WorldWideScience

Sample records for head island sc

  1. 46 CFR 7.70 - Folly Island, SC to Hilton Head Island, SC.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Folly Island, SC to Hilton Head Island, SC. 7.70 Section... BOUNDARY LINES Atlantic Coast § 7.70 Folly Island, SC to Hilton Head Island, SC. (a) A line drawn from the southernmost extremity of Folly Island to latitude 32°35′ N. longitude 79°58.2′ W. (Stono Inlet Lighted...

  2. 33 CFR 80.712 - Morris Island, SC to Hilton Head Island, SC.

    Science.gov (United States)

    2010-07-01

    ... 10 across Stono River to the shoreline of Sandy Point. (c) A line drawn from the southernmost extremity of Seabrook Island 257° true across the North Edisto River Entrance to the shore of Botany Bay...

  3. The capybara, Hydrochoerus hydrochaeris (Mammalia: Rodentia, found at the archaeological site SC PRV 02, Santa Catarina Island, Brasil

    Directory of Open Access Journals (Sweden)

    Paulo César Simões-Lopes

    2005-11-01

    Full Text Available Santa Catarina Island possesses dozens of archeological sites where the skeletal remains of a great array of animals can be found. The goal of this study was to quantify the skeletal remains of capybaras found at the archeological site SC PRV 02 (1067 to 1735 BP, located in the northern part of the island, along the shores of Lagoa da Conceição, a saltwater lagoon. Thirty-seven skeletal fragments of at least 12 different individuals were identified. The anatomic regions of the capybaras most sought-after by pre-colonial inhabitants were the anterior and posterior limbs. About 40% of the skeletal fragments did not show any epiphyseal fusion with the shaft. Approximately 48% of the fragments found presented evidence of human activity. Our analyses suggest that capybaras played an important role in the diet of these inhabitants and that they were also used for the confection of different functional goods. We diagnosed the manipulation techniques used to obtain these goods, such as percussion and transversal section. The evidence of carbonization and superficial incisions indicates dismembering, preparation, and consumption of capybaras for feeding. Similar techniques were found at other archeological sites of the same age, suggesting that even though pre-colonial inhabitants of the island were considered to be fishermen, capybaras represented a well-appreciated resource.

  4. Incidental catch of marine turtles by the artisanal fisheries on Santa Catarina Island, SC, Brazil

    Directory of Open Access Journals (Sweden)

    Natalia Hanazaki

    2006-12-01

    Full Text Available The five species of sea turtles, which inhabit the Brazilian shore, have a wordwide distribution and are threatened with extinction. The south of Brazil is characterized as a feeding and breeding area of at least three of these species. The presence of turtles close to the shore and their incidental catch are occurrences reported by artisan fishermen of the Island of Santa Catarina in this work. The study was based on a questionnaire, applied to fishermen and fishfarmers at selected spots on the island. Scientific and popular names were matched using illustrations. The spots with the highest number of events and captures were close to the islands, rocky coasts and stony grounds, i.e. areas related with the foraging habits of the most abundant species, Chelonia mydas. The place, depth and size of the net are characteristics, which influence the capture. The time the net remains in the water is a factor which is fundamental to the survival of the captured turtles. The flesh of the turtle is used as an occasional feeding resource. Capacitation programs and training applied to the communities involved are recommended.

  5. A systematic literature review of pediculosis due to head lice in the Pacific Island Countries and Territories: what country specific research on head lice is needed?

    Science.gov (United States)

    Speare, Rick; Harrington, Humpress; Canyon, Deon; Massey, Peter D

    2014-06-24

    Lack of guidelines on control of pediculosis in the Solomon Islands led to a search for relevant evidence on head lice in the Pacific Island Countries and Territories (PICTs). The aim of this search was to systematically evaluate evidence in the peer reviewed literature on pediculosis due to head lice (Pediculus humanus var capitis) in the 22 PICTs from the perspective of its value in informing national guidelines and control strategies. PubMed, Web of Science, CINAHL and Scopus were searched using the terms (pediculosis OR head lice) AND each of the 22 PICTs individually. PRISMA methodology was used. Exclusion criteria were: i) not on topic; ii) publications on pediculosis not relevant to the country of the particular search; iii) in grey literature. Of 24 publications identified, only 5 were included. Four related to treatment and one to epidemiology. None contained information relevant to informing national guidelines. Current local evidence on head lice in the PICTs is minimal and totally inadequate to guide any recommendations for treatment or control. We recommend that local research is required to generate evidence on: i) epidemiology; ii) knowledge, attitudes and practices of health care providers and community members; iii) efficacy of local commercially available pharmaceutical treatments and local customary treatments; iv) acceptability, accessibility and affordability of available treatment strategies; and iv) appropriate control strategies for families, groups and institutions. We also recommend that operational research be done by local researchers based in the PICTs, supported by experienced head lice researchers, using a two way research capacity building model.

  6. Percolation cooling of the Three Mile Island Unit 2 lower head by way of thermal cracking and gap formation

    DEFF Research Database (Denmark)

    Thomsen, K.L.

    2002-01-01

    Two partial models have been developed to elucidate the Three Mile Island Unit 2 lower head coolability by water percolation from above into the thermally cracking debris bed and into a gap between the debris and the wall The bulk permeability of the cracked top crust is estimated based on simple...

  7. Temporal variation in seed predation by insects in a population of Syagrus romanzoffiana (Arecaceae) in Santa Catarina Island, SC, Brazil.

    Science.gov (United States)

    da Silva, F R; Begnini, R M; Lopes, B C; Castellani, T T

    2012-02-01

    Insect seed predation may vary depending on seed production. The present study considers the hypothesis that the rates of seed predation tend to be smaller in years of higher fruit production. Thus, we monitored the production of fruits and predation of seeds of the palm Syagrus romanzoffiana over 2 years in the Atlantic Forest (Parque Municipal da Lagoa do Peri, Florianópolis, SC, Brazil), between July 2006 and June 2008. Plots of 0.25 m(2) were fitted under 20 mother plants and fruits were monthly collected for assessment of abundance and seed predation. There was variation in fruit production between the 2 years and among reproductive plants. Predation rates were high and occurred in the predispersal phase by the Curculionidae Revena rubiginosa Boheman, Anchylorhynchus aegrotus Fahraeus, and Anchylorhynchus variabilis Gyllenhal. Seed predation by these species of Anchylorhynchus is first registered in the present study. In average, about 60% of the seeds monthly produced in the population tend to escape insect predation in year of high or low production, becoming available for recruitment. The predation rate was not related to the amount of fruits produced per reproductive plant. Also, different than expected, there was a positive relation between the rates of seed predation and the total of fruits produced monthly on the plots. Thus, no evidence for the satiation of insect seed predators was found in this study with S. romanzoffiana.

  8. Reproductive success of South American terns (Sterna hirundinacea from Cardos Islands, Florianópolis, SC, Brazil

    Directory of Open Access Journals (Sweden)

    Hélio A.A. Fracasso

    2012-06-01

    Full Text Available Sterna hirundinacea (Lesson, 1831 is a migratory seabird that breeds in the Pacific Coast (from Peru to Chile and along the Atlantic coast of South America from Espírito Santo (Brazil to Terra del Fuego (Argentina. This paper describes the reproductive success of South American Terns on Cardos Island, Florianopolis, Brazil in the breeding seasons of 2003, 2005 and 2006. The colony was formed in mid-May in 2003 and early April in other years, with the total number of nests ranging from 1,852 in 2006 to 2,486 in 2005. Hatching success was estimated at 76.39% in 2006, 62.73% in 2003 and 41.1% in 2005, the lowest value that could be attributed to predation by hawks Caracara plancus, lizards Tupinambis merianae and black vulture Coragyps atratus. The chicks hatched in July in 2003, and in June 2005 and 2006, and fledging success was 50.94%, 35.96 and 53.47% respectively. Cardos Island has been constantly used as a breeding site by South American Terns, and therefore represents an important area for conservation of this species. This success could be attributed to low pressure of Kelp gulls (Larus dominicanus, the main predator of seabirds along the Brazilian coast.Sterna hirundinacea (Lesson, 1831 é uma ave migratória que nidifica na costa do Pacífico (do Peru ao Chile e ao longo do Atlântico Sul do Espírito Santo (Brasil até a Terra do Fogo (Argentina. Este trabalho descreve o sucesso reprodutivo do trinta-réis do bico-vermelho na ilha dos Cardos, Florianópolis, Brasil, durante as temporadas reprodutivas de 2003, 2005 e 2006. A formação da colônia ocorreu em maio de 2003 e inicio de abril nos outros anos, com um total de ninhos variando entre 1.852 em 2006 a 2.486 em 2005. O sucesso de incubação foi estimado em 76,39% (2006, 62,73% (2003 e 41,1% em 2005, sendo que os menores valores puderam ser atribuídos a predação dos gaviões Caracara plancus, lagartos Tupinambis merianae e urubus Coragyps atratus. As primeiras eclosões foram

  9. Sea-Floor geology and character of Eastern Rhode Island Sound West of Gay Head, Massachusetts

    Science.gov (United States)

    Poppe, L.J.; McMullen, K.Y.; Ackerman, S.D.; Blackwood, D.S.; Irwin, B.J.; Schaer, J.D.; Forrest, M.R.

    2011-01-01

    Gridded multibeam bathymetry covers approximately 102 square kilometers of sea floor in eastern Rhode Island Sound west of Gay Head, Massachusetts. Although originally collected for charting purposes during National Oceanic and Atmospheric Administration hydrographic survey H11922, these acoustic data and the sea-floor stations subsequently occupied to verify them (1) show the composition and terrain of the seabed, (2) provide information on sediment transport and benthic habitat, and (3) are part of an expanding series of studies that provide a fundamental framework for research and management activities (for example, windfarms and fisheries) along the Massachusetts inner continental shelf. Most of the sea floor in the study area has an undulating to faintly rippled appearance and is composed of bioturbated muddy sand, reflecting processes associated with sediment sorting and reworking. Shallower areas are composed of rippled sand and, where small fields of megaripples are present, indicate sedimentary environments characterized by processes associated with coarse bedload transport. Boulders and gravel were found on the floors of scour depressions and on top of an isolated bathymetric high where erosion has removed the Holocene marine sediments and exposed the underlying relict lag deposits of Pleistocene drift. The numerous scour depressions, which formed during storm-driven events, result in the juxtaposition of sea-floor areas with contrasting sedimentary environments and distinct gravel, sand, and muddy sand textures. This textural heterogeneity in turn creates a complex patchwork of habitats. Our observations of local variations in community structure suggest that this small-scale textural heterogeneity adds dramatically to the sound-wide benthic biological diversity.

  10. Hydrogeology, water quality, and saltwater intrusion in the Upper Floridan Aquifer in the offshore area near Hilton Head Island, South Carolina, and Tybee Island, Georgia, 1999-2002

    Science.gov (United States)

    Falls, W. Fred; Ransom, Camille; Landmeyer, James E.; Reuber, Eric J.; Edwards, Lucy E.

    2005-01-01

    To assess the hydrogeology, water quality, and the potential for saltwater intrusion in the offshore Upper Floridan aquifer, a scientific investigation was conducted near Tybee Island, Georgia, and Hilton Head Island, South Carolina. Four temporary wells were drilled at 7, 8, 10, and 15 miles to the northeast of Tybee Island, and one temporary well was drilled in Calibogue Sound west of Hilton Head Island. The Upper Floridan aquifer at the offshore and Calibogue sites includes the unconsolidated calcareous quartz sand, calcareous quartz sandstone, and sandy limestone of the Oligocene Lazaretto Creek and Tiger Leap Formations, and the limestone of the late Eocene Ocala Limestone and middle Avon Park Formation. At the 7-, 10-, and 15-mile sites, the upper confining unit between the Upper Floridan and surficial aquifers correlates to the Miocene Marks Head Formation. Paleochannel incisions have completely removed the upper confining unit at the Calibogue site and all but a 0.8-foot-thick interval of the confining unit at the 8-mile site, raising concern about the potential for saltwater intrusion through the paleochannel-fill sediments at these two sites. The paleochannel incisions at the Calibogue and 8-mile sites are filled with fine- and coarse-grained sediments, respectively. The hydrogeologic setting and the vertical hydraulic gradients at the 7- and 10-mile sites favored the absence of saltwater intrusion during predevelopment. After decades of onshore water use in Georgia and South Carolina, the 0-foot contour in the regional cone of depression of the Upper Floridan aquifer is estimated to have been at the general location of the 7- and 10-mile sites by the mid-1950s and at or past the 15-mile site by the 1980s. The upward vertical hydraulic gradient reversed, but the presence of more than 17 feet of upper confining unit impeded the downward movement of saltwater from the surficial aquifer to the Upper Floridan aquifer at the 7- and 10-mile sites. At the 10

  11. Pattern of head injuries in Malta (EU): a small Mediterranean island.

    Science.gov (United States)

    Agius, Shawn; Ansari, Sohail; Zrinzo, Antoine

    2012-04-01

    We have reviewed all acute neurosurgical admissions between December 2007 and December 2009. Hundred and nine (46.6%) of our admissions were head injuries. A subdural haematoma(SDH) was found in 51.4%(56) of the head injuries. Of these, 50/56 presented with a Glasgow Coma Scale(GCS) of 14 to 15, 41.1% (23) of these SDH needed surgery. The commonest mode of injury was falls [67.9%(74) of head injuries]. Risk factors for falls are co-morbidities which are particular to an elderly population, these include osteoarthritis and audio/ visual impairment. Falls are more common in rural areas where elderly are more likely to feel comfortable to walk and sustain trivial falls resulting in chronic subdural heamatomas.

  12. Xemilofiban: SC 54684A, xemlofiban.

    Science.gov (United States)

    2003-01-01

    Xemilofiban [SC 54684, SC 54684A (HCl), xemlofiban], a glycoprotein IIb/IIIa antagonist, is an orally available prodrug of a non-peptide mimetic of the tetrapeptide RGDF. It is converted to the active metabolite, SC 54701 (the free base form of SC 54701A). Development was initiated by Searle (Monsanto). Searle became part of Pharmacia Corporation, which was acquired by, and merged into, Pfizer in April 2003. Searle had co-development and co-marketing agreements with Sankyo in Japan; these have been discontinued. In January 2003, Pharmacia donated the intellectual property for xemilofiban to Western Michigan University. In February 2003, Western Michigan University granted an exclusive worldwide licence of xemilofiban to VDDI Pharmaceuticals (formerly Virtual Drug Development Inc.). Xemilofiban was in a phase III clinical trial, the Evaluation of Xemilofiban in Controlling Thrombotic Events (EXCITE) trial, with Searle (Monsanto) in the US and Europe for the treatment of thrombosis in patients with unstable angina pectoris and acute myocardial infarction undergoing angioplasty. However, as xemilofiban demonstrated no significant clinical benefit, Searle discontinued its development. In Japan, Sankyo discontinued the development of xemilofiban for thrombosis at phase II following Searle's decision to drop the project. VDDI Pharmaceuticals plans to develop xemilofiban in cardiovascular disorders following on from the phase III studies completed by Pharmacia; a restructured dosing schedule and narrowed patient selection will be used. VDDI has research facilities worldwide and will utilise facilities in Ireland for the European clinical development programme; research facilities in the Southwest Michigan Innovation Center are planned while the head office of VDDI is based in Tennessee. Xemilofiban is in phase III development for the treatment of cardiovascular disease in conjunction with percutaneous coronary intervention.

  13. S-C Mylonites

    NARCIS (Netherlands)

    Lister, G.S.; Snoke, A.W.

    1984-01-01

    Two types of foliations are commonly developed in mylonites and mylonitic rocks: (a) S-surfaces related to the accumulation of finite strain and (b) C-surfaces related to displacement discontinuities or zones of relatively high shear strain. There are two types of S-C mylonites. Type I S-C mylonites

  14. Effects of sea-level rise and pumpage elimination on saltwater intrusion in the Hilton Head Island area, South Carolina, 2004-2104

    Science.gov (United States)

    Payne, Dorothy F.

    2010-01-01

    Saltwater intrusion of the Upper Floridan aquifer has been observed in the Hilton Head area, South Carolina since the late 1970s and currently affects freshwater supply. Rising sea level in the Hilton Head Island area may contribute to the occurrence of and affect the rate of saltwater intrusion into the Upper Floridan aquifer by increasing the hydraulic gradient and by inundating an increasing area with saltwater, which may then migrate downward into geologic units that presently contain freshwater. Rising sea level may offset any beneficial results from reductions in groundwater pumpage, and thus needs to be considered in groundwater-management decisions. A variable-density groundwater flow and transport model was modified from a previously existing model to simulate the effects of sea-level rise in the Hilton Head Island area. Specifically, the model was used to (1) simulate trends of saltwater intrusion from predevelopment to the present day (1885-2004) and evaluate the conceptual model, (2) project these trends from the present day into the future based on different potential rates of sea-level change, and (3) evaluate the relative influences of pumpage and sea-level rise on saltwater intrusion. Four scenarios were simulated for 2004-2104: (1) continuation of the estimated sea-level rise rate over the last century, (2) a doubling of the sea-level rise, (3) a cessation of sea-level rise, and (4) continuation of the rate over the last century coupled with an elimination of all pumpage. Results show that, if present-day (year 2004) pumping conditions are maintained, the extent of saltwater in the Upper Floridan aquifer will increase, whether or not sea level continues to rise. Furthermore, if all pumpage is eliminated and sea level continues to rise, the simulated saltwater extent in the Upper Floridan aquifer is reduced. These results indicate that pumpage is a strong driving force for simulated saltwater intrusion, more so than sea-level rise at current rates

  15. Keep Your Head in the Gutter: Engendering Empathy Through Participatory Delusion in Christian de Metter's Graphic Adaptation of Shutter Island.

    Science.gov (United States)

    Servitje, Lorenzo

    2015-09-01

    This paper argues that the graphic adaptation of Dennis Lehane's Shutter Island utilizes the medium to evoke an affective participation and investment from the reader. It explores the ways the graphic novel overcomes problematic representations of mental illness in the popular film version. Drawing on graphic fiction theory, I contend that readers' engagement in and construction of the story between panels, in the "gutters," allows them to participate in the protagonist's persecutory delusion. Additionally, I draw on Foucault's conceptualizations of the medical gaze and historical figurations of madness connected to water in order to demonstrate the mechanism by which the reader is placed in a dual subject position, becoming both observer and observed. In this capacity, I suggest that graphic fiction provides a unique experience to engender empathy for psychiatric illness.

  16. Age of overwash and rate of relative sea-level rise inferred from detrital heads and microatolls of medieval corals at Anegada, British Virgin Islands

    Science.gov (United States)

    Jennifer, W.; Feuillet, N.; Robert, H.; Brian, A.; Ten Brink, U. S.; Deschamps, P.; Tuttle, M. P.; Wei, Y.; Fuentes, Z.

    2012-12-01

    Coral boulders deposited on Anegada, an island 120 km south of the Puerto Rico Trench, record overwash dated to AD 1200-1450 and relative sea-level changes that preceded it. Composed largely of Pleistocene limestone, Anegada is less than 8 m above sea level and is fringed on the north and east by a coral reef where Atlantic Ocean waves break. The lowest parts of the island were washed over from the north in AD 1650-1800, as judged from landforms and deposits reported previously (doi:10.1007/s11069-010-9622-6). The coral boulders indicate overwash of higher elevation and earlier age. The boulders were apparently torn from the adjacent reef by a tsunami of nearby origin, as inferred in companion abstracts on geology and modeling. We found the corals scattered in five areas inland from the north shore. Two of the areas show solitary coral heads 1500 m from the reef. The boulders are more numerous in the three other areas, where they are up to 500-700 m from the reef and up to 4 m above sea level. Some were transported over beach ridges or through breaches cut into them. Others are hundreds of meters inland from a modern storm berm. Most rest on the Pleistocene limestone. Many are overturned. Most are broken but few are whole. The largest measured diameter is 2 m and the greatest measured height is 1 m. Most of the boulders are of the brain coral Diploria strigosa, but smaller Porites asteroides and Montastrea annularis are also present. Some of the D. strigosa retain the rounded shape typical of living heads and are dimpled with holes perhaps left by feather-duster worms. The preservation of these features suggests that many of the boulders came ashore alive. We avoided dating a head that shows field evidence for death before transport; an erosional surface cuts across its youngest growth bands and is covered with the remains of encrusting marine organisms. Among the 18 coral boulders dated, 13 form a young group with ages in the range 890±25 to 1020±25 14C yr BP

  17. 33 CFR 334.480 - Archers Creek, Ribbon Creek and Broad River, S.C.; U.S. Marine Corps Recruit Depot rifle and...

    Science.gov (United States)

    2010-07-01

    ... Broad River, S.C.; U.S. Marine Corps Recruit Depot rifle and pistol ranges, Parris Island. 334.480..., S.C.; U.S. Marine Corps Recruit Depot rifle and pistol ranges, Parris Island. (a) During periods when the rifle and pistol ranges on Parris Island are in use, the following areas will be restricted to...

  18. SC tuning fork

    CERN Multimedia

    The tuning fork used to modulate the radiofrequency system of the synchro cyclotron (SC) from 1957 to 1973. This piece is an unused spare part. The SC was the 1st accelerator built at CERN. It operated from August 1957 until it was closed down at the end of 1990. In the SC the magnetic field did not change with time, and the particles were accelerated in successive pulses by a radiofrequency voltage of some 20kV which varied in frequency as they spiraled outwards towards the extraction radius. The frequency varied from 30MHz to about 17Mz in each pulse. The tuning fork vibrated at 55MHz in vacuum in an enclosure which formed a variable capacitor in the tuning circuit of the RF system, allowing the RF to vary over the appropriate range to accelerate protons from the centre of the macine up to 600Mev at extraction radius. In operation the tips of the tuning fork blade had an amplitude of movement of over 1 cm. The SC accelerator underwent extensive improvements from 1973 to 1975, including the installation of a...

  19. SC2 dee

    CERN Multimedia

    1974-01-01

    Checking the positioning of the dee before its introduction into the vacuum chamber of SC2. The dee is mounted on a large cover plate which also carries the dee liner and the pump manifold. The dummy dee is fixed to the pole faces within the vacuum chamber.

  20. A Case Report on Bilateral Knee Coverage Following Septic Arthritis: Lateral Distal Thigh Island Flap and Medial Head Gastrocnemius Flap Methods

    Directory of Open Access Journals (Sweden)

    Abdolrazaghi

    2016-03-01

    Full Text Available Introduction Septic arthritis is the rheumatological and orthopedic emergency that causes the most difficulties with joints–especially knee and hip joints. The clinical symptoms include pain, swelling, inflammation, stiffness, and a limited range of motion in both active and passive joints. Debridement of the necrotic tissue is one beneficial method for septic arthritis treatment, although soft tissue defects around joints are a challenging issue for surgeons. Our purpose was to investigate the consequences of two flap surgery methods undertaken to repair soft tissue damaged during knee joint debridement caused by septic arthritis. Case Presentation This is a case report concerning a patient who had septic arthritis in the knee area and so underwent soft tissue surgery. The reconstruction methods were not the same for both knees as the lateral distal thigh island flap reparation method was used on the left knee and the medial head gastrocnemius flap method was utilized on the right. We then investigated the results and outcomes of the surgery three months later. Conclusions Lower extremity movement extent was carefully evaluated and, in respect to muscle strength, the patient was able to walk independently three months after the surgery. The patient’s balance was studied and the results showed moderate levels of stability.

  1. Diet analysis by next-generation sequencing indicates the frequent consumption of introduced plants by the critically endangered red-headed wood pigeon (Columba janthina nitens) in oceanic island habitats.

    Science.gov (United States)

    Ando, Haruko; Setsuko, Suzuki; Horikoshi, Kazuo; Suzuki, Hajime; Umehara, Shoko; Inoue-Murayama, Miho; Isagi, Yuji

    2013-10-01

    Oceanic island ecosystems are vulnerable to the introduction of alien species, and they provide a habitat for many endangered species. Knowing the diet of an endangered animal is important for appropriate nature restoration efforts on oceanic islands because introduced species may be a major component of the diets of some endangered species. DNA barcoding techniques together with next-generation sequencing may provide more detailed information on animal diets than other traditional methods. We performed a diet analysis using 48 fecal samples from the critically endangered red-headed wood pigeon that is endemic to the Ogasawara Islands based on chloroplast trnL P6 loop sequences. The frequency of each detected plant taxa was compared with a microhistological analysis of the same sample set. The DNA barcoding approach detected a much larger number of plants than the microhistological analysis. Plants that were difficult to identify by microhistological analysis after being digested in the pigeon stomachs were frequently identified only by DNA barcoding. The results of the barcoding analysis indicated the frequent consumption of introduced species, in addition to several native species, by the red-headed wood pigeon. The rapid eradication of specific introduced species may reduce the food resources available to this endangered bird; thus, balancing eradication efforts with the restoration of native food plants should be considered. Although some technical problems still exist, the trnL approach to next-generation sequencing may contribute to a better understanding of oceanic island ecosystems and their conservation.

  2. Sediment Transport and Infilling of a Borrow Pit on an Energetic Sandy Ebb Tidal Delta Offshore of Hilton Head Island, South Carolina

    Science.gov (United States)

    Wren, A.; Xu, K.; Ma, Y.; Sanger, D.; Van Dolah, R.

    2014-12-01

    Bottom-mounted instrumentation was deployed at two sites on an ebb tidal delta to measure hydrodynamics, sediment transport, and seabed elevation. One site ('borrow site') was 2 km offshore and used as a dredging site for beach nourishment of nearby Hilton Head Island in South Carolina, and the other site ('reference site') was 10 km offshore and not directly impacted by the dredging. In-situ time-series data were collected during two periods after the dredging: March 15 - June 12, 2012('spring') and August 18 - November 18, 2012 ('fall'). At the reference site directional wave spectra and upper water column current velocities were measured, as well as high-resolution current velocity profiles and suspended sediment concentration profiles in the Bottom Boundary Layer (BBL). Seabed elevation and small-scale seabed changes were also measured. At the borrow site seabed elevation and near-bed wave and current velocities were collected using an Acoustic Doppler Velocimeter. Throughout both deployments bottom wave orbital velocities ranged from 0 - 110 m/s at the reference site. Wave orbital velocities were much lower at the borrow site ranging from 10-20 cm/s, as wave energy was dissipated on the extensive and rough sand banks before reaching the borrow site. Suspended sediment concentrations increased throughout the BBL when orbital velocities increased to approximately 20 cm/s. Sediment grain size and critical shear stresses were similar at both sites, therefore, re-suspension due to waves was less frequent at the borrow site. However, sediment concentrations were highly correlated with the tidal cycle at both sites. Semidiurnal tidal currents were similar at the two sites, typically ranging from 0 - 50 cm/s in the BBL. Maximum currents exceeded the critical shear stress and measured suspended sediment concentrations increased during the first hours of the tidal cycle when the tide switched to flood tide. Results indicate waves contributed more to sediment mobility at

  3. Estimation of the depth to the fresh-water/salt-water interface from vertical head gradients in wells in coastal and island aquifers

    Science.gov (United States)

    Izuka, Scot K.; Gingerich, Stephen B.

    An accurate estimate of the depth to the theoretical interface between fresh, water and salt water is critical to estimates of well yields in coastal and island aquifers. The Ghyben-Herzberg relation, which is commonly used to estimate interface depth, can greatly underestimate or overestimate the fresh-water thickness, because it assumes no vertical head gradients and no vertical flow. Estimation of the interface depth needs to consider the vertical head gradients and aquifer anisotropy that may be present. This paper presents a method to calculate vertical head gradients using water-level measurements made during drilling of a partially penetrating well; the gradient is then used to estimate interface depth. Application of the method to a numerically simulated fresh-water/salt-water system shows that the method is most accurate when the gradient is measured in a deeply penetrating well. Even using a shallow well, the method more accurately estimates the interface position than does the Ghyben-Herzberg relation where substantial vertical head gradients exist. Application of the method to field data shows that drilling, collection methods of water-level data, and aquifer inhomogeneities can cause difficulties, but the effects of these difficulties can be minimized. Résumé Une estimation précise de la profondeur de l'interface théorique entre l'eau douce et l'eau salée est un élément critique dans les estimations de rendement des puits dans les aquifères insulaires et littoraux. La relation de Ghyben-Herzberg, qui est habituellement utilisée pour estimer la profondeur de cette interface, peut fortement sous-estimer ou surestimer l'épaisseur de l'eau douce, parce qu'elle suppose l'absence de gradient vertical de charge et d'écoulement vertical. L'estimation de la profondeur de l'interface requiert de prendre en considération les gradients verticaux de charge et l'éventuelle anisotropie de l'aquifère. Cet article propose une méthode de calcul des

  4. Lipídios em sedimentos arqueológicos: resultados preliminares do sítio arqueológico Rio do Meio, Ilha de Santa Catarina (SC Lipids in archaeological sediments: preliminary results of the archaeological site Rio do Meio, Santa Catarina Island (SC, Brazil

    Directory of Open Access Journals (Sweden)

    Fabrício Augusto Hansel

    2008-02-01

    Full Text Available Este trabalho foi realizado com o objetivo de avaliar a distribuição de lipídios em sedimentos arqueológicos do sítio Rio do Meio, Ilha de Santa Catarina. Nos extratos totais de lipídios, analisados por cromatografia gasosa e espectrometria de massas (CG e CG-EM, predominaram os compostos ácidos e álcoois saturados. Foram detectados pelo menos dois tipos de matéria orgânica: uma antiga e outra comparativamente recente. Na primeira, o extrato total de lipídios foi dominado por ácidos graxos de cadeias curtas ( Ac20:0 e Al20:0. Em contraste, na deposição classificada como recente, foram identificados em maiores teores os ácidos e álcoois de cadeias longas (> Ac20:0 e Al20:0. Neste estudo, foi possível observar a incorporação de material orgânico procedente de fontes de origem vegetal, bacteriana e, possivelmente, animal (gorduras nos sedimentos arqueológicos analisados.In this study the distribution of lipid compounds was evaluated in sediment samples of an archaeological site Rio do Meio, Santa Catarina Island, Brazil. In the total lipid extracts, analyzed by gas chromatography and mass spectrometry (GC and GC-MS, saturated fatty acids and alcohols were predominant. At least two sources of organic matter were detected, an older and a more recent one. In the old deposit, the most abundant lipids were short-chain fatty acids ( Ac20:0 and Al20:0. In contrast, the fresh deposit was dominated by long-chain fatty acids and alcohols (> Ac20:0 and Al20:0. This paper described the incorporation of vegetal, bacterial and possible animal (fat sources into the archaeological sediments analyzed.

  5. Monitor of SC beam profiles

    CERN Multimedia

    1977-01-01

    A high-resolution secondary emission grid for the measurement of SC beam profiles. Modern techniques of metal-ceramic bonding, developed for micro-electronics, have been used in its construction. (See Annual Report 1977 p. 105 Fig. 12.)

  6. First coil for the SC

    CERN Multimedia

    CERN PhotoLab

    1955-01-01

    The coils for the SC magnet were stored in the large hangar of the Cointrin Airport (to make sure that they would be available before snow and ice would block the roads and canals from Belgium, where they were built).

  7. Molecular and functional characterization of peptidoglycan-recognition protein SC2 (PGRP-SC2) from Nile tilapia (Oreochromis niloticus) involved in the immune response to Streptococcus agalactiae.

    Science.gov (United States)

    Gan, Zhen; Chen, Shannan; Hou, Jing; Huo, Huijun; Zhang, Xiaolin; Ruan, Baiye; Laghari, Zubair Ahmed; Li, Li; Lu, Yishan; Nie, Pin

    2016-07-01

    PGRP-SC2, the member of PGRP family, plays an important role in regulation of innate immune response. In this paper, a PGRP-SC2 gene of Nile tilapia, Oreochromis niloticus (designated as On-PGRP-SC2) was cloned and its expression pattern under the infection of Streptococcus agalactiae was investigated. Sequence analysis showed main structural features required for amidase activity were detected in the deduced amino acid sequence of On-PGRP-SC2. In healthy tilapia, the On-PGRP-SC2 transcripts could be detected in all the examined tissues, with the most abundant expression in the muscle. When infected with S. agalactiae, there was a clear time-dependent expression pattern of On-PGRP-SC2 in the spleen, head kidney and brain. The assays for the amidase activity suggested that recombinant On-PGRP-SC2 protein had a Zn(2+)-dependent PGN-degrading activity. Moreover, our works showed that recombinant On-PGRP-SC2 protein could significantly reduce bacterial load in target organs attacked by S. agalactiae. These findings indicated that On-PGRP-SC2 may play important roles in the immune response to S. agalactiae in Nile tilapia.

  8. Digital image mosaic of the nearshore coastal waters of Diamond Head on the island of O'ahu generated using aerial photographs and SHOALS airborne lidar bathymetry data

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This portion of the data release contains a digital image mosaic with 1.0 foot-per-pixel (0.3048 meter-per-pixel) resolution of the Diamond Head area on the...

  9. Heat Islands

    Science.gov (United States)

    EPA's Heat Island Effect Site provides information on heat islands, their impacts, mitigation strategies, related research, a directory of heat island reduction initiatives in U.S. communities, and EPA's Heat Island Reduction Program.

  10. Upper boundary of the Pacific plate subducting beneath Hokkaido, Japan, estimated from ScSp phase

    OpenAIRE

    Osada, Kinue; Yoshizawa, Kazunori; YOMOGIDA, Kiyoshi

    2010-01-01

    Three-dimensional geometry of the upper boundary of the Pacific plate subducting beneath Hokkaido, Japan, was obtained using the ScSp phase: the phase converted from ScS (S wave reflected at the core-mantle boundary) to P wave at the plate boundary. Taking the advantage of a dense seismic network, "Hi-net", recently deployed across the Japanese islands, we applied several seismic array analyses to the recorded waveform data for a large nearby deep earthquake, in order to enhance very weak ScS...

  11. Rotary condenser for SC2

    CERN Multimedia

    1975-01-01

    During 1975 the SC2 performance was improved among other things by redesigning some of the elements of the ROTCO (Annual Report 1975, p. 55). The photo shows an interior wiew of the housing of the rotary condenser and of the sixteen sets of shaped stator blades.

  12. Islands, Island Studies, Island Studies Journal

    Directory of Open Access Journals (Sweden)

    Godfrey Baldacchino

    2006-05-01

    Full Text Available Islands are sites of innovative conceptualizations, whether of nature or human enterprise, whether virtual or real. The study of islands on their own terms today enjoys a growing and wide-ranging recognition. This paper celebrates the launch of Island Studies Journal in the context of a long and thrilling tradition of island studies scholarship.

  13. 2010 ARRA Lidar: Hampton County (SC)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Provide high density LiDAR elevation data map of Hampton County, SC. Provide Bare Earth DEM (vegetation removal) of Hampton County, SC.

