract Background Novel high throughput sequencing technologies require permanent development of bioinformatics data processing methods. Among them, rapid and reliable identification of encoded proteins plays a pivotal role. To search for particular protein families, the amino acid sequence motifs suitable for selective screening of nucleotide sequence databases may be used. In this work, we suggest a novel method for simplified representation of protein amino acid sequences named Single Residue Distribution Analysis, which is applicable both for homology search and database screening. Results Using the procedure developed, a search for amino acid sequence motifs in sea anemone polypeptides was performed, and 14 different motifs with broad and low specificity were discriminated. The adequacy of motifs for mining toxin-like sequences was confirmed by their ability to identify 100% toxin-like anemone polypeptides in the reference polypeptide database. The employment of novel motifs for the search of polypeptide toxins in Anemonia viridis EST dataset allowed us to identify 89 putative toxin precursors. The translated and modified ESTs were scanned using a special algorithm. In addition to direct comparison with the motifs developed, the putative signal peptides were predicted and homology with known structures was examined. Conclusions The suggested method may be used to retrieve structures of interest from the EST databases using simple amino acid sequence motifs as templates. The efficiency of the procedure for directed search of polypeptides is higher than that of most currently used methods. Analysis of 39939 ESTs of sea anemone Anemonia viridis resulted in identification of five protein precursors of earlier described toxins, discovery of 43 novel polypeptide toxins, and prediction of 39 putative polypeptide toxin sequences. In addition, two precursors of novel peptides presumably displaying neuronal function were disclosed.
Transition of poloidal viscosity by electrode biasing in the Large Helical Device
International Nuclear Information System (INIS)
Kitajima, S.; Ishii, K.; Takahashi, H.
2012-11-01
Electrode biasing experiments were tried in various magnetic configurations on the Large Helical Device (LHD). The transitions of poloidal viscosity, which were accompanied with bifurcation phenomena characterized by a negative resistance, were clearly observed on LHD by the electrode biasing. The critical external driving force required for transition were compared with the local maximum in ion viscosity, and the radial resistivity before the transition also compared with the expected value from a neoclassical theory. The critical driving force increased and the radial resistivity decreased with the major radius of the magnetic axis R ax going outward. The configuration dependence of the transition condition and the radial resistivity qualitatively agreed with neoclassical theories. The radial electric field and the viscosity were also evaluated by the neoclassical transport code for a non-axisymmetric system, and estimated electrode voltage required for the transition, which was consistent with the experimental results. (author)
Transition of poloidal viscosity by electrode biasing in the Large Helical Device
International Nuclear Information System (INIS)
Kitajima, S.; Ishii, K.; Sato, Y.; Kanno, M.; Tachibana, J.; Okamoto, A.; Sasao, M.; Takahashi, H.; Masuzaki, S.; Shoji, M.; Ashikawa, N.; Tokitani, M.; Yokoyama, M.; Suzuki, Y.; Satake, S.; Ido, T.; Shimizu, A.; Suzuki, C.; Inagaki, S.; Takayama, M.
2013-01-01
Electrode biasing experiments were carried out in various magnetic configurations on the Large Helical Device (LHD). The transitions of poloidal viscosity, which were accompanied with bifurcation phenomena characterized by a negative resistance in an electrode characteristic, were clearly observed on LHD by the electrode biasing. The critical external driving force required for transition was compared with the local maximum in ion viscosity, and the radial resistivity before the transition also compared with the expected value from a neoclassical theory. The critical driving force increased and the radial resistivity decreased with the major radius of the magnetic axis R ax going outwards. The configuration dependence of the transition condition and the radial resistivity qualitatively agreed with neoclassical theories. The radial electric field and the viscosity were also evaluated by the neoclassical transport code for a non-axisymmetric system, and estimated electrode voltage required for the transition, which was consistent with the experimental results. (paper)
Counting Unfolding Events in Stretched Helices with Induced Oscillation by Optical Tweezers
Bacabac, Rommel Gaud; Otadoy, Roland
Correlation measures based on embedded probe fluctuations, single or paired, are now widely used for characterizing the viscoelastic properties of biological samples. However, more robust applications using this technique are still lacking. Considering that the study of living matter routinely demonstrates new and complex phenomena, mathematical and experimental tools for analysis have to catch up in order to arrive at newer insights. Therefore, we derive ways of probing non-equilibrium events in helical biopolymers provided by stretching beyond thermal forces. We generalize, for the first time, calculations for winding turn probabilities to account for unfolding events in single fibrous biopolymers and globular proteins under tensile stretching using twin optical traps. The approach is based on approximating the ensuing probe fluctuations as originating from a damped harmonic oscillator under oscillatory forcing.
Tavenor, Nathan Albert
Protein-based supramolecular polymers (SMPs) are a class of biomaterials which draw inspiration from and expand upon the many examples of complex protein quaternary structures observed in nature: collagen, microtubules, viral capsids, etc. Designing synthetic supramolecular protein scaffolds both increases our understanding of natural superstructures and allows for the creation of novel materials. Similar to small-molecule SMPs, protein-based SMPs form due to self-assembly driven by intermolecular interactions between monomers, and monomer structure determines the properties of the overall material. Using protein-based monomers takes advantage of the self-assembly and highly specific molecular recognition properties encodable in polypeptide sequences to rationally design SMP architectures. The central hypothesis underlying our work is that alpha-helical coiled coils, a well-studied protein quaternary folding motif, are well-suited to SMP design through the addition of synthetic linkers at solvent-exposed sites. Through small changes in the structures of the cross-links and/or peptide sequence, we have been able to control both the nanoscale organization and the macroscopic properties of the SMPs. Changes to the linker and hydrophobic core of the peptide can be used to control polymer rigidity, stability, and dimensionality. The gaps in knowledge that this thesis sought to fill on this project were 1) the relationship between the molecular structure of the cross-linked polypeptides and the macroscopic properties of the SMPs and 2) a means of creating materials exhibiting multi-dimensional net or framework topologies. Separate from the above efforts on supramolecular architectures was work on improving backbone modification strategies for an alpha-helix in the context of a complex protein tertiary fold. Earlier work in our lab had successfully incorporated unnatural building blocks into every major secondary structure (beta-sheet, alpha-helix, loops and beta
Recent Results of Helical Nonneutral Plasmas on Compact Helical System (CHS)
International Nuclear Information System (INIS)
Himura, H.; Yamamoto, Y.; Sanpei, A.; Masamune, S.; Wakabayashi, H.; Isobe, M.
2006-01-01
First of all, non-constant space potential φs and electron density ne on magnetic surfaces of helical nonneutral plasmas are verified experimentally. The difference in φs enlarges significantly at the outer region inside the closed magnetic surfaces, and the corresponding equipotential surfaces are inferred to shift upward vertically with respect to magnetic surfaces. Meanwhile, larger value of ne is clearly observed in the downward region (z < 0) of magnetic surfaces, which seems to be consistent with the φs measurement. These results are the first evidence which strongly suggests the equilibrium proposed for nonneutral plasmas confined in closed magnetic surfaces. Secondly, in order to investigate the mechanism of the multiple disruption of helical nonneutral plasmas observed in experiments, space and time evolutions of electron flux are measured carefully inside the magnetic surfaces, when the plasma disruption occurs. Surprisingly, a set of data show that the observed disruption is at first happened at ρ ∼ 0.8, where ρ is the normalized minor radius, and then, it seems to propagate inside magnetic surfaces
Liu, Xinpei; Shen, Yiming; Zhang, Xuqian; Lin, Rui; Jia, Qiang; Chang, Yixiang; Liu, Wenge; Liu, Wentian
2016-10-01
Brachytherapy is a targeted type of radiotherapy utilized in the treatment of cancers. Elastin-like polypeptides are a unique class of genetically engineered peptide polymers that have several attractive properties for brachytherapy. To explore the feasibility and application of brachytherapy for VX2 liver tumor using elastin-like polypeptides with (131)I so as to provide reliable experimental evidence for a new promising treatment of liver cancer. Elastin-like polypeptide as carrier was labeled with (131)I using the iodogen method. Ten eligible rabbits with VX2 liver tumor were randomly divided into the treatment group (n = 5) and control group (n = 5). The treatment group received brachytherapy using elastin-like polypeptide with (131)I, and in the control group, elastin-like polypeptide was injected into the VX2 liver tumor as a control. Periodic biochemical and imaging surveillances were required to assess treatment efficacy. The stability of elastin-like polypeptide with (131)I in vitro was maintained at over 96.8 % for 96 h. Biochemistry and imaging indicated brachytherapy using elastin-like polypeptide with (131)I for liver tumor can improve liver function and inhibit tumor growth (P Elastin-like polypeptide can be an ideal carrier of (131)I and have high labeling efficiency, radiochemical purity and stability. Brachytherapy using elastin-like polypeptide with (131)I for liver tumor is a useful therapy that possesses high antitumor efficacy advantages.
Munegumi, Toratane; Tanikawa, Naoya
2017-09-01
Asparagine and aspartic acid might have mutually transformed in the primordial hydrosphere of the earth, if ammonia and aspartic acid had existed in equilibrium. These amino acids seem to contribute to polypeptides, while the simple amino acids glycine and alanine easily form cyclic dipeptides and do not achieve long peptide chains. Asparagine-comprising dipeptides contribute some kinds of activation forms of dipeptides because these can polymerize faster than asparagine only. The new finding of polypeptide formation suggests a pathway of sequential polypeptides to evolve a diversity of polypeptides.
Munegumi, Toratane; Tanikawa, Naoya
2017-09-01
Asparagine and aspartic acid might have mutually transformed in the primordial hydrosphere of the earth, if ammonia and aspartic acid had existed in equilibrium. These amino acids seem to contribute to polypeptides, while the simple amino acids glycine and alanine easily form cyclic dipeptides and do not achieve long peptide chains. Asparagine-comprising dipeptides contribute some kinds of activation forms of dipeptides because these can polymerize faster than asparagine only. The new finding of polypeptide formation suggests a pathway of sequential polypeptides to evolve a diversity of polypeptides.
Avian leukosis virus is a versatile eukaryotic platform for polypeptide display
International Nuclear Information System (INIS)
Khare, Pranay D.; Russell, Stephen J.; Federspiel, Mark J.
2003-01-01
Display technology refers to methods of generating libraries of modularly coded biomolecules and screening them for particular properties. Retroviruses are good candidates to be a eukaryotic viral platform for the display of polypeptides synthesized in eukaryotic cells. Here we demonstrate that avian leukosis virus (ALV) provides an ideal platform for display of nonviral polyaeptides expressed in a eukaryotic cell substrate. Different sizes of polypeptides were genetically fused to the extreme N-terminus of the ALV envelope glycoprotein in an ALV infectious clone containing an alkaline phosphatase reporter gene. The chimeric envelope glycoproteins were efficiently incorporated into virions and were stably displayed on the surface of the virions through multiple virus replication cycles. The foreign polypeptides did not interfere with the attachment and entry functions of the underlying ALV envelope glycoproteins. The displayed polypeptides were fully functional and could efficiently mediate attachment of the recombinant viruses to their respective cognate receptors. This study demonstrates that ALV is an ideal display platform for the generation and selection of libraries of polypeptides where there is a need for expression, folding, and posttranslational modification in the endoplasmic reticulum of eukaryotic cells
Directory of Open Access Journals (Sweden)
Santos P.R.P.
1997-01-01
Full Text Available Biotinylation is proposed for the identification of surface proteins in Schistosoma mansoni using the streptavidin-HRP conjugate for the detection of labeled polypeptides. However, control samples also showed several endogenous biotinylated polypeptides. In an attempt to determine the possibility of nonspecific binding between the streptavidin-HRP conjugate and polypeptides from S. mansoni, the conjugate was blocked with biotinamidecaproate-N-hydroxysuccinimide ester (BcapNHS before biotin-streptavidin blotting. No bands were detected on the nitrocellulose sheet, demonstrating the specific recognition of biotin by the streptavidin present in the conjugate. Whole cercariae and cercarial bodies and tails showed several endogenous biotinylated polypeptides. The biotin concentration was 13 µg/190,000 cercariae. Adult worms presented less endogenous biotinylated polypeptides than cercariae. These results may be due to changes in the environment from aerobic to anaerobic conditions when cercarial bodies (schistosomula are transformed into adult worms and a decrease in CO2 production may occur. Cercariae, cercarial bodies and adult male worms were examined by transmission electron microscopy employing an avidin-colloidal gold conjugate for the detection of endogenous biotin. Gold particles were distributed mainly on the muscle fibers, but dispersed granules were observed in the tegument, mitochondria and cytosol. The discovery of endogenous biotin in S. mansoni should be investigated in order to clarify the function of this vitamin in the parasite
Moreadith, R W; Cleeter, M W; Ragan, C I; Batshaw, M L; Lehninger, A L
1987-02-01
Recently, we described a patient with severe lactic acidosis due to congenital complex I (NADH-ubiquinone oxidoreductase) deficiency. We now report further enzymatic and immunological characterizations. Both NADH and ferricyanide titrations of complex I activity (measured as NADH-ferricyanide reductase) were distinctly altered in the mitochondria from the patient's tissues. In addition, antisera against complex I immunoprecipitated NADH-ferricyanide reductase from the control but not the patient's mitochondria. However, immunoprecipitation and sodium dodecyl sulfate-polyacrylamide gel electrophoresis of complex I polypeptides demonstrated that the majority of the 25 polypeptides comprising complex I were present in the affected mitochondria. A more detailed analysis using subunit selective antisera against the main polypeptides of the iron-protein fragments of complex I revealed a selective absence of the 75- and 13-kD polypeptides. These findings suggest that the underlying basis for this patient's disease was a congenital deficiency of at least two polypeptides comprising the iron-protein fragment of complex I, which resulted in the inability to correctly assemble a functional enzyme complex.
Fabrication of genetically engineered polypeptide@quantum dots hybrid nanogels for targeted imaging
Yang, Jie; Yao, Ming-Hao; Zhao, Dong-Hui; Zhang, Xiao-Shuai; Jin, Rui-Mei; Zhao, Yuan-Di; Liu, Bo
2017-08-01
Nanogels have been widely used as multifunctional drug delivery carriers because of high water content, biocompatibility, and high loading capability. We designed and biosynthesized two triblock artificial polypeptides PC10A and PC10ARGD as vehicles for encapsulating hydrophobic materials. These polypeptides can form nanogels by self-assembly when the concentration is below 2% ( w/ v). The physical properties of nanogels, including size, surface potential, and targeting domain, are able to be tuned. Hydrophobic materials from molecular size to nano-size can be loaded into the polypeptide nanogels to form hybrid nanogels. Hydrophobic quantum dots CdSe@ZnS below 10 nM were loaded into the polypeptide nanogels by ultrasonic treatment. Encapsulation endows hydrophobic QDs with good tunability of size, water solubility, stability, targeting, and biocompatibility. PC10ARGD nanogels and PC10ARGD@QDs hybrid nanogels showed excellent biocompatibility, which the cellular viabilities of HeLa and MCF-7 cells treated with 1% PC10ARGD nanogels and PC10ARGD@QDs hybrid nanogels contained 20 nM QDs were above 90 and 80%, respectively. PC10ARGD@QDs hybrid nanogels with an arginine-glycine-aspartic acid motif present efficient receptor-mediated endocytosis in α v β 3 overexpressing HeLa cells but not in the control MCF-7 cells as analyzed by confocal microscopy. These results demonstrate that such polypeptide nanogels as nanocarriers are expected to have great potential applications in biomedicine.