  14. Magnetic moment of {sup 48}Sc

    Energy Technology Data Exchange (ETDEWEB)

    Ohtsubo, T., E-mail: tohtsubo@np.gs.niigata-u.ac.jp; Kawamura, Y.; Ohya, S. [Niigata University, Department of Physics (Japan); Izumikawa, T. [Niigata University, Radioisotope Center (Japan); Nishimura, K. [Toyama University, Faculty of Engineering (Japan); Muto, S. [Neutron Science Laboratory, KEK (Japan); Shinozuka, T. [Tohoku University, Cyclotron and Radioisotope Center (Japan)

    2007-11-15

    Nuclear magnetic resonances were measured for {sup 48}Sc and {sup 44m}Sc oriented at 8 mK in an Fe host metal. The magnetic hyperfine splitting frequencies at an external magnetic field of 0.2 T were determined to be 63.22(11) MHz and 64.81(1) MHz for {sup 48}Sc and {sup 44m}Sc, respectively. With the known magnetic moment of {mu}({sup 44m}Sc)=+3.88 (1) {mu}{sub N}, the magnetic moment of {sup 48}Sc is deduced as {mu}({sup 44}Sc)=+3.785(12) {mu}{sub N}. The measured magnetic moment of {sup 48}Sc is discussed in terms of the shell model using the effective interactions.

  15. Materials Characterization of High-Temperature Epoxy Resins: SC-79 and SC-15/SC-79 Blend

    Science.gov (United States)

    2011-03-01

    Army composite applications. SC-15 is a toughened commercial vacuum-assisted resin transfer molding ( VARTM ) resin produced by Applied Poleramic Inc...very well in VARTM processes and has good damage resistance in structural and ballistic applications. However, the relatively low glass transition...low-viscosity, two-phase toughened, cycloaliphatic amine–cured commercial VARTM resin system designed to be easy to handle and have a long processing

  16. Main: 3SC2 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 3SC2 小麦 Bread Wheat Triticum aestivum Serine Carboxypeptidase Ii Chains A And B Nam... 1WHS; X-ray; A=6-260, B=266-418.|PDB; 1WHT; X-ray; A=5-260, B=266-418.|PDB; 3SC2; X-ray; A=1-259, B=266-417...WHDAPRSMLPIYRELIAAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVSVRGAGHEVPLHRPRQALVLFQYFLQGKPMPGQTKNAT wheat_3SC2.jpg ...

  17. Academic Training - Pulsed SC Magnets

    CERN Multimedia

    Françoise Benz

    2006-01-01

    2005-2006 ACADEMIC TRAINING PROGRAMME LECTURE SERIES 2, 3, June 29, 30, 31 May, 1, 2 June 11:00-12:00 - Auditorium, bldg 500 Pulsed SC Magnets by M. Wilson Lecture 1. Introduction to Superconducting Materials Type 1,2 and high temperature superconductors; their critical temperature, field & current density. Persistent screening currents and the critical state model. Lecture 2. Magnetization and AC Loss How screening currents cause irreversible magnetization and hysteresis loops. Field errors caused by screening currents. Flux jumping. The general formulation of ac loss in terms of magnetization. AC losses caused by screening currents. Lecture 3. Twisted Wires and Cables Filamentary composite wires and the losses caused by coupling currents between filaments, the need for twisting. Why we need cables and how the coupling currents in cables contribute more ac loss. Field errors caused by coupling currents. Lecture 4. AC Losses in Magnets, Cooling and Measurement Summary of all loss mech...

  18. rotor of the SC rotating condenser

    CERN Multimedia

    1974-01-01

    The rotor of the rotating condenser was installed instead of the tuning fork as the modulating element of the radiofrequency system, when the SC accelerator underwent extensive improvements between 1973 to 1975 (see object AC-025). The SC was the first accelerator built at CERN. It operated from August 1957 until it was closed down at the end of 1990.

  19. Radiation Protection Section (SC/SL/RP)

    CERN Multimedia

    2006-01-01

    We should like to inform you that the Radiation Protection Section (SC/SL/RP) located on the Prévessin site has moved from Building 865 (ground floor) to new premises in Wing A of Building 892 (second floor). Telephone numbers remain the same. SC/SL/RP section

  20. Faroe Islands

    DEFF Research Database (Denmark)

    Christoffersen, Lisbet

    2015-01-01

    An update introduction including recent legislative changes on the Folkchurch of the Faroe Islands......An update introduction including recent legislative changes on the Folkchurch of the Faroe Islands...

  1. Cs3ScCl6

    Directory of Open Access Journals (Sweden)

    Matthew D. Ward

    2014-06-01

    Full Text Available Crystals of tricaesium scandium(III hexachloride were obtained as a side product from the reaction of U, SnCl2, Sc, and S in a CsCl flux at 1073 K. Cs3ScCl6 crystallizes in the Rb3YCl6 structure type. The asymmetric unit comprises three Cs sites, two Sc sites, and six Cl sites, all of which have site symmetry 1, except for the two Sc sites that have site symmetries of 2 and -1, respectively. The structure is composed of isolated [ScCl6]3− octahedra that are surrounded by Cs+ cations. Two Cs+ cations have interactions with eight Cl− anions, while the third has interactions with ten Cl− anions.

  2. SC-FDMA for mobile communications

    CERN Document Server

    Abd El-Samie, Fathi E

    2013-01-01

    SC-FDMA for Mobile Communications examines Single-Carrier Frequency Division Multiple Access (SC-FDMA). Explaining this rapidly evolving system for mobile communications, it describes its advantages and limitations and outlines possible solutions for addressing its current limitations. The book explores the emerging trend of cooperative communication with SC-FDMA and how it can improve the physical layer security. It considers the design of distributed coding schemes and protocols for wireless relay networks where users cooperate to send their data to the destination. Supplying you with the re

  3. Galapagos Islands

    Science.gov (United States)

    2002-01-01

    This true-color image of the Galapagos Islands was acquired on March 12, 2002, by the Moderate-resolution Imaging Spectroradiometer (MODIS), flying aboard NASA's Terra satellite. The Galapagos Islands, which are part of Ecuador, sit in the Pacific Ocean about 1000 km (620 miles) west of South America. As the three craters on the largest island (Isabela Island) suggest, the archipelago was created by volcanic eruptions, which took place millions of years ago. Unlike most remote islands in the Pacific, the Galapagos have gone relatively untouched by humans over the past few millennia. As a result, many unique species have continued to thrive on the islands. Over 95 percent of the islands' reptile species and nearly three quarters of its land bird species cannot be found anywhere else in the world. Two of the more well known are the Galapagos giant tortoise and marine iguanas. The unhindered evolutionary development of the islands' species inspired Charles Darwin to begin The Origin of Species eight years after his visit there. To preserve the unique wildlife on the islands, the Ecuadorian government made the entire archipelago a national park in 1959. Each year roughly 60,000 tourists visit these islands to experience what Darwin did over a century and a half ago. Image courtesy Jacques Descloitres, MODIS Land Rapid Response Team at NASA GSFC

  4. z206sc_video_observations

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This part of DS 781 presents video observations from cruise Z206SC for the Santa Barbara Channel region and beyond in southern California. The vector data file is...

  5. z107sc_video_observations

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This part of DS 781 presents video observations from cruise Z107SC for the Santa Barbara Channel region and beyond in southern California. The vector data file is...

  6. z206sc_video_observations

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This part of DS 781 presents video observations from cruise Z206SC for the Santa Barbara Channel region and beyond in southern California. The vector data file is...

  7. z107sc_video_observations

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This part of DS 781 presents video observations from cruise Z107SC for the Santa Barbara Channel region and beyond in southern California. The vector data file is...

  8. Bandwidth challenge teams at SC2003 conference

    CERN Multimedia

    2003-01-01

    Results from the fourth annual High-Performance Bandwidth Challenge, held in conjunction with SC2003, the international conference on high-performance computing and networking which occurred last week in Phoenix, AZ (1 page).

  9. Recrystallization of Al-Sc alloys

    Energy Technology Data Exchange (ETDEWEB)

    Drits, M.E.; Toropova, L.S.; Bykov, Yu.G.; Ber, L.B.

    Scandium effect on the temperature range of aluminium recrystallization was investigated. Al-Sc alloys were studied under cold rolled and hot pressed conditions. It is found that the temperature range of Al-Sc alloy recrystallization depends on ScAl/sub 3/ particle dispersion during recrystallization heats. During heating in quenched alloys at 200-300 deg C decomposition occurs which prevents recrystallization, In the alloys with scandium contents less 0.2% decomposition and recrystallization processes pass simultaneously. In quenched alloys with scandium contents over 0.2% and in aged alloys the initiation and subsequent development of recrystallization are determined by the processes of coalescence and solution of ScAl/sub 3/ phase particles.

  10. Sc3N and Sc2C2 encapsulated B40: Smarter than its carbon analogue

    Science.gov (United States)

    Shah, Esha V.; Roy, Debesh R.

    2016-10-01

    A detailed comparative investigation on the recently synthesised B40 and C40 along with their metal nitride (Sc3N)and carbide (Sc2C2) encapsulated endohedral fullerenes, is performed under density functional theory for the first time. The structures, electronic, thermodynamic and magnetic properties of all the considered compounds are explored in detail. The present study identifies borospherene (B40) and its encapsulated nitride (Sc3N@B40) and carbide (Sc2C2@B40) endohedral borofullerenes as the better candidates for future novel nano-applications compared to their carbon bucky ball analogues.

  11. Pregnancy in Sickle Cell-Haemoglobin C (SC) Disease, A Retrospective Study of Birth Size and Maternal Weight Gain

    Science.gov (United States)

    Thame, Minerva M.; Singh-Minott, Indira; Osmond, Clive; Melbourne-Chambers, Roxanne H.; Serjeant, Graham R

    2017-01-01

    Objective To assess pregnancy and fetal outcomes in Jamaican subjects with sickle cell-haemoglobin C (SC) disease. Study Design A retrospective chart review over 21 years (1992-2012) of all pregnancies in SC disease and a comparison group matched by gender and date of delivery in mothers with a normal haemoglobin (AA) phenotype at the University Hospital of the West Indies, Jamaica. There were 118 pregnancies in 81 patients with SC disease and 110 pregnancies in 110 in the normal comparison group. Corrections were made for repeat pregnancies from the same mother. Outcome measures included maternal weight at 20, 25, 30, 35 and 38 weeks gestation, maternal pregnancy complications, birth weight, head circumference and crown heel length and were used to analyse possible predictors of birth weight. Results First antenatal visits occurred later in women with SC disease, who also had lower haemoglobin level and lower systolic blood pressure. The prevalence of pregnancy-induced hypertension, pre-eclampsia, ante-partum or postpartum haemorrhage did not differ between genotypes. Maternal weight gain was significantly lower in SC disease and there was a significantly lower birth weight, head circumference, and gestational age. Conclusions Pregnancy in SC disease is generally benign but mothers had lower weight gain and lower birth weight babies, the difference persisting after correction for gestational age. PMID:27235631

  12. Head Injuries

    Science.gov (United States)

    ... object that's stuck in the wound. previous continue Concussions Concussions — the temporary loss of normal brain function due ... also a type of internal head injury. Repeated concussions can permanently damage the brain. In many cases, ...

  13. Head Tilt

    Science.gov (United States)

    ... Healthy Living Healthy Living Healthy Living Nutrition Fitness Sports Oral Health Emotional Wellness Growing Healthy Sleep Safety & ... When this happens, the neck muscles go into spasm, causing the head to tilt to one side. ...

  14. Head Injuries

    Science.gov (United States)

    ... ATV) Safety Balance Disorders Knowing Your Child's Medical History First Aid: Falls First Aid: Head Injuries Preventing Children's Sports Injuries Getting Help: Know the Numbers Concussions Stay Safe: Baseball Concussions Concussions: Getting Better Sports and Concussions Dealing ...

  15. Head MRI

    Science.gov (United States)

    ... heart valves Heart defibrillator or pacemaker Inner ear (cochlear) implants Kidney disease or dialysis (you may not ... to: Abnormal blood vessels in the brain ( arteriovenous malformations of the head ) Tumor of the nerve that ...

  16. Sc20C60: a volleyballene

    Science.gov (United States)

    Wang, Jing; Ma, Hong-Man; Liu, Ying

    2016-06-01

    An exceptionally stable hollow cage containing 20 scandium atoms and 60 carbon atoms has been identified. This Sc20C60 molecular cluster has a Th point group symmetry and a volleyball-like shape that we refer to below as ``Volleyballene''. Electronic structure analysis shows that the formation of delocalized π bonds between Sc atoms and the neighboring pentagonal rings made of carbon atoms is crucial for stabilizing the cage structure. A relatively large HOMO-LUMO gap (~1.4 eV) was found. The results of vibrational frequency analysis and molecular dynamics simulations both demonstrate that this Volleyballene molecule is exceptionally stable.An exceptionally stable hollow cage containing 20 scandium atoms and 60 carbon atoms has been identified. This Sc20C60 molecular cluster has a Th point group symmetry and a volleyball-like shape that we refer to below as ``Volleyballene''. Electronic structure analysis shows that the formation of delocalized π bonds between Sc atoms and the neighboring pentagonal rings made of carbon atoms is crucial for stabilizing the cage structure. A relatively large HOMO-LUMO gap (~1.4 eV) was found. The results of vibrational frequency analysis and molecular dynamics simulations both demonstrate that this Volleyballene molecule is exceptionally stable. Electronic supplementary information (ESI) available: Sc20C60: a Volleyballene_SI. See DOI: 10.1039/c5nr07784b

  17. Recrystallization and Morphology of Microstructure in Al-Sc Alloys

    Institute of Scientific and Technical Information of China (English)

    Zhang Jun; Zhang Zonghua

    2007-01-01

    Minor addition of Sc to aluminum results in the rapid precipitation of homogeneously distributed Al3Sc dispersoids. The presence of Al3Sc dispersoids is more effective recrystallization inhibitors. Our work established the precipitation of homogeneously distributed Al3Sc dispersoids, which are coherent with the matrix, have the L12 structure. It was also established that the addition of Sc was effective in improving the recrystallization resistance.

  18. Axial compression behavior and partial composite action of SC walls in safety-related nuclear facilities

    Science.gov (United States)

    Zhang, Kai

    Steel-plate reinforced concrete (SC) composite walls typically consist of thick concrete walls with two exterior steel faceplates. The concrete core is sandwiched between the two steel faceplates, and the faceplates are attached to the concrete core using shear connectors, for example, ASTM A108 steel headed shear studs. The shear connectors and the concrete infill enhance the stability of the steel faceplates, and the faceplates serve as permanent formwork for concrete placement. SC composite walls were first introduced in the 1980's in Japan for nuclear power plant (NPP) structures. They are used in the new generation of nuclear power plants (GIII+) and being considered for small modular reactors (SMR) due to their structural efficiency, economy, safety, and construction speed. Steel faceplates can potentially undergo local buckling at certain locations of NPP structures where compressive forces are significant. The steel faceplates are usually thin (0.25 to 1.50 inches in Customary units, or 6.5 to 38 mm in SI units) to maintain economical and constructional efficiency, the geometric imperfections and locked-in stresses induced during construction make them more vulnerable to local buckling. Accidental thermal loading may also reduce the compressive strength and exacerbate the local buckling potential of SC composite walls. This dissertation presents the results from experimental and numerical investigations of the compressive behavior of SC composite walls at ambient and elevated temperatures. The results are used to establish a slenderness limit to prevent local buckling before yielding of the steel faceplates and to develop a design approach for calculating the compressive strength of SC composite walls with non-slender and slender steel faceplates at ambient and elevated temperatures. Composite action in SC walls is achieved by the embedment of shear connectors into the concrete core. The strength and stiffness of shear connectors govern the level of

  19. K2SC: K2 Systematics Correction

    Science.gov (United States)

    Aigrain, Suzanne; Parviainen, Hannu; Pope, Benjamin

    2016-05-01

    K2SC (K2 Systematics Correction) models instrumental systematics and astrophysical variability in light curves from the K2 mission. It enables the user to remove both position-dependent systematics and time-dependent variability (e.g., for transit searches) or to remove systematics while preserving variability (for variability studies). K2SC automatically computes estimates of the period, amplitude and evolution timescale of the variability for periodic variables and can be run on ASCII and FITS light curve files. Written in Python, this pipeline requires NumPy, SciPy, MPI4Py, Astropy (ascl:1304.002), and George (ascl:1511.015).

  20. Norma Audio Revo SC-/PA-150

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    Norma audio是意大利一间顶级HI-Fi音响器材生产商。这款IRevo SC-2/PA-150为正是公司旗下的一款高端型号产品。其中,Revo SC-2前置放大器的放大电路以低噪音、高速和宽频作为设计重点,能反映出音频信号中的每一个细节。

  1. Upper Boundary of the Pacific Plate Subducting Under Hokkaido,Japan,Estimated from ScSp Phase

    OpenAIRE

    長田, 絹絵; 吉澤, 和範; 蓬田, 清

    2006-01-01

    Geometry of the upper boundary of the subducting Pacific plate or slab was estimated in the Hokkaido region, Japan, using the ScSp phase: the converted phase to P wave at the boundary from the S wave reflected at the core-mantle boundary and propagating nearly vertically (i.e., ScS phase). Taking the advantage of a dense seismic network named “Hi-net” recently deployed across the Japanese islands, we applied several seismic array analyses to the recorded waveform data for a large nearby deep ...

  2. Island Armor

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    A new law has been enacted to protect China’s islands from destruction After three rounds of deliberations that began in June 2009, the National People’s Congress (NPC) Standing Committee endorsed the Law of Sea

  3. Head Start.

    Science.gov (United States)

    Greenman, Geri

    2000-01-01

    Discusses an art project in which students created drawings of mop heads. Explains that the approach of drawing was more important than the subject. States that the students used the chiaroscuro technique, used by Rembrandt and Caravaggio, in which light appears out of the darkness. (CMK)

  4. Measurement of the SC magnetic field

    CERN Multimedia

    CERN PhotoLab

    1973-01-01

    The 3.5-metre-arm carrying 100 Hall plates used for the measurmeent of the SC magnetic field. The arm rotates in a horizontal plane, its positioning and the data read-out are controlled by an on-line computer.

  5. Magnet measuring equipment of SC2

    CERN Multimedia

    CERN PhotoLab

    1974-01-01

    Checking the positioning of the magnet measuring equipment installed between the poles of SC2. The steel structure in front of the magnet is designed to house the rotary condenser and to shield it from the stray magnetic field of the accelerator.

  6. Magnet measuring equipment of SC2

    CERN Multimedia

    1974-01-01

    Checking the positioning of the magnet measuring equipment installed between the poles of SC2. The steel structure in front of the magnet is designed to house the rotary condenser and to shield it from the stray magnetic field of the accelerator. On the left, Marinus van Gulik. (See Photo Archive 7402005 and Annual Report 1974, p. 44.)

  7. The Synchrocyclotron (SC) in building 300

    CERN Multimedia

    Maximilien Brice

    2012-01-01

    The red magnet of CERN's first accelerator, the Synchrocyclotron (SC), has occupied a large part of Hall 300 since it was installed in the late 1950s. The remaining part of the 300-square-metre building has been used as a storage room since the accelerator was shut down in 1990. Now a public exhibition will breathe new life into the hall.

  8. Knowledge insufficient: the management of haemoglobin SC disease.

    Science.gov (United States)

    Pecker, Lydia H; Schaefer, Beverly A; Luchtman-Jones, Lori

    2017-02-01

    Although haemoglobin SC (HbSC) accounts for 30% of sickle cell disease (SCD) in the United States and United Kingdom, evidence-based guidelines for genotype specific management are lacking. The unique pathology of HbSC disease is complex, characterized by erythrocyte dehydration, intracellular sickling and increased blood viscosity. The evaluation and treatment of patients with HbSC is largely inferred from studies of SCD consisting mostly of haemoglobin SS (HbSS) patients. These studies are underpowered to allow definitive conclusions about HbSC. We review the pathophysiology of HbSC disease, including known and potential differences between HbSS and HbSC, and highlight knowledge gaps in HbSC disease management. Clinical and translational research is needed to develop targeted treatments and to validate management recommendations for efficacy, safety and impact on quality of life for people with HbSC. © 2016 John Wiley & Sons Ltd.

  9. Applicaiotn of modified pectoralis major myocutaneous island flap in head and neck surgeries%改良的胸大肌岛状肌皮瓣在头颈外科的应用

    Institute of Scientific and Technical Information of China (English)

    陈晓红; 韩德民; 黄志刚; 房居高; 倪鑫; 周维国; 王琪; 李平栋

    2009-01-01

    目的 总结保护供区胸大肌功能和颈部外形美观的改良式胸大肌岛状肌皮瓣安全制作方法 .方法 采用改良的胸大肌岛状肌皮瓣修复头颈部缺损17例,其中6例复发性喉癌和下咽癌,4例下咽癌,3例舌根癌,2例复发性上颌窦癌,1例扁桃体癌,1例术后下咽癌术后咽瘘.术前超声检查标记胸肩峰动脉胸肌支走行,以胸肌支最下一个分支进入胸肌的起始位置(最下入肌点)和内乳动脉第四肋间穿支连线为轴设计单血管蒂的岛状肌皮瓣;在皮瓣顶部切口水平向外沿腋前线向上切开;保留胸内侧和部分胸外侧神经;维持胸大肌锁骨部完整,经锁骨上或锁骨下将肌皮瓣送到受区.结果 术中发现胸肩峰动脉胸肌支最下入肌点全部分布在胸肋部,该点距锁骨中点最下缘平均(4.9±1.2)cm(x±s,下同),术前超声定位最下入肌点的准确率为76.5%(13/17);内乳动脉的第四肋间穿支距离胸骨外侧缘(1.8±0.5)cm.17例胸大肌岛状肌皮瓣中,除1例下咽癌术中解离血管蒂时损伤血管放弃外,其余16例均成活,手术成功率为94.1%.术后1例舌根癌患者胸大肌远端与残舌分离,通过换药缝合后痊愈;2例出现术后咽瘘,均系放疗后复发下咽癌,换药后创面愈合.术后4周至3个月复查,胸大肌功能正常,颈部外形良好.结论 改良胸大肌岛状肌皮瓣不仅保留了胸大肌结构和功能,实现高位缺损的修复,还维持颈部和上胸部良好外观.术前超声检查标记胸肩峰动脉的胸肌支走行和最下入肌点位置有利于术中准确操作.%Objective To preserve the function of the donor site and good cervical shape, a modified pectoralis major myocutaneous island flap was designed. Methods The modified pectoralis major myocutaneous flaps were used to repair primarily the defect in head and neck surgery. In all 17 cases, six cases were patients with recurrence of larynx or hypopharynx cancer, four cases with

  10. Precipitation hardening in ternary alloys of the Al-Sc-Cu and Al-Sc-Si systems

    Energy Technology Data Exchange (ETDEWEB)

    Kharakterova, M.L.; Eskin, D.G.; Toropova, L.S. (Russian Academy of Sciences, Moscow (Russian Federation). A.A. Baikov Inst. of Metallurgy)

    1994-07-01

    The processes of precipitation hardening in cast ternary alloys of the Al-Sc-Cu and Al-Sc-Si systems were studied in the temperature range of aging from 100 to 450 C and at exposures to 200 h. It was shown that the CuAl[sub 2] and ScAl[sub 3] phases were involved in the process of aging in ternary Al-Sc-Cu alloys, and the Si and V (AlSiSc) phases, in ternary Al-Sc-Si alloys with excess silicon in a supersaturated solid solution. The V phase was for the first time revealed as the hardening phase in aluminum alloys.

  11. Computed Tomography (CT) -- Head

    Medline Plus

    Full Text Available ... Professions Site Index A-Z Computed Tomography (CT) - Head Computed tomography (CT) of the head uses special ... the Head? What is CT Scanning of the Head? Computed tomography, more commonly known as a CT ...

  12. LHCb Data Replication During SC3

    CERN Multimedia

    Smith, A

    2006-01-01

    LHCb's participation in LCG's Service Challenge 3 involves testing the bulk data transfer infrastructure developed to allow high bandwidth distribution of data across the grid in accordance with the computing model. To enable reliable bulk replication of data, LHCb's DIRAC system has been integrated with gLite's File Transfer Service middleware component to make use of dedicated network links between LHCb computing centres. DIRAC's Data Management tools previously allowed the replication, registration and deletion of files on the grid. For SC3 supplementary functionality has been added to allow bulk replication of data (using FTS) and efficient mass registration to the LFC replica catalog.Provisional performance results have shown that the system developed can meet the expected data replication rate required by the computing model in 2007. This paper details the experience and results of integration and utilisation of DIRAC with the SC3 transfer machinery.

  13. Reduced-Latency SC Polar Decoder Architectures

    CERN Document Server

    Zhang, Chuan; Parhi, Keshab K

    2011-01-01

    Polar codes have become one of the most favorable capacity achieving error correction codes (ECC) along with their simple encoding method. However, among the very few prior successive cancellation (SC) polar decoder designs, the required long code length makes the decoding latency high. In this paper, conventional decoding algorithm is transformed with look-ahead techniques. This reduces the decoding latency by 50%. With pipelining and parallel processing schemes, a parallel SC polar decoder is proposed. Sub-structure sharing approach is employed to design the merged processing element (PE). Moreover, inspired by the real FFT architecture, this paper presents a novel input generating circuit (ICG) block that can generate additional input signals for merged PEs on-the-fly. Gate-level analysis has demonstrated that the proposed design shows advantages of 50% decoding latency and twice throughput over the conventional one with similar hardware cost.

  14. Single chain Fab (scFab fragment

    Directory of Open Access Journals (Sweden)

    Brenneis Mariam

    2007-03-01

    Full Text Available Abstract Background The connection of the variable part of the heavy chain (VH and and the variable part of the light chain (VL by a peptide linker to form a consecutive polypeptide chain (single chain antibody, scFv was a breakthrough for the functional production of antibody fragments in Escherichia coli. Being double the size of fragment variable (Fv fragments and requiring assembly of two independent polypeptide chains, functional Fab fragments are usually produced with significantly lower yields in E. coli. An antibody design combining stability and assay compatibility of the fragment antigen binding (Fab with high level bacterial expression of single chain Fv fragments would be desirable. The desired antibody fragment should be both suitable for expression as soluble antibody in E. coli and antibody phage display. Results Here, we demonstrate that the introduction of a polypeptide linker between the fragment difficult (Fd and the light chain (LC, resulting in the formation of a single chain Fab fragment (scFab, can lead to improved production of functional molecules. We tested the impact of various linker designs and modifications of the constant regions on both phage display efficiency and the yield of soluble antibody fragments. A scFab variant without cysteins (scFabΔC connecting the constant part 1 of the heavy chain (CH1 and the constant part of the light chain (CL were best suited for phage display and production of soluble antibody fragments. Beside the expression system E. coli, the new antibody format was also expressed in Pichia pastoris. Monovalent and divalent fragments (DiFabodies as well as multimers were characterised. Conclusion A new antibody design offers the generation of bivalent Fab derivates for antibody phage display and production of soluble antibody fragments. This antibody format is of particular value for high throughput proteome binder generation projects, due to the avidity effect and the possible use of

  15. 46 CFR 7.115 - Santa Catalina Island, CA.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Santa Catalina Island, CA. 7.115 Section 7.115 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY PROCEDURES APPLICABLE TO THE PUBLIC BOUNDARY LINES Pacific Coast § 7.115 Santa Catalina Island, CA. (a) A line drawn from the northernmost point of Lion Head...

  16. The SC gets ready for visitors

    CERN Multimedia

    Antonella Del Rosso

    2012-01-01

    Hall 300, which houses the Synchrocyclotron (SC), CERN’s first accelerator, is getting ready to host a brand-new exhibition. The site will be one of the stops on the new visit itineraries that will be inaugurated for the 2013 CERN Open Day.   The Synchrocyclotron through the years. Just as it did in the late 1950s, when the accelerator was first installed, the gigantic red structure of the Synchrocyclotron's magnet occupies a large part of the 300-square-metre hall. “We have completed the first phase of the project that will give the SC a new lease of life,” says Marco Silari, the project leader and a member of CERN’s Radiation Protection Group. “We have removed all the equipment that was not an integral part of the accelerator. The hall is now ready for the civil-engineering work that will precede the installation of the exhibition.” The SC was witness to a big part of the history of CERN. The accelerator produced ...

  17. Head Position and Internally Headed Relative Clauses.

    Science.gov (United States)

    Basilico, David

    1996-01-01

    Examines "Head Movement" in internally headed relative clauses (IHRCs). The article shows that in some cases, head movement to an external position need not take place and demonstrates that this movement of the head to a sentence-internal position results from the quantificational nature of IHRCs and Diesing's mapping hypothesis (1990, 1992). (56…

  18. ViSC Social Competence Program.

    Science.gov (United States)

    Strohmeier, Dagmar; Hoffmann, Christine; Schiller, Eva-Maria; Stefanek, Elisabeth; Spiel, Christiane

    2012-01-01

    The ViSC Social Competence Program has been implemented in Austrian schools within the scope of a national strategy plan, Together Against Violence. The program is a primary preventive program designed for grades 5 to 8. The prevention of aggression and bullying is defined as a school development task, and the initial implementation of the program lasts one school year. The program consists of universal and specific actions that are implemented through in-school teacher training and a class project for students. The program was evaluated with a randomized intervention control group design. Data were collected from teachers and students. Results suggest that the program reduces aggression in schools.

  19. Islands of the Arctic

    Science.gov (United States)

    Dowdeswell, Julian; Hambrey, Michael

    2002-11-01

    The Arctic islands are characterized by beautiful mountains and glaciers, in which the wildlife lives in delicate balance with its environment. It is a fragile region with a long history of exploration and exploitation that is now experiencing rapid environmental change. All of these themes are explored in Islands of the Arctic, a richly illustrated volume with superb photographs from the Canadian Arctic archipelago, Greenland, Svalbard and the Russian Arctic. It begins with the various processes shaping the landscape: glaciers, rivers and coastal processes, the role of ice in the oceans and the weather and climate. Julian Dowdeswell and Michael Hambrey describe the flora and fauna in addition to the human influences on the environment, from the sustainable approach of the Inuit, to the devastating damage inflicted by hunters and issues arising from the presence of military security installations. Finally, they consider the future prospects of the Arctic islands Julian Dowdeswell is Director of the Scott Polar Research Institute and Professor of Physical Geography at 0he University of Cambridge. He received the Polar Medal from Queen Elizabeth for his contributions to the study of glacier geophysics and the Gill Memorial Award from the Royal Geographical Society. He is chair of the Publications Committee of the International Glaciological Society and head of the Glaciers and Ice Sheets Division of the International Commission for Snow and Ice. Michael Hambrey is Director of the Centre for Glaciology at the University of Wales, Aberystwyth. A past recipient of the Polar Medal, he was also given the Earth Science Editors' Outstanding Publication Award for Glaciers (Cambridge University Press). Hambrey is also the author of Glacial Environments (British Columbia, 1994).

  20. Effect of head rotation during surgery in the prone position on regional cerebral oxygen saturation

    DEFF Research Database (Denmark)

    Andersen, Johnny Dohn Holmgren; Baake, Gerben; Wiis, Julie Therese;

    2014-01-01

    BACKGROUND: Near-infrared spectroscopy (NIRS) has been used to study regional cerebral blood oxygen saturation (rScO2) in patients in the prone position. OBJECTIVES: We aimed to test the hypothesis that head rotation more than 45° would affect the rScO2. DESIGN: A prospective, controlled, single......-state anaesthesia with the head in the neutral position, rotated left, rotated right and returned to the neutral position. Each series consisted of three measurements: resting on the head support, during head lift (to relieve pressure on the tissue at the sensors) and returned to rest on the head support. MAIN...... OUTCOME MEASURES: The differences in rScO2 between the neutral and the turned head positions. RESULTS: For both left and right sensors, the median differences in rScO2 between neutral and left or right positions were between 0 and -1 with the head up (P = 0.14 to 0.84). The median differences...

  1. Measurement of (43)Sc and (44)Sc production cross-section with an 18MeV medical PET cyclotron.

    Science.gov (United States)

    Carzaniga, Tommaso Stefano; Auger, Martin; Braccini, Saverio; Bunka, Maruta; Ereditato, Antonio; Nesteruk, Konrad Pawel; Scampoli, Paola; Türler, Andreas; van der Meulen, Nicholas

    2017-11-01

    (43)Sc and (44)Sc are positron emitter radionuclides that, in conjunction with the β(-) emitter (47)Sc, represent one of the most promising possibilities for theranostics in nuclear medicine. Their availability in suitable quantity and quality for medical applications is an open issue and their production with medical cyclotrons represents a scientific and technological challenge. For this purpose, an accurate knowledge of the production cross sections is mandatory. In this paper, we report on the cross section measurement of the reactions (43)Ca(p,n)(43)Sc, (44)Ca(p,2n) (43)Sc, (46)Ti(p,α)(43)Sc, and (44)Ca(p,n)(44)Sc at the Bern University Hospital cyclotron. A study of the production yield and purity performed by using commercially available enriched target materials is also presented. Copyright © 2017 Elsevier Ltd. All rights reserved.

  2. BOOK REVIEW: Assessing Sc1 for GCSE

    Science.gov (United States)

    Reynolds, H.

    2000-01-01

    It is well known that investigations that `fit' the National Curriculum or examination board criteria are few in number. The fair testing emphasis means that pupils all over the country are finding out what affects the rate of a chemical reaction, the rate of photosynthesis or, in the case of Physics, the resistance of a wire. This book focuses on nine of the most common Sc1 investigations and how to prepare for them, manage and assess them. The author, a GCSE examiner, has turned his expertise into a handbook for improving Sc1 performance in the classroom. He has produced a book that would be extremely useful to both newly qualified teachers and experienced teachers. The first aim of the book, however, is to explain the requirements of Sc1. This is done comprehensively with examples of what the jargon means in practice. By breaking down the elements of planning, obtaining evidence, analysing evidence and evaluating, it is easy to see the subtleties of the mark descriptors. At first glance there seems to be little difference between the type of scientific knowledge needed for planning at level 6 and level 8. However, the level 8 statement specifies `detailed' scientific knowledge and understanding, which would mean a student should use equations from physics or symbolic chemical equations to support their arguments. One of the most useful sections in the book details the marking problems that can arise with some investigations. For example, in an investigation into electromagnets it is difficult for students to provide sufficient relevant scientific theory to satisfy the requirements of planning at level 6. One of the problems with Sc1 is that certain requirements, such as graph plotting, are difficult for many students. This book provides exercises that can be given to students to improve those skills. Each of the nine investigations is covered in great detail. Each investigation begins with an introduction detailing the rationale for choosing it, whether students

  3. Is HEADS in our heads?

    DEFF Research Database (Denmark)

    Boisen, Kirsten A; Hertz, Pernille Grarup; Blix, Charlotte

    2016-01-01

    BACKGROUND: Outpatient clinic visits are a window of opportunity to address health risk behaviors and promote a healthier lifestyle among young people. The HEADS (Home, Education, Eating, Activities, Drugs [i.e. substance use including tobacco, alcohol, and illegal drugs], Sexuality [including...... care professionals participated. We found only small reported differences between staff and young patients regarding whether home, education, and activity were addressed. However, staff reported twice the rate of addressing smoking, alcohol, illegal drugs, sexuality, and contraception compared to young...... patients. Young patients reported that smoking, alcohol, illegal drugs, sexuality, and contraception were addressed significantly more at adult clinics in comparison to pediatric clinics. After controlling for age, gender and duration of illness, according to young patients, adjusted odds ratios...

  4. Construction of multiform scFv antibodies using linker peptide

    Institute of Scientific and Technical Information of China (English)

    Shihua Wang; Cengjie Zheng; Ying Liu; Huirong Zheng; Zonghua Wang

    2008-01-01

    Multiform single chain variable fragments (acFvs) including different length linker scFvs and bispecific seFv were constructed. The linker lengths of 0, 3, 5, 8, 12, and 15 amino acids between VH and VL of antideoxynivalenol (anti-DON) scFv were used to analyze the affinities of scFvs. The affinity constants of these scFvs increased when the linker was lower than 12 amino acids. The affinity constant would not change when the linker was longer than 12 amino acids. Fusion gene of anti-DON seFv and antizearalenone (anti-ZEN) scFv was also constructed through eormection by a short peptide tinker DNA to express a bispecific scFv. The affinity constants assay showed that the two scFvs of fusion bispecific scFv remained their own affinity compared to their parental scFvs. Competitive direct enzyme linked immunosorbent assay was used to detect DON and ZEN in contaminated wheat (Triticum aestivum L.) samples, and the results indicated that this bispecifie acFv was applicable in DON and ZEN detection. This work confirmed that bispecific scFv could be successfully obtained, and might also have an application in diagnosing fungal infection, and breeding transgertic plants.

  5. Computed Tomography (CT) -- Head

    Medline Plus

    Full Text Available ... of the Head? What is CT Scanning of the Head? Computed tomography, more commonly known as a ... of page What are some common uses of the procedure? CT scanning of the head is typically ...

  6. Computed Tomography (CT) -- Head

    Medline Plus

    Full Text Available ... of the Head? What is CT Scanning of the Head? Computed tomography, more commonly known as a ... of page What are some common uses of the procedure? CT scanning of the head is typically ...

  7. Head Impact Laboratory (HIL)

    Data.gov (United States)

    Federal Laboratory Consortium — The HIL uses testing devices to evaluate vehicle interior energy attenuating (EA) technologies for mitigating head injuries resulting from head impacts during mine/...

  8. SC response characteristics of two kinds of coagulant

    Institute of Scientific and Technical Information of China (English)

    杨万东; 宋爽; 史惠祥

    2002-01-01

    Automatic coagulant dosage control with streaming current (SC) technique is introduced in this paper. Aluminum and ferric coagulants are widely used in surface water treatment. The SC response characteristics of P-AlCl3 aluminum coagulant and P-FeCl3 ferric coagulant were investigated in this work. Bench-scale water treatment results were obtained from jar tests including rapid mixing, flocculation and undisturbed sedimentation. Results showed that aluminum coagulant is more sensitive than ferric coagulant to SC response.

  9. SC response characteristics of two kinds of coagulant

    Institute of Scientific and Technical Information of China (English)

    杨万东; 宋爽; 史惠祥

    2002-01-01

    Automatic coagulant dosage control with streaming current (SC) technique is in troduced inthis paper. Aluminum and ferric coagulants are widely used in surface water treatment. The SC response characteristics of P-AiCI3 aluminum coagulant and P-FeCI3 ferric coagulant were investigated in this work. Bench-scale water treatment results were obtained from jar tests including rapid mixing,flocculation and undisturbed sedimentation. Results showed that aluminum coagulant is more sensitive than ferric coagulant to SC response.

  10. Final Scientific Report: DE-SC0002194

    Energy Technology Data Exchange (ETDEWEB)

    Seidler, Gerald [Univ. of Washington, Seattle, WA (United States)

    2017-04-07

    We provide the final scientific report for DE-SC0002194. During the term of this grant, 28 publications spanning a variety of topics were addressed under the rubric of advanced x-ray methods and their application to extreme conditions of time-resolution or x-ray intensities. Notable accomplishments include a new observation of XANES features associated with f-shell reconfiguration in lanthanides, size-dependent x-ray heating effects under XFEL illumination conditions, theoretical development of improved treatments of inelastic x-ray scattering for 'warm dense matter' conditions, and several new instrument develop efforts for atomic, molecular, and condensed phase studies in the lab and at major facility lightsources.

  11. Beautiful hainan island

    Institute of Scientific and Technical Information of China (English)

    汪伦

    2002-01-01

    Hainan Island is the second largest island in China. It is situated on the Nanhai Sea(South China Sea) and faces Guangdong Province across Qiongzhou Strait (海峡).Hainan Province was established (建立)in 1988. It consists of Hainan Island, Xisha Islands, Zhongsha Islands, Nansha Islands and the vast sea areas around them.Its total area is 340,000 km2.

  12. Heading and head injuries in soccer.

    Science.gov (United States)

    Kirkendall, D T; Jordan, S E; Garrett, W E

    2001-01-01

    In the world of sports, soccer is unique because of the purposeful use of the unprotected head for controlling and advancing the ball. This skill obviously places the player at risk of head injury and the game does carry some risk. Head injury can be a result of contact of the head with another head (or other body parts), ground, goal post, other unknown objects or even the ball. Such impacts can lead to contusions, fractures, eye injuries, concussions or even, in rare cases, death. Coaches, players, parents and physicians are rightly concerned about the risk of head injury in soccer. Current research shows that selected soccer players have some degree of cognitive dysfunction. It is important to determine the reasons behind such deficits. Purposeful heading has been blamed, but a closer look at the studies that focus on heading has revealed methodological concerns that question the validity of blaming purposeful heading of the ball. The player's history and age (did they play when the ball was leather and could absorb significant amounts of water), alcohol intake, drug intake, learning disabilities, concussion definition and control group use/composition are all factors that cloud the ability to blame purposeful heading. What does seem clear is that a player's history of concussive episodes is a more likely explanation for cognitive deficits. While it is likely that the subconcussive impact of purposeful heading is a doubtful factor in the noted deficits, it is unknown whether multiple subconcussive impacts might have some lingering effects. In addition, it is unknown whether the noted deficits have any affect on daily life. Proper instruction in the technique is critical because if the ball contacts an unprepared head (as in accidental head-ball contacts), the potential for serious injury is possible. To further our understanding of the relationship of heading, head injury and cognitive deficits, we need to: learn more about the actual impact of a ball on the

  13. Anomalous Halo Formation in an Arc-Melted ScNi-Sc2Ni Off-Eutectic Binary Alloy

    Directory of Open Access Journals (Sweden)

    Kai Wang

    2016-07-01

    Full Text Available Diverse non-equilibrium eutectic structures have attracted numerous experimental and theoretical studies. One special type is the formation of a halo of one phase around a primary dendrite of another phase. In our experiments, it was occasionally observed that ScNi halos grow as dendritic morphology around the primary Sc 2 Ni dendrites in an arc-melted ScNi-Sc 2 Ni off-eutectic binary alloy. The formation of this anomalous halo structure was then well reproduced by employing quantitative phase-field simulations. Based on the phase-field simulation, It was found that (i the large undercooling and growth velocity of the ScNi phase during solidification causes the formation of halos; and (ii the released latent heat induces the recalescence phenomenon, and changes the solidification sequence largely, resulting in the anomalous halo structure in the Sc-34 at % Ni alloy.

  14. Genome Sequence of the Fish Pathogen Yersinia ruckeri SC09 Provides Insights into Niche Adaptation and Pathogenic Mechanism.

    Science.gov (United States)

    Liu, Tao; Wang, Kai-Yu; Wang, Jun; Chen, De-Fang; Huang, Xiao-Li; Ouyang, Ping; Geng, Yi; He, Yang; Zhou, Yi; Min, Jie

    2016-04-14

    Yersinia ruckeri is the etiologic agent of enteric red mouth disease (ERM), a severe fish disease prevailing in worldwide aquaculture industries. Here we report for the first time the complete genome of Y. ruckeri (Yersinia ruckeri) SC09, a highly virulent strain isolated from Ictalurus punctatus with severe septicemia. SC09 possesses a single chromosome of 3,923,491 base pairs, which contains 3651 predicted protein coding sequences (CDS), 19 rRNA genes, and 79 tRNA genes. Among the CDS, we have identified a Ysa locus containing genes encoding all the components of a type III secretion system (T3SS). Comparative analysis suggest that SC09-Ysa share extensive similarity in sequence, gene content, and gene arrangement with Salmonella enterica pathogenicity island 1 (SPI1) and chromosome-encoded T3SS from Yersinia enterocolitica biotype 1B. Furthermore, phylogenetic analysis shown that SC09-Ysa and SPI1-T3SS belong on the same branch of the phylogenetic tree. These results suggest that SC09-Ysa and SPI1-T3SS appear to mediate biological function to adapt to specific hosts with a similar niche, and both of them are likely to facilitate the development of an intracellular niche. In addition, our analysis also indicated that a substantial part of the SC09 genome might contribute to adaption in the intestinal microenvironment, including a number of proteins associated with aerobic or anaerobic respiration, signal transduction, and various stress reactions. Genomic analysis of the bacterium offered insights into the pathogenic mechanism associated with intracellular infection and intestinal survivability, which constitutes an important first step in understanding the pathogenesis of Y. ruckeri.

  15. IEC SC15E: Report on liaison activities of CIGRÉ-SC15

    DEFF Research Database (Denmark)

    Henriksen, Mogens

    2000-01-01

    WG’s activities under CIGRÉ SC15:WG 15.01 - Fluid impregnated systems.WG 15.02 - Dielectric Liquids.WG 15.03 - Gas Insulation.WG 15.04 - Outdoor Insulation.WG 15.05 - Capacitors.WG 15.07 - Solid Insulating Materials for Rotating Machines.WG 15/33.08 - Insulation Monitoring and Life Estimation. WG...

  16. Energy dependence of deformation parameters in the SC(p,p') SC reaction

    Energy Technology Data Exchange (ETDEWEB)

    Jones, K.W.; Glashausser, C.; de Swiniarski, R.; Nanda, S.; Carey, T.A.; Cornelius, W.; Moss, J.M.; McClelland, J.B.; Comfort, J.R.; Escudie, J.

    1986-01-01

    Values of deformation parameters have been extracted from macroscopic coupled-channels analyses of inelastic proton scattering to the first 2 , 3 , and 4 states of SC over the energy range from 200 to 700 MeV. The apparent deformations are almost unchanged over this energy interval; they agree also with nucleon scattering data at much lower energies and at 800 MeV and 1 GeV.

  17. Experimental, numerical, and analytical studies on the seismic response of steel-plate concrete (SC) composite shear walls

    Science.gov (United States)

    Epackachi, Siamak

    The seismic performance of rectangular steel-plate concrete (SC) composite shear walls is assessed for application to buildings and mission-critical infrastructure. The SC walls considered in this study were composed of two steel faceplates and infill concrete. The steel faceplates were connected together and to the infill concrete using tie rods and headed studs, respectively. The research focused on the in-plane behavior of flexure- and flexure-shear-critical SC walls. An experimental program was executed in the NEES laboratory at the University at Buffalo and was followed by numerical and analytical studies. In the experimental program, four large-size specimens were tested under displacement-controlled cyclic loading. The design variables considered in the testing program included wall thickness, reinforcement ratio, and slenderness ratio. The aspect ratio (height-to-length) of the four walls was 1.0. Each SC wall was installed on top of a re-usable foundation block. A bolted baseplate to RC foundation connection was used for all four walls. The walls were identified to be flexure- and flexure-shear critical. The progression of damage in the four walls was identical, namely, cracking and crushing of the infill concrete at the toes of the walls, outward buckling and yielding of the steel faceplates near the base of the wall, and tearing of the faceplates at their junctions with the baseplate. A robust finite element model was developed in LS-DYNA for nonlinear cyclic analysis of the flexure- and flexure-shear-critical SC walls. The DYNA model was validated using the results of the cyclic tests of the four SC walls. The validated and benchmarked models were then used to conduct a parametric study, which investigated the effects of wall aspect ratio, reinforcement ratio, wall thickness, and uniaxial concrete compressive strength on the in-plane response of SC walls. Simplified analytical models, suitable for preliminary analysis and design of SC walls, were

  18. Human bulbar conjunctival hemodynamics in hemoglobin SS and SC disease.

    Science.gov (United States)

    Wanek, Justin; Gaynes, Bruce; Lim, Jennifer I; Molokie, Robert; Shahidi, Mahnaz

    2013-08-01

    The known biophysical variations of hemoglobin (Hb) S and Hb C may result in hemodynamic differences between subjects with SS and SC disease. The purpose of this study was to measure and compare conjunctival hemodynamics between subjects with Hb SS and SC hemoglobinopathies. Image sequences of the conjunctival microcirculation were acquired in 9 healthy control subjects (Hb AA), 24 subjects with SC disease, and 18 subjects with SS disease, using a prototype imaging system. Diameter (D) and blood velocity (V) measurements were obtained in multiple venules of each subject. Data were categorized according to venule caliber by averaging V and D for venules with diameters less than (vessel size 1) or greater than (vessel size 2) 15 µm. V in vessel size 2 was significantly greater than V in vessel size 1 in the AA and SS groups (P ≥ 0.009), but not in the SC group (P = 0.1). V was significantly lower in the SC group as compared to the SS group (P = 0.03). In AA and SS groups, V correlated with D (P ≤ 0.005), but the correlation was not statistically significant in the SC group (P = 0.08). V was inversely correlated with hematocrit in the SS group for large vessels (P = 0.03); however, no significant correlation was found in the SC group (P ≥ 0.2). Quantitative assessment of conjunctival microvascular hemodynamics in SS and SC disease may advance understanding of sickle cell disease pathophysiology and thereby improve therapeutic interventions.

  19. 76 FR 58401 - Safety Zone; Swim Around Charleston, Charleston, SC

    Science.gov (United States)

    2011-09-21

    ... Zone; Swim Around Charleston, Charleston, SC in the Federal Register (76 FR 38586). We received no... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Swim Around Charleston, Charleston, SC... temporary moving safety zone during the Swim Around Charleston, a swimming race occurring on waters of...

  20. Thermal stability of Al-Mg-Sc-Zr alloy

    Institute of Scientific and Technical Information of China (English)

    ZHAO Wei-tao; YAN De-sheng; RONG Li-jian

    2006-01-01

    The thermal stability of Al3(Sc,Zr) precipitates in the cold worked Al-Mg-Sc-Zr alloy after elevated temperature exposure was investigated. The evaluation was conducted using room temperature tensile, Vicker's hardness, optical metallography and scanning electron microscope (SEM) with the backscatter. The results show that the Al3(Sc,Zr) precipitates and mechanical properties have no obvious change, and the grains keep elongated along the working direction as that in cold worked sample after exposure at 300 ℃ for 1 000 h. The coarsening of Al3(Sc,Zr) precipitates occurs and is no longer effective on the recrystallization resistance, and partial recrystallization is observed after 400 ℃ exposure. In particular, after 500 ℃ exposure, the hardness decreases drastically and the alloy has fully recrystallized due to the obvious coarsening of Al3(Sc,Zr) precipitates.

  1. Cyclotron production of (44)Sc: From bench to bedside.

    Science.gov (United States)

    van der Meulen, Nicholas P; Bunka, Maruta; Domnanich, Katharina A; Müller, Cristina; Haller, Stephanie; Vermeulen, Christiaan; Türler, Andreas; Schibli, Roger

    2015-09-01

    (44)Sc, a PET radionuclide, has promising decay characteristics (T1/2 = 3.97 h, Eβ(+)av = 632 keV) for nuclear imaging and is an attractive alternative to the short-lived (68)Ga (T1/2 = 68 min, Eβ(+)av = 830 keV). The aim of this study was the optimization of the (44)Sc production process at an accelerator, allowing its use for preclinical and clinical PET imaging. (44)CaCO3 targets were prepared and irradiated with protons (~11 MeV) at a beam current of 50 μA for 90 min. (44)Sc was separated from its target material using DGA extraction resin and concentrated using SCX cation exchange resin. Radiolabeling experiments at activities up to 500 MBq and stability tests were performed with DOTANOC by investigating different scavengers, including gentisic acid. Dynamic PET of an AR42J tumor-bearing mouse was performed after injection of (44)Sc-DOTANOC. The optimized chemical separation method yielded up to 2 GBq (44)Sc of high radionuclidic purity. In the presence of gentisic acid, radiolabeling of (44)Sc with DOTANOC was achieved with a radiochemical yield of ~99% at high specific activity (10 MBq/nmol) and quantities which would allow clinical application. The dynamic PET images visualized increasing uptake of (44)Sc-DOTANOC into AR42J tumors and excretion of radioactivity through the kidneys of the investigated mouse. The concept "from-bench-to-bedside" was clearly demonstrated in this extended study using cyclotron-produced (44)Sc. Sufficiently high activities of (44)Sc of excellent radionuclidic purity are obtainable for clinical application, by irradiation of enriched calcium at a cyclotron. This work demonstrates a promising basis for introducing (44)Sc to clinical routine of nuclear imaging using PET. Copyright © 2015 Elsevier Inc. All rights reserved.

  2. Hydride vapor phase epitaxy growth of GaN, InGaN, ScN, and ScAIN

    NARCIS (Netherlands)

    Bohnen, T.

    2010-01-01

    Chemical vapor deposition (CVD); hydride vapor phase epitaxy (HVPE); gallium nitride (GaN); indium gallium nitride (InGaN); scandium nitride (ScN); scandium aluminum nitride (ScAlN); semiconductors; thin films; nanowires; III nitrides; crystal growth - We studied the HVPE growth of different III ni

  3. Effective single chain antibody (scFv) concentrations in vivo via adenoviral vector mediated expression of secretory scFv

    NARCIS (Netherlands)

    Arafat, WO; Gomez-Navarro, J; Buchsbaum, DJ; Xiang, J; Casado, E; Barker, SD; Mahasreshti, PJ; Haisma, HJ; Barnes, MN; Siegal, GP; Alvarez, RD; Hemminki, A; Nettelbeck, DM; Curiel, DT

    2002-01-01

    Single chain antibodies (scFv) represent powerful interventional agents for the achievement of targeted therapeutics. The practical utility of these agents have been limited, however, by difficulties related to production of recombinant scFv and the achievement of effective and sustained levels of s

  4. Hawaiian Island Archipelago

    Science.gov (United States)

    1985-01-01

    The entire Hawaiian Island Archipelago (21.5N, 158.0W) is seen in this single view. The islands are a favorite international resort and tourist attraction drawing visitors from all over the world to enjoy the tropical climate, year round beaches and lush island flora. Being volcanic in origin, the islands' offer a rugged landscape and on the big island of Hawaii, there is still an occasional volcanic eruption of lava flows and steam vents.

  5. The high-temperature modification of ScRuSi - Structure, 29Si and 45Sc solid state NMR spectroscopy

    Science.gov (United States)

    Hoffmann, Rolf-Dieter; Rodewald, Ute Ch.; Haverkamp, Sandra; Benndorf, Christopher; Eckert, Hellmut; Heying, Birgit; Pöttgen, Rainer

    2017-10-01

    A polycrystalline sample of the TiNiSi type low-temperature (LT) modification of ScRuSi was synthesized by arc-melting. Longer annealing in a sealed silica tube (6 weeks at 1270 K) followed by quenching led to the high-temperature (HT) phase. HT-ScRuSi adopts the ZrNiAl structure type: P 6 bar 2 m , a = 688.27(9), c = 336.72(5) pm, wR2 = 0.0861, 260 F2 values, 14 variables. The striking structural building units are regular, tricapped trigonal prisms Si1@Ru3Sc6 and Si2@Ru6Sc3. Both polymorphs have been characterized by 29Si and 45Sc MAS-NMR spectroscopy. The local scandium environments in the two polymorphs are easily distinguished by their electric field gradient tensor values, in agreement with theoretically calculated values.

  6. Cyclotron production of {sup 43}Sc for PET imaging

    Energy Technology Data Exchange (ETDEWEB)

    Walczak, Rafał [Institute of Nuclear Chemistry and Technology, Dorodna 16, 03-195 Warsaw (Poland); Krajewski, Seweryn [Synektik S.A., Research and Development Center, Warsaw (Poland); Szkliniarz, Katarzyna [Department of Nuclear Physics, University of Silesia, Katowice (Poland); Sitarz, Mateusz [Heavy Ion Laboratory, University of Warsaw, Warsaw (Poland); Abbas, Kamel [Nuclear Security Unit, Joint Research Centre, Institute for Transuranium Elements, European Commission, Ispra (Italy); Choiński, Jarosław; Jakubowski, Andrzej; Jastrzębski, Jerzy [Heavy Ion Laboratory, University of Warsaw, Warsaw (Poland); Majkowska, Agnieszka [Institute of Nuclear Chemistry and Technology, Dorodna 16, 03-195 Warsaw (Poland); Simonelli, Federica [Nuclear Decommissioning Unit, Joint Research Centre, Ispra Site Management Directorate, European Commission, Ispra (Italy); Stolarz, Anna; Trzcińska, Agnieszka [Heavy Ion Laboratory, University of Warsaw, Warsaw (Poland); Zipper, Wiktor [Department of Nuclear Physics, University of Silesia, Katowice (Poland); Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Dorodna 16, 03-195 Warsaw (Poland)

    2015-12-04

    Recently, significant interest in {sup 44}Sc as a tracer for positron emission tomography (PET) imaging has been observed. Unfortunately, the co-emission by {sup 44}Sc of high-energy γ rays (E{sub γ} = 1157, 1499 keV) causes a dangerous increase of the radiation dose to the patients and clinical staff. However, it is possible to produce another radionuclide of scandium—{sup 43}Sc—having properties similar to {sup 44}Sc but is characterized by much lower energy of the concurrent gamma emissions. This work presents the production route of {sup 43}Sc by α irradiation of natural calcium, its separation and purification processes, and the labeling of [DOTA,Tyr3] octreotate (DOTATATE) bioconjugate. Natural CaCO{sub 3} and enriched [{sup 40}Ca]CaCO{sub 3} were irradiated with alpha particles for 1 h in an energy range of 14.8–30 MeV at a beam current of 0.5 or 0.25 μA. In order to find the optimum method for the separation of {sup 43}Sc from irradiated calcium targets, three processes previously developed for {sup 44}Sc were tested. Radiolabeling experiments were performed with DOTATATE radiobioconjugate, and the stability of the obtained {sup 43}Sc-DOTATATE was tested in human serum. Studies of {sup nat}CaCO{sub 3} target irradiation by alpha particles show that the optimum alpha particle energies are in the range of 24–27 MeV, giving 102 MBq/μA/h of {sup 43}Sc radioactivity which creates the opportunity to produce several GBq of {sup 43}Sc. The separation experiments performed indicate that, as with {sup 44}Sc, due to the simplicity of the operations and because of the chemical purity of the {sup 43}Sc obtained, the best separation process is when UTEVA resin is used. The DOTATATE conjugate was labeled by the obtained {sup 43}Sc with a yield >98 % at elevated temperature. Tens of GBq activities of {sup 43}Sc of high radionuclidic purity can be obtainable for clinical applications by irradiation of natural calcium with an alpha beam.

  7. Effects of cooling rate on solidification behavior of dilute Al-Sc and Al-Sc-Zr solid solution

    Institute of Scientific and Technical Information of China (English)

    金头男; 聂祚仁; 徐国富; 阮海琼; 杨军军; 付静波; 左铁镛

    2004-01-01

    Six alloys with different compositions of Al-0.1%Sc, Al-0.3%Sc, Al-0.3%Zr, Al-0.1% Sc-0. 1%Zr,Al-0.3%Sc-0.1%Zr and Al-0.3%Sc-0.3%Zr were prepared by casting in a wedge shaped copper mould. The hardness test, microstructure observation, and DSC thermal analysis were applied to fully investigate the solidification behavior of the wedge tip (whose cooling rate is 1 000 K/s) and the top surface (cooling rate 100 K/s) of each casting. The results show that the cast structures in the hypoeutectic region of Al-Sc alloys are slightly affected by cooling rates during the solidification. In the case of hypereutectic alloy of Al-0.3%Sc-0.3%Zr , the cast grains were remarkably refined under the condition of a 100 K/s cooling rate, however, under a 1 000 K/s cooling rate condition,solute atoms contribute nothing to the grain-refinement, due to the eutectic concentration becomes higher. The hardness can be improved to a greater degree by Sc single addition, compared to single Zr addition, but it can be improved even greater when Sc added together with Zr. It is sensitive to cooling rate, the higher the cooling rate, the greater the hardness. By combining the results of TEM examination and DSC analysis, it can be seen that a supersaturated Al solid solution forms during the solidification, and the solubility of Sc in Al solution can be improved by increasing the cooling rate.

  8. The influence of shear-velocity heterogeneity on ScS2/ScS amplitude ratios and estimates of Q in the mantle

    Science.gov (United States)

    Chaves, Carlos A. M.; Ritsema, Jeroen

    2016-08-01

    Regional waveforms of deep-focus Tonga-Fiji earthquakes indicate anomalous traveltime differences (ScS2-ScS) and amplitude ratios (ScS2/ScS) of the phases ScS and ScS2. The correlation between the ScS2-ScS delay time and the ScS2/ScS amplitude ratio suggests that shear wave apparent Q in the mantle below the Tonga-Fiji region is highest when shear wave velocities are lowest. This observation is unexpected if temperature variations were responsible for the seismic anomalies. Using spectral element method waveform simulations for four tomographic models, we demonstrate that focusing and scattering of shear waves by long-wavelength 3-D heterogeneity in the mantle may overwhelm the signal from intrinsic attenuation in long-period ScS2/ScS amplitude ratios. The tomographic models reproduce the trends in recorded ScS2-ScS difference times and ScS2/ScS amplitude ratios. Although they cannot be ruled out, variations in shear wave attenuation (i.e., the quality factor Q) are not necessary to explain the data.

  9. Pascal-SC a computer language for scientific computation

    CERN Document Server

    Bohlender, Gerd; von Gudenberg, Jürgen Wolff; Rheinboldt, Werner; Siewiorek, Daniel

    1987-01-01

    Perspectives in Computing, Vol. 17: Pascal-SC: A Computer Language for Scientific Computation focuses on the application of Pascal-SC, a programming language developed as an extension of standard Pascal, in scientific computation. The publication first elaborates on the introduction to Pascal-SC, a review of standard Pascal, and real floating-point arithmetic. Discussions focus on optimal scalar product, standard functions, real expressions, program structure, simple extensions, real floating-point arithmetic, vector and matrix arithmetic, and dynamic arrays. The text then examines functions a

  10. III-V compound SC for optoelectronic devices

    Directory of Open Access Journals (Sweden)

    Sudha Mokkapati

    2009-04-01

    Full Text Available III-V compound semiconductors (SC have played a crucial role in the development of optoelectronic devices for a broad range of applications. Major applications of InP or GaAs based III-V compound SC are devices for optical fiber communications, infrared and visible LEDs/LDs and high efficiency solar cells. GaN based compounds are extremely important for short wavelength light emitters used in solid state lighting systems. We review the important device applications of various III-V compound SC materials.

  11. SC-System of convergence theory and foundations

    Directory of Open Access Journals (Sweden)

    Sergio G. De los Cobos Silva

    2015-08-01

    Full Text Available In this paper a novel system of convergence (SC is presented as well as its fundamentals and computing experience. An implementation using a novel mono-objetive particle swarm optimization (PSO algorithm with three phases (PSO-3P: stabilization, generation with broad-ranging exploration and generation with in-depth exploration, is presented and tested in a diverse benchmark problems. Evidence shows that the three-phase PSO algoritm along with the SC criterion (SC-PSO-3Pcan converge to the global optimum in several difficult test functions for multiobjective optimization problems, constrained optimization problems and unconstrained optimization problems with 2 until 120,000 variables.

  12. Gadolinium scandium germanide, Gd2Sc3Ge4

    Directory of Open Access Journals (Sweden)

    Sumohan Misra

    2009-04-01

    Full Text Available Gd2Sc3Ge4 adopts the orthorhombic Pu5Rh4-type structure. The crystal structure contains six sites in the asymmetric unit: two sites are statistically occupied by rare-earth atoms with Gd:Sc ratios of 0.967 (4:0.033 (4 and 0.031 (3:0.969 (3, one site (.m. symmetry is occupied by Sc atoms, and three distinct sites (two of which with .m. symmetry are occupied by Ge atoms. The rare-earth atoms form two-dimensional slabs with Ge atoms occupying the trigonal-prismatic voids.

  13. Streamlined Islands in Ares Valles

    Science.gov (United States)

    2002-01-01

    catastrophic floods that came through Ares Valles. The Story In symbolism only, these guppy-shaped islands and current-like flutes of land beside them may conjure up a mental image of a flowing Martian river. This picture would only be half-right. Scientifically, no fish ever swam this channel, but these landforms do reveal that catastrophic floods of rushing water probably patterned the land in just this way. Geologists who study flood areas believe that a tremendous force of moving water probably carved both the islands and the small, parallel, 'current-like' ridges around them. The blunt end of the islands (the 'heads' of the 'fish') are probably ancient impact craters that posed obstacles to the water as it rushed down the channel in torrents. Because a crater is resistant to erosion, it creates a geologic barrier around which the water must flow. As the water makes its way downstream, the crater's interference with the water flow is reduced, so the water that was diverted around the obstacle rejoins at the narrow end of the island (the 'tail' of the 'fish'). Therefore, from this information, you can tell that the water flowed from the southeast to the northwest. As a rule of thumb for the future, you can say that the narrow end of the island points downstream. The result may be the island behind the crater, but geologists disagree about the exact process by which the island forms. Some scientists argue that the erosive power of the water is directed outward, leaving the area behind, or in the lee of, the obstacle relatively untouched. Other scientists argue that the water slows when it encounters the crater obstacle, and small particles of sand and 'dirt' drop out of the water and are deposited in the lee. There's another small associated uncertainty too. Look closely at the edges of the islands and notice how the land is terraced. These ledges might mark the height of the water at various times during the flood . . . or they might be an indication that layering occurred

  14. Computed Tomography (CT) -- Head

    Medline Plus

    Full Text Available ... limitations of CT Scanning of the Head? What is CT Scanning of the Head? Computed tomography, more ... the body being studied. top of page How is the procedure performed? The technologist begins by positioning ...

  15. Infectivity-associated PrP(Sc) and disease duration-associated PrP(Sc) of mouse BSE prions.

    Science.gov (United States)

    Miyazawa, Kohtaro; Okada, Hiroyuki; Masujin, Kentaro; Iwamaru, Yoshifumi; Yokoyama, Takashi

    2015-01-01

    Disease-related prion protein (PrP(Sc)), which is a structural isoform of the host-encoded cellular prion protein, is thought to be a causative agent of transmissible spongiform encephalopathies. However, the specific role of PrP(Sc) in prion pathogenesis and its relationship to infectivity remain controversial. A time-course study of prion-affected mice was conducted, which showed that the prion infectivity was not simply proportional to the amount of PrP(Sc) in the brain. Centrifugation (20,000 ×g) of the brain homogenate showed that most of the PrP(Sc) was precipitated into the pellet, and the supernatant contained only a slight amount of PrP(Sc). Interestingly, mice inoculated with the obtained supernatant showed incubation periods that were approximately 15 d longer than those of mice inoculated with the crude homogenate even though both inocula contained almost the same infectivity. Our results suggest that a small population of fine PrP(Sc) may be responsible for prion infectivity and that large, aggregated PrP(Sc) may contribute to determining prion disease duration.

  16. Precipitation in cold-rolled Al-Sc-Zr and Al-Mn-Sc-Zr alloys prepared by powder metallurgy

    KAUST Repository

    Vlach, Martin

    2013-12-01

    The effects of cold-rolling on thermal, mechanical and electrical properties, microstructure and recrystallization behaviour of the AlScZr and AlMnScZr alloys prepared by powder metallurgy were studied. The powder was produced by atomising in argon with 1% oxygen and then consolidated by hot extrusion at 350 C. The electrical resistometry and microhardness together with differential scanning calorimetry measurements were compared with microstructure development observed by transmission and scanning electron microscopy, X-ray diffraction and electron backscatter diffraction. Fine (sub)grain structure developed and fine coherent Al3Sc and/or Al3(Sc,Zr) particles precipitated during extrusion at 350 C in the alloys studied. Additional precipitation of the Al3Sc and/or Al3(Sc,Zr) particles and/or their coarsening was slightly facilitated by the previous cold rolling. The presence of Sc,Zr-containing particles has a significant antirecrystallization effect that prevents recrystallization at temperatures minimally up to 420 C. The precipitation of the Al6Mn- and/or Al 6(Mn,Fe) particles of a size ~ 1.0 μm at subgrain boundaries has also an essential antirecrystallization effect and totally suppresses recrystallization during 32 h long annealing at 550 C. The texture development of the alloys seems to be affected by high solid solution strengthening by Mn. The precipitation of the Mn-containing alloy is highly enhanced by a cold rolling. The apparent activation energy of the Al3Sc particles formation and/or coarsening and that of the Al6Mn and/or Al 6(Mn,Fe) particle precipitation in the powder and in the compacted alloys were determined. The cold deformation has no effect on the apparent activation energy values of the Al3Sc-phase and the Al 6Mn-phase precipitation. © 2013 Elsevier Inc.

  17. Design of SC walls and slabs for impulsive loading

    Energy Technology Data Exchange (ETDEWEB)

    Varma, Amit H. [Purdue Univ., West Lafayette, IN (United States)

    2015-11-11

    Reinforced concrete (RC) structures have historically been the preferred choice for blast resistant structures because of their mass and the ductility provided by steel reinforcement. Steel-plate composite (SC) walls are a viable alternative to RC for protecting the infrastructure against explosive threats. SC structures consist of two steel faceplates with a plain concrete core between them. The steel faceplates are anchored to the concrete using stud anchors and connected to each other using tie bars. SC structures provide mass from the concrete infill and ductility from the continuous external steel faceplates. This dissertation presents findings and recommendations from experimental and analytical investigations of the performance of SC walls subjected to far-field blast loads.

  18. The data acquisition system (DAS) for the improved CERN SC

    CERN Document Server

    Beger, H; Fiebig, A; Schroot, H

    1975-01-01

    A digital data acquisition system (DAS) based on a minicomputer is described which registers the failure sequences in various equipment areas of the CERN synchrocyclotron (henceforward referred to as the SC). The avalanches of failure signals which occur from time to time are tapped from the alarm/security systems, time-resolved to 10 msec and recorded on a printer in order to aid SC failure diagnosis. The mechanisms of the DAS and its relation to the SC equipment are explained in some detail. All programs were constructed at assembler language level for speed and for ease of on-line program maintenance. The alarm sequences recorded have been of considerable help during the running in of the new radiofrequency system. Now that the new SC is operational, the DAS furnishes useful data from several equipment areas to the operators and engineers.

  19. 75 FR 71734 - Outer Continental Shelf (OCS), Scientific Committee (SC)

    Science.gov (United States)

    2010-11-24

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF THE INTERIOR Bureau of Ocean Energy Management, Regulation and Enforcement Outer Continental Shelf (OCS), Scientific Committee (SC) AGENCY: Bureau of Ocean Energy Management, Regulation and Enforcement (BOEMRE),...