Tarasova, Irina A; Goloborodko, Anton A; Perlova, Tatyana Y; Pridatchenko, Marina L; Gorshkov, Alexander V; Evreinov, Victor V; Ivanov, Alexander R; Gorshkov, Mikhail V
2015-07-07
The theory of critical chromatography for biomacromolecules (BioLCCC) describes polypeptide retention in reversed-phase HPLC using the basic principles of statistical thermodynamics. However, whether this theory correctly depicts a variety of empirical observations and laws introduced for peptide chromatography over the last decades remains to be determined. In this study, by comparing theoretical results with experimental data, we demonstrate that the BioLCCC: (1) fits the empirical dependence of the polypeptide retention on the amino acid sequence length with R(2) > 0.99 and allows in silico determination of the linear regression coefficients of the log-length correction in the additive model for arbitrary sequences and lengths and (2) predicts the distribution coefficients of polypeptides with an accuracy from 0.98 to 0.99 R(2). The latter enables direct calculation of the retention factors for given solvent compositions and modeling of the migration dynamics of polypeptides separated under isocratic or gradient conditions. The obtained results demonstrate that the suggested theory correctly relates the main aspects of polypeptide separation in reversed-phase HPLC.
Electrohydrodynamic (EHD) vortices in helical turbulence
International Nuclear Information System (INIS)
Kikuchi, H.
1996-01-01
The study of large-scale coherent hydrodynamic (HD) vortex generation has been extended to electrified charged dusty vortices to be termed as electrohydrodynamic (EHD) vortices, incorporating helical turbulence in electric and magnetic fields into that in fluid velocity, which are all created by an external DC electric field on the background. A new equation of EHD vortices is introduced on the basis of a set of EHD or electromagnetohydrodynamic (EMHD) equations, including equations of state and a full set of Maxwell's equations by using functional techniques for estimating equations for an ensemble average, turbulent background, and additional random field. In fact, EHD vortices for a charged dusty fluid can be more explosive with larger instabilities than HD vortices. In addition, it is inferred that an external DC electric field could provide the origin of additional self-organization to a coalescence of fluid vortex and electric field lines as a manifestation of a new frozen-in field concept for electric fields when the electric Reynolds number is sufficiently high. This is discussed on the basis of a set of general transport equations for fluid vorticity, magnetic and electric fields that are rederived concisely. In particular, a novel concept of electric field line merging-reconnection is developed in close relation to fluid vortex line merging, indicating a coalescence of fluid vortex breakdown or merging point and electric field line reconnection point, X-type or O-type with possible application to tornadic thunderstorms. In fact, a thundercloud charge distribution so as to provide a coalescence of fluid vortex and electric field lines is quite possible without theoretical inconsistency, and is thought most likely to occur from observations available so far. (orig.)
Kuster, Daniel J; Liu, Chengyu; Fang, Zheng; Ponder, Jay W; Marshall, Garland R
2015-01-01
Theoretical and experimental evidence for non-linear hydrogen bonds in protein helices is ubiquitous. In particular, amide three-centered hydrogen bonds are common features of helices in high-resolution crystal structures of proteins. These high-resolution structures (1.0 to 1.5 Å nominal crystallographic resolution) position backbone atoms without significant bias from modeling constraints and identify Φ = -62°, ψ = -43 as the consensus backbone torsional angles of protein helices. These torsional angles preserve the atomic positions of α-β carbons of the classic Pauling α-helix while allowing the amide carbonyls to form bifurcated hydrogen bonds as first suggested by Némethy et al. in 1967. Molecular dynamics simulations of a capped 12-residue oligoalanine in water with AMOEBA (Atomic Multipole Optimized Energetics for Biomolecular Applications), a second-generation force field that includes multipole electrostatics and polarizability, reproduces the experimentally observed high-resolution helical conformation and correctly reorients the amide-bond carbonyls into bifurcated hydrogen bonds. This simple modification of backbone torsional angles reconciles experimental and theoretical views to provide a unified view of amide three-centered hydrogen bonds as crucial components of protein helices. The reason why they have been overlooked by structural biologists depends on the small crankshaft-like changes in orientation of the amide bond that allows maintenance of the overall helical parameters (helix pitch (p) and residues per turn (n)). The Pauling 3.6(13) α-helix fits the high-resolution experimental data with the minor exception of the amide-carbonyl electron density, but the previously associated backbone torsional angles (Φ, Ψ) needed slight modification to be reconciled with three-atom centered H-bonds and multipole electrostatics. Thus, a new standard helix, the 3.6(13/10)-, Némethy- or N-helix, is proposed. Due to the use of constraints from
Li, Yanyan; Xu, Jiajie; Su, Xiurong
2017-07-01
Hydrolysates and peptide fractions (PF) obtained from sea cucumber with commercial enzyme were studied on the hpyerglycemic and renal protective effects on db/db rats using urine metabolomics. Compared with the control group the polypeptides from the two species could significantly reduce the urine glucose and urea. We also tried to address the compositions of highly expressed urinary proteins using a proteomics approach. They were serum albumins, AMBP proteins, negative trypsin, elastase and urinary protein, GAPDH, a receptor of urokinase-type plasminogen activator (uPAR), and Ig kappa chain C region. We used the electronic nose to quickly detect changes in the volatile substances in mice urine after holothurian polypeptides fed, and the results show it can identify the difference between treatment groups with the control group without overlapping. The protein express mechanism of holothurian polypeptides treating diabetes was discussed, and we suggested these two peptides with the hypoglycemic and renal protective activity might be utilized as nutraceuticals.
Comparison between the polypeptide profile of halophilic bacteria and salt tolerant plants.
Muñoz, G; González, C; Flores, P; Prado, B; Campos, V
1997-12-01
Changes in the polypeptide profile induced by salt stress in halotolerant and halophilic bacteria, isolated from the Atacama desert (northern Chile), were compared with those in the cotyledons of Prosopis chilensis (Leguminoseae) seedlings, a salt tolerant plant. SDS-PAGE analyses show the presence of four predominant polypeptides, with molecular weights around 78, 70, 60 and 44 kDa respectively, both in bacteria and in cotyledons from P. chilensis seedlings raised under salt stress conditions. Moreover, the 60 and 44 kDa polypeptides seem to be salt responsive, since their concentration increases with increasing NaCl in the growth medium. Our results suggest a common mechanism for salt tolerance in prokaryotes and in eukaryotes.
Effect of oxygen on morphogenesis and polypeptide expression by Mucor racemosus
International Nuclear Information System (INIS)
Phillips, G.J.; Borgia, P.T.
1985-01-01
The morphology of Mucor racemosus in cultures continuously sparged with nitrogen gas was investigated. When appropriate precautions were taken to prevent oxygen from entering the cultures, the morphology of the cells was uniformly yeastlike irrespective of the N 2 flow rate. When small amounts of oxygen entered the cultures the resulting microaerobic conditions evoked mycelial development. Polypeptides synthesized by aerobic mycelia, microaerobic mycelia, anaerobic yeasts, and yeasts grown in a CO 2 atmosphere were compared by two-dimensional gel electrophoresis. The results indicated that a large number of differences in polypeptide expression exist when microaerobic mycelia or anaerobic yeasts are compared with aerobic mycelia and that these alterations correlate with a change from an oxidative to a fermentative metabolic mode. The authors hypothesize that oxygen regulates the expression of polypeptides involved in both the metabolic mode and in morphogenesis
Synthetic profiles of polypeptides of human oocytes and normal and abnormal preimplantation embryos.
Capmany, G; Bolton, V N
1999-09-01
There is considerable variation in the rate of development in vitro of individual preimplantation human embryos. The relationship between the rate of development and patterns of polypeptide synthesis in individual embryos was examined using SDS-PAGE and autoradiography. After incubation in [35S]methionine, 19 polypeptide bands were identified that change between fertilization and the morula stage. Although changes in two of the bands occurred in embryos that were developing normally and in ageing oocytes, and are thus independent of fertilization, the changes identified in the remaining 17 bands occurred only after fertilization. In embryos that were developing abnormally, as assessed by delayed cleavage, cleavage arrest or extensive fragmentation, the alteration in polypeptide synthetic profiles increased with increasing abnormality.
Directory of Open Access Journals (Sweden)
Yong-Liang Zhuang
2010-01-01
Full Text Available Jellyfish gelatin was hydrolyzed by different proteases to obtain antioxidative polypeptides. The gelatin hydrolysate obtained by progressive hydrolysis using trypsin and Properase E exhibited the highest hydrolysis degree and antioxidant activity. Three series of gelatin polypeptides (SCP1, SCP2 and SCP3 were obtained by ultrafiltrating the gelatin hydrolysate through molecular mass cut-off membranes of 10, 6 and 2 kDa, respectively. Amino acid composition analysis showed that SCP3 had the highest total hydrophobic amino acid content. The in vitro antioxidant tests demonstrated that SCP2 had the strongest hydroxyl radical and hydrogen peroxide scavenging activities and metal chelating ability, while SCP3 showed the highest reducing power, antioxidant activity in linoleic acid emulsion system and superoxide anion radical scavenging activity. The results support the feasibility of jellyfish gelatin as a natural antioxidant polypeptide provider, and enzymatic hydrolysis and ultrafiltration could be potent future processing technologies to utilize the abundant jellyfish resource.
Benjannet, S; Leduc, R; Lazure, C; Seidah, N G; Marcinkiewicz, M; Chrétien, M
1985-01-16
During the course of reverse-phase high pressure liquid chromatography (RP-HPLC) purification of a postulated big ACTH (1) from human pituitary gland extracts, a highly purified peptide bearing no resemblance to any known polypeptide was isolated. The complete sequence of this 74 amino acid polypeptide, called GAWK, has been determined. Search on a computer data bank on the possible homology to any known protein or fragment, using a mutation data matrix, failed to reveal any homology greater than 30%. An antibody produced against a synthetic fragment allowed us to detect several immunoreactive forms. The antisera also enabled us to localize the polypeptide, by immunocytochemistry, in the anterior lobe of the pituitary gland.
Gong, Yinchun; Ai, Zhijiu; Sun, Xu; Fu, Biwei
2016-01-01
Analytical buckling models are important for down-hole operations to ensure the structural integrity of the drill string. A literature survey shows that most published analytical buckling models do not address the effects of inclination angle, boundary conditions or friction. The objective of this paper is to study the effects of boundary conditions, friction and angular inclination on the helical buckling of coiled tubing in an inclined wellbore. In this paper, a new theoretical model is established to describe the buckling behavior of coiled tubing. The buckling equations are derived by applying the principles of virtual work and minimum potential energy. The proper solution for the post-buckling configuration is determined based on geometric and natural boundary conditions. The effects of angular inclination and boundary conditions on the helical buckling of coiled tubing are considered. Many significant conclusions are obtained from this study. When the dimensionless length of the coiled tubing is greater than 40, the effects of the boundary conditions can be ignored. The critical load required for helical buckling increases as the angle of inclination and the friction coefficient increase. The post-buckling behavior of coiled tubing in different configurations and for different axial loads is determined using the proposed analytical method. Practical examples are provided that illustrate the influence of the angular inclination on the axial force. The rate of change of the axial force decreases with increasing angular inclination. Moreover, the total axial friction also decreases with an increasing inclination angle. These results will help researchers to better understand helical buckling in coiled tubing. Using this knowledge, measures can be taken to prevent buckling in coiled tubing during down-hole operations.
Maeda, Katsuhiro; Yashima, Eiji
2017-08-01
Construction of predominantly one-handed helical polyacetylenes with a desired helix sense utilizing noncovalent chiral interactions with nonracemic chiral guest compounds based on a supramolecular approach is described. As with the conventional dynamic helical polymers possessing optically active pendant groups covalently bonded to the polymer chains, this noncovalent helicity induction system can show significant chiral amplification phenomena, in which the chiral information of the nonracemic guests can transfer with high cooperativity through noncovalent bonding interactions to induce an almost single-handed helical conformation in the polymer backbone. An intriguing "memory effect" of the induced macromolecular helicity is observed for some polyacetylenes, which means that the helical conformations induced in dynamic helical polyacetylene can be transformed into metastable static ones by tuning their helix-inversion barriers. Potential applications of helical polyacetylenes with controlled helix sense constructed by the "noncovalent helicity induction and/or memory effect" as chiral materials are also described.
Gho, Francesca; Peña-Neira, Alvaro; López-Solís, Remigio O
2007-02-01
Isoproterenol-induced salivary polypeptides (IISP), a group of proline-rich proteins synthesized by mouse parotids, have been considered as markers for isoproterenol-induced parotid hypertrophy. Rodents fed diets containing high-tannin cereals (sorghum), also develop parotid hypertrophy. To test whether tannins are directly involved in provoking sialotrophic growth, we studied the effect of intraperitoneal and topical oral administrations of tannic acid (TA) on the induction of IISP polypeptides in endogamic mice (A/Snell). TA was characterized by HPLC chromatography and spectral analysis and shown to be composed solely of gallotannins, a complex family of glucose and gallic acid esters. IISP polypeptides were monitored in saliva by SDS-polyacrylamide gel electrophoresis during 36 h after ending TA stimulation. Single daily intraperitoneal administrations of TA for 3 consecutive days (0.033 mg/g bw/day), at variance of parallel administrations of isoproterenol (0.042 mg/g bw/day) failed to induce IISP polypeptides. However, repeated topical applications of TA into the mouse mouths (1.21 mg/g bw divided into three equal doses given at 4-h intervals within a single day) resulted in unequivocal induction of IISP polypeptides. That response was clearly intensified by increasing the stimulation frequency to eight equivalent doses given at 1.5-h intervals within a single day (corresponding to 3.23 mg/g bw) and even further by repeating this protocol for 3 days. Under these productive schemes of stimulations by TA, electrophoretic fractionation of parotid homogenates showed new polypeptide bands migrating in parallel to salivary IISP. These results suggest that topically administered gallotannins are effective inducers of trophic growth in mouse parotids.
Peng, Zhou; Bu, Jiexun; McLuckey, Scott A.