  20. Aging of Al-0,3 at. % Sc alloy

    Energy Technology Data Exchange (ETDEWEB)

    Drits, M.E.; Ber, L.B.; Bykov, L.S.; Toropova, L.S.; Anastas' eva, G.K. (AN SSSR, Moscow. Inst. Metallurgii)

    1984-06-01

    Method of measuring electric conductivity, hardness and yield limit was used to study the kinetics of aging of Al-0.3 at.%Sc alloy in 20-450 deg c range. It was established by X-ray methods of monocrystal investigation and diffraction electron microscopy that coherent precipitations of equilibrium ScAl/sub 3/ pha se with li/sub 2/ type structure and 0.41 nm lattice parameter represent the product of decomposition of supersaturated solid solution. Characteristic features and the kinetics of ScAl/sub 3/ phase particle growth were studied by the electron microscopic method. The activation energy of scandium and aluminium diffusion equal to 3.81 MJ/kg was determined. The analysis of deformation hardening of Al-0.3 at.%Sc alloy at different stages of aging was conducted.

  1. Magnetic properties of the Sc-H system

    Energy Technology Data Exchange (ETDEWEB)

    Volkenshtein, N.V.; Galoshina, E.V. (AN SSSR, Sverdlovsk. Ural' skij Nauchnyj Tsentr); Kost, M.E. (AN SSSR, Moscow. Inst. Obshchej i Neorganicheskoj Khimii); Shubina, T.S. (Ural' skij Gosudarstvennyj Univ., Sverdlovsk (USSR))

    1983-05-01

    The magnetic susceptibility in the ..cap alpha..-phase region of the Sc-H system and in scandium hydrides ScH/sub 2/ is investigated. The temperature dependence of the susceptibility was measured from liquid-helium temperature to room temperature in a magnetic field of 10 kOe. The influence of hydrogenation and of band structure parameters (density of states at the Fermi level, spin-relaxation time, and Fermi energy) on the susceptibility is shown and discussed.

  2. Homogenization of alloys in the system Al-Mg-Sc

    Science.gov (United States)

    Drits, M. E.; Toropova, L. S.; Bykov, Yu. G.

    1983-07-01

    A reduction in homogenizing anneal temperature and a reduction in soaking time leads to an increase in yield point for alloys of the system Al-Mg-Sc. The optimum homogenizing schedule for alloys of this system is heating to 400°C and soaking for up to 10 h. This homogenizing schedule provides an alloy structure of fine coherent ScAl3-phase precipitates and dissolution of excess β-phase precipitates.

  3. Shemya Island prehistory

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The 752 artifacts described in this paper are from 5 sites on Shemya Island. Artifactual evidence suggests the island had a small resident population and was...

  4. and Prince Edward Island

    African Journals Online (AJOL)

    spamer

    -nesting seabirds of the Prince Edward Islands into the 21st century, but only providing the effects of .... too penguins resulted in high losses of eggs and chicks ... Marion Island base. ..... which comes into force three months after five Parties.

  5. Classifying Pacific islands

    Science.gov (United States)

    Nunn, Patrick D.; Kumar, Lalit; Eliot, Ian; McLean, Roger F.

    2016-12-01

    An earth-science-based classification of islands within the Pacific Basin resulted from the preparation of a database describing the location, area, and type of 1779 islands, where island type is determined as a function of the prevailing lithology and maximum elevation of each island, with an island defined as a discrete landmass composed of a contiguous land area ≥1 ha (0.01 km2) above mean high-water level. Reefs lacking islands and short-lived (ocean setting as well as the biological attributes of Pacific islands. It may also be used in spatial assessments of second-order phenomena associated with the islands, such as their vulnerability to various disasters, coastal erosion, or ocean pollution as well as human populations, built infrastructure and natural resources.

  6. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... Site Index A-Z Magnetic Resonance Imaging (MRI) - Head Magnetic resonance imaging (MRI) of the head uses ... of the Head? What is MRI of the Head? Magnetic resonance imaging (MRI) is a noninvasive medical ...

  7. Arctic ice islands

    Energy Technology Data Exchange (ETDEWEB)

    Sackinger, W.M.; Jeffries, M.O.; Lu, M.C.; Li, F.C.

    1988-01-01

    The development of offshore oil and gas resources in the Arctic waters of Alaska requires offshore structures which successfully resist the lateral forces due to moving, drifting ice. Ice islands are floating, a tabular icebergs, up to 60 meters thick, of solid ice throughout their thickness. The ice islands are thus regarded as the strongest ice features in the Arctic; fixed offshore structures which can directly withstand the impact of ice islands are possible but in some locations may be so expensive as to make oilfield development uneconomic. The resolution of the ice island problem requires two research steps: (1) calculation of the probability of interaction between an ice island and an offshore structure in a given region; and (2) if the probability if sufficiently large, then the study of possible interactions between ice island and structure, to discover mitigative measures to deal with the moving ice island. The ice island research conducted during the 1983-1988 interval, which is summarized in this report, was concerned with the first step. Monte Carlo simulations of ice island generation and movement suggest that ice island lifetimes range from 0 to 70 years, and that 85% of the lifetimes are less then 35 years. The simulation shows a mean value of 18 ice islands present at any time in the Arctic Ocean, with a 90% probability of less than 30 ice islands. At this time, approximately 34 ice islands are known, from observations, to exist in the Arctic Ocean, not including the 10-meter thick class of ice islands. Return interval plots from the simulation show that coastal zones of the Beaufort and Chukchi Seas, already leased for oil development, have ice island recurrences of 10 to 100 years. This implies that the ice island hazard must be considered thoroughly, and appropriate safety measures adopted, when offshore oil production plans are formulated for the Alaskan Arctic offshore. 132 refs., 161 figs., 17 tabs.

  8. Researching Pacific island livelihoods:

    DEFF Research Database (Denmark)

    Egelund Christensen, Andreas; Mertz, Ole

    2010-01-01

    Small island literature is vast in focus and aim, and is rooted in many different disciplines. The challenge is to find common grounds for researching small islands conceptually and theoretically. The aim of this article is to comment on how to research small islands, including a discussion on co...... and interdisciplinary in focus and link socio-economic and ecological processes of small island societies at temporal and analytical scales....

  9. Theoretical studies of the low-lying states of ScO, ScS, VO, and VS

    Science.gov (United States)

    Bauschlicher, Charles W., Jr.; Langhoff, Stephen R.

    1986-01-01

    Bonding in the low-lying states of ScO, ScS, VO, and VS is theoretically studied. Excellent agreement is obtained with experimental spectroscopic constants for the low-lying states of ScO and VO. The results for VS and ScS show that the bonding in the oxides and sulfides is similar, but that the smaller electronegativity in S leads to a smaller ionic component in the bonding. The computed D0 of the sulfides are about 86 percent of the corresponding oxides, and the low-lying excited states are lower in the sulfides than in the corresponding oxides. The CPF method is shown to be an accurate and cost-effective method for obtaining reliable spectroscopic constants for these systems.

  10. Effect of homogenizing heatings on the properties of Al-Sc and Al-Mg-Sc alloy systems

    Energy Technology Data Exchange (ETDEWEB)

    Drits, M.E.; Toropova, L.S.; Anastas' eva, G.K.; Nagornichnykh, G.L.

    Effect of annealing on hardness and electric conductivity of cast alloys of Al-Mg-Sc and Al-Sc systems has been studied. Magnesium content in studied alloys was changed in the range of 0-6.5%, scandium content was chosen to be constant -0.4%. It has been revealed that homogenizing heatings of Al-Sc alloys lead to a decomposition of abnormally saturated solid solution during crystallization at temperatures >250 deg C. Maximum hardness values are achieved after annealing at 300 deg C during 1h. Homogenizing of Al-Mg--- Sc alloys at 350 deg C during 24h leads to practically full solubility of a nonequilibrium ..beta..-phase (Mg/sub 2/Al/sub 3/) and also to a decomposition of a solid solution abnormally saturated with scandium. Maximum values of hardness are achieved after annealing at 35O deg C during 0.5-1h.

  11. The Islands, Barbados

    NARCIS (Netherlands)

    Drieman, R.; Hinborch, M.; Monden, M.; Vendrik, E.A.J.

    2009-01-01

    Master project report. In Barbados the problem arose of lack of space for development on the existing shoreline. Therefore the project "The Islands" has been conceptualized. In front of the west coast of Barbados, a group of artificial islands will be created. On the islands there will be space for

  12. Compensation of native donor doping in ScN: Carrier concentration control and p-type ScN

    Science.gov (United States)

    Saha, Bivas; Garbrecht, Magnus; Perez-Taborda, Jaime A.; Fawey, Mohammed H.; Koh, Yee Rui; Shakouri, Ali; Martin-Gonzalez, Marisol; Hultman, Lars; Sands, Timothy D.

    2017-06-01

    Scandium nitride (ScN) is an emerging indirect bandgap rocksalt semiconductor that has attracted significant attention in recent years for its potential applications in thermoelectric energy conversion devices, as a semiconducting component in epitaxial metal/semiconductor superlattices and as a substrate material for high quality GaN growth. Due to the presence of oxygen impurities and native defects such as nitrogen vacancies, sputter-deposited ScN thin-films are highly degenerate n-type semiconductors with carrier concentrations in the (1-6) × 1020 cm-3 range. In this letter, we show that magnesium nitride (MgxNy) acts as an efficient hole dopant in ScN and reduces the n-type carrier concentration, turning ScN into a p-type semiconductor at high doping levels. Employing a combination of high-resolution X-ray diffraction, transmission electron microscopy, and room temperature optical and temperature dependent electrical measurements, we demonstrate that p-type Sc1-xMgxN thin-film alloys (a) are substitutional solid solutions without MgxNy precipitation, phase segregation, or secondary phase formation within the studied compositional region, (b) exhibit a maximum hole-concentration of 2.2 × 1020 cm-3 and a hole mobility of 21 cm2/Vs, (c) do not show any defect states inside the direct gap of ScN, thus retaining their basic electronic structure, and (d) exhibit alloy scattering dominating hole conduction at high temperatures. These results demonstrate MgxNy doped p-type ScN and compare well with our previous reports on p-type ScN with manganese nitride (MnxNy) doping.

  13. Resurrection Peninsula and Knight Island ophiolites and recent faulting on Montague Island, southern Alaska

    Science.gov (United States)

    Nelson, Steven W.; Miller, Marti L.; Dumoulin, Julie A.

    1987-01-01

    The Resurrection Peninsula forms the east side of Resurrection Bay (Fig. 1). The city of Seward is located at the head of the bay and can be reached from Anchorage by highway (127 mi;204 km). Relief ranges from 1,434 ft (437 m) at the southern end of the peninsula to more than 4,800 ft (1,463 m) 17 mi (28 km) to the north. All rock units composing the informally named Resurrection Peninsula ophiolite are visible and (or) accessible by boat.The eastern half of the peninsula is located within the Chugach National Forest; the western half is mainly state land, but there is some private land with recreational cabins. The Seward A6 and A7 and Blying Sound D6 and D7 maps at 1:63,360 scale (mile-to-the-inch) cover the entire Resurrection Peninsula.Knight Island is located 53 mi (85 km) east of Seward (Fig. 1). Numerous fiords indent the 31-mi-long (50 km) by 7.4-mi-wide (12 km) island and offer excellent bedrock exposures. The island is rugged and has a maximum elevation of 3,000 ft (914 m). It has numerous mineral prospects (Tysdal, 1978; Nelson and others, 1984; Jansons and others, 1984; Koski and others, 1985), and several abandoned canneries are located on the island. Knight Island lies entirely within the Chugach National Forest—state and private inholdings constitute less than five percent of its total land area. The Seward A2, A3, B2, B3, and C2, 1:63,360-scale U.S. Geological Survey topographic maps cover the entire island.Montague Island, 50 mi (80 km) long and up to 11 mi (18 km) wide, lies 10.6 mi (17 km) southeast of Knight Island. It belongs to an island group that forms the southern margin of Prince William Sound (Fig. 1). Montague Island is less rugged and less heavily vegetated than either the Resurrection Peninsula or Knight Island. Rock exposures are excellent along the beaches, and ground disruption due to recent fault movements is clearly visible. The Seward Al and A2 and Blying Sound Dl, D2, and D3 maps cover the areas of interest on Montague Island

  14. A Phenomenology of Islands

    Directory of Open Access Journals (Sweden)

    Pete Hay

    2006-05-01

    Full Text Available The question is posed: is a coherent theory of islandness – nissology – possible? Faultlines within constructions of islands and islandness are noted. Some of these axes of contestation have remained latent but have the potential to be sharply divisive. Three of the identified faultlines are examined – the nature of the island ‘edge’, the import for questions of island memory and identity of massive inward and outward movements of people, and the appropriation of island ‘realness’ by those for whom ‘island’ best functions as metaphor. A case is made for the excision of the latter from the purview of island studies. Despite apparent irreconcilability within island studies’ emerging faultlines, it is argued that place theory does constitute a theoretical framing that can work for island studies. Following a brief overview of the faultlines that also exist within place studies, it is noted that the difference-respecting and identity focused nature of phenomenology of place is particularly apposite for island studies, and the paper concludes with a consideration of what a phenomenology of islands might look like.

  15. Final Technical Report for Award SC0008613

    Energy Technology Data Exchange (ETDEWEB)

    Knopf, Daniel A. [Stony Brook Univ., NY (United States)

    2017-04-05

    Discovering how aerosol particles, present in the atmosphere in sizes of a few nanometers to hundred micrometers, initiate ice crystal formation represents a great challenge. Atmospheric ice nucleation is important because ice crystals alter the radiative properties of clouds and thus climate, and impact precipitation and thus the hydrological cycle. The difficulty in predicting atmospheric ice formation is attributable at least in part, to the diversity of ice nucleation pathways, the physical and chemical complexity of the ice nucleating particles (INPs), and the relatively small numbers of INPs (compared with all other aerosol particles), sometimes less than one in 100000. These factors in turn makes constraining ice nucleation parameterizations for modeling applications challenging. The majority of airborne particles are known to be organic in nature or contain organic biogenic material. The presence of organic material adds to the complexity of the particles and therefore the predictability of ice nucleation events since the organic species can display different phase states, e.g. liquid or solid, in response to temperature and humidity. The award DE-SC0008613 to PI Prof. Daniel Knopf at Stony Brook University, “Relating the Chemical and Physical Properties of Aerosols to the Water Uptake and Ice Nucleation Potential of Particles Collected During the Carbonaceous Aerosols and Radiative Effects Study (CARES)”, allowed examination of laboratory generated aerosol particles and field-collected particles for their propensity to nucleate ice under typical tropospheric conditions and relate ice nucleation to the physicochemical properties of the particles including their morphology and chemical composition. This in turn allowed for development of ice nucleation parameterizations for implementation in cloud models. The award resulted in 10 peer-reviewed publications and more than 20 seminar and conference presentations. We demonstrated that the rate of immersion

  16. Medialogy (English Information Brochure on the education M.Sc.,Medialogy, 3rd to 10th semester (B.Sc. & M.Sc) - For graduates from higher study programmes such as Multimedia Design and IT Graduates)

    DEFF Research Database (Denmark)

    Nordahl, Rolf

    2005-01-01

    An information brochure, 24 pages, in English which describes the education M.Sc., Medialogy, offered by Aalborg University in Copenhagen and Esbjerg. The brochure describes the 3rd to 10th semester (B.Sc. and M.Sc. degree) of the education. The information is primarily directed toward potential...

  17. Piezoelectric coefficients and spontaneous polarization of ScAlN.

    Science.gov (United States)

    Caro, Miguel A; Zhang, Siyuan; Riekkinen, Tommi; Ylilammi, Markku; Moram, Michelle A; Lopez-Acevedo, Olga; Molarius, Jyrki; Laurila, Tomi

    2015-06-24

    We present a computational study of spontaneous polarization and piezoelectricity in Sc(x)Al(1-x)N alloys in the compositional range from x = 0 to x = 0.5, obtained in the context of density functional theory and the Berry-phase theory of electric polarization using large periodic supercells. We report composition-dependent values of piezoelectric coefficients e(ij), piezoelectric moduli d(ij) and elastic constants C(ij). The theoretical findings are complemented with experimental measurement of e33 for a series of sputtered ScAlN films carried out with a piezoelectric resonator. The rapid increase with Sc content of the piezoelectric response reported in previous studies is confirmed for the available data. A detailed description of the full methodology required to calculate the piezoelectric properties of ScAlN, with application to other complex alloys, is presented. In particular, we find that the large amount of internal strain present in ScAlN and its intricate relation with electric polarization make configurational sampling and the use of large supercells at different compositions necessary in order to accurately derive the piezoelectric response of the material.

  18. Head and Neck

    DEFF Research Database (Denmark)

    Højgaard, Liselotte; Berthelsen, Anne Kiil; Loft, Annika

    2014-01-01

    Positron emission tomography (PET)/computed tomography with FDG of the head and neck region is mainly used for the diagnosis of head and neck cancer, for staging, treatment evaluation, relapse, and planning of surgery and radio therapy. This article is a practical guide of imaging techniques......, including a detailed protocol for FDG PET in head and neck imaging, physiologic findings, and pitfalls in selected case stories....

  19. Stochastic particle acceleration in multiple magnetic islands during reconnection.

    Science.gov (United States)

    Hoshino, Masahiro

    2012-03-30

    A nonthermal particle acceleration mechanism involving the interaction of a charged particle with multiple magnetic islands is proposed. The original Fermi acceleration model, which assumes randomly distributed magnetic clouds moving at random velocity V(c) in the interstellar medium, is known to be of second-order acceleration of O(V(c)/c)(2) owing to the combination of head-on and head-tail collisions. In this Letter, we reconsider the original Fermi model by introducing multiple magnetic islands during reconnection instead of magnetic clouds. We discuss that the energetic particles have a tendency to be distributed outside the magnetic islands, and they mainly interact with reconnection outflow jets. As a result, the acceleration efficiency becomes first order of O(V(A)/c), where V(A) and c are the Alfvén velocity and the speed of light, respectively.

  20. Birds observed at Shemya Island, Aleutian Islands

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This report covers Shemya Island bird surveys. The reports outline migrant bird activity during August 31 to October 3, 1977. The purpose of the study was to survey...

  1. Paradise Islands? Island States and Environmental Performance

    Directory of Open Access Journals (Sweden)

    Sverker C. Jagers

    2016-03-01

    Full Text Available Island states have been shown to outperform continental states on a number of large-scale coordination-related outcomes, such as levels of democracy and institutional quality. The argument developed and tested in this article contends that the same kind of logic may apply to islands’ environmental performance, too. However, the empirical analysis shows mixed results. Among the 105 environmental outcomes that we analyzed, being an island only has a positive impact on 20 of them. For example, island states tend to outcompete continental states with respect to several indicators related to water quality but not in aspects related to biodiversity, protected areas, or environmental regulations. In addition, the causal factors previously suggested to make islands outperform continental states in terms of coordination have weak explanatory power in predicting islands’ environmental performance. We conclude the paper by discussing how these interesting findings can be further explored.

  2. Electrochemical island growth

    Science.gov (United States)

    Guo, Lian

    The ability to independently dictate the shape and crystal orientation of islands in electrocrystallization remains a significant challenge. The main reason for this is that the complex interplay between the substrate, nucleation, and surface chemistry are not fully understood. Here the kinetics of 3D island growth for copper on ruthenium oxide is studied. The small nucleation overpotential leads to enhanced lateral growth and the formation of hexagonal, disk-shaped islands. The amorphous substrate allows the nuclei to achieve the thermodynamically favorable orientation, i.e. a surface normal. Island growth follows power law kinetics in both lateral and vertical directions. At shorter times, the two growth exponents are equal to 1/2 whereas at longer times lateral growth slows down while vertical growth speeds up. Accordingly, a growth mechanism is proposed, wherein the lateral growth of disk-shaped islands is initiated by attachment of Cu adatoms on the ruthenium oxide surface onto the island periphery while vertical growth is initiated by 2D nucleation on the top terrace and followed by lateral step propagation. These results indicate three criteria for enhanced lateral growth in electrodeposition: (i) a substrate that leads to a small nucleation overpotential, (ii) fast adatom surface diffusion on substrate to promote lateral growth, and (iii) preferential anion adsorption to stabilize the basal plane. The surface roughness evolution, during isolated island growth, island coalescence, and continuous film growth, has also been studied as a function of island shape and island density. It is shown that the surface width wsat(l,t) initially follows anomalous scaling in the isolated island growth regime but exhibits normal scaling during the early stages of continuous film growth. Furthermore, the short length scale roughness is dependent primarily on island shape while the long length scale roughness is dependent on island density. Electrochemical deposition of

  3. Experience with OpenMP for MADX-SC

    Energy Technology Data Exchange (ETDEWEB)

    D' Imperio, Nicholas [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Montag, Christophe [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Yu, Kwangmin [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Kapin, Valery [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); McIntosh, Eric [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Renshall, Harry [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Schmidt, Frank [European Organization for Nuclear Research (CERN), Geneva (Switzerland)

    2014-07-01

    MADX-SC allows the treatment of frozen space charge using beam-beam elements in a thin lattice, i.e. one can take advantage of the standard set-up of MAD-X lattices without the need for specialized codes for the space-charge (SC) evaluation. The idea is to simulate over many turns without the problem of noise as in the PIC SC codes. For the examples under study, like the PS and RHIC, it would be desirable to simulate up to 1 million turns or more. To this end one had to make an effort to optimize the scalar speed and, most importantly, get a speed-up of approximately a factor of 5 using OpenMP.

  4. Estudo medico da hemoglobinopatia SC em negroides paulistas

    OpenAIRE

    Raquel Ribeiro Gomes

    1988-01-01

    Resumo: A hemoglobinopatia SC é a segunda síndrome falcêmica mais importante no Brasil, devido à sua significativa prevalência entre negróides e também pelas manifestações clínicas apresentadas Apesar disso, ela tem sido pouco estudada em nosso país, não existindo na literatura nacional nenhum trabalho específico sobre essa doença. No presente trabalho, procurou-se investigar o significado médico da doença SC no Estado de são Paulo, analisando-se dois tipos de casuísticas de pacientes SC. Em ...

  5. Experience with OpenMP 1 for MADX-SC

    CERN Document Server

    D’Imperio, N; Yu, K; Kapin, V; McIntosh, E; Renshall, H; Schmidt, F

    2014-01-01

    MADX-SC [1–3] allows the treatment of frozen space charge using beam-beam elements in a thin lattice, i.e. one can take advantage of the standard set-up of MAD-X [4] lattices without the need for specialized codes for the space-charge (SC) evaluation. The idea is to simulate over many turns without the problem of noise as in the PIC 1 SC codes. For the examples under study, like the PS and RHIC, it would be desirable to simulate up to 1 million turns or more. To this end one had to make an effort to optimize the scalar speed and, most importantly, get a speed-up of approximately a factor of 5 using OpenMP [5].

  6. Transport of one SC coil through the village of Meyrin

    CERN Multimedia

    1956-01-01

    In 1952, before CERN was officially founded, two accelerator projects were launched: one for an innovative accelerator to operate at an energy level unequalled at the time, the other for a more standard machine, a Synchro-Cyclotron (SC) to operate at 600 MeV. Design work on the SC was started in 1952 and carried out by teams scattered throughout Europe. Once construction began in 1954, CERN had to arrange road transport for the first of what has since been a long series of spectacular component deliveries, such as those of the machine's two magnetic coils each weighing 60 tonnes and measuring 7.2 metres in diameter. Above, one of them is seen passing through the village of Meyrin. The SC was commissioned in 1957 and was operational for 34 years!

  7. Synthesis and structure of perovskite ScMnO3.

    Science.gov (United States)

    Chen, Haiyan; Yu, Tian; Gao, Peng; Bai, Jianming; Tao, Jing; Tyson, Trevor A; Wang, Liping; Lalancette, Roger

    2013-08-19

    The rare-earth manganites RMnO3 (R = rare earth) are a class of important multiferroics with stable hexagonal structures for small R ion radius (Sc, Lu, Yb, ...). Metastable perovskite phases of these systems possess intriguing electronically driven electrical polarization, but the synthesis of the perovskite phase for the end member ScMnO3 system has proven to be elusive. We report the structure of a new monoclinic P2(1)/n perovskite phase of ScMnO3 synthesized from the hexagonal phase under high-pressure and high-temperature conditions. This extends the small ion region for so-called E-phase electronically driven ferroelectric manganese perovsites.

  8. The {\\sc Majorana Demonstrator} Neutrinoless Double-Beta Decay Experiment

    CERN Document Server

    Abgrall, N; Avignone, F T; Barabash, A S; Bertrand, F E; Boswell, M; Brudanin, V; Busch, M; Caldwell, A S; Chan, Y-D; Christofferson, C D; Combs, D C; Detwiler, J A; Doe, P J; Efremenko, Yu; Egorov, V; Ejiri, H; Elliott, S R; Esterline, J; Fast, J E; Finnerty, P; Fraenkle, F M; Galindo-Uribarri, A; Giovanetti, G K; Goett, J; Green, M P; Gruszko, J; Guiseppe, V E; Gusey, K; Hallin, A L; Hazama, R; Hegai, A; Henning, R; Hoppe, E W; Howard, S; Howe, M A; Keeter, K J; Kidd, M F; Knecht, A; Kochetov, O; Konovalov, S I; Kouzes, R T; LaFerriere, B D; Leon, J; Leviner, L E; Loach, J C; MacMullin, S; Martin, R D; Mertens, S; Mizouni, L; Nomachi, M; Orrell, J L; O'Shaughnessy, C; Overman, N R; Phillips, D G; Poon, A W P; Pushkin, K; Radford, D C; Rielage, K; Robertson, R G H; Ronquest, M C; Schubert, A G; Shanks, B; Shima, T; Shirchenko, M; Snavely, K J; Snyder, N; Steele, D; Strain, J; Suriano, A M; Thompson, J; Timkin, V; Tornow, W; Varner, R L; Vasilyev, S; Vetter, K; Vorren, K; White, B R; Wilkerson, J F; Xu, W; Yakushev, E; Young, A R; Yu, C-H; Yumatov, V

    2013-01-01

    The {\\sc Majorana Demonstrator will search for the neutrinoless double-beta decay of the isotope Ge-76 with a mixed array of enriched and natural germanium detectors. The observation of this rare decay would indicate the neutrino is its own antiparticle, demonstrate that lepton number is not conserved, and provide information on the absolute mass scale of the neutrino. The {\\sc Demonstrator} is being assembled at the 4850-foot level of the Sanford Underground Research Facility in Lead, South Dakota. The array will be situated in a low-background environment and surrounded by passive and active shielding. Here we describe the science goals of the {\\sc Demonstrator} and the details of its design.

  9. Thermoelectric performance of functionalized Sc2C MXenes

    KAUST Repository

    Kumar, S.

    2016-07-05

    Functionalization of the MXene Sc2C, which has the rare property to realize semiconducting states for various functionalizations including O, F, and OH, is studied with respect to the electronic and thermal behavior. The lowest lattice thermal conductivity is obtained for OH functionalization and an additional 30% decrease can be achieved by confining the phonon mean free path to 100 nm. Despite a relatively low Seebeck coefficient, Sc2C(OH)2 is a candidate for intermediate-temperature thermoelectric applications due to compensation by a high electrical conductivity and very low lattice thermal conductivity.

  10. Determination of Sc by Ion-exchanger Colorimetry

    Institute of Scientific and Technical Information of China (English)

    1999-01-01

    Ion-exchanger colorimetry for scandium in the form of ternary color system "Sc(Ⅲ)-CPA-pc-Ac" was developed. The influences of types and grain sizes of resin, adsorption modes and the acidity on the determination were studied systematically, and the optimum operating conditions and the allowable amounts of foreign ions were determined. In comparison with the ordinary solution colorimetry, both of the sensitivity and the selectivity of this ion-exchanger colorimetry are improved obviously. The preliminary uses of this method to the determination of Sc(Ⅲ) in two synthetic samples were satisfied.

  11. Product policy of SC Electrecord S.A.

    Directory of Open Access Journals (Sweden)

    Ph. D. Candidate Cristina Andreescu (Manolache

    2009-12-01

    Full Text Available The global brand has the advantage of the scale economy, facilitates the company image and prestige and sometimes benefits even from its origin country effect. Its use is quite difficult (the semantic variations can impede the use of the same brand. The international brands act as a restriction against standardisation (the product should not be differentiated as there are internationally accepted and recognized brands. This paper makes an overview description of the general market environment, but also of the arket environment of SC ELECTRECORD S.A.; it underlines the product characteristics as well as the commercial diagnosis within SC ELECTRECORD S.A.

  12. Bayesian narrowband interference mitigation in SC-FDMA

    KAUST Repository

    Ali, Anum

    2015-08-12

    This paper presents a novel narrowband interference (NBI) mitigation scheme for SC-FDMA systems. The proposed scheme exploits the frequency domain sparsity of the unknown NBI signal and adopts a low complexity Bayesian sparse recovery procedure. In practice, however, the sparsity of the NBI is destroyed by a grid mismatch between NBI sources and SC-FDMA system. Towards this end, an accurate grid mismatch model is presented and a sparsifying transform is utilized to restore the sparsity of the unknown signal. Numerical results are presented that depict the suitability of the proposed scheme for NBI mitigation.

  13. Radiation protection Group (SC/RP) desperately seeking...

    CERN Multimedia

    A. Hervé, Y. Donjoux / SC

    2006-01-01

    We are trying to trace two transit permits (passavants), which constitute the customs clearance documentation for two 'AD6'portable radiation detectors. The two permits (No. 1308 and No. 1309) were sent in the same internal mail envelope towards the middle of March 2006 but never reached their final destination. After weeks of searching in vain, we are now appealing for your help. If you have these two permits in your possession, please get in touch with us. Many thanks in advance. A.HERVE - SC/RP- ( 163168 / 70927) Y.DONJOUX - SC/RP - (160105 / 73171)

  14. Head Injuries in Children

    Science.gov (United States)

    Pennington, Nicole

    2010-01-01

    School nurses play a crucial role in injury prevention and initial treatment when injuries occur at school. The role of school nurses includes being knowledgeable about the management of head injuries, including assessment and initial treatment. The school nurse must be familiar with the outcomes of a head injury and know when further evaluation…

  15. 76 FR 81487 - Environmental Management Site-Specific Advisory Board, Savannah River Site

    Science.gov (United States)

    2011-12-28

    ... Westin Hotel, 2 Grasslawn Avenue, Hilton Head Island, SC 29928. FOR FURTHER INFORMATION CONTACT: Gerri... restoration, waste management, and related activities. Tentative Agenda Monday, January 23, 2012 1...

  16. Tetrahedron dynamics in the icosahedral quasicrystals i-ZnMgSc and i-ZnAgSc and the cubic 1/1-approximant Zn6Sc.

    Science.gov (United States)

    Euchner, H; Yamada, T; Rols, S; Ishimasa, T; Kaneko, Y; Ollivier, J; Schober, H; Mihalkovic, M; de Boissieu, M

    2013-03-20

    A comparison of periodic approximants and their quasicrystalline counterparts offers the opportunity to better understand the structure, physical properties and stabilizing mechanisms of these complex phases. We present a combined experimental and molecular dynamics study of the lattice dynamics of the icosahedral quasicrystals i-ZnMgSc and i-ZnAgSc and compare it to recently published results obtained for the cubic 1/1-approximant Zn(6)Sc. Both phases, quasicrystal and approximant, are built up from large atomic clusters which contain a tetrahedral shell at the cluster centre and are packed either quasiperiodically or on a bcc lattice. Using quasielastic neutron scattering and atomic scale simulations, we show that in the quasicrystal the tetrahedra display a dynamics similar to that observed in the 1/1-approximant: the tetrahedra behave as a 'single molecule' and reorient dynamically on a timescale of the order of a few ps. The tetrahedra reorientation is accompanied by a large distortion of the surrounding cluster shells which provide a unique dynamical flexibility to the quasicrystal. However, whereas in the 1/1-approximant the tetrahedron reorientation is observed down to T(c) = 160 K, where a phase transition takes place, in the quasicrystal the tetrahedron dynamics is gradually freezing from 550 to 300 K, similarly to a glassy system.

  17. Reactor vessel lower head integrity

    Energy Technology Data Exchange (ETDEWEB)

    Rubin, A.M.

    1997-02-01

    On March 28, 1979, the Three Mile Island Unit 2 (TMI-2) nuclear power plant underwent a prolonged small break loss-of-coolant accident that resulted in severe damage to the reactor core. Post-accident examinations of the TMI-2 reactor core and lower plenum found that approximately 19,000 kg (19 metric tons) of molten material had relocated onto the lower head of the reactor vessel. Results of the OECD TMI-2 Vessel Investigation Project concluded that a localized hot spot of approximately 1 meter diameter had existed on the lower head. The maximum temperature on the inner surface of the reactor pressure vessel (RPV) in this region reached 1100{degrees}C and remained at that temperature for approximately 30 minutes before cooling occurred. Even under the combined loads of high temperature and high primary system pressure, the TMI-2 RPV did not fail. (i.e. The pressure varied from about 8.5 to 15 MPa during the four-hour period following the relocation of melt to the lower plenum.) Analyses of RPV failure under these conditions, using state-of-the-art computer codes, predicted that the RPV should have failed via local or global creep rupture. However, the vessel did not fail; and it has been hypothesized that rapid cooling of the debris and the vessel wall by water that was present in the lower plenum played an important role in maintaining RPV integrity during the accident. Although the exact mechanism(s) of how such cooling occurs is not known, it has been speculated that cooling in a small gap between the RPV wall and the crust, and/or in cracks within the debris itself, could result in sufficient cooling to maintain RPV integrity. Experimental data are needed to provide the basis to better understand these phenomena and improve models of RPV failure in severe accident codes.

  18. Tanzania - Mafia Island Airport

    Data.gov (United States)

    Millennium Challenge Corporation — The evaluation design and subsequent data gathering activities will address the following key research questions: a) Has the Mafia Island Airport Upgrade Project...

  19. Genome Sequence of Herpes Simplex Virus 1 Strain SC16

    Science.gov (United States)

    Rastrojo, Alberto; López-Muñoz, Alberto Domingo

    2017-01-01

    ABSTRACT Herpes simplex virus 1 (HSV-1), also known as Human herpesvirus 1, is a highly prevalent human neurotropic pathogen that causes a variety of diseases, including lethal encephalitis. Here, we report the genome sequence of the HSV-1 strain SC16. PMID:28126930

  20. Calibration of the DLP-SC-3300-02 probe

    DEFF Research Database (Denmark)

    Pivnenko, Sergey; Breinbjerg, Olav

    This report douments the calibration measurement of the DLP-SC-3300-02 dual-linearly polarized near-field probe. The measurement comprises radiation pattern, diretivity, gain, spetra of spherial wave coefients, polarization charateristis, and complex channel balance at 41 frequencies, as well...

  1. Programmable SC biquad using one single capacitor bank

    OpenAIRE

    Torralba Silgado, Antonio Jesús; Pérez Vega-Leal, Alfredo; García Franquelo, Leopoldo

    2001-01-01

    This paper presents a new technique for programming SC circuits using a single time-multiplexed capacitor bank, achieving a significant reduction in capacitance area. Simulation results of a programmable biquad low pass filter show the validity of the proposed method.

  2. Toelating Herbasan SC welkom voor dahlia, A. coronaria en narcis

    NARCIS (Netherlands)

    Leeuwen, van P.J.; Koster, A.T.J.; Trompert, J.P.T.

    2005-01-01

    Onlangs is Herbasan SC voor de onkruidbestrijding in onder meer dahlia, narcis en Anemone coronaria toegelaten. PPO ging na hoe het middel het beste is in te zetten. In dit artikel zijn de resultaten van het onderzoek vermeld en een advies voor toepassing

  3. 78 FR 20369 - South Carolina Disaster #SC-00021

    Science.gov (United States)

    2013-04-04

    ... ADMINISTRATION South Carolina Disaster SC-00021 AGENCY: U.S. Small Business Administration. ACTION: Notice. SUMMARY: This is a notice of an Administrative declaration of a disaster for the State of South Carolina dated 03/29/2013. Incident: Windsor Green Condo Complex Fire. Incident Period: 03/16/2013....

  4. 77 FR 14700 - Safety Zones; Swim Around Charleston, Charleston, SC

    Science.gov (United States)

    2012-03-13

    ... notice regarding our public dockets in the January 17, 2008, issue of the Federal Register (73 FR 3316... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zones; Swim Around Charleston, Charleston, SC... establish temporary moving safety zones during the Swim Around Charleston, a swimming race occurring on...

  5. 76 FR 38586 - Safety Zone; Swim Around Charleston, Charleston, SC

    Science.gov (United States)

    2011-07-01

    ... Federal Register (73 FR 3316). Public Meeting We do not now plan to hold a public meeting. But you may... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Swim Around Charleston, Charleston, SC... establish a temporary moving safety zone during the Swim Around Charleston, a swimming race occurring...

  6. 78 FR 54583 - Safety Zone; Swim Around Charleston, Charleston, SC

    Science.gov (United States)

    2013-09-05

    ..., telephone 202-366-9826. SUPPLEMENTARY INFORMATION: Table of Acronyms DHS Department of Homeland Security FR... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Swim Around Charleston, Charleston, SC... temporary moving safety zone during the Swim Around Charleston, a swimming race occurring on waters of...

  7. 77 FR 51471 - Safety Zone; Swim Around Charleston, Charleston, SC

    Science.gov (United States)

    2012-08-24

    ... rulemaking (NPRM) entitled Safety Zone; Swim Around Charleston, Charleston, SC in the Federal Register (77 FR...: Table of Acronyms DHS Department of Homeland Security FR Federal Register NPRM Notice of Proposed... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Swim Around Charleston, Charleston,...

  8. South Carolina's SC LENDS: Optimizing Libraries, Transforming Lending

    Science.gov (United States)

    Hamby, Rogan; McBride, Ray; Lundberg, Maria

    2011-01-01

    Since SC LENDS started operating in June 2009, more public libraries have come on board. All of this on the back end connects to a Mozilla-based staff client that has distributions for Mac OS X and Microsoft Windows, using SSL encryption to keep communications secure and private between remote libraries and the servers hosted at a high-end…

  9. Envíos Confianza, S.C.

    OpenAIRE

    Banco Interamericano de Desarrollo (BID); S.C. Envíos Confianza

    2009-01-01

    Presentación acerca de Envíos Confianza, S.C., en el cual da a conocer su historia, misión, visión, valores, efecto de las remesas en comunidades e impacto de la crisis financiera. Además, señala la proyección para el 2009-2011.

  10. M.Sc. in Civil and Structural Engineering

    DEFF Research Database (Denmark)

    The catalogue contain a list of project ideas proposed by the scientific staff at the Department of Civil Engineering, Aalborg University, and a number of companies. Most of the project ideas in this catalogue may form the basis for long and short candidate projects as well as regular 3rd semester...... projects at the M.Sc. programme in Civil and Structural Engineering....

  11. M.Sc. in Civil and Structural Engineering

    DEFF Research Database (Denmark)

    The following pages contain a list of project ideas proposed by the scientific staff at the Department of Civil Engineering, Aalborg University, and a number of companies. Most of the project ideas in this catalogue may form the basis for long and short master projects as well as regular 3rd...... semester projects at the M.Sc. programme in Civil and Structural Engineering....

  12. M.Sc. in Civil and Structural Engineering

    DEFF Research Database (Denmark)

    This catalogue contains a list of project ideas proposed by the scientific staff at the Department of Civil Engineering, Aalborg University, and a number of companies. Most of the project ideas in this catalogue may form the basis for long and short candidate projects as well as regular 3rd...... semester projects at the M.Sc. programme in Civil and Structural Engineering....

  13. M.Sc. in Civil and Structural Engineering

    DEFF Research Database (Denmark)

    Clausen, Johan

    The report contain a list of project ideas proposed by the scientific staff at the Department of Civil Engineering, Aalborg University, and a number of companies. Most of the project ideas in this catalogue may form the basis for long and short candidate projects as well as regular 3rd semester...... projects at the M.Sc. programme in Civil and Structural Engineering....

  14. 44gSc from metal calcium targets for PET

    DEFF Research Database (Denmark)

    Severin, Gregory; Gagnon, K.; Engle, J. W.

    2012-01-01

    A low-cost and efficient method for producing pre-clinical scale quantities of 44gSc is presented. Production involves proton irradiation of natural unenriched calcium metal followed by rapid separation of radioscandium from the target using hydroxmate functionalized resin.© 2012 American Institu...

  15. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... MRI of the Head? What is MRI of the Head? Magnetic resonance imaging (MRI) is a noninvasive ... of page What are some common uses of the procedure? MR imaging of the head is performed ...

  16. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... MRI of the Head? What is MRI of the Head? Magnetic resonance imaging (MRI) is a noninvasive ... of page What are some common uses of the procedure? MR imaging of the head is performed ...

  17. Effect of Sc on Precipitation Hardening of AlSi6Mg Alloy

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    The effect of Sc on precipitation hardening of AlSi6Mg was studied. Zr was previously reported that it increased the effectiveness of Sc in wrought aluminum in many areas so Zr was also used together with Sc in this study.Different levels of Sc and Zr additions were added to AlSi6Mg before casting in the permanent mold. The samples were precipitation hardened at different aging temperatures and for various aging time before testing for tensile strength and hardness. It was found that Sc addition into Al6SiMg can change its response to age hardening. Additions of Sc and Sc with Zr increased both yield strength and hardness for both aging temperatures. In addition, Sc was found to modify eutectic Si to obtain fibrous morphology. This effect of Sc on eutectic silicon modification has never been reported before.

  18. Role of cell death in the propagation of PrP(Sc) in immune cells.

    Science.gov (United States)

    Takahashi, Kenichi; Inoshima, Yasuo; Ishiguro, Naotaka

    2015-03-01

    A number of studies have suggested that macrophages, dendritic cells, and follicular dendritic cells play an important role in the propagation of PrP(Sc). Both accumulation and proteolysis of PrP(Sc) have been demonstrated in peripheral macrophages. Macrophages may act as reservoirs for PrP(Sc) particles if the cells die during transient PrP(Sc) propagation. However, whether cell death plays a role in PrP(Sc) propagation in macrophages remains unclear. In this study, we investigated the possibility of propagation and transmission of PrP(Sc) between dead immune cells and living neural cells. We found that under specific conditions, transient PrP(Sc) propagation occurs in dead cells, indicating that interaction between PrP(C) and PrP(Sc) on plasma membrane lipid rafts might be important for PrP(Sc) propagation. Co-culturing of killed donor PrP(Sc)-infected macrophages with recipient N2a-3 neuroblastoma cells accelerated PrP(Sc) transmission. Our results suggest that cell death may play an important role in PrP(Sc) propagation, whereas transient PrP(Sc) propagation in macrophages has little effect on PrP(Sc) transmission.

  19. Ulnar head replacement.

    Science.gov (United States)

    Herbert, Timothy J; van Schoonhoven, Joerg

    2007-03-01

    Recent years have seen an increasing awareness of the anatomical and biomechanical significance of the distal radioulnar joint (DRUJ). With this has come a more critical approach to surgical management of DRUJ disorders and a realization that all forms of "excision arthroplasty" can only restore forearm rotation at the expense of forearm stability. This, in turn, has led to renewed interest in prosthetic replacement of the ulnar head, a procedure that had previously fallen into disrepute because of material failures with early implants, in particular, the Swanson silicone ulnar head replacement. In response to these early failures, a new prosthesis was developed in the early 1990s, using materials designed to withstand the loads across the DRUJ associated with normal functional use of the upper limb. Released onto the market in 1995 (Herbert ulnar head prosthesis), clinical experience during the last 10 years has shown that this prosthesis is able to restore forearm function after ulnar head excision and that the materials (ceramic head and noncemented titanium stem), even with normal use of the limb, are showing no signs of failure in the medium to long term. As experience with the use of an ulnar head prosthesis grows, so does its acceptance as a viable and attractive alternative to more traditional operations, such as the Darrach and Sauve-Kapandji procedures. This article discusses the current indications and contraindications for ulnar head replacement and details the surgical procedure, rehabilitation, and likely outcomes.

  20. ALERTES-SC3 Early Warning System prototype for South Iberian Peninsula: on-site approach.

    Science.gov (United States)

    Pazos, Antonio; Lopez de Mesa, Mireya; Gallego Carrasco, Javier; Martín Davila, José; Rioja del Rio, Carlos; Morgado, Arturo; Vera, Angel; Ciberia, Angel; Cabieces, Roberto; Strollo, Angelo; Hanka, Winfried; Carranza, Marta

    2016-04-01

    In recent years several Earthquake Early Warning Systems (EEWS) have been developed for different parts of the world. The area between SW Cape St. Vicente and the Strait of Gibraltar is one of the most seismically active zones in the Ibero-Maghrebian region, with predominantly moderate and superficial seismicity, but also big events with associated tsunamis are well documented in the area, like the 1755 Lisbon earthquake. In the frame of the ALERT-ES (2011-2013) and ALERTES-RIM (2014-2016) Spanish projects, the ALERTES-SC3 EEWS, regional approach, prototype has been developed at the Royal Spanish Navy Observatory (ROA) and is being tested in near real time for south Iberia. This prototype, based on the SeisComP3 software package, is largely based on algorithms derived from the analysis of the first seconds of the P wave records. Calculation of several parameters are carried out, mainly the characteristic period (τc) and the displacement peak (Pd), but also the velocity peak (Pv), the maximum period (τPmáx), among others. In order to warm the areas closest to the hypocentre, places located inside the "blind zone", a on-site EEWS has also been developed by ROA and integrated in the ALERTES-SC3 prototype. From the on-site approach, a warm level is declared from one station as a function of the estimated characteristic period (τc) and the displacement Peak (Pd), although the earthquake location and therefore the lead time available remains unknown. This on-site EEWS is being tested in several Western Mediterranean net (WM) stations as ARNO (Arenosillo, Huelva,Spain) or CHAS (Chafarinas island, North Africa, Spain). Also an on-site low cost station is being developed based in low cost accelerometers. In this work the current state of the on-site EEWS developed, its integration in the ALERTES-SC3 EEWS system and the low cost seismic stations are shown.

  1. Update on the NSF PAARE Program at SC State

    Science.gov (United States)

    Walter, Donald K.; Ajello, Marco; Brittain, Sean D.; Cash, Jennifer; Hartmann, Dieter; Ho, Shirley; Howell, Steve B.; King, Jeremy R.; Leising, Mark D.; Smith, Daniel M.

    2017-01-01

    We report on results from our NSF PAARE program during Year 2 of the project. Our partnership under this PAARE award includes South Carolina State University (a Historically Black College/University), Clemson University (a Ph.D. granting institution) as well as individual investigators at NASA Ames and Carnegie Mellon University. Our recent work on variable and peculiar stars, work with the Kepler Observatory and our educational products in cosmology for non-STEM majors will be presented. We have successfully piloted sharing our teaching resources by offering an upper-level astrophysics course taught at Clemson via video conferencing , allowing a graduating senior from SC State to take a course not available through his home institution. Additionally, we are working on a memorandum of agreement between the two institutions that will allow for the seamless transfer of an undergraduate from SC State to Clemson’s graduate program in physics and astronomy. Our curriculum work includes new web-based cosmology activities and laboratory experiments. SC State undergraduates are reporting at this conference on their work with the light curves of semiregular variables using Kepler data. Additionally, we are heavily involved in the Citizen CATE Experiment. A PAARE scholarship student from SC State and the PAARE PI traveled to Indonesia for the March 2016 solar eclipse. Their results are also being presented elsewhere at this conference (see Myles McKay’s poster). Support for this work includes our NSF PAARE award AST-1358913 as well as resources and support provided by Clemson University and the National Optical Astronomy Observatory. Additional support has been provided by the South Carolina Space Grant Consortium and from NASA to SC State under awards NNX11AB82G and NNX13AC24G. CATE work has been supported by NASA SMD award NNX16AB92A to the National Solar Observatory. Additional details can be found at: http://physics.scsu.edu

  2. Maneuvering impact boring head

    Science.gov (United States)

    Zollinger, W. Thor; Reutzel, Edward W.

    1998-01-01

    An impact boring head may comprise a main body having an internal cavity with a front end and a rear end. A striker having a head end and a tail end is slidably mounted in the internal cavity of the main body so that the striker can be reciprocated between a forward position and an aft position in response to hydraulic pressure. A compressible gas contained in the internal cavity between the head end of the striker and the front end of the internal cavity returns the striker to the aft position upon removal of the hydraulic pressure.

  3. St. Vincent Island Tour

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This letter, written by Charles Marks who lived on St. Vincent Island as a child, notes the changes he saw in the island when he visited in 1981. He notes that the...

  4. Marine and Island Ecology.

    Science.gov (United States)

    Stephens, Lawrence J.; And Others

    1988-01-01

    Describes an ecology course which provides students with an opportunity to observe aquatic and terrestrial life in the Bahamas. States that students learn scientific methodology by measuring physical and chemical aspects of the island habitats. Provides information on the island, course description and objectives, transportation, facilities, and…

  5. Transmission of bovine herpesvirus 1 within and between herds on an island with a BHV1 control programme

    NARCIS (Netherlands)

    Hage, J.J.; Schukken, Y.H.; Schols, H.; Maris-Veldhuis, M.A.; Rijsewijk, F.A.M.; Klaassen, C.H.L.

    2003-01-01

    Transmission of bovine herpesvirus 1 (BHV1) within and between herds was studied on the island of Ameland, The Netherlands. There were 50 herds with 3300 head of cattle on the island. Herds were divided into three groups: (1) only containing seronegative cattle, (2) containing seronegative cattle an

  6. Effect of solution treatment on the aging processes of Al-Sc alloys

    Energy Technology Data Exchange (ETDEWEB)

    Drits, M.E.; Toropova, L.S. (AN SSSR, Moscow. Inst. Metallurgii); Dutkiewicz, J.; Salawa, J. (Polish Academy of Sciences, Cracow. Inst. for Metal Research)

    1984-10-01

    The kinetics of aging process of two Al-Sc alloys containing 0.2 and 0.5 wt% Sc, respectively was investigated using electrical resistivity and hardness measurements. Transmission electron micrographs of quenched samples show Sc-rich precipitates, especially Al/sub 3/Sc precipitates. The addition of Sc to Al causes the strongest hardening effect during aging in relation to other alloying additions. Cast Al-Sc alloys and water quenched ones from solid solubility range show very similiar age-hardening curves.

  7. On the nature of escapable relative islands

    DEFF Research Database (Denmark)

    Christensen, Ken Ramshøj; Nyvad, Anne Mette

    2014-01-01

    It is generally assumed that universal island constraints block extraction from relative clauses. However, it is well-known that such extractions can be acceptable in the Scandinavian languages. Kush & Lindahl (2011) argue that the acceptability in Swedish is illusory; relative clauses that allow...... extraction have a different structure (small clause structure) from those that block extraction (true relatives, CPs). We present data from an acceptability survey of relative clause extraction in Danish. In the survey, extraction significantly decreased acceptability but we found no statistically...... significant effect of the ability of the verb to take a small-clause complement. We also found no difference between som ‘that/who/which’ and der ‘that/who/which’, both of which can head a relative clause while only som can head a small clause. We argue that our results do not warrant the stipulation...

  8. On the nature of escapable relative islands

    DEFF Research Database (Denmark)

    Christensen, Ken Ramshøj; Nyvad, Anne Mette

    2014-01-01

    It is generally assumed that universal island constraints block extraction from relative clauses. However, it is well-known that such extractions can be acceptable in the Scandinavian languages. Kush & Lindahl (2011) argue that the acceptability in Swedish is illusory; relative clauses that allow...... extraction have a different structure (small clause structure) from those that block extraction (true relatives, CPs). We present data from an acceptability survey of relative clause extraction in Danish. In the survey, extraction significantly decreased acceptability but we found no statistically...... significant effect of the ability of the verb to take a small-clause complement. We also found no difference between som ‘that/who/which’ and der ‘that/who/which’, both of which can head a relative clause while only som can head a small clause. We argue that our results do not warrant the stipulation...

  9. Early Head Start Evaluation

    Data.gov (United States)

    U.S. Department of Health & Human Services — Longitudinal information from an evaluation where children were randomly assigned to Early Head Start or community services as usual;direct assessments and...

  10. Computed Tomography (CT) -- Head

    Medline Plus

    Full Text Available ... you! Do you have a personal story about radiology? Share your patient story here Images × Image Gallery ... Pregnancy Head and Neck Cancer X-ray, Interventional Radiology and Nuclear Medicine Radiation Safety Images related to ...

  11. Head and face reconstruction

    Science.gov (United States)

    ... work together. Head and neck surgeons also perform craniofacial reconstruction operations. The surgery is done while you are deep asleep and pain-free (under general anesthesia ). The surgery may take ...

  12. Computed Tomography (CT) -- Head

    Medline Plus

    Full Text Available ... headaches, dizziness, and other symptoms of aneurysm, bleeding, stroke and brain tumors. It also helps your doctor ... scanning provides more detailed information on head injuries, stroke , brain tumors and other brain diseases than regular ...

  13. Computed Tomography (CT) -- Head

    Medline Plus

    Full Text Available ... a stroke, especially with a new technique called Perfusion CT. brain tumors. enlarged brain cavities (ventricles) in ... X-Ray and CT Exams Blood Clots CT Perfusion of the Head CT Angiography (CTA) Stroke Brain ...

  14. Computed Tomography (CT) -- Head

    Medline Plus

    Full Text Available ... traditional x-rays, particularly of soft tissues and blood vessels. CT scanning provides more detailed information on head injuries, stroke , brain tumors and other brain diseases than ...

  15. Computed Tomography (CT) -- Head

    Medline Plus

    Full Text Available ... special x-ray equipment to help assess head injuries, severe headaches, dizziness, and other symptoms of aneurysm, ... cancer. In emergency cases, it can reveal internal injuries and bleeding quickly enough to help save lives. ...

  16. Computed Tomography (CT) -- Head

    Medline Plus

    Full Text Available ... headaches, dizziness, and other symptoms of aneurysm, bleeding, stroke and brain tumors. It also helps your doctor ... scanning provides more detailed information on head injuries, stroke , brain tumors and other brain diseases than regular ...

  17. Computed Tomography (CT) -- Head

    Medline Plus

    Full Text Available ... images of internal organs, bones, soft tissue and blood vessels provide greater detail than traditional x-rays, particularly of soft tissues and blood vessels. CT scanning provides more detailed information on head ...

  18. Head CT scan

    Science.gov (United States)

    Brain CT; Cranial CT; CT scan - skull; CT scan - head; CT scan - orbits; CT scan - sinuses; Computed tomography - cranial; CAT scan - brain ... hold your breath for short periods. A complete scan usually take only 30 seconds to a few ...

  19. Head Start Impact Study

    Data.gov (United States)

    U.S. Department of Health & Human Services — Nationally representative, longitudinal information from an evaluation where children were randomly assigned to Head Start or community services as usual;direct...

  20. Computed Tomography (CT) -- Head

    Medline Plus

    Full Text Available ... special x-ray equipment to help assess head injuries, severe headaches, dizziness, and other symptoms of aneurysm, ... cancer. In emergency cases, it can reveal internal injuries and bleeding quickly enough to help save lives. ...

  1. Head and neck teratomas

    OpenAIRE

    Shah, Ajaz; Latoo, Suhail; Ahmed, Irshad; Malik, Altaf H

    2009-01-01

    Teratomas are complex lesions composed of diverse tissues from all 3 germinal cell layers and may exhibit variable levels of maturity. Head and neck teratomas are most commonly cervical with the oropharynx (epignathus) being the second commonest location. In this article, clinical presentation, behaviour and associated significance of head and neck teratomas have been highlightened. Because of their obscure origin, bizarre microscopic appearance, unpredictable behaviour and often dramatic cli...

  2. Comparison of the effect of individual dietary counselling and of standard nutritional care on weight loss in patients with head and neck cancer undergoing radiotherapy

    OpenAIRE

    2010-01-01

    Clinical research shows that nutritional intervention is necessary to prevent malnutrition in head and neck cancer patients undergoing radiotherapy. The objective of the present study was to assess the value of individually adjusted counselling by a dietitian compared to standard nutritional care (SC). A prospective study, conducted between 2005 and 2007, compared individual dietary counselling (IDC, optimal energy and protein requirement) to SC by an oncology nurse (standard nutritional coun...

  3. Comparison of the effect of individual dietary counselling and of standard nutritional care on weight loss in patients with head and neck cancer undergoing radiotherapy.

    OpenAIRE

    2010-01-01

    Clinical research shows that nutritional intervention is necessary to prevent malnutrition in head and neck cancer patients undergoing radiotherapy. The objective of the present study was to assess the value of individually adjusted counselling by a dietitian compared to standard nutritional care (SC). A prospective study, conducted between 2005 and 2007, compared individual dietary counselling (IDC, optimal energy and protein requirement) to SC by an oncology nurse (standard nutritional coun...

  4. Borderlands and Tourism Development in Kalimantan Island: Kalimantan Barat, Indonesia - Sarawak, Malaysia 'Head to Head'

    Directory of Open Access Journals (Sweden)

    Syaiful Muazir

    2013-12-01

    Full Text Available As part of the regions that share lands and boundaries, Sarawak-Malaysia and Kalimantan Barat-Indonesia have respective characteristics in the borderlands treatment. This paper aims to explore and compare the border areas between two nations, ranging from the borderlands profiles, (tourism development and planning, and their opportunities. Besides, this paper also wants to highlight tourism development as one of the strategies. This paper uses documentary research to seek 'text and context' by narratively describing and compiling the documents. From the discussion, it can be seen that both regions have different characteristics of conditions and problems. For tourism development, different approaches are also 'colored' with timing, momentum, and priorities; as influenced and supported by the national plans. Tourism in the borderlands is the impetus in which each regions has already been aware of this potential because of the traction of informal flow, accessibility, supply, and demand. Furthermore, we argue that if tourism has exist at the first place, in the future, by its backward linkages, it will encourage more physical and economic development and cooperation between nations.

  5. Native Americans, regional drought and tree Island evolution in the Florida Everglades

    Science.gov (United States)

    Bernhardt, C.

    2011-01-01

    This study uses palynologic data to determine the effects of regional climate variability and human activity on the formation and development of tree islands during the last ~4000 years. Although prolonged periods of aridity have been invoked as one mechanism for their formation, Native American land use has also been hypothesized as a driver of tree island development. Using pollen assemblages from head and near tail sediments collected on two tree islands and documented archeological data, the relative roles of Native Americans, climate variability, and recent water-management practices in forming and structuring Everglades tree islands are examined. The timing of changes recorded in the pollen record indicates that tree islands developed from sawgrass marshes ~3800 cal. yr BP, prior to human occupation. Major tree island expansion, recorded near tail sediments, occurred ~1000 years after initial tree island formation. Comparison of the timing of pollen assemblages with other proxy records indicates that tree island expansion is related to regional and global aridity correlated with southward migration of the Intertropical Convergence Zone. Local fire associated with droughts may also have influenced tree island expansion. This work suggests that Native American occupation did not significantly influence tree island formation and that the most important factors governing tree island expansion are extreme hydrologic events due to droughts and intense twentieth century water management.

  6. Two anionically derivatized scandium oxoselenates(IV): ScF[SeO3] and Sc2O2[SeO3

    Science.gov (United States)

    Greiner, Stefan; Chou, Sheng-Chun; Schleid, Thomas

    2017-02-01

    Scandium fluoride oxoselenate(IV) ScF[SeO3] and scandium oxide oxoselenate(IV) Sc2O2[SeO3] could be synthesized through solid-state reactions. ScF[SeO3] was obtained phase-pure, by reacting mixtures of Sc2O3, ScF3 and SeO2 (molar ratio: 1:1:3) together with CsBr as fluxing agent in corundum crucibles embedded into evacuated glassy silica ampoules after firing at 700 °C for seven days. Sc2O2[SeO3] first emerged as by-product during the attempts to synthesize ScCl[SeO3] following aforementioned synthesis route and could later be reproduced from appropriate Sc2O3/SeO3 mixtures. ScF[SeO3] crystallizes monoclinically in space group P21/m with a=406.43(2), b =661.09(4), c=632.35(4) pm, β=93.298(3)° and Z=2. Sc2O2[SeO3] also crystallizes in the monoclinic system, but in space group P21/n with a=786.02(6), b=527.98(4), c=1086.11(8) pm, β=108.672(3)° for Z=4. The crystal structures of both compounds are strongly influenced by the stereochemically active lone pairs of the ψ1-tetrahedral [SeO3]2- anions. They also show partial structures, where the derivatizing F- or O2- anions play an important role. For ScF[SeO3] chains of the composition 2+ ∞ 1[FSc2/2] form from connected [FSc2]5+ dumbbells, while [OSc3]7+ pyramids and [OSc4]10+ tetrahedra units are condensed to layers according to 2+ ∞ 2[O2Sc2 ] in Sc2O2[SeO3].

  7. Island-trapped Waves, Internal Waves, and Island Circulation

    Science.gov (United States)

    2015-09-30

    Island-trapped waves , internal waves , and island circulation T. M. Shaun Johnston Scripps Institution of Oceanography University of California...topography. As strong flows encounter small islands, points, and submarine ridges, it is expected that wakes, eddies, and arrested internal lee waves ...form drag, lee waves , eddy generation) over small-scale topographic features and (ii) fundamentally nonlinear processes (turbulent island wakes

  8. Structural, elastic and thermodynamic properties of Ti2SC

    Indian Academy of Sciences (India)

    Hongzhi Fu; Wenfang Liu; Tao Gao

    2011-12-01

    The structural parameters, elastic constants and thermodynamic properties of Ti2SC were investigated under pressure and temperature by using first-principles plane-wave pseudopotential density functional theory within the generalized gradient approximation. The obtained results are in agreement with the available experimental data. The bulk moduli along the - and -axes, $B_{a}$ and $B_{c}$, almost linearly increase with pressure, and the former is always smaller than the latter. The ratio of $B_{c}/B_{a}$ has a trend of gradual increase as the pressure increases. It is found that the elastic constants, anisotropy and Debye temperature of Ti2SC increase with pressure, while axial compressibility along the - and -axes decreases with pressure. The thermal properties including the equation of state, the Grüneisen parameter , the anisotropies $\\Delta_{p}, \\Delta_{S1}$ and $\\Delta_{S2}$, and the heat capacity are estimated at various pressures and temperatures.

  9. Dynamical stability and evolution of the discs of Sc galaxies

    CERN Document Server

    Fuchs, B

    1997-01-01

    We examine the local stability of galactic discs against axisymmetric density perturbations with special attention to the different dynamics of the stellar and gaseous components. In particular the discs of the Milky Way and of NGC 6946 are studied. The Milky Way is shown to be stable, whereas the inner parts of NGC 6946, a typical Sc galaxy from the Kennicutt (1989) sample, are dynamically unstable. The ensuing dynamical evolution of the composite disc is studied by numerical simulations. The evolution is so fierce that the stellar disc heats up dynamically on a short time scale to such a degree, which seems to contradict the morphological appearance of the galaxy. The star formation rate required to cool the disc dynamically is estimated. Even if the star formation rate in NGC 6946 is at present high enough to meet this requirement, it is argued that the discs of Sc galaxies cannot sustain such a high star formation rate for longer periods.

  10. A Study on the Fluorescence System of Sc-BPMPHD-CTMAB and Its Analytical Application

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    @@ Introduction The fluorescence of Sc3+ itself in solution is not observed. After complexed with an organic ligand with a chromophore, Sc3+ makes the ligand, which has no or has weak fluorescence, emit strong fluorescence.

  11. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... News Physician Resources Professions Site Index A-Z Magnetic Resonance Imaging (MRI) - Head Magnetic resonance imaging (MRI) of the head ... limitations of MRI of the Head? What is MRI of the Head? Magnetic resonance imaging (MRI) is ...

  12. Missouri: Early Head Start Initiative

    Science.gov (United States)

    Center for Law and Social Policy, Inc. (CLASP), 2012

    2012-01-01

    Missouri's Early Head Start/Child Care Partnership Project expands access to Early Head Start (EHS) services for children birth to age 3 by developing partnerships between federal Head Start, EHS contractors, and child care providers. Head Start and EHS contractors that participate in the initiative provide services through community child care…

  13. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... News Physician Resources Professions Site Index A-Z Magnetic Resonance Imaging (MRI) - Head Magnetic resonance imaging (MRI) of the head uses a powerful ... the Head? What is MRI of the Head? Magnetic resonance imaging (MRI) is a noninvasive medical test that ...

  14. Status of Simulation Tools for the ILD ScECAL

    OpenAIRE

    Kotera, Katsushige; anduze, marc; Boudry, Vincent; Brient, Jean-Claude; Jeans, Daniel; Kawagoe, Kiyotomo; Miyamoto, Akiya; de Freitas, Paulo Mora; Musat, Gabriel; Ono, Hiroaki; Takeshita, Tohru; Uozumi, Satoru

    2010-01-01

    The scintillator-strip electromagnetic calorimeter (ScECAL) is one of the calorimeter technic for the ILC. To achieve the fine granularity from the strip-segmented layers the strips in odd layers are orthogonal with respect to those in the even layers. In order to extract the best performance from such detector concept, a special reconstruction method and simulation tools are being developed in ILD collaboration. This manuscript repots the status of developing of those tools.

  15. Metastable Al-Sc phase diagram in aluminium rich region

    Energy Technology Data Exchange (ETDEWEB)

    Drits, M.E.; Toropova, L.S.; Bykov, Yu.G.; Gushchina, F.L.; Elagin, V.I.; Filatov, Yu.A.

    1982-12-01

    An aluminium rich part of binary metastable phase diagram Al-Sc for 100 deg/s alloy cooling rate under crystallization is studied. Eutectic horizontal in the metastable diagram is 4 deg lower as compared to the equilibrium one, scandium concentration in the eutectic point makes up approximately 0.8%, the maximum solubility is 0.6%. Maximum cast grain refining in aluminium under crystallization at the rate of 100 deg/s is attained at 0.6% scandium content.

  16. Economics of head injuries

    Directory of Open Access Journals (Sweden)

    Singh Manmohan

    2006-01-01

    Full Text Available Summary: Head injuries account for significant proportion of neurosurgical admissions and bed occupancy. Patients with head injuries also consume significant proportions of neurosurgical resources. A prospective 6-month study has been carried out to evaluate the expenditure incurred on head injury patients in a modern neurosurgical center equipped with state of the art infrastructure. Costing areas included wages / salaries of health care personnel, cost of medicines / surgical items / crystalloids, general store items, stationary, all investigation charges, equipment cost, overhead building cost, maintenance cost, electricity and water charges and cost of medical gases, air conditioning and operation theatre expenses. Expenditure in each area was calculated and apportioned to each bed. The statistical analysis was done using X2 test. The cost of stay in ward was found to be Rs. 1062 / bed / day and in neurosurgical ICU Rs. 3082 / bed / day. The operation theatre cost for each surgery was Rs. 11948. The cost of hospital stay per day for minor, moderate and severe head injury group was found to be Rs. 1921, Rs. 2569 and Rs. 2713 respectively. The patients who developed complications, the cost of stay per day in the hospital were Rs. 2867. In the operative group, the cost of hospital stay per day was Rs. 3804. The total expenditure in minor head injury was Rs. 7800 per patient, in moderate head injury was Rs. 22172 per patient, whereas in severe head injury, it was found to be Rs. 32852 per patient. Patients who underwent surgery, the total cost incurred was Rs. 33100 per operated patient.

  17. QUALITY MANAGEMENT OF BAKERY PRODUCTS: A CASE STUDY IN SC

    Directory of Open Access Journals (Sweden)

    Nicoleta- Luminiţa STRÂMBEANU RISTEA

    2013-01-01

    Full Text Available The paper aimed to present the benefits of implementing HACCP (Hazard Analysis and Critical Control Points to company S.C. "DOBRE AND SONS" S.R.L. Constanta, Romania. The data have been provided by the above mentioned manufacturer. The objectives of S.C. "DOBRE AND SONS" S.R.L. are protecting the health of the consumers of the products and their satisfaction regarding the consumption of products that are nutritional, tasty, fresh, free from microbiological, chemical and physical hazard, as well as possessing stable properties during the validity for consumption. In this respect, there has been implemented and maintained an integrated management system of food quality and safety according to SR EN ISO 9001:2008, SR EN ISO 22000:2005 and according to IFS standard, version 5/2007, which consists of determining the potential biological, chemical and physical hazards that might affect the safety of bread and bakery products, or the health of the consumer. HACCP team is analyzing hazard using one of the recommended techniques: brainstorming or the cause - effect diagram. In conclusion, the company S.C. "DOBRE AND SONS" S.R.L. Constanta, Romania provides awareness and employee involvement at all levels in achieving the appointed objectives.

  18. Charleston Harbor, SC, Regional Sediment Management Study; Beneficial Use of Dredged Material through Nearshore Placement

    Science.gov (United States)

    2017-05-01

    ER D C/ CH L TR -1 7- 7 Regional Sediment Management (RSM) Program Charleston Harbor, SC, Regional Sediment Management Study...acwc.sdp.sirsi.net/client/default. Regional Sediment Management (RSM) Program ERDC/CHL TR-17-7 May 2017 Charleston Harbor, SC, Regional Sediment...454632, “Charleston Harbor, SC; Regional Sediment Management Study” ERDC/CHL TR-17-7 ii Abstract The 2015 Charleston Harbor, SC, final

  19. A study of Al-Sc-Zr alloys in the aluminum-rich region

    Energy Technology Data Exchange (ETDEWEB)

    Toropova, L.S.; Kamardinkin, A.N.; Kindzhibalo, V.V.; Tyvanchuk, A.T. (AN SSSR, Institut Metallurgii, Moscow (USSR))

    1990-12-01

    Alloys in the ternary system Al-Sc-Zr along a section of approximately 1.0 pct Sc and 0.8 pct Zr were investigated by X-ray diffraction and electron probe analyses. It is found that phases Al3Sc and Al3Zr are in equilibrium with the alpha solid solution of aluminum. The contents of zirconium and scandium in the phase Al3Sc are determined as a function of their concentrations in the alloy.

  20. Effect of ScAl/sub 3/ phase dispersity on hardening of A1-6. 3% Mg-0. 21% Sc alloy

    Energy Technology Data Exchange (ETDEWEB)

    Drits, M.E.; Bykov, Y.G.; Toropova, L.S.