2017-09-01
We examine a gas-phase approach for converting a subset of amino acid residues in polypeptide cations to dehydroalanine (Dha). Subsequent activation of the modified polypeptide ions gives rise to specific cleavage N-terminal to the Dha residue. This process allows for the incorporation of selective cleavages in the structural characterization of polypeptide ions. An ion/ion reaction within the mass spectrometer between a multiply protonated polypeptide and the sulfate radical anion introduces a radical site into the multiply protonated polypeptide reactant. Subsequent collisional activation of the polypeptide radical cation gives rise to radical side chain loss from one of several particular amino acid side chains (e.g., leucine, asparagine, lysine, glutamine, and glutamic acid) to yield a Dha residue. The Dha residues facilitate preferential backbone cleavages to produce signature c- and z-ions, demonstrated with cations derived from melittin, mechano growth factor (MGF), and ubiquitin. The efficiencies for radical side chain loss and for subsequent generation of specific c- and z-ions have been examined as functions of precursor ion charge state and activation conditions using cations of ubiquitin as a model for a small protein. It is noted that these efficiencies are not strongly dependent on ion trap collisional activation conditions but are sensitive to precursor ion charge state. Moderate to low charge states show the greatest overall yields for the specific Dha cleavages, whereas small molecule losses (e.g., water/ammonia) dominate at the lowest charge states and proton catalyzed amide bond cleavages that give rise to b- and y-ions tend to dominate at high charge states. [Figure not available: see fulltext.
Antiviral activity of α-helical stapled peptides designed from the HIV-1 capsid dimerization domain
Directory of Open Access Journals (Sweden)
Cowburn David
2011-05-01
Full Text Available Abstract Background The C-terminal domain (CTD of HIV-1 capsid (CA, like full-length CA, forms dimers in solution and CTD dimerization is a major driving force in Gag assembly and maturation. Mutations of the residues at the CTD dimer interface impair virus assembly and render the virus non-infectious. Therefore, the CTD represents a potential target for designing anti-HIV-1 drugs. Results Due to the pivotal role of the dimer interface, we reasoned that peptides from the α-helical region of the dimer interface might be effective as decoys to prevent CTD dimer formation. However, these small peptides do not have any structure in solution and they do not penetrate cells. Therefore, we used the hydrocarbon stapling technique to stabilize the α-helical structure and confirmed by confocal microscopy that this modification also made these peptides cell-penetrating. We also confirmed by using isothermal titration calorimetry (ITC, sedimentation equilibrium and NMR that these peptides indeed disrupt dimer formation. In in vitro assembly assays, the peptides inhibited mature-like virus particle formation and specifically inhibited HIV-1 production in cell-based assays. These peptides also showed potent antiviral activity against a large panel of laboratory-adapted and primary isolates, including viral strains resistant to inhibitors of reverse transcriptase and protease. Conclusions These preliminary data serve as the foundation for designing small, stable, α-helical peptides and small-molecule inhibitors targeted against the CTD dimer interface. The observation that relatively weak CA binders, such as NYAD-201 and NYAD-202, showed specificity and are able to disrupt the CTD dimer is encouraging for further exploration of a much broader class of antiviral compounds targeting CA. We cannot exclude the possibility that the CA-based peptides described here could elicit additional effects on virus replication not directly linked to their ability to bind
Stable–streamlined and helical cavities following the impact of Leidenfrost spheres
Mansoor, Mohammad M.
2017-06-23
We report results from an experimental study on the formation of stable–streamlined and helical cavity wakes following the free-surface impact of Leidenfrost spheres. Similar to the observations of Mansoor et al. (J. Fluid Mech., vol. 743, 2014, pp. 295–326), we show that acoustic ripples form along the interface of elongated cavities entrained in the presence of wall effects as soon as the primary cavity pinch-off takes place. The crests of these ripples can act as favourable points for closure, producing multiple acoustic pinch-offs, which are found to occur in an acoustic pinch-off cascade. We show that these ripples pacify with time in the absence of physical contact between the sphere and the liquid, leading to extremely smooth cavity wake profiles. More importantly, the downward-facing jet at the apex of the cavity is continually suppressed due to a skin-friction drag effect at the colliding cavity-wall junction, which ultimately produces a stable–streamlined cavity wake. This streamlined configuration is found to experience drag coefficients an order of a magnitude lower than those acting on room-temperature spheres. A striking observation is the formation of helical cavities which occur for impact Reynolds numbers and are characterized by multiple interfacial ridges, stemming from and rotating synchronously about an evident contact line around the sphere equator. The contact line is shown to result from the degeneration of Kelvin–Helmholtz billows into turbulence which are observed forming along the liquid–vapour interface around the bottom hemisphere of the sphere. Using sphere trajectory measurements, we show that this helical cavity wake configuration has 40 %–55 % smaller force coefficients than those obtained in the formation of stable cavity wakes.
Stable–streamlined and helical cavities following the impact of Leidenfrost spheres
Mansoor, Mohammad M.; Vakarelski, Ivan Uriev; Marston, J. O.; Truscott, T. T.; Thoroddsen, Sigurdur T
2017-01-01
We report results from an experimental study on the formation of stable–streamlined and helical cavity wakes following the free-surface impact of Leidenfrost spheres. Similar to the observations of Mansoor et al. (J. Fluid Mech., vol. 743, 2014, pp. 295–326), we show that acoustic ripples form along the interface of elongated cavities entrained in the presence of wall effects as soon as the primary cavity pinch-off takes place. The crests of these ripples can act as favourable points for closure, producing multiple acoustic pinch-offs, which are found to occur in an acoustic pinch-off cascade. We show that these ripples pacify with time in the absence of physical contact between the sphere and the liquid, leading to extremely smooth cavity wake profiles. More importantly, the downward-facing jet at the apex of the cavity is continually suppressed due to a skin-friction drag effect at the colliding cavity-wall junction, which ultimately produces a stable–streamlined cavity wake. This streamlined configuration is found to experience drag coefficients an order of a magnitude lower than those acting on room-temperature spheres. A striking observation is the formation of helical cavities which occur for impact Reynolds numbers and are characterized by multiple interfacial ridges, stemming from and rotating synchronously about an evident contact line around the sphere equator. The contact line is shown to result from the degeneration of Kelvin–Helmholtz billows into turbulence which are observed forming along the liquid–vapour interface around the bottom hemisphere of the sphere. Using sphere trajectory measurements, we show that this helical cavity wake configuration has 40 %–55 % smaller force coefficients than those obtained in the formation of stable cavity wakes.
Helical CT in evaluation of the bronchial tree
International Nuclear Information System (INIS)
Perhomaa, M.; Laehde, S.; Rossi, O.; Suramo, I.
1997-01-01
Purpose: To establish a protocol for and to assess the value of helical CT in the imaging of the bronchial tree. Material and Methods: Noncontrast helical CT was performed in 30 patients undergoing fiberoptic bronchoscopy for different reasons. Different protocols were compared; they included overlapping 10 mm, 5 mm, or 3 mm slices and non-tilted, cephalad or caudal tilted images. Ordinary cross-sectional and multiplanar 2D reformats were applied for visualization of the bronchial branches. The effect of increasing the helical pitch was tested in one patient. Results: A total of 92.1-100% of the segmental bronchi present in the helical acquisitions were identified by the different protocols. The collimation had no significant impact on the identification of the bronchial branches, but utilization of 3-mm overlapping slices made it easier to distinguish the nearby branches and provided better longitudinal visualization of the bronchi in 2D reformats. The tilted scans illustrated the disadvantage of not covering all segmental bronchi in one breath-hold. An increase of the pitch from 1 to 1.5 did not cause noticeable blurring of the images. CT and bronchoscopic findings correlated well in the area accessible to bronchoscopy, but CT detected 5 additional pathological lesions (including 2 cancers) in the peripheral lung. Conclusion: Helical CT supplemented with bronchography-like 2D reformats provides an effective method complementary to bronchoscopy in the examination of the bronchial tree. (orig.)
Chirality of Intermediate Filaments and Magnetic Helicity of Active Regions
Lim, Eun-Kyung; Chae, J.
2009-05-01
Filaments that form either between or around active regions (ARs) are called intermediate filaments. Even though there have been many theoretical studies, the origin of the chirality of filaments is still unknown. We investigated how intermediate filaments are related to their associated ARs, especially from the point of view of magnetic helicity and the orientation of polarity inversion lines (PILs). The chirality of filaments has been determined based on the orientations of barbs observed in the full-disk Hα images taken at Big Bear Solar Observatory during the rising phase of solar cycle 23. The sign of magnetic helicity of ARs has been determined using S/inverse-S shaped sigmoids from Yohkoh SXT images. As a result, we have found a good correlation between the chirality of filaments and the magnetic helicity sign of ARs. Among 45 filaments, 42 filaments have shown the same sign as helicity sign of nearby ARs. It has been also confirmed that the role of both the orientation and the relative direction of PILs to ARs in determining the chirality of filaments is not significant, against a theoretical prediction. These results suggest that the chirality of intermediate filaments may originate from magnetic helicity of their associated ARs.
Gynecological applications of helical CT using SmartPrep
Energy Technology Data Exchange (ETDEWEB)
Sakurada, Akira; Kakizaki, Dai; Abe, Kimihiko [Tokyo Medical Coll. (Japan)
1999-11-01
SmartPrep is software program for scanning a given region of interest (ROI) at optimal contrast density. An operator can arbitrarily define ROI and preset the CT value at which scanning should be started. After the injection of a contrast medium, system conducts continuous monitoring of the ROI and the operator starts helical scanning of the planned region when the present CT value has been reached. In comparison with conventional helical CT that requires a period of time from the beginning of contrast medium injection to the beginning of scanning, SmartPrep minimizes personal error and better depicts the artery-predominant phase under optimal conditions. In this study we examine the usefulness of contrast-enhanced helical CT using SmartPrep in the evaluation of gynecological disease. When the contrast medium was injected into the dorsal vein of the hand at a rate of 3 ml/sec, strong staining of pelvic arteries was observed in the CT images started at 17 to 23 sec after injection. The early-phase helical CT obtained under these conditions provided good depiction of lesions in cases of placenta accreta and invasive mole, as well as clear demonstration of tumor angiogenesis and evaluation of laterality in cases of cervical cancer. Comparison of the early and delayed phase also facilitated easier evaluation of lymph nodes than conventional comparison of simple and contrast-enhanced CT. The results thus suggest the usefulness of contrast-enhanced helical CT using SmartPrep in gynecology. (author)
Helicity and potential vorticity in the surface boundary layer turbulence
Chkhetiani, Otto; Kurgansky, Michael; Koprov, Boris; Koprov, Victor
2016-04-01
An experimental measurement of all three components of the velocity and vorticity vectors, as well as the temperature and its gradient, and potential vorticity, has been developed using four acoustic anemometers. Anemometers were placed at vertices of a tetrahedron, the horizontal base of which was a rectangular triangle with equal legs, and the upper point was exactly above the top of the right angle. The distance from the surface to the tetrahedron its base was 5.5 m, and the lengths of legs and a vertical edge were 5 m. The measurements were carried out of total duration near 100 hours both in stable and unstable stratification conditions (at the Tsimlyansk Scientific Station in a uniform area of virgin steppe 700 x 650 m, August 2012). A covariance-correlation matrix for turbulent variations in all measured values has been calculated. In the daytime horizontal and vertical components of the helicity are of the order of -0.03 and +0.01 m s-2, respectively. The nighttime signs remain unchanged, but the absolute values are several times smaller. It is confirmed also by statistics of a relative helicity. The cospectra and spectral correlation coefficients have been calculated for all helicity components. The time variations in the components of "instantaneous" relative helicity and potential vorticity are considered. Connections of helicity with Monin-Obukhov length and the wind vertical profile structure are discussed. This work was supported by the Russian Science Foundation (Project No 14-27-00134).
Structural analysis of compression helical spring used in suspension system
Jain, Akshat; Misra, Sheelam; Jindal, Arun; Lakhian, Prateek
2017-07-01
The main aim of this work has to develop a helical spring for shock absorber used in suspension system which is designed to reduce shock impulse and liberate kinetic energy. In a vehicle, it increases comfort by decreasing amplitude of disturbances and it improves ride quality by absorbing and dissipating energy. When a vehicle is in motion on a road and strikes a bump, spring comes into action quickly. After compression, spring will attempt to come to its equilibrium state which is on level road. Helical springs can be made lighter with more strength by reducing number of coils and increasing the area. In this research work, a helical spring is modeled and analyzed to substitute the existing steel spring which is used in suspension. By using different materials, stress and deflection of helical spring can be varied. Comparability between existing spring and newly replaced spring is used to verify the results. For finding detailed stress distribution, finite element analysis is used to find stresses and deflection in both the helical springs. Finite element analysis is a method which is used to find proximate solutions of a physical problem defined in a finite domain. In this research work, modeling of spring is accomplished using Solid Works and analysis on Ansys.
Kinetic theory of rf current drive and helicity injection
International Nuclear Information System (INIS)
Mett, R.R.
1992-01-01
Current drive and helicity injection by plasma waves are examined with the use of kinetic theory. The Vlasov equation yields a general current drive formula that contains resonant and nonresonant (ponderomotivelike) contributions. Standard quasilinear current drive is described by the former, while helicity current drive may be contained in the latter. Since direct analytical comparison of the sizes of the two terms is, in general, difficult, a new approach is taken. Solution of the drift-kinetic equation shows that the standard Landau damping/transit time magnetic pumping quasilinear diffusion coefficient is the only contribution to steady-state current drive to leading order in ε=ρ L /l, where ρ L is the Larmor radius and l is the inhomogeneity scale length. All nonresonant contributions, including the helicity, appear at higher order, after averages are taken over a flux surface, over azimuth, and over time. Consequently, at wave frequencies well below the electron cyclotron frequency, a wave helicity flux perpendicular to the magnetic field does not influence the parallel motion of electrons to leading order and therefore will not drive a significant current. Any current associated with a wave helicity flux is then either ion current (and thus inefficient) or electron current stemming from effects not included in the drift-kinetic treatment, such as cyclotron, collisional, or nonlinear (i.e., not quasilinear)
Reduced bispectrum seeded by helical primordial magnetic fields
Energy Technology Data Exchange (ETDEWEB)
Hortúa, Héctor Javier [Universidad Nacional de Colombia-Bogotá, Facultad de Ciencias, Departamento de Física, Carrera 30 Calle 45-03, C.P. 111321 Bogotá (Colombia); Castañeda, Leonardo, E-mail: hjhortuao@unal.edu.co, E-mail: lcastanedac@unal.edu.co [Grupo de Gravitación y Cosmología, Observatorio Astronómico Nacional, Universidad Nacional de Colombia, cra 45 No 26-85, Edificio Uriel Gutierréz, Bogotá, D.C. (Colombia)
2017-06-01
In this paper, we investigate the effects of helical primordial magnetic fields (PMFs) on the cosmic microwave background (CMB) reduced bispectrum. We derive the full three-point statistics of helical magnetic fields and numerically calculate the even contribution in the collinear configuration. We then numerically compute the CMB reduced bispectrum induced by passive and compensated PMF modes on large angular scales. There is a negative signal on the bispectrum due to the helical terms of the fields and we also observe that the biggest contribution to the bispectrum comes from the non-zero IR cut-off for causal fields, unlike the two-point correlation case. For negative spectral indices, the reduced bispectrum is enhanced by the passive modes. This gives a lower value of the upper limit for the mean amplitude of the magnetic field on a given characteristic scale. However, high values of IR cut-off in the bispectrum, and the helical terms of the magnetic field relaxes this bound. This demonstrates the importance of the IR cut-off and helicity in the study of the nature of PMFs from CMB observations.
l=1 helical axis heliotron device in Kyoto university
International Nuclear Information System (INIS)
Nagasaki, K.; Sano, F.; Mizuuchi, T.; Hanatani, K.; Okada, H.; Obiki, T.
1999-01-01
Helical systems are an attractive candidate for magnetic fusion reactor. Recently, there has been great progress in theoretical research of three dimensional magnetic field structures, resulting in several kinds of confinement optimization being proposed for toroidal magnetic confinement system. For example, some sophisticated ideas have appeared on stage such as quasi-helical symmetry and quasi-isodynamic system. To find experimentally which way is the best Optimisation, a new helical axis heliotron device, so called 'Heliotron J', is under construction in the Institute of Advanced Energy, Kyoto University, Japan. In this conference, the basic concept and the present status will be presented. In the conventional plane axis helical system, it was difficult to have both good particle confinement and good MHD stability simultaneously. The goal of Heliotron J project is to clarify their compatibility in the spatial axis toroidal device. The best way for Optimising the helical magnetic field configuration will be explored by investigating the plasma response to the change in the field components. The main subjects for plasma experiment are: demonstration of the existence of good magnetic flux surfaces, reduction of neoclassical transport in collisionless regime, MHD Stabilisation in high β plasma, controllability of bootstrap current, good confinement of high energy particles
Controllable helical deformations on printed anisotropic composite soft actuators
Wang, Dong; Li, Ling; Serjouei, Ahmad; Dong, Longteng; Weeger, Oliver; Gu, Guoying; Ge, Qi
2018-04-01
Helical shapes are ubiquitous in both nature and engineering. However, the development of soft actuators and robots that mimic helical motions has been hindered primarily due to the lack of efficient modeling approaches that take into account the material anisotropy and the directional change of the external loading point. In this work, we present a theoretical framework for modeling controllable helical deformations of cable-driven, anisotropic, soft composite actuators. The framework is based on the minimum potential energy method, and its model predictions are validated by experiments, where the microarchitectures of the soft composite actuators can be precisely defined by 3D printing. We use the developed framework to investigate the effects of material and geometric parameters on helical deformations. The results show that material stiffness, volume fraction, layer thickness, and fiber orientation can be used to control the helical deformation of a soft actuator. In particular, we found that a critical fiber orientation angle exists at which the twist of the actuator changes the direction. Thus, this work can be of great importance for the design and fabrication of soft actuators with tailored deformation behavior.
Double Helical Gear Performance Results in High Speed Gear Trains
Handschuh, Robert F.; Ehinger, Ryan; Sinusas, Eric; Kilmain, Charles
2010-01-01
The operation of high speed gearing systems in the transmissions of tiltrotor aircraft has an effect on overall propulsion system efficiency. Recent work has focused on many aspects of high-speed helical gear trains as would be used in tiltrotor aircraft such as operational characteristics, comparison of analytical predictions to experimental data and the affect of superfinishing on transmission performance. Baseline tests of an aerospace quality system have been conducted in the NASA Glenn High-Speed Helical Gear Train Test Facility and have been described in earlier studies. These earlier tests had utilized single helical gears. The results that will be described in this study are those attained using double helical gears. This type of gear mesh can be configured in this facility to either pump the air-oil environment from the center gap between the meshing gears to the outside of tooth ends or in the reverse direction. Tests were conducted with both inward and outward air-oil pumping directions. Results are compared to the earlier baseline results of single helical gears.
Heat transfer characteristics of a helical heat exchanger
International Nuclear Information System (INIS)
San, Jung-Yang; Hsu, Chih-Hsiang; Chen, Shih-Hao
2012-01-01
Heat transfer performance of a helical heat exchanger was investigated. The heat exchanger is composed of a helical tube with rectangular cross section and two cover plates. The ε–Ntu relation of the heat exchanger was obtained using a numerical method. In the analysis, the flow in the tube (helical flow) was considered to be mixed and the flow outside the tube (radial flow) was unmixed. In the experiment, the Darcy friction factor (f) and convective heat transfer coefficient (h) of the radial flow were measured. The radial flow was air and the helical flow was water. Four different channel spacing (0.5, 0.8, 1.2 and 1.6 mm) were individually considered. The Reynolds numbers were in the range 307–2547. Two correlations, one for the Darcy friction factor and the other for the Nusselt number, were proposed. - Highlights: ► We analyze the heat transfer characteristics of a helical heat exchanger and examine the effectiveness–Ntu relation. ► Increasing number of turns of the heat exchanger would slightly increase the effectiveness. ► There is an optimum Ntu value corresponding to a maximum effectiveness. ► We measure the Darcy friction factor and Nusselt number of the radial flow and examine the correlations.
Phase transition in polypeptides: a step towards the understanding of protein folding
DEFF Research Database (Denmark)
Yakubovich, Alexander V.; Solov'yov, Ilia; Solov'yov, Andrey V.
2006-01-01
We present a formalism which turns out to be very successful in the description of the polypeptide folding. We consider this process as a first-order phase transition and develop a theory which is free of model parameters and is based solely on fundamental physical principles. It describes...... essential thermodynamical properties of the system such as heat capacity, the phase transition temperature and others from the analysis of the polypeptide potential energy surface calculated within ab initio density functional theory and parameterized by two dihedral angles. This problem is viewed...
Directory of Open Access Journals (Sweden)
Kalliopi K Patapati
Full Text Available Conventional wisdom has it that the presence of disordered regions in the three-dimensional structures of polypeptides not only does not contribute significantly to the thermodynamic stability of their folded state, but, on the contrary, that the presence of disorder leads to a decrease of the corresponding proteins' stability. We have performed extensive 3.4 µs long folding simulations (in explicit solvent and with full electrostatics of an undecamer peptide of experimentally known helical structure, both with and without its disordered (four residue long C-terminal tail. Our simulations clearly indicate that the presence of the apparently disordered (in structural terms C-terminal tail, increases the thermodynamic stability of the peptide's folded (helical state. These results show that at least for the case of relatively short peptides, the interplay between thermodynamic stability and the apparent structural stability can be rather subtle, with even disordered regions contributing significantly to the stability of the folded state. Our results have clear implications for the understanding of peptide energetics and the design of foldable peptides.
Chiral forces and molecular dissymmetry
International Nuclear Information System (INIS)
Mohan, R.
1992-01-01
Chiral molecules leading to helical macromolecules seem to preserve information and extend it better. In the biological world RNA is the very paradigm for self-replication, elongation and autocatalytic editing. The nucleic acid itself is not chiral. It acquires its chirality by association with D-sugars. Although the chiral information or selectivity put in by the unit monomer is no longer of much interest to the biologists - they tend to leave it to the Darwinian selection principle to take care of it as illustrated by Frank's model - it is vital to understand the origin of chirality. There are three different approaches for the chiral origin of life: (1) Phenomenological, (2) Electromagnetic molecular and Coriolis forces and (3) Atomic or nuclear force, the neutral weak current. The phenomenological approach involves spontaneous symmetry breaking fluctuations in far for equilibrium systems or nucleation and crystallization. Chance plays a major role in the chiral molecule selected
Stable single helical C- and I-chains inside single-walled carbon nanotubes
International Nuclear Information System (INIS)
Yao Z; Li Y; Jing X D; Meng F S; Zhao X; Li J H; Qiu Z Y; Yuan Q; Wang W X; Bi L; Liu H; Zhang Y P; Liu C J; Zheng S P; Liu B B
2016-01-01
The helicity of stable single helical carbon chains and iodine chains inside single-walled carbon nanotubes (SWCNTs) is studied by calculating the systematic van der Waals interaction energy. The results show that the optimal helical radius increases linearly with increasing tube radius, which produces a constant separation between the chain structure and the tube wall. The helical angle exhibits a ladder-like decrease with increasing tube radius, indicating that a large tube can produce a small helicity in the helical structures. (paper)
DEFF Research Database (Denmark)
Rivas, Matilde De Las; Lira-Navarrete, Erandi; Daniel, Earnest James Paul
2017-01-01
The polypeptide GalNAc-transferases (GalNAc-Ts), that initiate mucin-type O-glycosylation, consist of a catalytic and a lectin domain connected by a flexible linker. In addition to recognizing polypeptide sequence, the GalNAc-Ts exhibit unique long-range N- A nd/or C-terminal prior glycosylation ...
Canning, A.; Pasquazi, A.; Fijten, M.; Rajput, S.; Buttery, L.; Aylott, J.W.; Zelzer, M.
2016-01-01
Ring opening polymerization (ROP) of N-carboxy anhydride (NCA) amino acids presents a rapid way to synthesize high molecular weight polypeptides with different amino acid compositions. The compositional and functional versatility of polypeptides make these materials an attractive choice for
New reconstruction algorithm in helical-volume CT
International Nuclear Information System (INIS)
Toki, Y.; Rifu, T.; Aradate, H.; Hirao, Y.; Ohyama, N.
1990-01-01
This paper reports on helical scanning that is an application of continuous scanning CT to acquire volume data in a short time for three-dimensional study. In a helical scan, the patient couch sustains movement during continuous-rotation scanning and then the acquired data is processed to synthesize a projection data set of vertical section by interpolation. But the synthesized section is not thin enough; also, the image may have artifacts caused by couch movement. A new reconstruction algorithm that helps resolve such problems has been developed and compared with the ordinary algorithm. The authors constructed a helical scan system based on TCT-900S, which can perform 1-second rotation continuously for 30 seconds. The authors measured section thickness using both algorithms on an AAPM phantom, and we also compared degree of artifacts on clinical data
Geometric scalings for the electrostatically driven helical plasma state
Akçay, Cihan; Finn, John M.; Nebel, Richard A.; Barnes, Daniel C.
2017-12-01
A new plasma state has been investigated [Akcay et al., Phys. Plasmas 24, 052503 (2017)], with a uniform applied axial magnetic field in a periodic cylinder of length L = 2 π R , driven by helical electrodes. The drive is single helicity, depending on m θ + k z = m θ - n ζ , where ζ = z / R and k = - n / R . For strong ( m , n ) = ( 1 , 1 ) drive, the state was found to have a strong axial mean current density, with a mean-field safety factor q 0 ( r ) just above the pitch of the electrodes m / n = 1 in the interior. This state has possible applications to DC electrical transformers and tailoring of the current profile in tokamaks. We study two geometric issues of interest for these applications: (i) scaling of properties with the plasma length or aspect ratio and (ii) behavior for different helicities, specifically ( m , n ) = ( 1 , n ) for n > 1 and ( m , n ) = ( 2 , 1 ) .
Effect of loss cone on confinement in toroidal helical device
International Nuclear Information System (INIS)
Itoh, K.; Itoh, S.-I.; Fukuyama, A.; Hanatani, K.
1988-12-01
Analytical estimation is given on the loss cone in the toroidal helical devices in the presence of the radial electric field and the modulation of the helical ripple. The minimum energy of particles entering the loss cone is calculated. The modulation is not always effective in reducing the loss in the presence of the radial electric field. The plasma loss due to the loss cone is estimated in the collisionless limit. The radial electric field is estimated in the presence of the loss cone. It is found that the transition to the solution with positive radial electric field, which is necessary to achieve the high-ion-temperature mode, becomes difficult. This difficulty is large for the systems with the small helical ripple. (author)
Geometric analysis of alloreactive HLA α-helices.
Ribarics, Reiner; Karch, Rudolf; Ilieva, Nevena; Schreiner, Wolfgang
2014-01-01
Molecular dynamics (MD) is a valuable tool for the investigation of functional elements in biomolecules, providing information on dynamic properties and processes. Previous work by our group has characterized static geometric properties of the two MHC α-helices comprising the peptide binding region recognized by T cells. We build upon this work and used several spline models to approximate the overall shape of MHC α-helices. We applied this technique to a series of MD simulations of alloreactive MHC molecules that allowed us to capture the dynamics of MHC α-helices' steric configurations. Here, we discuss the variability of spline models underlying the geometric analysis with varying polynomial degrees of the splines.
Imploding to equilibrium of helically symmetric theta pinches
International Nuclear Information System (INIS)
Sharky, N.N.
1978-01-01
The time-dependent, single-fluid, dissipative magnetohydrodynamic equations are solved in helical coordinates (r,phi), where phi = THETA-kz, k = 2π/L and L is the periodicity length in the z-direction. The two-dimensional numerical calculations simulate theta pinches which have an l = 1 helical field added to them. Given the applied magnetic fields and the initial state of the plasma, we study the time evolution of the system. The plasma is found to experience two kinds of oscillations, occurring on different time scales. These are the radial compression oscillations, and the slower helical oscillations of the plasma column. The plasma motion is followed until these oscillations disappear and an equilibrium is nearly reached. Hence given the amplitude and the rise time of the applied magnetic fields, the calculations allow one to relate the initial state of a cold, homogeneous plasma to its final equilibrium state where it is heated and compressed
Theory of dynamics in long pulse helical plasmas
International Nuclear Information System (INIS)
Itoh, K.; Sanuki, H.; Toda, S.; Yokoyama, M.; Itoh, S.-I.; Yagi, M.; Fukuyama, A.
2001-01-01
Self-organized dynamics of toroidal helical plasma, which is induced by the nonlinear transport property, is discussed. Neoclassical ripple diffusion is a dominant mechanism that drives the radial electric field. The bifurcation nature of the electric field generation gives rise to the electric field domain interface, across which the electric field changes strongly. This domain interface is an origin of internal transport barrier in helical systems. This nonlinearity gives rise to the self-organized oscillations; the electric field pulsation is one of the examples. Based on the model of density limit, in which the competition between the transport loss and radiation loss is analyzed, dynamics near the density limit of helical systems is also discussed. (author)
Helicity amplitudes and electromagnetic decays of hyperon resonances
International Nuclear Information System (INIS)
Cauteren, T. van; Ryckebusch, J.; Metsch, B.; Petry, H.R.
2005-01-01
We present results for the helicity amplitudes of the lowest-lying hyperon resonances Y * , computed within the framework of the Bonn Constituent-Quark model, which is based on the Bethe-Salpeter approach. The seven parameters entering the model were fitted to the best-known baryon masses. Accordingly, the results for the helicity amplitudes are genuine predictions. Some hyperon resonances are seen to couple more strongly to a virtual photon with finite Q 2 than to a real photon. Other Y * 's, such as the S 01 (1670) Λ-resonance or the S 11 (1620) Σ-resonance, couple very strongly to real photons. We present a qualitative argument for predicting the behaviour of the helicity asymmetries of baryon resonances at high Q 2 . (orig.)