    1985-09-01

    This paper reports on attempts to evaluate the quantitatively separate influence exerted on the hardening of an aluminum alloy containing 6.3% Mg and 0.21% Sc by both particles of the ScAl/sub 3/ phase exhibiting a different degree of dispersity and also the substructure which is formed in the alloy after hot deformation. The binary aluminum alloy containing 6.3% of Mg after hot deformation has a fully recrystallized structure, while the aluminum alloy containing 6.5% of Mg and Sc is recrystallized. It is concluded that: the magnitude of substructure hardening of the A1-6.3% Mg-0.21% Sc alloy is similar, irrespective of the dispersity of coherent ScAl/sub 3/ particles; and, hardening of the alloy, which is governed by coherent ScAl/sub 3/-phase segregations less than 20 mm in diameter, significantly exceeds the effect of substructure hardening.

  1. Editorial : islands : objects of representation

    OpenAIRE

    Baldacchino, Godfrey

    2005-01-01

    In this article, Baldacchino tries to define what is an island and what makes an island. Insularity is a diverse experience ranging from the remoteness of Easter Island in the Pacific to the more international and globalized islands of the Western world.

  2. Crystal fields of dilute Tb, Dy, or Er in Sc obtained by magnetization measurements

    DEFF Research Database (Denmark)

    Høg, J.; Touborg, P.

    1976-01-01

    Crystal-field parameters for dilute Sc-Tb, Sc-Dy, and Sc-Er alloys have been obtained by fitting theoretical expressions to the experimentally measured paramagnetic susceptibility. The initial susceptibility was measured and corrected for the effects of ordering at the lowest temperatures in the ...

  3. Preparation and characterization of Sc doped MgB2 wires

    DEFF Research Database (Denmark)

    Grivel, Jean-Claude; Burdusel, M.

    2016-01-01

    The in-situ technique was used to manufacture scandium (Sc) doped MgB2 wires in a composite Cu–Nb sheath. After reaction at 700 °C, at most 1 at.% Mg was replaced by Sc in the MgB2 phase, without significant influence on its superconducting transition temperature. For higher Sc concentrations...

  4. File list: InP.PSC.10.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 35242 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/InP.PSC.10.AllAg.EpiSC.bed ... ...InP.PSC.10.AllAg.EpiSC mm9 Input control Pluripotent stem cell EpiSC SRX590285,SRX5

  5. File list: InP.PSC.50.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 90285 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/InP.PSC.50.AllAg.EpiSC.bed ... ...InP.PSC.50.AllAg.EpiSC mm9 Input control Pluripotent stem cell EpiSC SRX535242,SRX5

  6. File list: InP.PSC.20.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 90285 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/InP.PSC.20.AllAg.EpiSC.bed ... ...InP.PSC.20.AllAg.EpiSC mm9 Input control Pluripotent stem cell EpiSC SRX535242,SRX5

  7. File list: His.PSC.10.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 0286,SRX535238 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.PSC.10.AllAg.EpiSC.bed ... ...His.PSC.10.AllAg.EpiSC mm9 Histone Pluripotent stem cell EpiSC SRX590288,SRX535240,

  8. File list: Unc.PSC.05.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 074908,SRX1074905 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.PSC.05.AllAg.EpiSC.bed ... ...Unc.PSC.05.AllAg.EpiSC mm9 Unclassified Pluripotent stem cell EpiSC SRX1074917,SRX1

  9. File list: His.PSC.50.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 909,SRX1074906 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.PSC.50.AllAg.EpiSC.bed ... ...His.PSC.50.AllAg.EpiSC mm9 Histone Pluripotent stem cell EpiSC SRX535239,SRX535240,

  10. File list: InP.PSC.05.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 35242 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/InP.PSC.05.AllAg.EpiSC.bed ... ...InP.PSC.05.AllAg.EpiSC mm9 Input control Pluripotent stem cell EpiSC SRX590285,SRX5

  11. File list: Unc.PSC.50.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 074905,SRX1074908 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.PSC.50.AllAg.EpiSC.bed ... ...Unc.PSC.50.AllAg.EpiSC mm9 Unclassified Pluripotent stem cell EpiSC SRX1074917,SRX1

  12. File list: His.PSC.05.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 4916,SRX590286 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.PSC.05.AllAg.EpiSC.bed ... ...His.PSC.05.AllAg.EpiSC mm9 Histone Pluripotent stem cell EpiSC SRX590288,SRX535240,

  13. File list: Unc.PSC.20.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 074908,SRX1074905 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.PSC.20.AllAg.EpiSC.bed ... ...Unc.PSC.20.AllAg.EpiSC mm9 Unclassified Pluripotent stem cell EpiSC SRX1074917,SRX1

  14. File list: His.PSC.20.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 4906,SRX535241 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.PSC.20.AllAg.EpiSC.bed ... ...His.PSC.20.AllAg.EpiSC mm9 Histone Pluripotent stem cell EpiSC SRX535239,SRX661083,

  15. Overview of 2009 IEC/TC SC 77C Plenary Meeting%2009 IEC/TC SC 77C年会

    Institute of Scientific and Technical Information of China (English)

    孟萃

    2009-01-01

    介绍了在法国召开的2009 IEC/TC SC 77C分技术委员会工作组会议讨论的IEC 61000-4-35、IEC 6100-5-9、IEC 6100-5-8三个标准项目实施情况、标准维护需求及新的技术工作.

  16. Heat Island Compendium

    Science.gov (United States)

    Heat islands can be mitigated through measures like planting trees and vegetation, installing green roofs and cool roofs, and using cool pavements. The compendium describes all of these strategies and shows how communities around the country are being used

  17. Nunivak Island muskox studies

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This report covers the Nunivak Island muskox, summarizing the carrying capacity and age and sex ratios. Recommendations are attached for muskox management.

  18. Acid-base chemistry in the formation of Mackay-type icosahedral clusters: μ3-acidity analysis of Sc-rich phases of the Sc-Ir system.

    Science.gov (United States)

    Guo, Yiming; Stacey, Timothy E; Fredrickson, Daniel C

    2014-05-19

    The crystal structures of intermetallic phases offer a wealth of geometrical features (helices, multishelled clusters, and host-guest motifs) whose formation has yet to be explained or predicted by chemical theory. A recently developed extension of the acid-base concept to metallic systems, the μ3-acidity model, provides an avenue for developing this understanding for intermetallics formed from transition metals. In this Article, we illustrate how this approach can be used to understand one of the most striking geometrical entities to emerge in intermetallic chemistry, the Mackay cluster of icosahedral quasicrystals. We present μ3-acidity analyses, based on DFT-calibrated Hückel calculations, for a series of Sc-Ir intermetallics: ScIr (CsCl-type), Sc2Ir (Ti2Ni-type), Sc11Ir4, and the Mackay cluster containing phases Sc57Ir13 and Sc44Ir7. We begin by illustrating that a μ3-acidity model correctly predicts that each of these phases is stable relative to disproportionation into their neighboring compounds when a common set of Hückel parameters and d-orbital occupancies is used. Next, we explain these results by developing a relationship between the distance distribution of homoatomic contacts within an atom's coordination sphere and the μ3-neutralization it experiences. For a given average homoatomic distance, the role of heteroatomic contacts is higher when the distribution of homoatomic contacts is narrower. This effect is key to the strength of the acid-base neutralization of the Sc-rich phases, where the Sc atoms find a scarcity of Ir atoms from which to obtain neutralization. Under these circumstances, Sc-Ir contacts should be maximized, whereas the number and distance variations of the Sc-Sc contacts should be minimized. These expectations are borne out by the observed crystal structures. In particular, the Mackay clusters of Sc57Ir13 and Sc44Ir7, in which a central Ir atom is icosahedrally coordinated by a pentagonal dodecahedral array of face-sharing Sc

  19. Effect of ScAl/sub 3/ phase dispersity on hardening of Al-6. 3 pct Mg-0. 21 pct Sc alloy

    Energy Technology Data Exchange (ETDEWEB)

    Drits, M.E.; Bykov, IU.G.; Toropova, L.S.

    1985-09-01

    The relative contributions of disperse coherent ScAl/sub 3/ segregations and of the substructure to the hardening of an aluminum alloy containing 6.3 pct Mg and 0.21 pct Sc are evaluated quantitatively. It is shown that the extent of substructure hardening is independent of the dispersity of coherent ScAl/sub 3/ particles and, consequently, of the homogenizing treatment. The contribution of coherent ScAl/sub 3/ segregations less than 20 nm in diameter to the hardening of the alloy significantly exceeds that of substructure hardening. 9 references.

  20. Al-Mg-Sc-Zr合金的再结晶%Recrystallization of Al-Mg-Sc-Zr Alloys

    Institute of Scientific and Technical Information of China (English)

    张永红; 尹志民; 张杰; 潘青林; 彭志辉

    2002-01-01

    研究了添加微量Sc,Zr的Al-Mg合金的再结晶行为,结果表明:Al-Mg-Sc-Zr合金的再结晶起始温度为400℃,细小、弥散、与基体共格的析出相对位错和亚晶的钉扎作用是合金再结晶温度大幅度提高的主要原因,再结晶形核机制为亚晶聚合机制.%The recrystalization behavior of Al-Mg alloys with Sc and Zr additives was studied.It is found that the recrystallization of the alloy began at 400℃.The main reason of the great increase of recrystallization temperature is attributed to that the dislocations and subgrain boundaries.The recrystallizing nucleation mechanism was the subgrain boundary merging mechanism in the alloy are pinned by ultrafine dispersed coherent precipitates.

  1. Fourier Transform Microwave Spectroscopy of Sc13C2 and Sc12C13C: Establishing AN Accurate Structure of ScC2 (tilde{X}2A1)

    Science.gov (United States)

    Burton, Mark; Halfen, DeWayne T.; Min, Jie; Ziurys, Lucy M.

    2016-06-01

    Pure rotational spectra of Sc13C2 and Sc12C13C (tilde{X}2A1) have been obtained using Fourier Transform Microwave methods. These molecules were created from scandium vapor in combination with 13CH4 and/or 12CH4, diluted in argon, using a Discharge Assisted Laser Ablation Source (DALAS). Transitions in the frequency range of 14-30 GHz were observed for both species including hyperfine splitting due to the nuclear spin of Sc (I = 7/2) and 13C (I = 1/2). Rotational, spin-rotational, and hyperfine constants have been determined for Sc13C2 and Sc12C13C, as well as a refined structure for ScC2. In agreement with theoretical calculations and previous Sc12C2 results, these data confirm a cyclic (or T-shaped) structure for this molecule. Scandium carbides have been shown to form endohedral-doped fullerenes, which have unique electrical and magnetic properties due to electron transfer between the metal and the carbon-cage. Spectroscopy of ScC2 provides data on model systems for comparison with theory.

  2. Melville Island, Australia

    Science.gov (United States)

    1992-01-01

    Melville Island, just off the coast of Darwin, Northern Territory, Australia (11.5S, 131.0E) is a sparsely inhabited tropical island with heavy woodland concentrations. The widespread and prominant smoke plumes were most likely set to renew pasture under open canopy woodland. Soil erosion is almost non- existant as can be seen by the clear and clean river flow. The offshore sediments are coastal current borne deposits from King Sound to the west.

  3. Pediatric head injury.

    Science.gov (United States)

    Tulipan, N

    1998-01-01

    Pediatric head injury is a public health problem that exacts a high price from patients, their families and society alike. While much of the brain damage in head-injured patients occurs at the moment of impact, secondary injuries can be prevented by aggressive medical and surgical intervention. Modern imaging devices have simplified the task of diagnosing intracranial injuries. Recent advances in monitoring technology have made it easier to assess the effectiveness of medical therapy. These include intracranial pressure monitoring devices that are accurate and safe, and jugular bulb monitoring which provides a continuous, qualitative measure of cerebral blood flow. The cornerstones of treatment remain hyperventilation and osmotherapy. Despite maximal treatment, however, the mortality and morbidity associated with pediatric head injury remains high. Reduction of this mortality and morbidity will likely depend upon prevention rather than treatment.

  4. Head First Statistics

    CERN Document Server

    Griffiths, Dawn

    2009-01-01

    Wouldn't it be great if there were a statistics book that made histograms, probability distributions, and chi square analysis more enjoyable than going to the dentist? Head First Statistics brings this typically dry subject to life, teaching you everything you want and need to know about statistics through engaging, interactive, and thought-provoking material, full of puzzles, stories, quizzes, visual aids, and real-world examples. Whether you're a student, a professional, or just curious about statistical analysis, Head First's brain-friendly formula helps you get a firm grasp of statistics

  5. Head first Ajax

    CERN Document Server

    Riordan, Rebecca M

    2008-01-01

    Ajax is no longer an experimental approach to website development, but the key to building browser-based applications that form the cornerstone of Web 2.0. Head First Ajax gives you an up-to-date perspective that lets you see exactly what you can do -- and has been done -- with Ajax. With it, you get a highly practical, in-depth, and mature view of what is now a mature development approach. Using the unique and highly effective visual format that has turned Head First titles into runaway bestsellers, this book offers a big picture overview to introduce Ajax, and then explores the use of ind

  6. Rocket injector head

    Science.gov (United States)

    Green, C. W., Jr. (Inventor)

    1968-01-01

    A high number of liquid oxygen and gaseous hydrogen orifices per unit area are provided in an injector head designed to give intimate mixing and more thorough combustion. The injector head comprises a main body portion, a cooperating plate member as a flow chamber for one propellant, a cooperating manifold portion for the second propellant, and an annular end plate for enclosing an annular propellant groove formed around the outer edge of the body. All the openings for one propellant are located at the same angle with respect to a radial plane to permit a short combustion chamber.

  7. Nootropic candidates inhibit head-twitches induced by mescaline in mice.

    Science.gov (United States)

    Yamamoto, T; Ohno, M; Yatsugi, S; Fujikawa, Y; Ueki, S

    1992-07-01

    The effects of various nootropic candidates on mescaline-induced head-twitches were studied in mice. The number of head-twitches induced by mescaline (100 mg/kg, s.c.) was significantly reduced by idebenone (32 and 100 mg/kg, i.p.), minaprine (0.32-10 mg/kg, p.o.) and nebracetam (100 mg/kg, p.o.). Cholinesterase inhibitors such as tetrahydroaminoacridine (1 and 10 mg/kg, p.o.), NIK-247 (10 and 18 mg/kg, p.o.) and physostigmine (0.32 mg/kg, i.p.) also suppressed the head-twitch response to mescaline. These results suggest that the direct or indirect cholinergic-activating effects of these drugs may be involved in inhibiting mescaline-induced head-twitches.

  8. LOCAL COLLISION SIMULATION OF AN SC WALL USING ENERGY ABSORBING STEEL

    Directory of Open Access Journals (Sweden)

    CHUL-HUN CHUNG

    2013-08-01

    Full Text Available This study evaluates the local damage of a turbine in an auxiliary building of a nuclear power plant due to an external impact by using the LS-DYNA finite element program. The wall of the auxiliary building is SC structure and the material of the SC wall plate is high manganese steel, which has superior ductility and energy absorbance compared to the ordinary steel used for other SC wall plates. The effects of the material of the wall, collision speed, and angle on the magnitude of the local damage were evaluated by local collision analysis. The analysis revealed that the SC wall made of manganese steel had significantly less damage than the SC wall made of ordinary steel. In conclusion, an SC wall made of manganese steel can have higher effective resistance than an SC wall made of ordinary steel against the local collision of an airplane engine or against a turbine impact.

  9. Performance Analysis of OFDM 60GHz System and SC-FDE 60GHz System

    Directory of Open Access Journals (Sweden)

    Han Xueyan

    2016-01-01

    Full Text Available In this paper, the performance of 60GHz wireless communication system with SC and OFDM is studied, the models of OFDM 60GHz system and SC 60GHz frequency domain equalization (SC-FDE system are established, and the bit error rate (BER performance of OFDM 60GHz system and SC-FDE 60GHz system in 802.15.3c channels is compared. The simulation results show that SC-FDE 60GHz system has a slight advantage over OFDM system in line-of-sight (LOS channels, while OFDM 60GHz system has a slight advantage over SC-FDE system in non-line-of-sight (NLOS channels. For 60GHz system, OFDM 60GHz system has a slight advantage over SC-FDE system in overcoming multipath fading, but the performance of both is close whether in the LOS or NLOS case.

  10. Josephson coupling between superconducting islands on single- and bi-layer graphene

    Science.gov (United States)

    Mancarella, Francesco; Fransson, Jonas; Balatsky, Alexander

    2016-05-01

    We study the Josephson coupling of superconducting (SC) islands through the surface of single-layer graphene (SLG) and bilayer graphene (BLG) in the long-junction regime, as a function of the distance between the grains, temperature, chemical potential and external (transverse) gate-voltage. For SLG, we provide a comparison with existing literature. The proximity effect is analyzed through a Matsubara Green’s function approach. This represents the first step in a discussion of the conditions for the onset of a granular superconductivity within the film, made possible by Josephson currents flowing between superconductors. To ensure phase coherence over the 2D sample, a random spatial distribution can be assumed for the SC islands on the SLG sheet (or intercalating the BLG sheets). The tunable gate-voltage-induced band gap of BLG affects the asymptotic decay of the Josephson coupling-distance characteristic for each pair of SC islands in the sample, which results in a qualitatively strong field dependence of the relation between Berezinskii-Kosterlitz-Thouless transition critical temperature and gate voltage.

  11. Heading in soccer: dangerous play?

    Science.gov (United States)

    Spiotta, Alejandro M; Bartsch, Adam J; Benzel, Edward C

    2012-01-01

    Soccer is the world's most popular sport and unique in that players use their unprotected heads to intentionally deflect, stop, or redirect the ball for both offensive and defensive strategies. Headed balls travel at high velocity pre- and postimpact. Players, coaches, parents, and physicians are justifiably concerned with soccer heading injury risk. Furthermore, risk of long-term neurocognitive and motor deficits caused by repetitively heading a soccer ball remains unknown. We review the theoretical concerns, the results of biomechanical laboratory experiments, and the available clinical data regarding the effects of chronic, subconcussive head injury during heading in soccer.

  12. Computed Tomography (CT) -- Head

    Medline Plus

    Full Text Available ... are present in the paranasal sinuses. plan radiation therapy for cancer of the brain or other tissues. guide the ... RTAnswers.org Radiation Therapy for Brain Tumors Radiation Therapy for Head and Neck Cancer Others American Stroke Association National Stroke Association top ...

  13. Head space analysis

    NARCIS (Netherlands)

    Stekelenburg, G.J. van; Koorevaar, G.

    Additional analytical information is given about the method of head space analysis. From the data presented it can be concluded that this technique may be advantageous for enzyme kinetic studies in turbid solutions, provided a volatile organic substance is involved in the chemical reaction. Also

  14. Sculpting Ceramic Heads.

    Science.gov (United States)

    Sapiro, Maurice

    1983-01-01

    Clay sculpture is difficult to produce because of the requirements of kiln firing. The problems can be overcome by modeling the original manikin head and making a plaster mold, pressing molding slabs of clay into the plaster mold to form the hollow clay armature, and sculpting on the armature. (IS)

  15. Lubricating the swordfish head

    NARCIS (Netherlands)

    Videler, John J.; Haydar, Deniz; Snoek, Roelant; Hoving, Henk-Jan T.; Szabo, Ben G.

    2016-01-01

    The swordfish is reputedly the fastest swimmer on Earth. The concave head and iconic sword are unique characteristics, but how they contribute to its speed is still unknown. Recent computed tomography scans revealed a poorly mineralised area near the base of the rostrum. Here we report, using magnet

  16. Prognosis in head injury.

    Science.gov (United States)

    Jane, J A; Rimel, R W

    1982-01-01

    The prognosis of head injury when viewed from the perspective of the Glasgow Coma Scale confirms the utility of this measure. In particular, decrease in mortality is associated with an increase in GCS. In addition, the motor score portion of the GCS was of predictive value when taken alone. The outcome of patients in coma (GCS less than 8) was closely related to three preventable or treatable factors, namely, hypoxia, shock, and increased intracranial pressure. These three factors, when considered in combination, powerfully predicted mortality. Of considerable interest was the finding that moderate head injury (GCS 9-12) was associated with a small but perhaps preventable mortality. The morbidity was intermediate between that of severe and minor and was surprisingly high. Minor head injury, while not associated with significant mortality, also resulted in considerable morbidity. Neuropsychological evaluation of the patients and an experimental study suggests that an organic component may be involved even in this group. To deal with head injury, distinctions must be made between grades of severity. The Glasgow Coma Scale is suited for this task. Nonetheless, the recognition of this basic continuity should elicit the further recognition that different health providers may be involved in the case of, say, severe, as opposed to mild, injury, and that different outcome measures are suitable for one group but not another.

  17. Head injuries, heading, and the use of headgear in soccer.

    Science.gov (United States)

    Niedfeldt, Mark W

    2011-01-01

    Soccer has more than 265 million players around the world and is the only contact sport with purposeful use of the head for controlling and advancing the ball. Head contact in soccer has the potential to cause acute traumatic brain injury including concussion or, potentially, a pattern of chronic brain injury. Although early retrospective research on the effects of soccer heading seemed to suggest that purposeful heading may contribute to long-term cognitive impairment, prospective controlled studies do not support this and, in fact, suggest that purposeful heading may not be a risk factor for cognitive impairment. Headgear has not been shown to be effective in reducing ball impact but may be helpful in reducing the force of non-ball-related impacts to the head. There are concerns that universal use of headgear may cause more aggressive heading and head challenges, leading to increased risk of injury.

  18. Post-elution processing of {sup 44}Ti/{sup 44}Sc generator-derived {sup 44}Sc for clinical application

    Energy Technology Data Exchange (ETDEWEB)

    Pruszynski, M. [Institute of Nuclear Chemistry and Technology, 03-195 Warszawa (Poland); Loktionova, N.S. [Institute of Nuclear Chemistry, Johannes Gutenberg-University of Mainz, D-55128 Mainz (Germany); Filosofov, D.V. [Joint Institute of Nuclear Research, DLNP, 141980 Dubna (Russian Federation); Roesch, F., E-mail: frank.roesch@uni-mainz.d [Institute of Nuclear Chemistry, Johannes Gutenberg-University of Mainz, D-55128 Mainz (Germany)

    2010-09-15

    The {sup 44}Ti/{sup 44}Sc (T{sub 1/2}{sup 44}Ti=60 a) generator provides cyclotron-independent access to positron-emitting {sup 44}Sc (T{sub 1/2}=3.97 d) for PET imaging. This work aims to post-elution processing of initial {sup 44}Sc generator eluates in order to reduce its volume, HCl concentration and remove the oxalate anions. The on-line adsorption of {sup 44}Sc on cationic resin AG 50W-X8 (200-400 mesh, H{sup +}-form) is achieved with >98% efficacy. Subsequently, the purified {sup 44}Sc is desorbed by using 3 ml of 0.25 M ammonium acetate (pH=4.0). The post-processing takes 10 min. The overall yield of the post-processing reached 90%, which is referred to the {sup 44}Sc obtained from the {sup 44}Ti/{sup 44}Sc generator. In addition to the chemical purification, the content of {sup 44}Ti breakthrough was further reduced by one order of magnitude. The 185 MBq generator finally provides 150 MBq of {sup 44}Sc containing <10 Bq of {sup 44}Ti ready for labeling.

  19. Heterogeneity of abnormal prion protein (PrP(Sc)) in murine scrapie prions determined by PrP(Sc)-specific monoclonal antibodies.

    Science.gov (United States)

    Ushiki-Kaku, Yuko; Shimizu, Yoshihisa; Tabeta, Naoko; Iwamaru, Yoshifumi; Ogawa-Goto, Kiyoko; Hattori, Shunji; Yokoyama, Takashi

    2014-03-01

    In prion diseases, abnormal prion protein (PrP(Sc)) is considered as the main component of the infectious agent. Delineation of PrP(Sc) conformation is expected to be a critical factor in understanding properties of prions. However, practical methods to differentiate between conformers of PrP(Sc) are inadequate. Here, we used two PrP(Sc)-specific monoclonal antibodies (mAbs), 3B7 and 3H6, and found that mAb 3H6 detected a limited portion of PrP(Sc) in five mice-adapted prion strains. The quantity of mAb 3H6-precipitated PrP(Sc) was significantly lesser in 22L compared to other strains. This result provides a direct evidence of the conformational heterogeneity of PrP(Sc) within the prion strains. Conformation-specific probes, like these mAbs, have the potential to be powerful tools for investigating conformational variations in PrP(Sc).

  20. THE SC7/SC14 GENE FAMILY OF SCHIZOPHYLLUM-COMMUNE CODES FOR EXTRACELLULAR PROTEINS SPECIFICALLY EXPRESSED DURING FRUIT-BODY FORMATION

    NARCIS (Netherlands)

    SCHUREN, FHJ; ASGEIRSDOTTIR, SA; KOTHE, EM; SCHEER, JMJ; WESSELS, JGH

    The Sc7 and Sc14 genes are specifically expressed in the dikaryon of the basidiomycete fungus Schizophyllum commune during fruiting. These genes are closely linked (within 6 kb) and highly similar in gene structure and nucleotide sequence (70% identical nucleotides in their coding regions). The

  1. Dragonflies of Polillo Island, Philippines

    OpenAIRE

    Villanueva, Reagan Joseph T.

    2010-01-01

    Polillo is a small group of island (27 islands in total) east of central Luzon (Figure 1). It is made up of four main island viz. Polillo I, Patnanungan I, Jomalig I and Palasan I and several islets. This island group has relatively flat to gentle sloping terrain and the highest point is only 300 m asl (Mt. Maluhod) in Polillo Island (ca 700 km²) which is the largest in the group and the third largest island in greater Luzon biogeographic region.

  2. Seal Island and Franklin Island National Wildlife Refuges Trip Report

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This is a summary of visits to both Seal Island National Wildlife Refuge and Franklin Island National Wildlife Refuge on August 14, 15, 16, 1982.

  3. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... content. Related Articles and Media MR Angiography (MRA) Magnetic Resonance, Functional (fMRI) - Brain Head and Neck Cancer Treatment Brain Tumor Treatment Magnetic Resonance Imaging (MRI) Safety Alzheimer's Disease Head Injury Brain ...

  4. Head Lice: Prevention and Control

    Science.gov (United States)

    ... Diseases Laboratory Diagnostic Assistance [DPDx] Parasites Home Prevention & Control Language: English Español (Spanish) Recommend on Facebook Tweet ... that can be taken to help prevent and control the spread of head lice: Avoid head-to- ...

  5. Head and Neck Cancer Treatment

    Science.gov (United States)

    ... Professions Site Index A-Z Head and Neck Cancer Treatment Head and neck cancer overview What are my ... and neck cancer. For updated information on new cancer treatments that are available, you should discuss these issues ...

  6. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... to remain perfectly still and follow breath-holding instructions while the images are being recorded. If you ... Images related to Magnetic Resonance Imaging (MRI) - Head Videos related to Magnetic Resonance Imaging (MRI) - Head Sponsored ...

  7. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... the limitations of MRI of the Head? What is MRI of the Head? Magnetic resonance imaging (MRI) ... ray, CT and ultrasound. top of page How is the procedure performed? MRI examinations may be performed ...

  8. Head and Neck Cancer Treatment

    Science.gov (United States)

    ... oncologist will listen to the history of your problem and perform a physical examination. Consultations with other members of the head and neck team, such as the head and neck surgeon, pathologist, ...

  9. Sports-related Head Injury

    Science.gov (United States)

    ... difficulty expressing words or thoughts; dysarthric speech Head Injury Prevention Tips Buy and use helmets or protective head gear approved by the ASTM for specific sports 100 percent of the time. The ASTM has ...

  10. Preventing head injuries in children

    Science.gov (United States)

    Concussion - preventing in children; Traumatic brain injury - preventing in children; TBI - children; Safety - preventing head injury ... Helmets help to prevent head injuries. Your child should wear a ... sports or activities: Playing contact sports, such as lacrosse, ...

  11. Structural transformations in Sc/Si multilayers irradiated by EUVlasers

    Energy Technology Data Exchange (ETDEWEB)

    Voronov, D.L.; Zubarev, E.N.; Pershyn, Y.P.; Sevryukova, V.A.; Kondratenko, V.V.; Vinogradov, A.V.; Artioukov, I.A.; Uspenskiy, Y.A.; Grisham, M.; Vaschenko, G.; Menoni, C.S.; Rocca, J.J.

    2007-08-21

    Multilayer mirrors for the extreme ultraviolet (EUV) are keyelements for numerous applications of coherent EUV sources such as newtabletop lasers and free-electron lasers. However the field ofapplications is limited by the radiation and thermal stability of themultilayers. Taking into account the growing power of EUV sources thestability of the optics becomes crucial. To overcome this problem it isnecessary to study the degradation of multilayers and try to increasetheir temporal and thermal stability. In this paper we report the resultsof detailed study of structural changes in Sc/Simultilayers when exposedto intense EUV laser pulses. Various types of surface damage such asmelting, boiling, shockwave creation and ablation were observed asirradiation fluencies increase. Cross-sectional TEM study revealed thatthe layer structure was completely destroyed in the upper part ofmultilayer, but still survived below. The layers adjacent tothe substrateremained intact even through the multilayer surface melted down, thoughthe structure of the layers beneath the molten zone was noticeablychanged. The layer structure in this thermally affected zone is similarto that of isothermally annealed samples. All stages of scandium silicideformation such as interdiffusion, solid-state amorphization, silicidecrystallization, etc., are present in the thermally affected zone. Itindicates a thermal nature of the damage mechanism. The tungstendiffusion barriers were applied to the scandium/silicon interfaces. Itwas shown that the barriers inhibited interdiffusion and increased thethermal stability of Sc/Si mirrors.

  12. V-ATPase, ScNhxlp and Yeast Vacuole Fusion

    Institute of Scientific and Technical Information of China (English)

    Quan-Sheng Qiu

    2012-01-01

    Membrane fusion is the last step in trafficking pathways during which membrane vesicles fuse with target organelles to deliver cargos.It is a central cellular reaction that plays important roles in signal transduction,protein sorting and subcellular compartmentation.Recent progress in understanding the roles of ion transporters in vacuole fusion in yeast is summanzed in this article.It is becoming increasingly evident that the vacuolar proton pump V-ATPase and vacuolar Na+/H+ antiporter ScNhxlp are key components of the vacuole fusion machinery in yeast.Yeast ScNhxlp regulates vacuole fusion by controlling the luminal pH.V-ATPases serve a dual role in vacuolar integrity in which they regulate both vacuole fusion and fission reactions in yeast.Fission defects are epistatic to fusion defects.Vacuole fission depends on the proton translocation activity of the V-ATPase; by contrast,the fusion reaction does not need the transport activity but requires the physical presence of the proton pump.Vo,the membrane-integral sector of the V-ATPase,forms trans-complexes between the opposing vacuoles in the terminal phase of vacuole fusion where the Vo trans-complexes build a continuous proteolipid channel at the fusion site to mediate the bilayer fusion.

  13. The first SC-SAGD pilot in the Grosmont

    Energy Technology Data Exchange (ETDEWEB)

    Solanki, S.C.; Barrett, K.; Riva, D.; Becker, L.; Brindle, G. [Laricina Energy Ltd. (Canada)

    2011-07-01

    In north-eastern Alberta, the Grosmont Formation is an Upper Devonian carbonate succession containing a vast amount of bitumen. In an attempt to exploit this resource, Laricina Energy Ltd. and OSUM Oil Sands Corp. built the first ever solvent-cyclic steam-assisted gravity drainage (SC-SAGD) pilot. In this process, solvent and/or steam are continuously injected at reservoir pressure to heat the reservoir and thus reduce bitumen viscosity. The aim of this paper is to present the pilot project and its initial results. The reservoir's geology, the recovery process, the drilling and completion challenges as well as the design and the operational plan are discussed in this paper. Steam injection started in December 2010 and indications show that the wells are progressing as planned. Results showed an uptime greater than 90% so far and this is expected to further improve in the future. The first SC-SAGD pilot is discussed and early phases showed excellent results from the project.

  14. A first-principles study of hydrogen interaction and saturation on ScAl{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Samolia, Madhu [Department of Chemistry, Indian Institute of Technology Ropar, Rupnagar 140001 (India); Dhilip Kumar, T.J., E-mail: dhilip@iitrpr.ac.in [Department of Chemistry, Indian Institute of Technology Ropar, Rupnagar 140001 (India)

    2013-03-05

    Graphical abstract: Electrostatic potential superimposed on electron density of H{sub 2}, Al{sub 4} and ScAI{sub 3}. Highlights: ► A first principles calculation on hydrogen interaction and saturation on stable ScAl{sub 3} cluster is performed. ► Sc atom has higher negative charge electron density over Al atom in ScAl{sub 3} from natural bond orbital charge analysis. ► H{sub 2} undergoes dissociative chemisorption on the Sc atop site resulting in Sc–H–AI bridge bond. ► H{sub 2} saturation on Sc site results initially in chemisorption and then physisorption with the maximum loading of 6 molecules resulting in stable ScAl{sub 3}H{sub 12} structure. -- Abstract: Complex metal hydrides are promising hydrogen storage material for mobile applications. The presence of scandium catalysts in complex metal hydrides is found to improve significantly the kinetics of H{sub 2} adsorption and desorption. The exact role of these additives is not completely understood. NMR studies suggests the presence of distorted ScAl{sub 3} phase which is attributed to the enhancement of reversible uptake and release rates of H{sub 2}. In this study, we have investigated the hydrogen interaction and saturation on stable ScAl{sub 3} cluster at various sites using the density functional theory by employing unrestricted B3LYP/6-311++G(d,p) and the GGA-PW91/DNP methods. From natural bond orbital charge analysis and electrostatic potential superimposed on electron density plots, ScAl{sub 3} is found to be more polarized and Sc atom in ScAl{sub 3} cluster has higher negative charge and electron density over Al atoms. H{sub 2} undergoes dissociative chemisorption on the Sc atop site in ScAl{sub 3} resulting in Sc–H–Al bridge structure. The hydrogen saturation is studied by sequential H{sub 2} adsorption on ScAl{sub 3} cluster. In the Sc site, the first H{sub 2} molecule undergoes dissociative chemisorption and further addition results in H{sub 2} physisorption with the maximum loading

  15. Islands of Astronomy

    Directory of Open Access Journals (Sweden)

    Godfrey Baldacchino

    2009-05-01

    Full Text Available A global review of islands and their connections with astronomy throughout history up to the contemporary times suggests eight compelling, distinct yet interlocking reasons why islands have been and remain so important to astronomy and astronomers. Islands constitute favourable locations for various types of astronomy-related activities: from tracking satellites and monitoring significant celestial events, to providing exceptional locations to jurisdictions with mandated dark and unpolluted skies. They appeal for their favourable longitude and (especially southern latitude, as well as for their disposition towards the conditions that the scientific community may expect in an ideal world: relatively clear viewing conditions from a secure, self-contained platform that is, however, endowed with connectivity. This article is written as a contribution to the International Year of Astronomy (2009.

  16. Small Island Visitor Attractions

    Directory of Open Access Journals (Sweden)

    Haven Allahar

    2015-03-01

    Full Text Available This article proposes a process framework for developing and managing visitor attractions (VA in small island developing states with Trinidad and Tobago, a two-island state in the Caribbean, as the case study. An extensive literature review was conducted, supported by field observations, individual depth interviews, and small and large focus group meetings. The process framework identified four sets of processes: national policy formulation and legislation; inventory, classification, evaluation, and ranking of VA; general operations management involving project management activities; and site specific activities of development, operations, and maintenance. The value of the framework lies in the fact that no similar framework applicable to small islands was covered in the literature and validation was obtained from a panel of experts and a cross section of tourism stakeholders in Tobago.