Directory of Open Access Journals (Sweden)
Michiya Fujiki
2010-08-01
Full Text Available From elemental particles to human beings, matter is dissymmetric with respect to mirror symmetry. In 1860, Pasteur conjectured that biomolecular handedness— homochirality—may originate from certain inherent dissymmetric forces existing in the universe. Kipping, a pioneer of organosilicon chemistry, was interested in the handedness of sodium chlorate during his early research life. Since Kipping first synthesized several Si-Si bonded oligomers bearing phenyl groups, Si-Si bonded high polymers carrying various organic groups—polysilanes—can be prepared by sodium-mediated condensation of the corresponding organodichlorosilanes. Among these polysilanes, optically active helical polysilanes with enantiomeric pairs of organic side groups may be used for testing the mirror symmetry-breaking hypothesis by weak neutral current (WNC origin in the realm of chemistry and material science. Several theoretical studies have predicted that WNC-existing chiral molecules with stereogenic centers and/or stereogenic bonds allow for distinguishing between image and mirror image molecules. Based on several amplification mechanisms, theorists claimed that minute differences, though still very subtle, may be detectable by precise spectroscopic and physicochemical measurements if proper chiral molecular pairs were employed. The present paper reports comprehensively an inequality between six pairs of helical polysilane high polymers, presumably, detectable by (chiroptical and achiral 29Si-/13C- NMR spectra, and viscometric measurements.
Self-assembly of Janus particles into helices with tunable pitch
Fernández, M. Sobrino; Misko, V. R.; Peeters, F. M.
2015-10-01
Janus particles present an important class of building blocks for directional assembly. These are compartmentalized colloids with two different hemispheres. In this work we consider a three-dimensional model of Janus spheres that contain one hydrophobic and one charged hemisphere. Using molecular dynamics simulations, we study the morphology of these particles when confined in a channel-like environment. The interplay between the attractive and repulsive forces on each particle gives rise to a rich phase space where the relative orientation of each particle plays a dominant role in the formation of large-scale clusters. The interest in this system is primarily due to the fact that it could give a better understanding of the mechanisms of the formation of polar membranes. A variety of ordered membranelike morphologies is found consisting of single and multiple connected chain configurations. The helicity of these chains can be chosen by simply changing the salt concentration of the solution. Special attention is given to the formation of Bernal spirals. These helices are composed of regular tetrahedra and are known to exhibit nontrivial translational and rotational symmetry.
International Nuclear Information System (INIS)
Korotaev, O.J.; Mizonov, N.V.; Nikolaevsky, V.B.; Nazarov, E.K.
1990-01-01
Analysis of thermal hydraulics characteristics of nuclear steam generators with different tube bundle arrangements and waste heat boilers for ammonia production units was performed on the basis of operating experience results and research and development data. The present report involves the obtained information. The estimations of steam generator performances and repair-ability are given. The significant temperature profile of the primary and secondary coolant flows are attributed to all steam generator designs. The intermediate mixing is found to be an effective means of temperature profile overcoming. At present the only means to provide an effective mixing in heat exchangers of the following types: straight tubes, field tubes, platen tubes and multibank helical coil tubes (with complicated bend distribution along their length) are section arrangements in series in conjunction with forced and natural mixing in connecting lines. Development of the unificated system from mini helical coil assemblies allows to design and manufacture heat exchangers and steam generators within the wide range of operating conditions without additional expenses on the research and development work
Kocica, Mladen J; Corno, Antonio F; Carreras-Costa, Francesc; Ballester-Rodes, Manel; Moghbel, Mark C; Cueva, Clotario N C; Lackovic, Vesna; Kanjuh, Vladimir I; Torrent-Guasp, Francisco
2006-04-01
We are currently witnessing the advent of new diagnostic tools and therapies for heart diseases, but, without serious scientific consensus on fundamental questions about normal and diseased heart structure and function. During the last decade, three successive, international, multidisciplinary symposia were organized in order to setup fundamental research principles, which would allow us to make a significant step forward in understanding heart structure and function. Helical ventricular myocardial band of Torrent-Guasp is the revolutionary new concept in understanding global, three-dimensional, functional architecture of the ventricular myocardium. This concept defines the principal, cumulative vectors, integrating the tissue architecture (i.e. form) and net forces developed (i.e. function) within the ventricular mass. Here we expose the compendium of Torrent-Guasp's half-century long functional anatomical investigations in the light of ongoing efforts to define the integrative approach, which would lead to new understanding of the ventricular form and function by linking across multiple scales of biological organization, as defined in ongoing Physiome project. Helical ventricular myocardial band of Torrent-Guasp may also, hopefully, allow overcoming some difficulties encountered in contemporary efforts to create a comprehensive mathematical model of the heart.
Generation of spin motive force in a soliton lattice
International Nuclear Information System (INIS)
Ovchinnikov, A. S.; Sinitsyn, V. E.; Bostrem, I. G.; Kishine, J.
2013-01-01
The generation of a spin motive force in a chiral helimagnet due to the action of two crossed magnetic fields is considered. The cases of pulsed and periodic magnetic fields directed along the helical axis under a perpendicular dc field are analyzed. It is shown that, in the case of a pulsed field, the spin motive force is related to dissipation, whereas in a periodic field, there is a reactive component that is not related to damping processes.
Conformal avoidance helical tomotherapy for dogs with nasopharyngeal tumors
International Nuclear Information System (INIS)
Welsh, J.S.; Turek, M.; Mackie, T.R.; Miller, P.; Mehta, M.P.; Forrest, L.J.
2003-01-01
Helical tomotherapy provides a unique means of delivering intensity-modulated radiation therapy (IMRT) using a novel treatment unit, which merges features of a linear accelerator with a helical CT scanner. Thanks to the CT imaging capacity, targeted regions can be visualized prior to, during, or immediately after each treatment. Such image-guidance through megavoltage CT will allow the realization and refinement of the concept of adaptive radiotherapy - the reconstruction of the actually delivered daily dose (as opposed to planned dose) accompanied by prescription adjustments when appropriate. In addition to this unique feature, helical tomotherapy promises further improvements in the specific avoidance of critical normal structures, i.e. conformal avoidance, the counterpart of conformal therapy. The first definitive treatment protocol using helical tomotherapy is presently underway for dogs with nasopharyngeal tumors. In general, such tumors can be treated with conventional external beam radiation therapy but at the cost of severe ocular toxicity due to the anatomy of the canine head. These are readily measurable toxicities and are almost universal in incidence; therefore, the canine nasopharyngeal tumor presents an ideal model to assess the ability to conformally avoid critical structures. It is hoped that conformal avoidance helical tomotherapy will improve tumor control via dose-escalation while reducing ocular toxicity in these veterinary patients. A total of 10 fractions are scheduled for these patients; the first 3 dogs have all received at least 7 fractions delivered via helical tomotherapy. Although preliminary, the first 3 dogs treated have not shown any evidence of ocular toxicity in this ongoing study
Divertors for Helical Devices: Concepts, Plans, Results, and Problems
International Nuclear Information System (INIS)
Koenig, R.; Grigull, P.; McCormick, K.
2004-01-01
With Large Helical Device (LHD) and Wendelstein 7-X (W7-X), the development of helical devices is now taking a large step forward on the path to a steady-state fusion reactor. Important issues that need to be settled in these machines are particle flux and heat control and the impact of divertors on plasma performance in future continuously burning fusion plasmas. The divertor concepts that will initially be explored in these large machines were prepared in smaller-scale devices like Heliotron E, Compact Helical System (CHS), and Wendelstein 7-AS (W7-AS). While advanced divertor scenarios relevant for W7-X were already studied in W7-AS, other smaller-scale experiments like Heliotron-J, CHS, and National Compact Stellarator Experiment will be used for the further development of divertor concepts. The two divertor configurations that are being investigated are the helical and the island divertor, as well as the local island divertor, which was successfully demonstrated on CHS and just went into operation on LHD. At present, on its route to a fully closed helical divertor, LHD operates in an open helical divertor configuration. W7-X will be equipped right from the start with an actively cooled discrete island divertor that will allow quasi-continuous operation. The divertor design is very similar to the one explored on W7-AS. For sufficiently large island sizes and not too long field line connection lengths, this divertor gives access to a partially detached quasi-steady-state operating scenario in a newly found high-density H-mode operating regime, which benefits from high energy and low impurity confinement times, with edge radiation levels of up to 90% and sufficient neutral compression in the subdivertor region (>10) for active pumping. The basic physics of the different divertor concepts and associated implementation problems, like asymmetries due to drifts, accessibility of essential operating scenarios, toroidal asymmetries due to symmetry breaking error fields
Variation in the helical structure of native collagen.
Directory of Open Access Journals (Sweden)
Joseph P R O Orgel
Full Text Available The structure of collagen has been a matter of curiosity, investigation, and debate for the better part of a century. There has been a particularly productive period recently, during which much progress has been made in better describing all aspects of collagen structure. However, there remain some questions regarding its helical symmetry and its persistence within the triple-helix. Previous considerations of this symmetry have sometimes confused the picture by not fully recognizing that collagen structure is a highly complex and large hierarchical entity, and this affects and is effected by the super-coiled molecules that make it. Nevertheless, the symmetry question is not trite, but of some significance as it relates to extracellular matrix organization and cellular integration. The correlation between helical structure in the context of the molecular packing arrangement determines which parts of the amino acid sequence of the collagen fibril are buried or accessible to the extracellular matrix or the cell. In this study, we concentrate primarily on the triple-helical structure of fibrillar collagens I and II, the two most predominant types. By comparing X-ray diffraction data collected from type I and type II containing tissues, we point to evidence for a range of triple-helical symmetries being extant in the molecules native environment. The possible significance of helical instability, local helix dissociation and molecular packing of the triple-helices is discussed in the context of collagen's supramolecular organization, all of which must affect the symmetry of the collagen triple-helix.
Bursty fluctuation characteristics in SOL/divertor plasmas of large helical device
International Nuclear Information System (INIS)
Ohno, N.
2006-01-01
Full text: Fluctuation properties in the SOL plasmas were intensively studied to understand the crossfield plasma transport, which determines the SOL structure and heat/particle deposition onto the first wall. Recent studies in tokamaks showed that the SOL density fluctuation is highly intermittent. Convective cross-field transport associated with the intermittent events would have strong influence on recycling processes and impurity generation from the first wall. On the other hand, in helical devices, there are few systematic studies on the SOL fluctuation property focusing on the intermittent bursty fluctuations related to plasma blob transport. Recent theory predicts that the blobs propagate toward a low field side in tokamaks. On the other hand, in the Large Helical Device (LHD), the direction of the gradient in B is not uniform because the high-field and the low-field sides rotates poloidally along the torus in the helical system. Comparison between the intermittent bursty fluctuations in the edge plasma of tokamaks and helical devices makes it possible to understand the essential physics of the blob transport. Recently, fast camera observation showed the radial motion of filaments in the edge of the LHD, suggesting the convective cross-field transport. In this paper, bursty fluctuation properties in the edge of the LHD have been investigated by analyzing the ion saturation currents measured with a probe array embedded in an outboard divertor plate. Statistical analysis based on probability distribution function was employed to determine the intermittent evens in the density fluctuation. Large positive bursty events were often observed in the ion saturation current measured with a divertor probe near a divertor leg at which the magnetic line of force connected to the area of a low-field side with a short connection length. Condition averaging result of the positive bursty events indicates the intermittent feature with a rapid increase and a slow decay is
Point contacts and localization in generic helical liquids
Orth, Christoph P.; Strübi, Grégory; Schmidt, Thomas L.
2013-10-01
We consider two helical liquids on opposite edges of a two-dimensional topological insulator, which are connected by one or several local tunnel junctions. In the presence of spatially inhomogeneous Rashba spin-orbit coupling, the spin of the helical edge states is momentum dependent, and this spin texture can be different on opposite edges. We demonstrate that this has a strong impact on the electron transport between the edges. In particular, in the case of many random tunnel contacts, the localization length depends strongly on the spin textures of the edge states.
Helical coil alignment in the advanced toroidal facility
International Nuclear Information System (INIS)
Taylor, D.J.; Cole, M.J.; Johnson, R.L.; Nelson, B.E.; Warwick, J.E.; Whitson, J.C.
1985-01-01
This paper presents a brief overview of the helical coil design concept, detailed descriptions of the method for installation and alignment, and discussions of segment installation and alignment equipment. Alignment is accomplished by optical methods using electronic theodolites connected to a microcomputer to form a coordinate measurement system. The coordinate measurement system is described in detail, along with target selection and fixturing for manipulation of the helical coil segments during installation. In addition, software is described including vendor-supplied software used in the coordinate measurement system and in-house-developed software used to calibrate segment and positioning fixture motion. 2 refs., 8 figs
Effects of different rod spacers (helical types) on coolant crossmixing
International Nuclear Information System (INIS)
Zhukov, A.V.; Sviridenko, E.Ya.; Matyukhin, N.M.; Rymkevich, K.S.; Ushakov, P.A.
1981-11-01
The results of investigations (electromagnetic measuring method) on coolant cross mixing in rod clusters with spiral wire spacers with different winding directions, with alternating unfinned and finned rods (case 'fin to rod'), as well as in rod clusters with much space between the rods, (case 'fin to fin') are reported. The local fluid dynamics parameters (distribution of the transversal and longitudinal velocity component) that define the physical processes of the coolant exchange in the rod clusters with helical spacers are explained. The investigation results for different helical spacer types are compared with each other. (orig.) [de
Demonstration of a helical armature for a superconducting generator
International Nuclear Information System (INIS)
Conley, P.L.; Kirtley, J.L. Jr.; Hagman, W.H.; Ula, A.H.M.S.
1979-01-01
This is a report on the design, construction and testing of an experimental helical armature for a superconducting geneator. Rated at 60 kVA, this armature was built to be operated in conjunction with the rotor of the first experimental superconducting machine built at MIT. It incorporates, in addition to the helical winding form, a high density edge-brazed end turn geometry, molded bar groups, and silicone fluid coolant and insulation impregnant. Tests showed that the thermal performance of the armature was within reasonable limits, magnetic analyses leading to the computation of reactance and voltage geneation were approximately correct. No abnormal cheating was observed. 9 refs
Helically symmetric equilibria with pressure anisotropy and incompressible plasma flow
Evangelias, A.; Kuiroukidis, A.; Throumoulopoulos, G. N.
2018-02-01
We derive a generalized Grad-Shafranov equation governing helically symmetric equilibria with pressure anisotropy and incompressible flow of arbitrary direction. Through the most general linearizing ansatz for the various free surface functions involved therein, we construct equilibrium solutions and study their properties. It turns out that pressure anisotropy can act either paramegnetically or diamagnetically, the parallel flow has a paramagnetic effect, while the non-parallel component of the flow associated with the electric field has a diamagnetic one. Also, pressure anisotropy and flow affect noticeably the helical current density.
Synthesis, model and stability of helically coiled carbon nanotubes
DEFF Research Database (Denmark)
Fejes, Dora; Raffai, Manuella; Hernadi, Klara
2013-01-01
. Our experiments focused on the production and development of catalysts for the synthesis of helically coiled CNTs (carbon nanotubes). The catalysts were tested in the decomposition of acetylene by CCVD (Catalytic Chemical Vapor Deposition) method. The carbon deposit was imaged by TEM (Transmission......Structural model of helically coiled carbon nanotubes is proposed. It is constructed by means of topological coordinate method. Relaxation and cohesive energy calculation are performed by molecular mechanics, using second-generation bond order potential for hydrocarbons introduced by D. W. Brenner...
Electron Capture Dissociation of Weakly Bound Polypeptide Polycationic Complexes
DEFF Research Database (Denmark)
Haselmann, Kim F; Jørgensen, Thomas J D; Budnik, Bogdan A
2002-01-01
as well as specific complexes of modified glycopeptide antibiotics with their target peptide. The weak nature of bonding is substantiated by blackbody infrared dissociation, low-energy collisional excitation and force-field simulations. The results are consistent with a non-ergodic ECD cleavage mechanism.......We have previously reported that, in electron capture dissociation (ECD), rupture of strong intramolecular bonds in weakly bound supramolecular aggregates can proceed without dissociation of weak intermolecular bonds. This is now illustrated on a series of non-specific peptide-peptide dimers...
Occupational Outlook Quarterly, 2012
2012-01-01
The labor force is the number of people ages 16 or older who are either working or looking for work. It does not include active-duty military personnel or the institutionalized population, such as prison inmates. Determining the size of the labor force is a way of determining how big the economy can get. The size of the labor force depends on two…
Functional polypeptides obtained by living ring opening polymerizations of N-carboxyanhydrides
Habraken, G.J.M.
2011-01-01
N-Carboxyanhydride ring opening polymerization (NCA ROP) is a method to prepare polypeptides with a high degree of polymerization in large quantities. The living polymerization technique of NCA ROP gave the opportunity to synthesize many polymer architectures with well-defined blocks and copolymers
Heeswijk, W.A.R.; Hoes, C.J.T.; Stoffer, T.; Eenink, M.J.D.; Potman, W.; Feijen, Jan
1985-01-01
Poly(α-l-glutamic acid) (PGA) was grafted with amino acid and oligopeptide spacers up to 5 amino acids with the use of N,N'-carbonyldiimidazole and 2,3-dihydro-1,2-benz-isothiazole-3-on-1, 1-dioxide (saccharin) as an additive, and these polypeptides were characterized. The antitumor antibiotic
DEFF Research Database (Denmark)
Meier, J J; Gallwitz, B; Siepmann, N
2003-01-01
AIMS/HYPOTHESIS: In the isolated perfused pancreas, gastric inhibitory polypeptide (GIP) has been shown to enhance glucagon secretion at basal glucose concentrations, but in healthy humans no glucagonotropic effect of GIP has yet been reported. Therefore, we studied the effect of GIP on glucagon ...
Molecular cloning and protein structure of a human blood group Rh polypeptide
International Nuclear Information System (INIS)
Cherif-Zahar, B.; Bloy, C.; Le Van Kim, C.; Blanchard, D.; Bailly, P.; Hermand, P.; Salmon, C.; Cartron, J.P.; Colin, Y.
1990-01-01
cDNA clones encoding a human blood group Rh polypeptide were isolated from a human bone marrow cDNA library by using a polymerase chain reaction-amplified DNA fragment encoding the known common N-terminal region of the Rh proteins. The entire primary structure of the Rh polypeptide has been deduced from the nucleotide sequence of a 1384-base-pair-long cDNA clone. Translation of the open reading frame indicates that the Rh protein is composed of 417 amino acids, including the initiator methionine, which is removed in the mature protein, lacks a cleavable N-terminal sequence, and has no consensus site for potential N-glycosylation. The predicted molecular mass of the protein is 45,500, while that estimated for the Rh protein analyzed in NaDodSO 4 /polyacrylamide gels is in the range of 30,000-32,000. These findings suggest either that the hydrophobic Rh protein behaves abnormally on NaDodSO 4 gels or that the Rh mRNA may encode a precursor protein, which is further matured by a proteolytic cleavage of the C-terminal region of the polypeptide. Hydropathy analysis and secondary structure predictions suggest the presence of 13 membrane-spanning domains, indicating that the Rh polypeptide is highly hydrophobic and deeply buried within the phospholipid bilayer. These results suggest that the expression of the Rh gene(s) might be restricted to tissues or cell lines expressing erythroid characters
DEFF Research Database (Denmark)
Hautmann, Matthias; Friis, Ulla G; Desch, Michael
2007-01-01
Besides of its functional role in the nervous system, the neuropeptide pituitary adenylate cyclase-activating polypeptide (PACAP) is involved in the regulation of cardiovascular function. Therefore, PACAP is a potent vasodilator in several vascular beds, including the renal vasculature. Because...
The Beads of Translation: Using Beads to Translate mRNA into a Polypeptide Bracelet
Dunlap, Dacey; Patrick, Patricia
2012-01-01
During this activity, by making beaded bracelets that represent the steps of translation, students simulate the creation of an amino acid chain. They are given an mRNA sequence that they translate into a corresponding polypeptide chain (beads). This activity focuses on the events and sites of translation. The activity provides students with a…
Directory of Open Access Journals (Sweden)
Guangxin Yuan
2018-01-01
Full Text Available Our previous research revealed that Cordyceps militaris can improve the learning and memory, and although the main active ingredient should be its polypeptide complexes, the underlying mechanism of its activity remains poorly understood. In this study, we explored the mechanisms by which Cordyceps militaris improves learning and memory in a mouse model. Mice were given scopolamine hydrobromide intraperitoneally to establish a mouse model of learning and memory impairment. The effects of Cordyceps polypeptide in this model were tested using the Morris water maze test; serum superoxide dismutase activity; serum malondialdehyde levels; activities of acetyl cholinesterase, Na+-k+-ATPase, and nitric oxide synthase; and gamma aminobutyric acid and glutamate contents in brain tissue. Moreover, differentially expressed genes and the related cellular signaling pathways were screened using an mRNA expression profile chip. The results showed that the genes Pik3r5, Il-1β, and Slc18a2 were involved in the effects of Cordyceps polypeptide on the nervous system of these mice. Our findings suggest that Cordyceps polypeptide may improve learning and memory in the scopolamine-induced mouse model of learning and memory impairment by scavenging oxygen free radicals, preventing oxidative damage, and protecting the nervous system.
Roossien, A; Brunstig, J.R; Nijmeijer, A; Zaagsma, Hans; Zijlstra, W.G
Objective: The vagal cardiac accelerator (VCA) system takes part in the nervous control of the heart rate. In the present study we tried to adduce evidence that vasoactive intestinal polypeptide (VLP) contributes to vagally induced cardioacceleration. Methods: The effect of VIP on heart rate and
Smith, Kathrine J; Petit, Chantal M; Aubart, Kelly; Smyth, Martin; McManus, Edward; Jones, Jo; Fosberry, Andrew; Lewis, Ceri; Lonetto, Michael; Christensen, Siegfried B
2003-02-01
Polypeptide deformylase (PDF) catalyzes the deformylation of polypeptide chains in bacteria. It is essential for bacterial cell viability and is a potential antibacterial drug target. Here, we report the crystal structures of polypeptide deformylase from four different species of bacteria: Streptococcus pneumoniae, Staphylococcus aureus, Haemophilus influenzae, and Escherichia coli. Comparison of these four structures reveals significant overall differences between the two Gram-negative species (E. coli and H. influenzae) and the two Gram-positive species (S. pneumoniae and S. aureus). Despite these differences and low overall sequence identity, the S1' pocket of PDF is well conserved among the four enzymes studied. We also describe the binding of nonpeptidic inhibitor molecules SB-485345, SB-543668, and SB-505684 to both S. pneumoniae and E. coli PDF. Comparison of these structures shows similar binding interactions with both Gram-negative and Gram-positive species. Understanding the similarities and subtle differences in active site structure between species will help to design broad-spectrum polypeptide deformylase inhibitor molecules.
Energy Technology Data Exchange (ETDEWEB)
Wang Jiannan, E-mail: wangjn@suda.edu.cn [College of Material Engineering, Soochow University, Suzhou 215021 (China); Yan Shuqin [College of Material Engineering, Soochow University, Suzhou 215021 (China); Lu Changde [Institute of Biochemistry and Cell Biology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, Shanghai 200031 (China); Bai Lun [College of Material Engineering, Soochow University, Suzhou 215021 (China)
2009-05-05
We aimed to investigate the self-organization/self-assembly mechanisms of silkworm fibroin-based material. In the present study, for the first time, we designed and multimerized four DNA 'monomer' sequences from structurally simple fibroin crystalline peptides or analog, [GAGAGX] (X = A, S, Y and V) to encode polypeptides [GAGAGX]{sub 16} (eGA, eGS, eGY and eGV) using a 'head-to-tail' construction strategy. Multimers were cloned into pGEX-KG and fusion proteins GST-[GAGAGX]{sub 16} (KGA, KGS, KGY and KGV) were efficiently expressed in Escherichia coli. These fusion proteins were isolated and purified by GST affinity chromatography and confirmed by SDS-PAGE and Western blot analysis using antibody reactive to GST. The polypeptides were cleavaged from GST fusion proteins by digesting with thrombin enzyme. The composition of the four polypeptides was confirmed by composition analysis of amino acids, and their abilities to form {beta}-sheet structure were determined by ThT fluorescence spectral analysis. The content of {beta}-sheet among the four polypeptides followed the order: eGS > eGV > eGY > eGA.
MARRINK, J; OOSTEROM, R; BONFRER, HMG; SCHRODER, FH; MENSINK, HJA
1993-01-01
The serum concentration of the cell proliferation marker TPS (tissue polypeptide-specific antigen) was compared with the tumour marker PSA (prostate specific antigen). PSA was found elevated in 50% of the benign prostatic hypertrophy (BPH) patients, in 88% of the patients with active prostate cancer
Wang, Ke; Wang, Jia; Liu, Bolong; Lin, Songyi; Zhao, Ping; Liu, Jingbo; Jones, Gregory; Huang, Hsiang-Chi
2013-05-01
Egg-white protein polypeptides are potentially used as a functional ingredient in food products. In this study, the effects on DPPH inhibition of egg-white protein polypeptides ranging from 10 to 30 kDa treated by pulsed electric field (PEF) technology were investigated. 2, 2-Diphenyl-1-picrylhydrazyl (DPPH) inhibition (%) was used to evaluate the antioxidant activity of polypeptides. In order to develop and optimize a pulsed electric field (PEF) mathematical model for improving the antioxidant activity, we have investigated three variables, including concentration (6, 8 and 10 mg mL(-1)), electric field intensity (10, 20 and 30 kV cm(-1)) and pulse frequency (2000, 2350 and 2700 Hz) and subsequently optimized them by response surface methodology (RSM). The concentration (8 mg mL(-1)), electric field intensity (10 kV cm(-1)) and pulse frequency (2000 Hz) were found to be the optimal conditions under which the DPPH inhibition increased 28.44%, compared to the sample without PEF treatment. Both near-infrared spectroscopy (NIR) and mid-infrared spectroscopy (MIR) were used to analyze the change of functional groups. The results showed that PEF technology could improve the antioxidant activity of antioxidant polypeptides from egg-white protein under the optimized conditions. © 2012 Society of Chemical Industry.
Side-chain-controlled self-assembly of polystyrene-polypeptide miktoarm star copolymers
Junnila, Susanna; Houbenov, Nikolay; Karatzas, A.; Hadjichristidis, Nikolaos; Hirao, Akira; Iatrou, Hermis; Ikkala, Olli T.
2012-01-01
polypeptide-surfactant self-assemblies with β-sheet conformation in PS 2PLL(DS) and PS 2(PLL(DS)) 2 which dominate over the formation of block copolymer scale structures. Differences between the 3- and 4-arm systems illustrate how packing frustration between
Helical CT of traumatic injuries of the thoracic aorta
International Nuclear Information System (INIS)
Mengozzi, E.; Burzi, M.; Miceli, M.; Lipparini, M.; Sartoni Galloni, S.
2000-01-01
Acute thoracic aortic injuries account for up to 10-20% of fatalities in high-speed deceleration road accidents and have an estimated immediate fatality rate of 80-90%. Untreated survivors to acute trauma (10-20%) have a dismal prognosis: 30% of them die within 6 hours, 40-50% die within 24 hours, and 90% within 4 months. It was investigated the diagnostic accuracy of Helical Computed Tomography (Helical CT) in acute traumatic injuries of the thoracic aorta, and the role of this technique in the diagnostic management of trauma patients with a strong suspicion of aortic rupture. It was compared retrospectively the chest Helical CT findings of 256 trauma patients examined June 1995 through August 1999. Chest Helical CT examinations were performed according to trauma score, to associated traumatic lesions and to plain chest radiographic findings. All the examinations were performed with no intravenous contrast agent administration and the pitch 2 technique. After a previous baseline study, contrast-enhanced scans were acquired with pitch 1 in 87 patients. Helical CT showed aortic lesions in 9 of 256 patients examined. In all the 9 cases it was found a mediastinal hematoma and all of them had positive plain chest radiographic findings of mediastinal enlargement. Moreover, in 6 cases aortic knob blurring was also evident on plain chest film and in 5 cases depressed left mainstem bronchus and trachea deviation rightwards were observed. All aortic lesions were identified on axial scans and located at the isthmus of level. Aortic rupture was always depicted as pseudo diverticulum of the proximal descending tract and intimal flap. It was also found that periaortic hematoma in 6 cases and intramural hematoma in 1 case. There were non false positive results in the series: 7 patients with Helical CT diagnosis of aortic rupture were submitted to conventional aortography that confirmed both type and extension of the lesions as detected by Helical CT, and all findings were
Energy Technology Data Exchange (ETDEWEB)
Yang, Gaoqiang; Wu, Mingyang; Yi, Honggen; Wang, Jiannan, E-mail: wangjn@suda.edu.cn
2016-02-01
Silk fibroin heavy chain is the major protein component of Bombyx mori silk fibroin and is composed of 12 repetitive and 11 non-repetitive regions, with the non-repetitive domain consisting of a hydrophilic polypeptide chain. In order to determine the biomedical function of the non-repetitive domain or potentially use it to modify hydrophobic biomaterials, high-purity isolation is necessary. Previously, we cloned and extended a gene motif (f(1)) encoding the non-repetitive domain. Here, this motif and its multimers are inserted into a glutathione S-transferase (GST)-tagged fusion-protein expression vector. Motif f(1) and multimers f(4) and f(8) were expressed in Escherichia coli BL21 cells following isopropyl β-D-1-thiogalactopyranoside induction, purified by GST-affinity chromatography, and single bands of purified fusion proteins GST-F(1), GST-F(4), and GST-F(8), were visualized by sodium dodecyl sulfate-polyacrylamide gel electrophoresis. Target polypeptides F(1), F(4), and F(8), were cleaved clearly from the GST-fusion tag following thrombin digestion. Mass spectrometry results indicate that the molecular weights associated with fusion proteins GST-F(1), GST-F(4), and GST-F(8) are 31.5, 43.8, and 59.0 kDa, respectively, and with the cleaved polypeptides F(1), F(4), and F(8) are 4.8, 16.8, and 32.8 kDa, respectively. The F(1), F(4), and F(8) polypeptide chains are negatively charged with isoelectric points (pI) of 3.3, 3.2, and 3.0, respectively. The molecular weight and pI values of the polypeptide chains are consistent with the predicted values and the amino acid compositions similar to predicted sequences. FTIR and CD results show the molecular conformation of F(1) was mainly random coil, and more stable α-helix structure formed in longer molecular chain. - Highlights: • A non-repetitive domain and its multimers of silk fibroin were expressed by E. coli. • The corresponding target polypeptides F(1), F(4) and F(8) were cleaved clearly. • Their
Directory of Open Access Journals (Sweden)
Holm Liisa
2011-05-01
Full Text Available Abstract Background Bacterial adhesive proteins, called adhesins, are frequently the decisive factor in initiation of a bacterial infection. Characterization of such molecules is crucial for the understanding of bacterial pathogenesis, design of vaccines and development of antibacterial drugs. Because adhesins are frequently difficult to express, their characterization has often been hampered. Alternative expression methods developed for the analysis of adhesins, e.g. surface display techniques, suffer from various drawbacks and reports on high-level extracellular secretion of heterologous proteins in Gram-negative bacteria are scarce. These expression techniques are currently a field of active research. The purpose of the current study was to construct a convenient, new technique for identification of unknown bacterial adhesive polypeptides directly from the growth medium of the Escherichia coli host and to identify novel proteinaceous adhesins of the model organism Staphylococcus aureus. Results Randomly fragmented chromosomal DNA of S. aureus was cloned into a unique restriction site of our expression vector, which facilitates secretion of foreign FLAG-tagged polypeptides into the growth medium of E. coli ΔfliCΔfliD, to generate a library of 1663 clones expressing FLAG-tagged polypeptides. Sequence and bioinformatics analyses showed that in our example, the library covered approximately 32% of the S. aureus proteome. Polypeptides from the growth medium of the library clones were screened for binding to a selection of S. aureus target molecules and adhesive fragments of known staphylococcal adhesins (e.g coagulase and fibronectin-binding protein A as well as polypeptides of novel function (e.g. a universal stress protein and phosphoribosylamino-imidazole carboxylase ATPase subunit were detected. The results were further validated using purified His-tagged recombinant proteins of the corresponding fragments in enzyme-linked immunoassay and
Energy Technology Data Exchange (ETDEWEB)
Nishimura, Seiya, E-mail: n-seiya@kobe-kosen.ac.jp [Kobe City College of Technology, Kobe, Hyogo 651-2194 (Japan)
2015-02-15
Magnetic islands are externally produced by resonant magnetic perturbations (RMPs) in toroidal plasmas. Spontaneous annihilation of RMP-induced magnetic islands called self-healing has been observed in helical systems. A possible mechanism of the self-healing is shielding of RMP penetration by helical ripple-induced neoclassical flows, which give rise to neoclassical viscous torques. In this study, effective helical ripple rates in multi-helicity helical systems are revisited, and a multi-helicity effect on the self-healing is investigated, based on a theoretical model of rotating magnetic islands. It is confirmed that effective helical ripple rates are sensitive to magnetic axis positions. It is newly found that self-healing thresholds also strongly depend on magnetic axis positions, which is due to dependence of neoclassical viscous torques on effective helical ripple rates.