  17. Directed evolution of human scFvs in DT40 cells.

    Science.gov (United States)

    Lim, Alfred W Y; Williams, Gareth T; Rada, Cristina; Sale, Julian E

    2016-02-01

    Cells that constitutively diversify their immunoglobulin genes can be used for selection of novel antibodies and for refining existing affinities and specificities. Here, we report an adaptation of the chicken DT40 system wherein its capacity for somatic hypermutation is harnessed to evolve human antibodies expressed as single-chain variable fragments (scFvs). Expression of membrane-anchored scFvs from within the rearranged Igλ locus created self-diversifying scFv libraries from which we could both select scFvs of a desired specificity and evolve both the specificity and affinity of existing scFvs by iterative expansion and selection. From these scFvs, we were able to create fully human IgG antibodies with nanomolar affinities. We further enhanced the functionality of the system by creating a pool of DT40 scFv lines with high levels of mutation driven by the overexpression of a hyperactive variant of activation-induced deaminase. From this library, we successfully isolated scFvs that bound the spliceosome factor CWC15 and the cytokine human IFNγ. Our results demonstrate the flexibility and utility of DT40 for rapid generation of scFv repertoires and efficient selection, evolution and affinity maturation of scFv specificities.

  18. Long Island Solar Farm

    Energy Technology Data Exchange (ETDEWEB)

    Anders, R.

    2013-05-01

    The Long Island Solar Farm (LISF) is a remarkable success story, whereby very different interest groups found a way to capitalize on unusual circumstances to develop a mutually beneficial source of renewable energy. The uniqueness of the circumstances that were necessary to develop the Long Island Solar Farm make it very difficult to replicate. The project is, however, an unparalleled resource for solar energy research, which will greatly inform large-scale PV solar development in the East. Lastly, the LISF is a superb model for the process by which the project developed and the innovation and leadership shown by the different players.

  19. Takarajima: A Treasured Island

    Directory of Open Access Journals (Sweden)

    Philip Hayward

    2014-06-01

    Full Text Available This article examines the manner in which local identity can be constructed on small islands from the selective prioritisation and elaboration of exogenous elements that become localised by this process and can subsequently function as a brand within contemporary tourism markets. The particular analysis of identity motifs on Takarajima island that we expound examines aspects of the relationships between folklore and contemporary media and references contemporary debates concerning archaeology’s interface with folklore and popular culture in the context of (non-scientific ‘treasure hunting’.

  20. Sakhalin Island terrain intelligence

    Science.gov (United States)

    ,

    1943-01-01

    This folio of maps and explanatory tables outlines the principal terrain features of Sakhalin Island. Each map and table is devoted to a specialized set of problems; together they cover the subjects of terrain appreciation, climate, rivers, water supply, construction materials, suitability for roads, suitability for airfields, fuels and other mineral resources, and geology. In most cases, the map of the island is divided into two parts: N. of latitude 50° N., Russian Sakhalin, and south of latitude 50° N., Japanese Sakhalin or Karafuto. These maps and data were compiled by the United States Geological Survey during the period from March to September, 1943.

  1. Island in the Air

    DEFF Research Database (Denmark)

    Simonsen, Dorthe Gert

    2017-01-01

    mobility and convert the sky into a sovereign territory was especially pronounced in Britain. But the challenge of creating a sovereign space out of mobile and transparent air was an intricate problem both in legal and practical terms. This article shows how geopolitical interests called for an upward...... extension of the Island Kingdom, extrapolating its coastal borders into the sky. However, even as Parliament passed the Aerial Navigation Act in 1913, this legal construction of an island in the air could not endure the agency of airplanes. The formation of airspace, I argue, is a history particularly well...

  2. Archaeoastronomy of Easter Island

    Science.gov (United States)

    Edwards, Edmundo

    Astronomer priests or "skywatchers" on Easter Island lived in stone towers that were used as observatories and built stone markers in the periphery that indicated the heliacal rising of certain stars that served to indicate the arrival of marine birds, turtles, the offshore fishing season, and times for planting and harvest. Petroglyphs related to such sites depict outriggers, fishhooks, pelagic fish, and turtles and supposedly represented a star map. In this chapter, we analyze a set of such skywatchers dwellings, and stone markers located upon the North coast of Easter Island that have astronomic orientations, its related petroglyphs, and the relations between these directions with their yearly activities and their ritual calendar.

  3. Chatham Islands Climate Change

    Energy Technology Data Exchange (ETDEWEB)

    Mullan, B.; Salinger, J.; Thompson, C.; Ramsay, D.; Wild, M.

    2005-06-15

    This brief report provides guidance on climate change specific to the Chatham Islands, to complement the information recently produced for local government by the Ministry for the Environment in 'Climate Change Effects and Impacts Assessment: A guidance manual for Local Government in New Zealand' and 'Coastal Hazards and Climate Change: A guidance manual for Local Government in New Zealand'. These previous reports contain a lot of generic information on climate change, and how to assess associated risks, that is relevant to the Chatham Islands Council.

  4. "Head versus heart"

    Directory of Open Access Journals (Sweden)

    Paul Rozin

    2007-08-01

    Full Text Available Most American respondents give ``irrational,'' magical responses in a variety of situations that exemplify the sympathetic magical laws of similarity and contagion. In most of these cases, respondents are aware that their responses (usually rejections, as of fudge crafted to look like dog feces, or a food touched by a sterilized, dead cockroach are not ``scientifically'' justified, but they are willing to avow them. We interpret this, in some sense, as ``heart over head.'' We report in this study that American adults and undergraduates are substantially less likely to acknowledge magical effects when the judgments involve money (amount willing to pay to avoid an ``unpleasant'' magical contact than they are when using preference or rating measures. We conclude that in ``head-heart'' conflicts of this type, money tips the balance towards the former, or, in other words, that money makes the mind less magical.

  5. 1957 Aleutian Islands, USA Images

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The magnitude 8.6 (Mw) earthquake occurred south of the Andreanof Islands, in the Aleutian Islands. It generated an 8-meter tsunami that did great damage on Adak...

  6. Gulf Island National Wildlife Refuges

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This document provides a brief history and describes physical features of the Gulf Island National Wildlife Refuges. The Gulf Island National Wildlife Refuges...

  7. "Head versus heart"

    OpenAIRE

    2007-01-01

    Most American respondents give ``irrational,'' magical responses in a variety of situations that exemplify the sympathetic magical laws of similarity and contagion. In most of these cases, respondents are aware that their responses (usually rejections, as of fudge crafted to look like dog feces, or a food touched by a sterilized, dead cockroach) are not ``scientifically'' justified, but they are willing to avow them. We interpret this, in some sense, as ``heart over head.'' We report in this ...

  8. Islanded operation of distribution networks

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    This report summarises the results of a study assessing the benefits and risks to distribution network of generator islanding and examining the technical, commercial and regulatory changes required to facilitate the operation of islanding. The background to the study is traced, and details are given of a literature review, the technical criteria for operating sections of the network in islanding mode, and the impact of islanding on trading. Case studies and a detailed implementation plan, data acquisition, and commercial incentives are discussed.

  9. Effect of Severe Plastic Deformation on Structure and Properties of Al-Sc-Ta and Al-Sc-Ti Alloys.

    Science.gov (United States)

    Berezina, Alla; Monastyrska, Tetiana; Davydenko, Olexandr; Molebny, Oleh; Polishchuk, Sergey

    2017-12-01

    The comparative analysis of the effect of monotonous and non-monotonous severe plastic deformations (SPD) on the structure and properties of aluminum alloys has been carried out. Conventional hydrostatic extrusion (HE) with a constant deformation direction and equal-channel angular hydroextrusion (ECAH) with an abrupt change in the deformation direction were chosen for the cases of monotonous and non-monotonous SPD, respectively. Model cast hypoeutectic Al-0.3%Sc alloys and hypereutectic Al-0.6%Sc alloys with Ta and Ti additives were chosen for studying. It was demonstrated that SPD of the alloys resulted in the segregation of the material into active and inactive zones which formed a banded structure. The active zones were shown to be bands of localized plastic deformation. The distance between zones was found to be independent of the accumulated strain degree and was in the range of 0.6-1 μm. Dynamic recrystallization in the active zones was observed using TEM. The dynamic recrystallization was accompanied by the formation of disclinations, deformation bands, low-angle, and high-angle boundaries, i.e., rotational deformation modes developed. The dynamic recrystallization was more intense during the non-monotonous deformation as compared with the monotonous one, which was confirmed by the reduction of texture degree in the materials after ECAH.

  10. SC1327-312 & SC1329-313 two galaxy groups in-between a major merging event observed with Beppo-SAX

    CERN Document Server

    Bardelli, S; Ettori, S; Molendi, S; Zucca, E; Colafrancesco, Sergio

    2001-01-01

    We present the results of two Beppo-SAX observations of the poor clusters SC1327-312 and SC1329-313. These objects are located in a huge structure, formed by three ACO clusters, which is probably the remnant of one of the largest and best studied major mergings known. Given the fact that these poor clusters are in between two interacting ACO clusters, the aim of this work is to study the physics of the intracluster medium and to look for the possible presence of shocks. We derived the gas distribution profiles, the global (i.e. within 0.3 Mpc) temperatures and abundances and the temperature profiles and maps for SC1327-312 and SC1329-313. Also the presence of soft excess in LECS and hard excess in PDS have been checked. We do not find evidence of regions where the gas is shocked or significantly heated. The image of SC1327-312 seems rather symmetric, while the gas profile of SC1329-313 shows disturbed, comet-like shaped isophotes, with the tail pointing toward A3562 and a compression toward SC1327-312. The pr...

  11. Preparation and characterization of Sc doped MgB2 wires

    Science.gov (United States)

    Grivel, J.-C.; Burdusel, M.

    2016-09-01

    The in-situ technique was used to manufacture scandium (Sc) doped MgB2 wires in a composite Cu-Nb sheath. After reaction at 700 °C, at most 1 at.% Mg was replaced by Sc in the MgB2 phase, without significant influence on its superconducting transition temperature. For higher Sc concentrations in the nominal composition, the formation of Sc-rich impurity phases was evidenced by SEM/EDS observations. The critical current density and accommodation field of the wires are weakly dependant on the Sc content. It is believed that these effects are related more to modifications of the thermal behaviour of the precursor powders revealed by DTA measurements than to actual doping. The best performance was obtained in a wire with Mg:Sc = 0.995_0.005 atomic ratio.

  12. In vitro neutralization of prions with PrP(Sc)-specific antibodies.

    Science.gov (United States)

    Taschuk, Ryan; Van der Merwe, Jacques; Marciniuk, Kristen; Potter, Andrew; Cashman, Neil; Griebel, Philip; Napper, Scott

    2015-01-01

    Prion diseases reflect the misfolding of a self-protein (PrP(C)) into an infectious, pathological isomer (PrP(Sc)). By targeting epitopes uniquely exposed by misfolding, our group developed PrP(Sc)-specific vaccines to 3 disease specific epitopes (DSEs). Here, antibodies induced by individual DSE vaccines are evaluated for their capacity to neutralize prions in vitro. For both purified antibodies and immunoreactive sera, the PrP(Sc)-specific antibodies were equally effective in neutralizing prions. Further, there was no significant increase in neutralizing activity when multiple DSEs were targeted within an assay. At a low antibody concentration, the PrP(Sc)-specific antibodies matched the neutralization achieved by an antibody that may act via both PrP(C) and PrP(Sc). At higher doses, however, this pan-specific antibody was more effective, potentially due to a combined deactivation of PrP(Sc) and depletion of PrP(C).

  13. 75 FR 51098 - Protection Island and San Juan Islands National Wildlife Refuges, Jefferson, Island, San Juan...

    Science.gov (United States)

    2010-08-18

    ... libraries in northwestern Washington: Anacortes Public Library, Bellingham Public Library, Clinton Public Library, Coupeville Public Library, Evergreen State College Library, Island Public Library, Jefferson County Central Library, Lopez Island Public Library, North Olympic Public Library, Oak Harbor Public...

  14. Syntactic-Head-Driven Generation

    CERN Document Server

    Koenig, E

    1994-01-01

    The previously proposed semantic-head-driven generation methods run into problems if none of the daughter constituents in the syntacto-semantic rule schemata of a grammar fits the definition of a semantic head given in Shieber et al. 1990. This is the case for the semantic analysis rules of certain constraint-based semantic representations, e.g. Underspecified Discourse Representation Structures (UDRSs) (Frank/Reyle 1992). Since head-driven generation in general has its merits, we simply return to a syntactic definition of `head' and demonstrate the feasibility of syntactic-head-driven generation. In addition to its generality, a syntactic-head-driven algorithm provides a basis for a logically well-defined treatment of the movement of (syntactic) heads, for which only ad-hoc solutions existed, so far.

  15. Sulfated dextrans enhance in vitro amplification of bovine spongiform encephalopathy PrP(Sc and enable ultrasensitive detection of bovine PrP(Sc.

    Directory of Open Access Journals (Sweden)

    Yuichi Murayama

    Full Text Available BACKGROUND: Prions, infectious agents associated with prion diseases such as Creutzfeldt-Jakob disease in humans, bovine spongiform encephalopathy (BSE in cattle, and scrapie in sheep and goats, are primarily comprised of PrP(Sc, a protease-resistant misfolded isoform of the cellular prion protein PrP(C. Protein misfolding cyclic amplification (PMCA is a highly sensitive technique used to detect minute amounts of scrapie PrP(Sc. However, the current PMCA technique has been unsuccessful in achieving good amplification in cattle. The detailed distribution of PrP(Sc in BSE-affected cattle therefore remains unknown. METHODOLOGY/PRINCIPAL FINDINGS: We report here that PrP(Sc derived from BSE-affected cattle can be amplified ultra-efficiently by PMCA in the presence of sulfated dextran compounds. This method is capable of amplifying very small amounts of PrP(Sc from the saliva, palatine tonsils, lymph nodes, ileocecal region, and muscular tissues of BSE-affected cattle. Individual differences in the distribution of PrP(Sc in spleen and cerebrospinal fluid samples were observed in terminal-stage animals. However, the presence of PrP(Sc in blood was not substantiated in the BSE-affected cattle examined. CONCLUSIONS/SIGNIFICANCE: The distribution of PrP(Sc is not restricted to the nervous system and can spread to peripheral tissues in the terminal disease stage. The finding that PrP(Sc could be amplified in the saliva of an asymptomatic animal suggests a potential usefulness of this technique for BSE diagnosis. This highly sensitive method also has other practical applications, including safety evaluation or safety assurance of products and byproducts manufactured from bovine source materials.

  16. Bone island and leprosy

    Energy Technology Data Exchange (ETDEWEB)

    Carpintero, P.; Garcia-Frasquet, A. [Department of Orthopaedic Surgery, Cordoba University, Medical School, Reina Sofia University Hospital, Cordoba (Spain); Tarradas, E. [Department of Imaging, Cordoba University, Medical School, Cordoba (Spain); Logrono, C. [Department of Dermatology, Reina Sofia University Hospital, Cordoba (Spain); Carrascal, A. [Department of Radiology, Infanta Elena Hospital, Huelva (Spain); Carreto, A. [Department of Radiology, Reina Sofia University Hospital, Cordoba (Spain)

    1998-06-01

    Objective. To determine the incidence of bone islands in leprosy patients. Design. X-rays of feet and hands of patients with Hansen`s disease (leprosy) were reviewed retrospectively. A second group of related age- and sex-matched patients who did not have Hansen`s disease was used for control purposes. Controls had undergone hand or foot X-rays during diagnosis of other pathologies. The patients with Hansen`s disease were compared with the control group, and were also analyzed as subgroups with different types of leprosy. The results were subjected to statistical analysis. Patients. Ninety patients with Hansen`s disease were randomly selected for this study. Patients who had had ulcers on hands or feet were excluded from the study. Results and conclusions. Bone islands were demonstrated in 20 patients with Hansen`s disease; no bone islands were observed in the controls. This was statistically significant (P<0.01). Bone islands were only seen in patients with lepromatous leprosy and borderline types but were not demonstrated in patients with tuberculoid leprosy. There was also a statistically significant relationship for a disease duration of 15 years or more. The cause of this raised incidence of enostosis in leprosy patients is not clear, but there may be a genetic predisposition in patients with leprosy, or it may be a side effect of leprosy, especially the lepromatous form. (orig.) With 4 figs., 2 tabs., 9 refs.

  17. Islands in the ice

    DEFF Research Database (Denmark)

    Jørgensen, Tina; Kjær, Kurt H.; Haile, James Seymour

    2012-01-01

    Nunataks are isolated bedrocks protruding through ice sheets. They vary in age, but represent island environments in 'oceans' of ice through which organism dispersals and replacements can be studied over time. The J.A.D. Jensen's Nunataks at the southern Greenland ice sheet are the most isolated ...

  18. Teachers' Potpourri: The Island

    Science.gov (United States)

    Levinson, Steven

    1971-01-01

    The author allows his students to create an imaginary society--the island. While developing the structure of their society, the students are actually practicing speech skills and activities such as problem solving through discussion, persuasive speaking and impromptu speaking. (Author/MS)

  19. The Flores Island tsunamis

    Science.gov (United States)

    Yeh, Harry; Imamura, Fumihiko; Synolakis, Costas; Tsuji, Yoshinobu; Liu, Philip; Shi, Shaozhong

    On December 12, 1992, at 5:30 A.M. GMT, an earthquake of magnitude Ms 7.5 struck the eastern region of Flores Island, Indonesia (Figure 1), a volcanic island located just at the transition between the Sunda and Banda Island arc systems. The local newspaper reported that 25-m high tsunamis struck the town of Maumere, causing substantial casualties and property damage. On December 16, television reports broadcast in Japan via satellite reported that 1000 people had been killed in Maumere and twothirds of the population of Babi Island had been swept away by the tsunamis.The current toll of the Flores earthquake is 2080 deaths and 2144 injuries, approximately 50% of which are attributed to the tsunamis. A tsunami survey plan was initiated within 3 days of the earthquake, and a cooperative international survey team was formed with four scientists from Indonesia, nine from Japan, three from the United States, one from the United Kingdom, and one from Korea.

  20. Potential emigration of Siberian cattle germplasm on Chirikof Island, Alaska

    Indian Academy of Sciences (India)

    M. D. MACNEIL; L. J. ALEXANDER; J. KANTANEN; I. A. AMMOSOV; Z. I. IVANOVA; R. G. POPOV; M. OZEROV; A. MILLBROOKE; M. A. CRONIN

    2017-03-01

    Feral cattle residing in Chirikof Island, Alaska, are relatively distinct from breeds used in commercial production in North America. However, preliminary evidence suggested that they exhibit substantial genetic relationship with cattle fromYakutian region of Siberia. Thus, our objective was to further elucidate quantify the origins, admixture and divergence of the Chirikof Island cattle relative to cattle from Siberia and USA. Subject animals were genotyped at 15 microsatellite loci.Compared with Turano–Mongolian and North American cattle, Chirikof Island cattle had similar variation, with slightly less observed heterozygosity, fewer alleles per locus and a positive fixation index. Analysis of the genetic distances revealed two primary clusters; one that contained the North American breeds and the Kazakh White head, and a second that contained the Yakutian and Kalmyk breeds, and the Chirikof population. Thus, it is suggested that Chirikof Island cattle may be a composite of British breeds emanating from North America and Turano–Mongolian cattle. A potential founder effect, consistent withhistorical records of the Russian–American period, may contribute to the adaptation of the Chirikof Island cattle to their harsh high-latitude environment. Further study of adaptive mechanisms manifest by these cattle is warranted.

  1. Toward low-cost affinity reagents: lyophilized yeast-scFv probes specific for pathogen antigens.

    Directory of Open Access Journals (Sweden)

    Sean A Gray

    Full Text Available The generation of affinity reagents, usually monoclonal antibodies, remains a critical bottleneck in biomedical research and diagnostic test development. Recombinant antibody-like proteins such as scFv have yet to replace traditional monoclonal antibodies in antigen detection applications, in large part because of poor performance of scFv in solution. To address this limitation, we have developed assays that use whole yeast cells expressing scFv on their surfaces (yeast-scFv in place of soluble purified scFv or traditional monoclonal antibodies. In this study, a nonimmune library of human scFv displayed on the surfaces of yeast cells was screened for clones that bind to recombinant cyst proteins of Entamoeba histolytica, an enteric pathogen of humans. Selected yeast-scFv clones were stabilized by lyophilization and used in detection assay formats in which the yeast-scFv served as solid support-bound monoclonal antibodies. Specific binding of antigen to the yeast-scFv was detected by staining with rabbit polyclonal antibodies. In flow cytometry-based assays, lyophilized yeast-scFv reagents retained full binding activity and specificity for their cognate antigens after 4 weeks of storage at room temperature in the absence of desiccants or stabilizers. Because flow cytometry is not available to all potential assay users, an immunofluorescence assay was also developed that detects antigen with similar sensitivity and specificity. Antigen-specific whole-cell yeast-scFv reagents can be selected from nonimmune libraries in 2-3 weeks, produced in vast quantities, and packaged in lyophilized form for extended shelf life. Lyophilized yeast-scFv show promise as low cost, renewable alternatives to monoclonal antibodies for diagnosis and research.

  2. File list: ALL.PSC.50.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.PSC.50.AllAg.EpiSC mm9 All antigens Pluripotent stem cell EpiSC SRX535239,SRX53...RX590290,SRX590286,SRX661084,SRX1074905,SRX1074908,SRX535237,SRX535241,SRX661085,SRX1074909,SRX1074906 http://dbarchive.biosc...iencedbc.jp/kyushu-u/mm9/assembled/ALL.PSC.50.AllAg.EpiSC.bed ...

  3. File list: ALL.PSC.10.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.PSC.10.AllAg.EpiSC mm9 All antigens Pluripotent stem cell EpiSC SRX590288,SRX53...RX590290,SRX1074917,SRX1074916,SRX590285,SRX590286,SRX535242,SRX1074908,SRX1074905,SRX535238,SRX535237 http://dbarchive.biosc...iencedbc.jp/kyushu-u/mm9/assembled/ALL.PSC.10.AllAg.EpiSC.bed ...

  4. File list: ALL.PSC.05.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.PSC.05.AllAg.EpiSC mm9 All antigens Pluripotent stem cell EpiSC SRX590288,SRX53...RX590290,SRX590289,SRX590285,SRX1074916,SRX1074917,SRX590286,SRX535242,SRX1074908,SRX1074905,SRX535237 http://dbarchive.biosc...iencedbc.jp/kyushu-u/mm9/assembled/ALL.PSC.05.AllAg.EpiSC.bed ...

  5. File list: ALL.PSC.20.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.PSC.20.AllAg.EpiSC mm9 All antigens Pluripotent stem cell EpiSC SRX535239,SRX66...RX590289,SRX590285,SRX590290,SRX590286,SRX1074909,SRX1074908,SRX1074905,SRX1074906,SRX535237,SRX535241 http://dbarchive.biosc...iencedbc.jp/kyushu-u/mm9/assembled/ALL.PSC.20.AllAg.EpiSC.bed ...

  6. DC-SC Photoinjector with Low Emittance at Peking University

    CERN Document Server

    Xiang Rong; Hao, J; Huang, Senlin; Lu Xiang Yang; Quan, Shengwen; Zhang, Baocheng; Zhao, Kui

    2005-01-01

    High average power Free Electron Lasers require the high quality electron beams with the low emittance and the sub-picosecond bunches. The design of DC-SC photoinjector, directly combining a DC photoinjector with an SRF cavity, can produce high average current beam with moderate bunch charge and high duty factor. Because of the DC gun, the emittance increases quickly at the beginning, so a carefully design is needed to control that. In this paper, the simulation of an upgraded design has been done to lower the normalized emittance below 1.5mm·mrad. The photoinjector consists of a DC gap and a 2+1/2-cell SRF cavity, and it is designed to produce 4.2 MeV electron beams at 100pC bunch charge and 81.25MHz repetition rate (8 mA average current).

  7. Domain structure and phase transition in Sc-doped zirconia

    Science.gov (United States)

    Brunauer, G.; Boysen, H.; Frey, F.; Ehrenberg, H.

    2002-01-01

    The temperature dependence of the domain structure associated with the ferroelastic phase transition (Fm↔R bar 3 m) in ZrO2 doped with 11% Sc2O3 has been determined from a peak shape analysis of high-resolution synchrotron x-ray powder diffraction data. In the temperature region of coexisting phases the observed characteristic anisotropic broadening and asymmetry of the lines is modelled by three different phases: a main rhombohedral phase, a distorted rhombohedral phase with a smaller c/a ratio, and a cubic phase. The latter two are assigned to the internal structure of the domain walls between two adjacent twin domains. The size and amount of the cubic phase show an initially slow increase with temperature followed by a very steep increase and a slow one after that. The size of the (main) rhombohedral domains remains nearly constant, while (micro-) strain in the distorted regions gradually decreases.

  8. M.Sc. in Civil and Structural Engineering

    DEFF Research Database (Denmark)

    Clausen, Johan Christian

    The following pages contain a list of project ideas proposed by the scientific staff at the Department of Civil Engineering, Aalborg University, and a number of companies. Most of the project ideas in this catalogue may form the basis for long and short master projects as well as regular 3rd...... semester projects at the M.Sc. programme in Civil and Structural Engineering. Each project description provides a brief overview of the purpose as well as the main activities. Further, a weighting between theoretical analysis, experimental work and computer modelling has been proposed. Usually...... page. Furthermore, other ideas for projects may be discussed with a potential supervisor. Many private engineering companies have a homepage on which they state that they would like to collaborate with students on a master project....

  9. Final Report for DOE Grant Number DE-SC0001481

    Energy Technology Data Exchange (ETDEWEB)

    Liang, Edison [Rice University

    2013-12-02

    This report covers research activities, major results and publications supported by DE-SC-000-1481. This project was funded by the DOE OFES-NNSA HEDLP program. It was a joint research program between Rice University and the University of Texas at Austin. The physics of relativistic plasmas was investigated in the context of ultra-intense laser irradiation of high-Z solid targets. Laser experiments using the Texas Petawatt Laser were performed in the summers of 2011, 2012 and 2013. Numerical simulations of laser-plasma interactions were performed using Monte Carlo and Particle-in-Cell codes to design and support these experiments. Astrophysical applications of these results were also investigated.

  10. Mean pion multiplicities in Ar+Sc collisions

    CERN Document Server

    Naskręt, Michał

    2016-01-01

    Preliminary results for mean negatively charged pion multiplicities $\\langle \\pi^- \\rangle$ using the $h^-$ method are presented for central Ar+Sc collisions at 13, 19, 30, 40, 75 and 150\\textit{A} GeV/c beam momentum. The data were recorded by the NA61/SHINE detector at the CERN SPS. Starting with rapidity distributions ${dn}/{dy}$ the procedure of obtaining total multiplicities is presented. The mean number of wounded nucleons $\\langle W\\rangle$ extracted from the Glissando MC model is used to calculate the ratio $\\langle \\pi^- \\rangle/\\langle W\\rangle.$ The results are compared to those from other experiments and their dependence on colliding systems and collision energy is discussed.

  11. Ferromagnetism carried by highly delocalized hybrid states in Sc-doped ZnO thin films

    KAUST Repository

    Benali Kanoun, Mohammed

    2012-05-29

    We present first-principles results for Sc-doped ZnOthin films. Neighboring Sc atoms in the surface and/or subsurface layers are found to be coupled ferromagnetically, where only two of the possible configurations induce spin polarization. In the first configuration, the polarization is carried by the Sc d states as expected for transition metaldoping. However, there is a second configuration which is energetically favorable. It is governed by polarized hybrid states of the Zns, O p, and Sc d orbitals. Such highly delocalized states can be an important ingredient for understanding the magnetism of dopedZnOthin films.

  12. Atomic bonding and mechanical properties of Al-Mg-Zr-Sc alloy

    Institute of Scientific and Technical Information of China (English)

    高英俊; 班冬梅; 韩永剑; 钟夏平; 刘慧

    2004-01-01

    The valence electron structures of Al-Mg alloy with minor Sc and Zr were calculated according to the empirical electron theory(EET) in solid. The results show that because of the strong interaction of Al atom with Zr and Sc atom in melting during solidification, the Al3 Sc and Al3 (Sc1-xZrx) particles which act as heterogeneous nuclear are firstly crystallized in alloy to make grains refine. In progress of solidification, the Al-Sc, Al-Zr-Sc segregation regions are formed in solid solution matrix of Al-Mg alloy owing to the strong interaction of Al atom with Zr, Scatoms in bulk of alloy, so in the following homogenization treatment, the finer dispersed Al3 Sc and Al3 (Sc1-x Zrx) second-particles which are coherence with the matrix are precipitated in the segregation region. These finer second particles with the strong Al-Zr, Al-Sc covalent bonds can strengthen the covalent bonds in matrix of the alloy, and also enhance the hardness and strength of Al-Mg alloy. Those finer second-particles precipitated in interface of sub-grains can also strengthen the covalence bonds there, and effectively hinder the interface of sub-grains from migrating and restrain the sub-grains from growing, and cause better thermal stability of Al-Mg alloy.

  13. Model of Dees and Rotco for the 600 MeV SC

    CERN Multimedia

    CERN PhotoLab

    1978-01-01

    The accelerating frequency of the 600 MeV Synchro-Cyclotron (SC) was modulated by the varying capacity of a rotating condenser ("Rotco", the most delicate component of the SC). A 1/5-scale model, dating from the design-period of the SC, was used to study improvements to the SC RF-system, and also the acceleration of ions, first Helium and, at the time of this picture, Carbon. In the middle of the picture is the case containing the Dees. To the left, at the wide end of the cone, a rotco. Reinhold Hohbach is busy with measurements. See also 7805235 (Annual Report 1978, p.110).

  14. Nuclear Level Density and Gamma-Ray Strength Function of 43Sc

    CERN Document Server

    Bürger, A; Hilaire, S; Guttormsen, M; Harissopulos, S; Kmiecik, M; Konstantinopoulos, T; Krticka, M; Lagoyannis, A; Lönnroth, T; Mazurek, K; Norrby, M; Nyhus, H T; Perdikakis, G; Siem, S; Spyrou, A; Syed, N U H; 10.1103/PhysRevC.85.064328

    2012-01-01

    The nuclear level density and the gamma-ray strength function have been determined for 43Sc in the energy range up to 2 MeV below the neutron separation energy using the Oslo method with the 46Ti(p,alpha)43Sc reaction. A comparison to 45Sc shows that the level density of 43Sc is smaller by an approximately constant factor of two. This behaviour is well reproduced in a microscopical/combinatorial model calculation. The gamma-ray strength function is showing an increase at low gamma-ray energies, a feature which has been observed in several nuclei but which still awaits theoretical explanation.

  15. Head first C#

    CERN Document Server

    Stellman, Andrew

    2008-01-01

    Head First C# is a complete learning experience for object-oriented programming, C#, and the Visual Studio IDE. Built for your brain, this book covers C# 3.0 and Visual Studio 2008, and teaches everything from language fundamentals to advanced topics including garbage collection, extension methods, and double-buffered animation. You'll also master C#'s hottest and newest syntax, LINQ, for querying SQL databases, .NET collections, and XML documents. By the time you're through, you'll be a proficient C# programmer, designing and coding large-scale applications. Every few chapters you will come

  16. Head first C#

    CERN Document Server

    Stellman, Andrew

    2010-01-01

    You want to learn C# programming, but you're not sure you want to suffer through another tedious technical book. You're in luck: Head First C# introduces this language in a fun, visual way. You'll quickly learn everything from creating your first program to learning sophisticated coding skills with C# 4.0, Visual Studio 2010 and .NET 4, while avoiding common errors that frustrate many students. The second edition offers several hands-on labs along the way to help you build and test programs using skills you've learned up to that point. In the final lab, you'll put everything together. From o

  17. Head First Python

    CERN Document Server

    Barry, Paul

    2010-01-01

    Ever wished you could learn Python from a book? Head First Python is a complete learning experience for Python that helps you learn the language through a unique method that goes beyond syntax and how-to manuals, helping you understand how to be a great Python programmer. You'll quickly learn the language's fundamentals, then move onto persistence, exception handling, web development, SQLite, data wrangling, and Google App Engine. You'll also learn how to write mobile apps for Android, all thanks to the power that Python gives you. We think your time is too valuable to waste struggling with

  18. Head First Web Design

    CERN Document Server

    Watrall, Ethan

    2008-01-01

    Want to know how to make your pages look beautiful, communicate your message effectively, guide visitors through your website with ease, and get everything approved by the accessibility and usability police at the same time? Head First Web Design is your ticket to mastering all of these complex topics, and understanding what's really going on in the world of web design. Whether you're building a personal blog or a corporate website, there's a lot more to web design than div's and CSS selectors, but what do you really need to know? With this book, you'll learn the secrets of designing effecti

  19. Head First Mobile Web

    CERN Document Server

    Gardner, Lyza; Grigsby, Jason

    2011-01-01

    Despite the huge number of mobile devices and apps in use today, your business still needs a website. You just need it to be mobile. Head First Mobile Web walks you through the process of making a conventional website work on a variety smartphones and tablets. Put your JavaScript, CSS media query, and HTML5 skills to work-then optimize your site to perform its best in the demanding mobile market. Along the way, you'll discover how to adapt your business strategy to target specific devices. Navigate the increasingly complex mobile landscapeTake both technical and strategic approaches to mobile

  20. Baculovirus display of single chain antibody (scFv using a novel signal peptide

    Directory of Open Access Journals (Sweden)

    Gonzalez Gaëlle

    2010-11-01

    Full Text Available Abstract Background Cells permissive to virus can become refractory to viral replication upon intracellular expression of single chain fragment variable (scFv antibodies directed towards viral structural or regulatory proteins, or virus-coded enzymes. For example, an intrabody derived from MH-SVM33, a monoclonal antibody against a conserved C-terminal epitope of the HIV-1 matrix protein (MAp17, was found to exert an inhibitory effect on HIV-1 replication. Results Two versions of MH-SVM33-derived scFv were constructed in recombinant baculoviruses (BVs and expressed in BV-infected Sf9 cells, N-myristoylation-competent scFvG2/p17 and N-myristoylation-incompetent scFvE2/p17 protein, both carrying a C-terminal HA tag. ScFvG2/p17 expression resulted in an insoluble, membrane-associated protein, whereas scFvE2/p17 was recovered in both soluble and membrane-incorporated forms. When coexpressed with the HIV-1 Pr55Gag precursor, scFvG2/p17 and scFvE2/p17 did not show any detectable negative effect on virus-like particle (VLP assembly and egress, and both failed to be encapsidated in VLP. However, soluble scFvE2/p17 isolated from Sf9 cell lysates was capable of binding to its specific antigen, in the form of a synthetic p17 peptide or as Gag polyprotein-embedded epitope. Significant amounts of scFvE2/p17 were released in the extracellular medium of BV-infected cells in high-molecular weight, pelletable form. This particulate form corresponded to BV particles displaying scFvE2/p17 molecules, inserted into the BV envelope via the scFv N-terminal region. The BV-displayed scFvE2/p17 molecules were found to be immunologically functional, as they reacted with the C-terminal epitope of MAp17. Fusion of the N-terminal 18 amino acid residues from the scFvE2/p17 sequence (N18E2 to another scFv recognizing CD147 (scFv-M6-1B9 conferred the property of BV-display to the resulting chimeric scFv-N18E2/M6. Conclusion Expression of scFvE2/p17 in insect cells using a BV

  1. Landscapes of Santa Rosa Island, Channel Islands National Park, California

    Science.gov (United States)

    Schumann, R. Randall; Minor, Scott A.; Muhs, Daniel R.; Pigati, Jeffery S.