Saffari, H.; Moosavi, R.
2014-11-01
In this article, turbulent single-phase and two-phase (air-water) bubbly fluid flows in a vertical helical coil are analyzed by using computational fluid dynamics (CFD). The effects of the pipe diameter, coil diameter, coil pitch, Reynolds number, and void fraction on the pressure loss, friction coefficient, and flow characteristics are investigated. The Eulerian-Eulerian model is used in this work to simulate the two-phase fluid flow. Three-dimensional governing equations of continuity, momentum, and energy are solved by using the finite volume method. The k- ɛ turbulence model is used to calculate turbulence fluctuations. The SIMPLE algorithm is employed to solve the velocity and pressure fields. Due to the effect of a secondary force in helical pipes, the friction coefficient is found to be higher in helical pipes than in straight pipes. The friction coefficient increases with an increase in the curvature, pipe diameter, and coil pitch and decreases with an increase in the coil diameter and void fraction. The close correlation between the numerical results obtained in this study and the numerical and empirical results of other researchers confirm the accuracy of the applied method. For void fractions up to 0.1, the numerical results indicate that the friction coefficient increases with increasing the pipe diameter and keeping the coil pitch and diameter constant and decreases with increasing the coil diameter. Finally, with an increase in the Reynolds number, the friction coefficient decreases, while the void fraction increases.
Buhmann, Stefan Yoshi
2012-01-01
In this book, a modern unified theory of dispersion forces on atoms and bodies is presented which covers a broad range of advanced aspects and scenarios. Macroscopic quantum electrodynamics is shown to provide a powerful framework for dispersion forces which allows for discussing general properties like their non-additivity and the relation between microscopic and macroscopic interactions. It is demonstrated how the general results can be used to obtain dispersion forces on atoms in the presence of bodies of various shapes and materials. Starting with a brief recapitulation of volume I, this volume II deals especially with bodies of irregular shapes, universal scaling laws, dynamical forces on excited atoms, enhanced forces in cavity quantum electrodynamics, non-equilibrium forces in thermal environments and quantum friction. The book gives both the specialist and those new to the field a thorough overview over recent results in the field. It provides a toolbox for studying dispersion forces in various contex...
Tardif, Steve; Brady, Heidi A; Breazeale, Kelly R; Bi, Ming; Thompson, Leslie D; Bruemmer, Jason E; Bailey, Laura B; Hardy, Daniel M
2010-02-01
Zonadhesin is a rapidly evolving protein in the sperm acrosome that confers species specificity to sperm-zona pellucida adhesion. Though structural variation in zonadhesin likely contributes to its species-specific function, the protein has not previously been characterized in organisms capable of interbreeding. Here we compared properties of zonadhesin in several animals, including the horse (Equus caballus), donkey (E. asinus), and Grevy's zebra (E. grevyi) to determine if variation in zonadhesin correlates with ability of gametes to cross-fertilize. Zonadhesin localized to the apical acrosomes of spermatozoa from all three Equus species, similar to its localization in other animals. Likewise, in horse and donkey testis, zonadhesin was detected only in germ cells, first in the acrosomal granule of round spermatids and then in the developing acrosomes of elongating spermatids. Among non-Equus species, D3-domain polypeptides of mature, processed zonadhesin varied markedly in size and detergent solubility. However, zonadhesin D3-domain polypeptides in horse, donkey, and zebra spermatozoa exhibited identical electrophoretic mobility and detergent solubility. Equus zonadhesin D3-polypeptides (p110/p80 doublet) were most similar in size to porcine and bovine zonadhesin D3-polypeptides (p105). Sequence comparisons revealed that the horse zonadhesin precursor's domain content and arrangement are similar to those of zonadhesin from other large animals. Partial sequences of horse and donkey zonadhesin were much more similar to each other (>99% identity) than they were to orthologous sequences of human, pig, rabbit, and mouse zonadhesin (52%-72% identity). We conclude that conservation of zonadhesin D3-polypeptide properties correlates with ability of Equus species to interbreed.
Bursty fluctuation characteristics in SOL/divertor plasmas of Large Helical Device
International Nuclear Information System (INIS)
Ohno, N.; Masuzaki, S.; Morisaki, T.; Ohyabu, N.; Komori, A.; Budaev, V.P.; Miyoshi, H.; Takamura, S.
2006-10-01
Bursty electrostatic fluctuation in the scrape off layer (SOL) and the divertor region of the Large Helical Device (LHD) have been investigated by using a Langmuir probe array on a divertor plate and a reciprocating Langmuir probe. Large positive bursty events were often observed in the ion saturation current measured with a divertor probe near the divertor leg at which the magnetic line of force connected to the area of a low-field side with a short connection length. Condition averaging result of the positive bursty events indicates the intermittent feature with a rapid increase and a slow decay is similar to that of plasma blobs observed in tokamaks. On the other hand, at a striking point with a long connection length, negative spikes were observed. Statistical analysis based on probability distribution function (PDF) was employed to investigate the bursty fluctuation property. The observed scaling exponents disagree with the predictions for the self-organized criticality (SOC) paradigm. (author)
Conceptual design of the cryogenic system for the helical-type fusion power plant FFHR
International Nuclear Information System (INIS)
Yamada, S.; Sagara, A.; Imagawa, S.; Mito, T.; Motojima, O.
2007-01-01
The force-free helical-type fusion reactor, FFHR, is proposed on the basis of the engineering achievements and confinement properties of the experimental fusion device of LHD. The outputs of the thermal power and electric power are optimized to 3 and 1 GW, respectively. Total weight of the superconducting (SC) coils and their supporting structures of the FFHR are estimated to be 18,000 t. An equivalent refrigeration capacity of 98 kW is necessary for coping with different plant loads. Mass-flow rate of the main circulation compressors is 9.5 kg/s and their power consumption is 29 MW. The FFHR is used for the co-generation system of electricity and hydrogen. The pressurized hydrogen of 100 t per day can be produced, when the stem electrolyzer of 150 MW class is applied. Electric power consumption of the hydrogen liquefaction with 100 t per day is estimated to be 26 MW
Finite element analysis of helical flows in human aortic arch: A novel index
Lee, Cheng-Hung; Liu, Kuo-Sheng; Jhong, Guan-Heng; Liu, Shih-Jung; Hsu, Ming-Yi; Wang, Chao-Jan; Hung, Kuo-Chun
2014-01-01
This study investigates the helical secondary flows in the aortic arch using finite element analysis. The relationship between helical flow and the configuration of the aorta in patients of whose three-dimensional images constructed from computed tomography scans was examined. A finite element model of the pressurized root, arch, and supra-aortic vessels was developed to simulate the pattern of helical secondary flows. Calculations indicate that most of the helical secondary flow was formed i...
Ignition access in a D-3He helical reactor
International Nuclear Information System (INIS)
Mitarai, Osamu
2003-01-01
Ignition access in a D- 3 He helical reactor is studied based on 0-dimensional particle and power balance equations for deuterium, tritium, helium-3, alpha ash, proton ash, electron density and temperature. The calculations are based on the following experimental facts observed in LHD. (author)
Field-theoretic calculation of kinetic helicity flux
Indian Academy of Sciences (India)
Given all these practical aspects, kinetic helicity is an important quantity to study in fluid turbulence. Turbulence involves millions of interacting modes. It is very difficult to analyze these modes theoretically as well as numerically. In recent times, a new numeri- cal procedure called 'large eddy simulations' (LES) has become ...
Is gadolinium a helical antiferromagnet or a collinear ferromagnet?
Indian Academy of Sciences (India)
that a helical spin structure similar to that prevalent in other heavy rare-earth .... magnetocrystalline anisotropy factor, HK is the uniaxial anisotropy field and MS is .... lends firm support to the observation that the asymptotic critical behaviour of ...
Helical Phase Inflation and Monodromy in Supergravity Theory
Directory of Open Access Journals (Sweden)
Tianjun Li
2015-01-01
Full Text Available We study helical phase inflation which realizes “monodromy inflation” in supergravity theory. In the model, inflation is driven by the phase component of a complex field whose potential possesses helicoid structure. We construct phase monodromy based on explicitly breaking global U(1 symmetry in the superpotential. By integrating out heavy fields, the phase monodromy from single complex scalar field is realized and the model fulfills natural inflation. The phase-axion alignment is achieved from explicitly symmetry breaking and gives super-Planckian phase decay constant. The F-term scalar potential provides strong field stabilization for all the scalars except inflaton, which is protected by the approximate global U(1 symmetry. Besides, we show that helical phase inflation can be naturally realized in no-scale supergravity with SU(2,1/SU(2×U(1 symmetry since the supergravity setup needed for phase monodromy is automatically provided in the no-scale Kähler potential. We also demonstrate that helical phase inflation can be reduced to another well-known supergravity inflation model with shift symmetry. Helical phase inflation is free from the UV-sensitivity problem although there is super-Planckian field excursion, and it suggests that inflation can be effectively studied based on supersymmetric field theory while a UV-completed framework is not prerequisite.
Study of electric field pulsation in helical plasmas
International Nuclear Information System (INIS)
Toda, S; Itoh, K
2011-01-01
A model for the experimental results of the periodic oscillation of the electric field, so-called the electric field pulsation, observed in the Compact Helical Device (Fujisawa et al 1998 Phys. Rev. Lett. 81 2256) and the Large Helical Device (Shimizu et al 2010 Plasma Fusion Res. 5 S1015) is presented. A self-generated oscillation of the radial electric field is shown as the simulation result in helical plasmas. The reduction of the anomalous transport diffusivity in the core region is observed due to the strong shear of the radial electric field when the positive electric field is shown in the core region in the periodic oscillation of E r . Two different time scales are found in the self-generated oscillation, which are the transport time scale and the fast time scale at the transition of the radial electric field. This oscillation because of the hysteresis characteristic is attributed to the electric field pulsation observed in helical plasmas. The parameter region of the condition for the self-generated oscillation is derived. It is shown that the multiple solutions of the radial electric field for the ambipolar condition are necessary but not sufficient for obtaining the self-generated oscillation.
Initial Results from Coaxial Helicity Injection Experiments in NSTX
International Nuclear Information System (INIS)
Raman, R.; Jarboe, T.R.; Mueller, D.; Schaffer, M.J.; Maqueda, R.; Nelson, B.A.; Sabbagh, S.; Bell, M.; Ewig, R.; Fredrickson, E.; Gates, D.; Hosea, J.; Ji, H.; Kaita, R.; Kaye, S.M.; Kugel, H.; Maingi, R.; Menard, J.; Ono, M.; Orvis, D.; Paolette, F.; Paul, S.; Peng, M.; Skinner, C.H.; Wilgen, W.; Zweben, S.
2001-01-01
Coaxial Helicity Injection (CHI) has been investigated on the National Spherical Torus Experiment (NSTX). Initial experiments produced 130 kA of toroidal current without the use of the central solenoid. The corresponding injector current was 20 kA. Discharges with pulse lengths up to 130 ms have been produced
Overview of quasi single helicity experiments in reversed field pinches
International Nuclear Information System (INIS)
Martin, P.; Marrelli, L.; Spizzo, G.
2003-01-01
We report the results of an experimental and theoretical project dedicated to the study of Quasi Single Helicity Reversed Field Pinch plasmas. The project has involved several RFP devices and numerical codes. It appears that QSH spectra are a feature common to all the experiments. (author)
Deceleration of arginine kinase refolding by induced helical structures.
Li, Hai-Long; Zhou, Sheng-Mei; Park, Daeui; Jeong, Hyoung Oh; Chung, Hae Young; Yang, Jun-Mo; Meng, Fan-Guo; Hu, Wei-Jiang
2012-04-01
Arginine kinase (AK) is a key metabolic enzyme for keeping energy balance in invertebrates. Therefore, regulation of the enzymatic activity and the folding studies of AK from the various invertebrates have been the focus of investigation. We studied the effects of helical structures by using hexafluoroisopropanol (HFIP) on AK folding. Folding kinetic studies showed that the folding rates of the urea-denatured AKs were significantly decelerated after being induced in various concentrations of HFIP. AK lost its activity completely at concentrations greater than 60%. The results indicated that the HFIP-induced helical structures in the denatured state play a negative role in protein folding, and the helical structures induced in 5% (v/v) HFIP act as the most effective barrier against AK taking its native structure. The computational docking simulations (binding energies for -2.19 kcal/mol for AutoDock4.2 and -20.47 kcal/mol for Dock6.3) suggested that HFIP interacts with the several important residues that are predicted by both programs. The excessively pre-organized helical structures not only hampered the folding process, but also ultimately brought about changes in the three-dimensional conformation and biological function of AK.
Helicity and other conservation laws in perfect fluid motion
Serre, Denis
2018-03-01
In this review paper, we discuss helicity from a geometrical point of view and see how it applies to the motion of a perfect fluid. We discuss its relation with the Hamiltonian structure, and then its extension to arbitrary space dimensions. We also comment about the existence of additional conservation laws for the Euler equation, and its unlikely integrability in Liouville's sense.
Experiments to measure the gluon helicity distribution in protons
International Nuclear Information System (INIS)
Spinka, H.; Beddo, M.E.; Underwood, D.G.
1993-01-01
Several experiments are described that could obtain information about the gluon helicity distribution in protons. These experiments include inclusive direct-γ, direct-γ + jet, jet, and jet + jet production with colliding beams of longitudinally-polarized protons. Some rates and kinematics are also discussed
Recent helicity source and power supply improvements in CTX
International Nuclear Information System (INIS)
Henins, I.; Knox, S.O.; Jarboe, T.R.; Barnes, C.W.
1985-01-01
Since the last CT Symposium, two major changes in CTX have been the introduction of pulse forming networks (PFNs) to drive the coaxial electrode helicity source, and the very recent installation of a larger source with electrode diameters about twice of the previous ones. The power supplies used for CTX have ranged from the simple connection of the capacitor bank across the electrode collector plates (slow mode) to the more sophisticated PFNs, described here, which optimize the energy transfer from the capacitor bank to the magnetic fields of the spheromak. Using the PFNs, the formation and sustainment phase to peak toroidal plasma current lasts longer (approx. =0.7 ms) than in the slow mode (approx. =0.05 ms), thus lowering the peak current that must flow through the electrode surfaces. Also, by supplying the source electrodes with both a square pulse current waveform and a quasi-steady source flux, phi/sub g/, one can generate helicity at a constant source lambda/sub g/ parameter. The use of a larger diameter helicity source will improve the energy efficiency of helicity injection and allow higher source current for the same surface current density because of the larger electrode surface area
Standard and Nonstandard Craniospinal Radiotherapy Using Helical TomoTherapy
International Nuclear Information System (INIS)
Parker, William; Brodeur, Marylene; Roberge, David; Freeman, Carolyn
2010-01-01
Purpose: To show the advantages of planning and delivering craniospinal radiotherapy with helical TomoTherapy (TomoTherapy Inc., Madison, WI) by presenting 4 cases treated at our institution. Methods and Materials: We first present a standard case of craniospinal irradiation in a patient with recurrent myxopapillary ependymoma (MPE) and follow this with 2 cases requiring differential dosing to multiple target volumes. One of these, a patient with recurrent medulloblastoma, required a lower dose to be delivered to the posterior fossa because the patient had been previously irradiated to the full dose, and the other required concurrent boosts to leptomeningeal metastases as part of his treatment for newly diagnosed MPE. The final case presented is a patient with pronounced scoliosis who required spinal irradiation for recurrent MPE. Results: The four cases presented were planned and treated successfully with Helical Tomotherapy. Conclusions: Helical TomoTherapy delivers continuous arc-based intensity-modulated radiotherapy that gives high conformality and excellent dose homogeneity for the target volumes. Increased healthy tissue sparing is achieved at higher doses albeit at the expense of larger volumes of tissue receiving lower doses. Helical TomoTherapy allows for differential dosing of multiple targets, resulting in very elegant dose distributions. Daily megavoltage computed tomography imaging allows for precision of patient positioning, permitting a reduction in planning margins and increased healthy tissue sparing in comparison with standard techniques.
Helical undulator based on partial redistribution of uniform magnetic field
Balal, N.; Bandurkin, I. V.; Bratman, V. L.; Fedotov, A. E.
2017-12-01
A new type of helical undulator based on redistribution of magnetic field of a solenoid by ferromagnetic helix has been proposed and studied both in theory and experiment. Such undulators are very simple and efficient for promising sources of coherent spontaneous THz undulator radiation from dense electron bunches formed in laser-driven photo-injectors.
Helical undulator based on partial redistribution of uniform magnetic field
Directory of Open Access Journals (Sweden)
N. Balal
2017-12-01
Full Text Available A new type of helical undulator based on redistribution of magnetic field of a solenoid by ferromagnetic helix has been proposed and studied both in theory and experiment. Such undulators are very simple and efficient for promising sources of coherent spontaneous THz undulator radiation from dense electron bunches formed in laser-driven photo-injectors.
Transmembrane helices can induce domain formation in crowded model membranes
Domanski, Jan; Marrink, Siewert J.; Schäfer, Lars V.
We studied compositionally heterogeneous multi-component model membranes comprised of saturated lipids, unsaturated lipids, cholesterol, and a-helical TM protein models using coarse-grained molecular dynamics simulations. Reducing the mismatch between the length of the saturated and unsaturated
Helicity of Solar Active Regions from a Dynamo Model Piyali ...
Indian Academy of Sciences (India)
- tions with positive and negative helicities are denoted by '+' and 'o' respectively. A flux eruption takes place in our model whenever the toroidal field at the bottom of the SCZ exceeds a critical value. Whenever an eruption takes place in our ...
Institute for Fusion Research and Large Helical Device program
International Nuclear Information System (INIS)
Iiyoshi, Atsuo
1989-01-01
In the research on nuclear fusion, the final objective is to materialize nuclear fusion reactors, and for the purpose, it is necessary to cause nuclear combustion by making the plasma of higher than 100 million deg and confine it for a certain time. So far in various universities, the researches on diversified fusion processes have been advanced, but in February, 1986, the Science Council issued the report 'Nuclear fusion research in universities hereafter'. As the next large scale device, an external conductor system helical device was decided, and it is desirable to found the organization for joint utilization by national universities to promote the project. The researches on the other processes are continued by utilizing the existing facilitie. The reason of selecting a helical device is the data base of the researches carried out so far can be utilized sufficiently, it is sufficiently novel even after 10 years from now, and many researchers can be collected. The place of the research is Toki City, Gifu Prefecture, where the Institute of Plasma Physics, Nagoya University, is to be moved. The basic concept of the superconducting helical device project, the trend of nuclear fusion development in the world, the physical research using a helical system and so on are reported. (Kako, I.)
Experimental and theoretical studies on a novel helical architecture ...
Indian Academy of Sciences (India)
A novel two-dimensional (2D), layered, helical supramolecular architecture constructed via cooperative hydrogen bond and halogen bonds was synthesized and characterized: [(BMBA)₂(TPB)]n (1) [BMBA= 3-bromo-2-methylbenzoic acid, TPB = 1,2,3,4-tetra-(4-pyridyl)-butane]. Density functional theory (DFT) calculations ...
Directory of Open Access Journals (Sweden)
Ting-Ying Jiang
Full Text Available The N-terminal starch binding domain of Rhizopus oryzae glucoamylase (RoSBD has a high binding affinity for raw starch. RoSBD has two ligand-binding sites, each containing a ligand-binding clamp: a polyN clamp residing near binding site I is unique in that it is expressed in only three members of carbohydrate binding module family 21 (CBM21 members, and a Y32/F58 clamp located at binding site II is conserved in several CBMs. Here we characterized different roles of these sites in the binding of insoluble and soluble starches using an amylose-iodine complex assay, atomic force microscopy, isothermal titration calorimetry, site-directed mutagenesis, and structural bioinformatics. RoSBD induced the release of iodine from the amylose helical cavity and disrupted the helical structure of amylose type III, thereby significantly diminishing the thickness and length of the amylose type III fibrils. A point mutation in the critical ligand-binding residues of sites I and II, however, reduced both the binding affinity and amylose helix disruption. This is the first molecular model for structure disruption of the amylose helix by a non-hydrolytic CBM21 member. RoSBD apparently twists the helical amylose strands apart to expose more ligand surface for further SBD binding. Repeating the process triggers the relaxation and unwinding of amylose helices to generate thinner and shorter amylose fibrils, which are more susceptible to hydrolysis by glucoamylase. This model aids in understanding the natural roles of CBMs in protein-glycan interactions and contributes to potential molecular engineering of CBMs.
A Lennard-Jones-like perspective on first order transitions in biological helices
DEFF Research Database (Denmark)
Oskolkov, Nikolay N.; Bohr, Jakob
2013-01-01
Helical structures with Lennard-Jones self-interactions are studied for optimal conformations. For this purpose, their self-energy is analyzed for extrema with respect to the geometric parameters of the helices. It is found that Lennard-Jones helices exhibit a first order phase transition from...
Numerical analysis of fluid flow and heat transfer in a helical ...
African Journals Online (AJOL)
Helical channels are widely applied in different application areas. In a converging diverging nozzle, helical channels are mainly used for cooling of its wall. The characteristics of fluid flow and heat transfer inside helical duct for a converging diverging nozzle is not commonly dealt in present literatures. In this paper CFD ...
The generic geometry of helices and their close-packed structures
DEFF Research Database (Denmark)
Olsen, Kasper; Bohr, Jakob
2010-01-01
The formation of helices is an ubiquitous phenomenon for molecular structures whether they are biological, organic, or inorganic, in nature. Helical structures have geometrical constraints analogous to close packing of three-dimensional crystal structures. For helical packing the geometrical cons...
Form coefficient of helical toroidal solenoids
International Nuclear Information System (INIS)
Amelin, V.Z.; Kunchenko, V.B.
1982-01-01
For toroidal solenoids with continuous spiral coil, winded according to the laws of equiinclined and simple cylindrical spirals with homogeneous, linearly increasing to the coil periphery and ''Bitter'' distribution of current density, the analytical expressions for the dependence between capacity consumed and generated magnetic field, expressions for coefficients of form similar to Fabry coefficient for cylindrical solenoids are obtained and dependence of the form coefficient and relative volume of solenoid conductor on the number of revolutions of screw line per one circumvention over the large torus radius is also investigated. Analytical expressions of form coefficients and graphical material permit to select the optimum geometry as to capacity consumed both for spiral (including ''force-free'') and conventional toroidal solenoids of magnetic systems in thermonulear installations
International Nuclear Information System (INIS)
Hsieh, Chen-Hsi; Shueng, Pei-Wei; Wei, Ming-Chow; Lee, Hsing-Yi; Hsiao, Sheng-Mou; Chen, Chien-An; Wang, Li-Ying; Hsieh, Yen-Ping; Tsai, Tung-Hu; Chen, Yu-Jen
2009-01-01
To review the experience and to evaluate the treatment plan of using helical tomotherapy (HT) for the treatment of cervical cancer. Between November 1st, 2006 and May 31, 2009, 10 cervical cancer patients histologically confirmed were enrolled. All of the patients received definitive concurrent chemoradiation (CCRT) with whole pelvic HT (WPHT) followed by brachytherapy. During WPHT, all patients were treated with cisplatin, 40 mg/m 2 intravenously weekly. Toxicity of treatment was scored according to the Common Terminology Criteria for Adverse Events v3.0 (CTCAE v3.0). The mean survival was 25 months (range, 3 to 27 months). The actuarial overall survival, disease-free survival, locoregional control and distant metastasis-free rates at 2 years were 67%, 77%, 90% and 88%, respectively. The average of uniformity index and conformal index was 1.06 and 1.19, respectively. One grade 3 of acute toxicity for diarrhea, thrombocytopenia and three grade 3 leucopenia were noted during CCRT. Only one grade 3 of subacute toxicity for thrombocytopenia was noted. There were no grade 3 or 4 subacute toxicities of anemia, leucopenia, genitourinary or gastrointestinal effects. Compared with conventional whole pelvic radiation therapy (WPRT), WPHT decreases the mean dose to rectum, bladder and intestines successfully. HT provides feasible clinical outcomes in locally advanced cervical cancer patients. Long-term follow-up and enroll more locally advanced cervical carcinoma patients by limiting bone marrow radiation dose with WPHT technique is warranted
Han, P; Lucero, M T
2005-01-01
Pituitary adenylate cyclase activating polypeptide has been shown to reduce apoptosis in neonatal cerebellar and olfactory receptor neurons, however the underlying mechanisms have not been elucidated. In addition, the neuroprotective effects of pituitary adenylate cyclase activating polypeptide have not been examined in adult tissues. To study the effects of pituitary adenylate cyclase activating polypeptide on neurons in apoptosis, we measured caspase activation in adult olfactory receptor neurons in vitro. Interestingly, we found that the protective effects of pituitary adenylate cyclase activating polypeptide were related to the absence of a 4-aminopyridine (IC50=144 microM) sensitive rapidly inactivating potassium current often referred to as A-type current. In the presence of 40 nM pituitary adenylate cyclase activating polypeptide 38, both A-type current and activated caspases were significantly reduced. A-type current reduction by pituitary adenylate cyclase activating polypeptide was blocked by inhibiting the phospholipase C pathway, but not the adenylyl cyclase pathway. Our observation that 5 mM 4-aminopyridine mimicked the caspase inhibiting effects of pituitary adenylate cyclase activating polypeptide indicates that A-type current is involved in apoptosis. This work contributes to our growing understanding that potassium currents are involved with the activation of caspases to affect the balance between cell life and death.
Plasma transport simulation modeling for helical confinement systems
International Nuclear Information System (INIS)
Yamazaki, K.; Amano, T.
1991-08-01
New empirical and theoretical transport models for helical confinement systems are developed based on the neoclassical transport theory including the effect of radial electric field and multi-helicity magnetic components, and the drift wave turbulence transport for electrostatic and electromagnetic modes, or the anomalous semi-empirical transport. These electron thermal diffusivities are compared with CHS (Compact Helical System) experimental data, which indicates that the central transport coefficient of the ECH plasma agrees with the neoclassical axi-symmetric value and the transport outside the half radius is anomalous. On the other hand, the transport of NBI-heated plasmas is anomalous in the whole plasma region. This anomaly is not explained by the electrostatic drift wave turbulence models in these flat-density-profile discharges. For the detailed prediction of plasma parameters in LHD (Large Helical Device), 3-D(dimensional) equilibrium/1-D transport simulations including empirical or drift wave turbulence models are carried out, which suggests that the global confinement time of LHD is determined mainly by the electron anomalous transport near the plasma edge region rather than the helical ripple transport in the core region. Even if the ripple loss can be eliminated, the increase of the global confinement is 10%. However, the rise in the central ion temperature is more than 20%. If the anomalous loss can be reduced to the half level of the present scaling, like so-called 'H-mode' of the tokamak discharge, the neoclassical ripple loss through the ion channel becomes important even in the plasma core. The 5% radial inward shift of the plasma column with respect to the major radius is effective for improving plasma confinement and raising more than 50% of the fusion product by reducing this neoclassical asymmetric ion transport loss and increasing 10% in the plasma radius. (author)