    2014-01-01

    Santa Rosa Island (SRI) is the second-largest of the California Channel Islands. It is one of 4 east–west aligned islands forming the northern Channel Islands chain, and one of the 5 islands in Channel Islands National Park. The landforms, and collections of landforms called landscapes, of Santa Rosa Island have been created by tectonic uplift and faulting, rising and falling sea level, landslides, erosion and deposition, floods, and droughts. Landscape features, and areas delineating groups of related features on Santa Rosa Island, are mapped, classified, and described in this paper. Notable landscapes on the island include beaches, coastal plains formed on marine terraces, sand dunes, and sand sheets. In this study, the inland physiography has been classified into 4 areas based on relief and degree of fluvial dissection. Most of the larger streams on the island occupy broad valleys that have been filled with alluvium and later incised to form steep- to vertical-walled arroyos, or barrancas, leaving a relict floodplain above the present channel. A better understanding of the processes and mechanisms that created these landscapes enhances visitors’ enjoyment of their surroundings and contributes to improving land and resource management strategies in order to optimize and balance the multiple goals of conservation, preservation, restoration, and visitor experience.

  2. Production of single chain Fab (scFab fragments in Bacillus megaterium

    Directory of Open Access Journals (Sweden)

    Dübel Stefan

    2007-11-01

    Full Text Available Abstract Background The demand on antigen binding reagents in research, diagnostics and therapy raises questions for novel antibody formats as well as appropriate production systems. Recently, the novel single chain Fab (scFab antibody format combining properties of single chain Fv (scFv and Fab fragments was produced in the Gram-negative bacterium Escherichia coli. In this study we evaluated the Gram-positive bacterium Bacillus megaterium for the recombinant production of scFab and scFvs in comparison to E. coli. Results The lysozyme specific D1.3 scFab was produced in B. megaterium and E. coli. The total yield of the scFab after purification obtained from the periplasmic fraction and culture supernatant of E. coli was slightly higher than that obtained from culture supernatant of B. megaterium. However, the yield of functional scFab determined by analyzing the antigen binding activity was equally in both production systems. Furthermore, a scFv fragment with specificity for the human C reactive protein was produced in B. megaterium. The total yield of the anti-CRP scFv produced in B. megaterium was slightly lower compared to E. coli, whereas the specific activity of the purified scFvs produced in B. megaterium was higher compared to E. coli. Conclusion B. megaterium allows the secretory production of antibody fragments including the novel scFab antibody format. The yield and quality of functional antibody fragment is comparable to the periplasmic production in E. coli.

  3. Expression and bioactivity identification of soluble MG7 scFv

    Institute of Scientific and Technical Information of China (English)

    Zhao-Cai Yu; Jie Ding; Bo-Rong Pan; Dai-Ming Fan; Xue-Yong Zhang

    2002-01-01

    AIM: To examine the molecular mass and identify thebioactivity of MG7 scFv for its application as a targetingmediator in gene therapy of gastric cancer.METHODS: Two strongly positive recombinant phage clonesscreened from MG7 recombinant phage antibody library wereseparately transfected into E. coli TG1. Plasmid wasisolated from the transfected E. coli TG1 and digested byEcoR Ⅰ and Hind Ⅲ to examine the length of exogenousscFv gene. Then, the positive recombinant phage cloneswere individually transfected into E. coli HB2151. Thetransfectant was cultured and induced by IPTG. Perplasmicextracts was prepared from the induced transfectant byosmotic shock. ELISA was used to examine the antigen-binding affinity of the soluble MG7 scFv. Immunodottingassay was adopted to evaluate the yield of soluble MG7 scFvproduced by transfected E. coli HB2151. Western blot wasused to examine the molecular mass of MG7 scFv. Finally,the nucleotide sequence of MG7 scFv was examined by DNAsequencing.RESULTS: Two positive recombinant phage clones werefound to contain the exogenous scFv gene. ELISA showedthat MG7 scFv had strong antigen-binding affinity.Immuodotting assay showed that transfected E. coli HB2151could successfully produce the soluble MG7 scFv with highyield via induction by IPTG. The molecular mass of MG7scFv was 30 kDa by western blot. DNA sequencingdemonstrated that the VH and VL genes of MG7 scFv were363bp and 321 bp, respectively.CONCLUSION: We have successfully developed the solubleMG7 scFv which possessed strong antigen-binding affinity.

  4. DOE Zero Energy Ready Home Case Study: Amerisips Homes — Miller-Bloch Residence, Johns Island, SC

    Energy Technology Data Exchange (ETDEWEB)

    none,

    2014-09-01

    For this DOE Zero Energy Ready Home that won a Custom Builder award in the 2014 Housing Innovation Awards, the builder uses structural insulated panels to construct the entire building shell, including the roof, walls, and floor of the home.

  5. NiO-ScSZ and Ni 0.9Mg 0.1O-ScSZ-based anodes under internal dry reforming of simulated biogas mixtures

    Science.gov (United States)

    Shiratori, Y.; Sasaki, K.

    Solid oxide fuel cells (SOFCs) with NiO-ScSZ and Ni 0.9Mg 0.1O-ScSZ-based anodes were operated by directly feeding a fuel mixture of CH 4, CO 2 and N 2 (CH 4 to CO 2 ratio of 3:2). Stable operation under constant current load (200 mA cm -2) was achieved with a NiO-ScSZ type anode during 200 h operating hours at 900 °C. Less stable operation occurred with a Ni 0.9Mg 0.1O-ScSZ type anode. In the case of SOFC with Ni 0.9Mg 0.1O-ScSZ as the anode, the methane reforming activity was higher than that with NiO-ScSZ. This was explained by change in the microstructure promoting reforming reactions. However, the addition of MgO resulted in degradation of electrochemical performance due to increase in ohmic resistance of the anode material during operation.

  6. Mauritius - a Sustainable Island

    DEFF Research Database (Denmark)

    Larsen, Anders

    2010-01-01

    The Government of Mauritius has a long-term vision of transforming Mauritius into a sustainable Island. One important element towards the achievement of this vision is to increase the country's renewable energy usage and thereby reducing dependence on fossil fuels. Democratisation of energy produ...... production via SSDG. Furthermore, the paper gives an update on the implementation in Mauritius of the proposed incentives.......The Government of Mauritius has a long-term vision of transforming Mauritius into a sustainable Island. One important element towards the achievement of this vision is to increase the country's renewable energy usage and thereby reducing dependence on fossil fuels. Democratisation of energy...... production is determined to be the way forward. A step in this direction is to devolve upon citizens the ability and motivation to produce electricity via small-scale distributed generation (SSDG), i.e. wind, photovoltaic and hydro installations below 50 kW. Given that SSDG is more expensive per installed...

  7. Island solution; Inselloesung

    Energy Technology Data Exchange (ETDEWEB)

    Bah, Isaac

    2013-06-15

    On the Azores island Graciosa the Berlin-based company Younicos has installed a new electricity system with advanced storage technology, which will make the islanders independent from fossil fuels. With an energy mix of wind power, photovoltaics and biomass the dependence on fossil fuels should be terminated. In the center of the flagship project specifically developed hybrid batteries are used (combination of sodium-sulfur- and lithium-ion batteries) with 2.7 MW of power and a storage capacity of ten megawatts hours. [German] Auf der Azoren-Insel Graciosa installiert das Berliner Unternehmen Younicos ein neues Stromsystem mit modernster Speichertechnologie, das die Bewohner unabhaengig von fossilen Energietraegern machen soll. Mit einem Energiemix aus Windkraft, Photovoltaik und Biomasse soll die Abhaengigkeit von fossilen Brennstoffen beendet werden. Im Zentrum des Vorzeigeprojekts stehen speziell fuer den Inseleinsatz entwickelte Hybridbatterien (Kombination aus Natrium-Schwefel- und Lithium-Ionen-Akkus) mit 2,7 Megawatt Leistung und eine Speicherkapazitaet von zehn Megawattestunden.

  8. Urban heat island 1

    DEFF Research Database (Denmark)

    Bühler, Oliver; Jensen, Marina Bergen; Petersen, Karen Sejr

    2010-01-01

    Urban Heat Island beskriver det forhold, at temperaturen i byområder er højere end temperaturen i tilgrænsede landområder. Årsagen hertil ligger i den urbane arealanvendelse, hvor en mindre andel af arealerne er dækket af vegetation, og en større andel består af forseglede arealer....

  9. [Salmonella pathogenicity islands].

    Science.gov (United States)

    Sırıken, Belgin

    2013-01-01

    Salmonella species are facultative intracellular pathogenic bacteria. They can invade macrophages, dendritic and epithelial cells. The responsible virulence genes for invasion, survival, and extraintestinal spread are located in Salmonella pathogenicity islands (SPIs). SPIs are thought to be acquired by horizontal gene transfer. Some of the SPIs are conserved throughout the Salmonella genus, and some of them are specific for certain serovars. There are differences between Salmonella serotypes in terms of adaptation to host cell, virulence factors and the resulting infection according to SPA presence and characteristics. The most important Salmonella virulence gene clusters are located in 12 pathogenicity islands. Virulence genes that are involved in the intestinal phase of infection are located in SPI-1 and SPI-2 and the remaining SPIs are required for intracellular survival, fimbrial expression, magnesium and iron uptake, multiple antibiotic resistance and the development of systemic infections. In addition SPIs, Sigma ss (RpoS) factors and adaptive acid tolerance response (ATR) are the other two important virulence factors. RpoS and ATR found in virulent Salmonella strains help the bacteria to survive under inappropriate conditions such as gastric acidity, bile salts, inadequate oxygen concentration, lack of nutrients, antimicrobial peptides, mucus and natural microbiota and also to live in phagosomes or phagolysosomes. This review article summarizes the data related to pathogenicity islands in Salmonella serotypes and some factors which play role in the regulation of virulence genes.

  10. Cushion plants as islands.

    Science.gov (United States)

    Tepedino, V J; Stanton, N L

    1976-09-01

    The acarine fauna of two abundant species of cushion plant on the high, short-grass prairie of S.E. Wyoming were used to test The MacArthur-Wilson Theory of Island Biogeography. Multiple regression analysis using area, distance and percent moisture as independent variables and number of mite species and number of mite individuals were run for the two sampling dates. Results showed area alone to be consistently and highly correlated (r=0.84-0.94) with both species and individuals for one cushion species. The slopes of the species-area and individuals-area curves are among the highest recorded and were significantly higher on the second sampling date. Selective seasonal changes in the fauna were shown by increases both in numbers of species and individuals, mainly on larger cushions, for the later sampling period. It is hypothesized that seasonal changes are due to an increase in the number of predator species in response to an increase in the number of prey items. The slopes of the species-area curves are compared with those in the literature and it is argued that slope values are more dependent upon the taxonomic group being studied than on whether the island is insular or oceanic. Finally, we suggest that The MacArthur-Wilson Theory is not applicable to islands which 1) exhibit continuous growth, 2) lack a discrete species source, and 3) are relatively transitory.

  11. Islands of the Arctic

    Science.gov (United States)

    Overpeck, Jonathan

    2004-02-01

    Few environments on Earth are changing more dramatically than the Arctic. Sea ice retreat and thinning is unprecedented in the period of the satellite record. Surface air temperatures are the warmest in centuries. The biology of Arctic lakes is changing like never before in millennia. Everything is pointing to the meltdown predicted by climate model simulations for the next 100 years. At the same time, the Arctic remains one of the most pristine and beautiful places on Earth. For both those who know the Arctic and those who want to know it, this book is worth its modest price. There is much more to the Arctic than its islands, but there's little doubt that Greenland and the major northern archipelagos can serve as a great introduction to the environment and magnificence of the Arctic. The book uses the islands of the Arctic to give a good introduction to what the Arctic environment is all about. The first chapter sets the stage with an overview of the geography of the Arctic islands, and this is followed by chapters that cover many key aspects of the Arctic: the geology (origins), weather and climate, glaciers, ice sheets, sea ice, permafrost and other frozen ground issues, coasts, rivers, lakes, animals, people, and environmental impacts. The material is pitched at a level well suited for the interested layperson, but the book will also appeal to those who study the science of the Arctic.

  12. Testing the island effect on phenotypic diversification: insights from the Hemidactylus geckos of the Socotra Archipelago.

    Science.gov (United States)

    Garcia-Porta, Joan; Šmíd, Jiří; Sol, Daniel; Fasola, Mauro; Carranza, Salvador

    2016-04-13

    Island colonization is often assumed to trigger extreme levels of phenotypic diversification. Yet, empirical evidence suggests that it does not always so. In this study we test this hypothesis using a completely sampled mainland-island system, the arid clade of Hemidactylus, a group of geckos mainly distributed across Africa, Arabia and the Socotra Archipelago. To such purpose, we generated a new molecular phylogeny of the group on which we mapped body size and head proportions. We then explored whether island and continental taxa shared the same morphospace and differed in their disparities and tempos of evolution. Insular species produced the most extreme sizes of the radiation, involving accelerated rates of evolution and higher disparities compared with most (but not all) of the continental groups. In contrast, head proportions exhibited constant evolutionary rates across the radiation and similar disparities in islands compared with the continent. These results, although generally consistent with the notion that islands promote high morphological disparity, reveal at the same time a complex scenario in which different traits may experience different evolutionary patterns in the same mainland-island system and continental groups do not always present low levels of morphological diversification compared to insular groups.

  13. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... have special pediatric considerations. The teddy bear denotes child-specific content. Related Articles ... Videos related to Magnetic Resonance Imaging (MRI) - Head Sponsored ...

  14. EngenuitySC Commercialization and Entrepreneurial Training Project

    Energy Technology Data Exchange (ETDEWEB)

    Hughes, Meghan; Hutton, Katherine R

    2012-12-31

    A team led by EngenuitySC has performed education and outreach on development of advanced energy markets that will enable wider use of clean energy technologies. This report details the efforts that have made significant advances to improve the market place through education, outreach, and increased communications between industry members. The project resulted in two self-funded industry clusters known as the Fuel Cell Collaborative and NuHub. This project has focused on building and strengthening the leading clean energy clusters in South Carolina: nuclear energy and fuel cell technologies. For the nuclear industry, a new cluster was developed that is now known as NuHub. This cluster has already engaged over 25 nuclear industry leaders or suppliers, four public sector partners, six community economic development foundations, and nearly ten academic partners in a 175 mile radius between Augusta, Georgia and Charlotte, North Carolina. Our outreach has touched over 2,000 stakeholders through the website alone, not including the public audiences and members of the business community reached through news stories and releases that were distributed to over 620 print and online publications. NuHub has established a formal leadership structure, developed subcommittees to focus on industry issues, instituted educational programs for the workforce, and created an industry funding structure that will sustain the industry cluster and mission. NuHub has participated in a wide-variety of community building and outreach activities since its formation under this grant. In the two years since its creation in 2010, we have initiated efforts focused in four main areas that correlate with the four NuHub subcommittees including: innovation, workforce development, industry engagement, and marketing and communications. NuHub successfully raised over $160,000 in both public and private funding, which has supported work to grow the cluster and engage partners including NuScale, Fluor, and

  15. Final Technical Report – DOE Grant DE-SC0005904

    Energy Technology Data Exchange (ETDEWEB)

    Dear, Jody [Connecticut State Univ. System, Hartford, CT (United States)

    2013-10-23

    DOE grant DE-SC0005904 was allocated to fund the faculty development, curriculum development and travel to support the four institutions of the Connecticut State University System’s (CSUS) Initiative for Nanotechnology-related Equipment, Faculty Development and Curriculum Development. DOE grant DE-SC0005072 was also awarded for this program. In 2010, CSUS had identified the establishment of nanotechnology programs and infrastructure as a priority. At that time, the system set the goal of establishing an academic initiative in nanotechnology for the CSUS, beginning with the development of a series of courses at the graduate level. Implementation was planned via a collaborative effort including faculty from all four of the CSUS campuses. The CSUS Nanotechnology Working Group [CSUS NWG] was established to accomplish this goal. A faculty member from the Physics Department at Southern Connecticut State University [SCSU] was assigned the task of organizing and coordinating the work of the CSUS NWG. Representatives from each of the four CSUS campuses were appointed to join the CSUS NWG with the following initial representation: SCSU [Physics and Biology], Western Connecticut State University (WCSU) [Chemistry], Eastern Connecticut State University (ECSU) [Chemistry] and Central Connecticut State University (CCSU) [Chemistry. As a further outcome it was determined that this collaborative effort would lead to the establishment of a formal nanotechnology center, serving as the nucleus of CSUS student and faculty learning and research. This CSUS Nanotechnology Center [CSUS-NC] was to be located at Southern Connecticut State University (SCSU). The goal of this grant was to provide funding for curriculum and faculty development necessary to facilitate the development and implementation of a collaborative Graduate Certificate in Nanotechnology for the Connecticut State University System. This outcome has been successfully achieved. The courses and structure of the Graduate

  16. Structural and electronic studies of metal carbide clusterfullerene Sc2C2@Cs-C72

    Science.gov (United States)

    Feng, Yongqiang; Wang, Taishan; Wu, Jingyi; Feng, Lai; Xiang, Junfeng; Ma, Yihan; Zhang, Zhuxia; Jiang, Li; Shu, Chunying; Wang, Chunru

    2013-07-01

    We present a metal carbide clusterfullerene Sc2C2@Cs(10528)-C72, whose structure has been baffling for many years. A motional endohedral Sc2C2 cluster, special molecule geometry and electronic structure were found in Sc2C2@Cs(10528)-C72. The paramagnetic Sc2C2@Cs-C72 anion radical was successfully prepared by a chemical reduction method and hyperfine couplings in the ESR spectrum were observed.We present a metal carbide clusterfullerene Sc2C2@Cs(10528)-C72, whose structure has been baffling for many years. A motional endohedral Sc2C2 cluster, special molecule geometry and electronic structure were found in Sc2C2@Cs(10528)-C72. The paramagnetic Sc2C2@Cs-C72 anion radical was successfully prepared by a chemical reduction method and hyperfine couplings in the ESR spectrum were observed. Electronic supplementary information (ESI) available: Experimental details, HPLC chromatogram, and DFT calculations. CCDC 917712. For ESI and crystallographic data in CIF or other electronic format see DOI: 10.1039/c3nr01739g

  17. Implementation of LTE SC-FDMA on the USRP2 Software Defined Radio Platform

    DEFF Research Database (Denmark)

    Jørgensen, Peter Bjørn; Hansen, Thomas Lundgaard; Sørensen, Troels Bundgaard;

    2011-01-01

    In this paper we discuss the implementation of a Single Carrier Frequency Division Multiple Access (SC-FDMA) transceiver running over the Universal Software Radio Peripheral 2 (USRP2). SC-FDMA is the air interface which has been selected for the uplink in the latest Long Term Evolution (LTE...

  18. Superconductivity at 3.1 K in the orthorhombic ternary silicide ScRuSi

    Science.gov (United States)

    Ruan, Bin-Bin; Wang, Xiao-Chuan; Yu, Jia; Pan, Bo-Jin; Mu, Qing-Ge; Liu, Tong; Chen, Gen-Fu; Ren, Zhi-An

    2017-02-01

    We report the synthesis, crystal structure, superconductivity and physical property characterizations of the ternary equiatomic compound ScRuSi. Polycrystalline samples of ScRuSi were prepared by an arc-melting method. The as-prepared samples were identified as the orthorhombic Co2P-type o-ScRuSi by powder x-ray diffraction analysis. Electrical resistivity measurements show o-ScRuSi to be a metal which superconducts below a T c of 3.1 K; the upper critical field μ 0 H c2(0) is estimated to be 0.87 T. The magnetization and specific heat measurements confirm the bulk type-II superconductivity in o-ScRuSi, with a specific heat jump within the BCS weak coupling limit. o-ScRuSi is the first Co2P-type superconductor to contain scandium. After annealing at 1273 K for a week, o-ScRuSi transforms into hexagonal Fe2P-type h-ScRuSi, which is a Pauli-paramagnetic metal with no superconductivity observed above 1.8 K.

  19. Characterization of early transient accumulation of PrP(Sc) in immune cells.

    Science.gov (United States)

    Elhelaly, Abdelazim Elsayed; Inoshima, Yasuo; Ishiguro, Naotaka

    2013-09-27

    PrP(Sc) is known to elicit no specific immune response and the immune cells are suspected to support its accumulation. In the present study, we investigated the response of some immune cell types to PrP(Sc) to characterize an observed early transient accumulation of PrP(Sc). After cells were treated with PrP(Sc)-brain homogenate, PrP(Sc) was transiently accumulated for the first 8-12h post-exposure then completely cleared by the 5th day of the experiment. The accumulated PrP(Sc) was not a de novo product of the cell PrP(C). Further investigation of this phenomenon revealed some potential factors influencing it. These factors included cholesterol homeostasis, temperature, the degradation power of the cell and the availability of sufficient PrP(C). Our in vitro results suggest that immune cells, especially macrophages are potential risk factors for the accumulation and intercellular spread of PrP(Sc) if the complete clearance of PrP(Sc) were not fulfilled.

  20. 33 CFR 110.72c - Lake Murray, S.C.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Lake Murray, S.C. 110.72c Section 110.72c Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.72c Lake Murray, S.C. (a) The area beginning at the 125...

  1. Hydrogenation reactions using scCO2 as a solvent in microchannel reactors.

    Science.gov (United States)

    Kobayashi, Juta; Mori, Yuichiro; Kobayashi, Shū

    2005-05-28

    We have developed an effective microfluidic system for hydrogenation reactions in scCO(2); the reactions proceeded very rapidly (within 1 second), by making the best use of scCO(2) and utilizing the large specific interfacial area of the microchannel reactor, and high reaction productivity was attained in each channel.

  2. High-efficient physical adsorption and detection of formaldehyde using Sc- and Ti-decorated graphdiyne

    Science.gov (United States)

    Chen, Xi; Gao, Pengfei; Guo, Lei; Wen, Yanni; Fang, Dangqi; Gong, Baihua; Zhang, Yang; Zhang, Shengli

    2017-03-01

    In sensitive analysis, the ultimate limit is to achieve reliable detection on trace amount of molecules. In this work, Sc- and Ti-decorated graphdiyne were proposed as promising materials for high-efficient molecular detection. Using density functional theory calculations, we investigated the electronic response of single Sc- and Ti-atom-decorated graphdiyne to HCHO (as a typical air pollutant). Thermodynamic analysis predicted that Sc or Ti adatom could be stabilized on the corner sites of single-layer graphdiyne sheet, with migration barriers high enough to prevent Sc or Ti adatom aggregation. The adsorption of HCHO on Sc- or Ti-decorated graphdiyne was found stronger than on pristine graphene or graphdiyne, which provides a prerequisite for molecular sensing. The electronegativity of HCHO leads to strong electronic attraction from Sc or Ti adatom to HCHO, resulting in a remarkable decrease of carrier density in graphdiyne. On Ti-decorated graphdiyne, the electronic attraction of HCHO appears to be stronger than on Sc-decorated graphdiyne and changes the system from metal to n-doped semiconductor. Quantum transport calculations show a decrease of current caused by the adsorbed HCHO. The results systematically exhibit the electronic response of Sc- or Ti-decorated graphdiyne to HCHO and suggest them as promising materials for molecule detection.

  3. Curriculum (Study Programme) for the M.Sc., Medialogy, at Aalborg University in Copenhagen

    DEFF Research Database (Denmark)

    Serafin, Stefania; Nordahl, Rolf; Lavatino, Salvatore

    2004-01-01

    Defining and describing the education, M.Sc., Medialogy. The curriculum (Study Programme) describes semesters, themes, projectunits, courses and contents of the eduation. offered at Aalborg University in Copenhagen.......Defining and describing the education, M.Sc., Medialogy. The curriculum (Study Programme) describes semesters, themes, projectunits, courses and contents of the eduation. offered at Aalborg University in Copenhagen....

  4. PRODUCTION, ISOLATION AND SPECTROSCOPIC STUDIES OF THE ENDOHEDRAL FULLERENE Sc2@C80 (Ⅰ-Ⅲ)

    Institute of Scientific and Technical Information of China (English)

    Chunru Wang; Lihua Gan; Chunli Bai; Hisanori Shinohara

    2004-01-01

    The isolation of multiple-isomers of Sc2@C80 (Ⅰ, Ⅱ, Ⅲ) endohedral metallofullerenes is reported for the first time. The new C80-based Sc-metallofullerenes are characterized by UV-Vis-NIR absorption spectroscopy and detailed chromatographic retention time data. A close relationship between the isomer structure and the corresponding HPLC retention time of the metallofullerenes is presented.

  5. Establishment and characterization of Roberts syndrome and SC phocomelia model medaka (Oryzias latipes).

    Science.gov (United States)

    Morita, Akihiro; Nakahira, Kumiko; Hasegawa, Taeko; Uchida, Kaoru; Taniguchi, Yoshihito; Takeda, Shunichi; Toyoda, Atsushi; Sakaki, Yoshiyuki; Shimada, Atsuko; Takeda, Hiroyuki; Yanagihara, Itaru

    2012-06-01

    Roberts syndrome and SC phocomelia (RBS/SC) are genetic autosomal recessive syndromes caused by establishment of cohesion 1 homolog 2 ( ESCO 2) mutation. RBS/SC appear to have a variety of clinical features, even with the same mutation of the ESCO2 gene. Here, we established and genetically characterized a medaka model of RBS/SC by reverse genetics. The RBS/SC model was screened from a mutant medaka library produced by the Targeting Induced Local Lesions in Genomes method. The medaka mutant carrying the homozygous mutation at R80S in the conserved region of ESCO2 exhibited clinical variety (i.e. developmental arrest with craniofacial and chromosomal abnormalities and embryonic lethality) as characterized in RBS/SC. Moreover, widespread apoptosis and downregulation of some gene expression, including notch1a, were detected in the R80S mutant. The R80S mutant is the animal model for RBS/SC and a valuable resource that provides the opportunity to extend knowledge of ESCO2. Downregulation of some gene expression in the R80S mutant is an important clue explaining non-correlation between genotype and phenotype in RBS/SC.

  6. SC-535, a Novel Oral Multikinase Inhibitor, Showed Potent Antitumor Activity in Human Melanoma Models

    Directory of Open Access Journals (Sweden)

    Xin Chen

    2013-07-01

    Full Text Available Background: Melanoma is considered as one of the most aggressive and deadliest cancers and current targeted therapies of melanoma often suffer limited efficacy or drug resistance. Discovery of novel multikinase inhibitors as anti-melanoma drug candidates is still needed. Methods: In this investigation, we assessed the in vitro and in vivo anti-melanoma activities of SC-535, which is a novel small molecule multikinase inhibitor discovered by us recently. We analyzed inhibitory effects of SC-535 on various melanoma cell lines and human umbilical vascular endothelial cells (HUVEC in vitro. Tumor xenografts in athymic mice were used to examine the in vivo activity of SC-535. Results: SC-535 could efficiently inhibit vascular endothelial growth factor receptor (VEGFR 1/2/3, B-RAF, and C-RAF kinases. It showed significant antiangiogenic potencies both in vitro and in vivo and considerable anti-proliferative ability against several melanoma cell lines. Oral administration of SC-535 resulted in dose-dependent suppression of tumor growth in WM2664 and C32 xenograft mouse models. Studies of mechanisms of action indicated that SC-535 suppressed the tumor angiogenesis and induced G2/M phase cell cycle arrest in human melanoma cells. SC-535 possesses favorable pharmacokinetic properties. Conclusion: All of these results support SC-535 as a potential candidate for clinical studies in patients with melanoma.

  7. 33 CFR 165.708 - Safety/Security Zone; Charleston Harbor and Cooper River, Charleston, SC.

    Science.gov (United States)

    2010-07-01

    ... Harbor and Cooper River, Charleston, SC. 165.708 Section 165.708 Navigation and Navigable Waters COAST... Guard District § 165.708 Safety/Security Zone; Charleston Harbor and Cooper River, Charleston, SC. (a... Cooper River. All coordinates referenced use datum: NAD 1983. (2) All waters within 100 yards of...

  8. Spatial transformations between superior colliculus visual and motor response fields during head-unrestrained gaze shifts.

    Science.gov (United States)

    Sadeh, Morteza; Sajad, Amirsaman; Wang, Hongying; Yan, Xiaogang; Crawford, John Douglas

    2015-12-01

    We previously reported that visuomotor activity in the superior colliculus (SC)--a key midbrain structure for the generation of rapid eye movements--preferentially encodes target position relative to the eye (Te) during low-latency head-unrestrained gaze shifts (DeSouza et al., 2011). Here, we trained two monkeys to perform head-unrestrained gaze shifts after a variable post-stimulus delay (400-700 ms), to test whether temporally separated SC visual and motor responses show different spatial codes. Target positions, final gaze positions and various frames of reference (eye, head, and space) were dissociated through natural (untrained) trial-to-trial variations in behaviour. 3D eye and head orientations were recorded, and 2D response field data were fitted against multiple models by use of a statistical method reported previously (Keith et al., 2009). Of 60 neurons, 17 showed a visual response, 12 showed a motor response, and 31 showed both visual and motor responses. The combined visual response field population (n = 48) showed a significant preference for Te, which was also preferred in each visual subpopulation. In contrast, the motor response field population (n = 43) showed a preference for final (relative to initial) gaze position models, and the Te model was statistically eliminated in the motor-only population. There was also a significant shift of coding from the visual to motor response within visuomotor neurons. These data confirm that SC response fields are gaze-centred, and show a target-to-gaze transformation between visual and motor responses. Thus, visuomotor transformations can occur between, and even within, neurons within a single frame of reference and brain structure.

  9. HEADS UP: Sensorimotor control of the head-neck system

    NARCIS (Netherlands)

    Forbes, P.A.

    2014-01-01

    Head-neck stabilization is inherently challenging even when stationary, requiring constant vigilance to counter the downward pull of gravity. It involves a highly complex biomechanical system comprised of a large mass (the head) balanced on top of seven vertebrae (the neck), that are in turn connect

  10. MARICULTURE ON CROATIAN ISLANDS

    Directory of Open Access Journals (Sweden)

    Gordana Šarušić

    2000-09-01

    Full Text Available The first attempts of intensive mariculture in Croatia commenced at the very beginning of 1980’s. The mid-eighties brought an expansion of mariculture production, which has been continuously increasing. A few different marine organisms are intensively cultured - both fish and shellfish. Among them commercially most important and highly valued species are sea bass Dicentrarchus labrax and sea bream Sparus aurata. Mussel Mytilus galloprovincialis and oyster Ostrea edulis are the most important shellfish. Fish species such as dentex Dentex dentex, red sea bream Pagrus major and sheepshead bream Puntazzo puntazzo are reared too, but in a rather small quantities. Only recently the rearing, on-growing- of bluefin tuna Thunnus thynnus started in Croatia. The juveniles (70% are reared in a Croatian hatcheries, and 30% has to be imported mainly from Italy and France, due to a higher demand for this kind of culture among the small growers. Croatian part of Adriatic sea possesses a number of geomorfologicaly suitable sites and meteorological conditions which determined the choice - type - of intensive culture. All fish species are reared in a floating cages. The choice of cages i. e. semi off-shore or floating frames, size, rearing volume and design depend on the investors personal preference. The annual turnouf of a market size bass was about 600t and 300t bream in 1996., by 10 island farms which is 70% of total production in Croatia. Including other cultured fish species last year production was up to 1000t, and it™s being estimated to be about 1300t in the following year. The shellfish production on the islands is usually individual attempt of farmers, producing minor quantities mostly in polyculture. This production has bigger potential but it’s limited owing to the EU quality control regulations which do not allow the export, and by domestic market which has drastically decreased due to the collapse of tourism during the recent war. Almost 80

  11. 4SC-202 activates ASK1-dependent mitochondrial apoptosis pathway to inhibit hepatocellular carcinoma cells

    Energy Technology Data Exchange (ETDEWEB)

    Fu, Meili, E-mail: fumeilidrlinyi@tom.com [Department of Infectious Disease, Linyi People' s Hospital, Linyi 276000 (China); Wan, Fuqiang [Department of Head and Neck Surgery, Linyi Tumor Hospital, Linyi 276000 (China); Li, Zhengling [Department of Nursing, Tengzhou Central People' s Hospital, Tengzhou 277500 (China); Zhang, Fenghua [Department of Operating Room, Linyi People' s Hospital, Linyi 276000 (China)

    2016-03-04

    The aim of the present study is to investigate the potential anti-hepatocellular carcinoma (HCC) cell activity by 4SC-202, a novel class I HDAC inhibitor (HDACi). The associated signaling mechanisms were also analyzed. We showed that 4SC-202 treatment induced potent cytotoxic and proliferation–inhibitory activities against established HCC cell lines (HepG2, HepB3, SMMC-7721) and patient-derived primary HCC cells. Further, adding 4SC-202 in HCC cells activated mitochondrial apoptosis pathway, which was evidenced by mitochondrial permeability transition pore (mPTP) opening, cytochrome C cytosol release and caspase-3/-9 activation. Inhibition of this apoptosis pathway, by caspase-3/-9 inhibitors, mPTP blockers, or by shRNA-mediated knockdown of cyclophilin-D (Cyp-D, a key component of mPTP), significantly attenuated 4SC-202-induced HCC cell death and apoptosis. Reversely, over-expression of Cyp-D enhanced 4SC-202's sensitivity in HCC cells. Further studies showed that 4SC-202 induced apoptosis signal-regulating kinase 1 (ASK1) activation, causing it translocation to mitochondria and physical association with Cyp-D. This mitochondrial ASK1-Cyp-D complexation appeared required for mediating 4SC-202-induced apoptosis activation. ASK1 stable knockdown by targeted-shRNAs largely inhibited 4SC-202-induced mPTP opening, cytochrome C release, and following HCC cell apoptotic death. Together, we suggest that 4SC-202 activates ASK1-dependent mitochondrial apoptosis pathway to potently inhibit human HCC cells. - Highlights: • 4SC-202 exerts potent anti-proliferative and cytotoxic activity against established/primary HCC cells. • SC-202-induced anti-HCC cell activity relies on caspase-dependent apoptosis activation. • 4SC-202 activates Cyp-D-dependent mitochondrial apoptosis pathway in HCC cells. • 4SC-202 activates ASK1 in HCC cells, causing it translocation to mitochondria. • Mitochondrial ASK1-Cyp-D complexation mediates 4SC-202's activity in HCC cells.

  12. Effect of Sc addition on microstructure and mechanical properties of 1460 alloy

    Directory of Open Access Journals (Sweden)

    Juan Ma

    2014-02-01

    Full Text Available The effect of minor addition of Sc on microstructure, age hardening behavior, tensile properties and fracture morphology of 1460 alloy have been studied. It is found that Sc content increase from 0.11 wt% to 0.22 wt% is favorable for grain refinement in as-cast alloy but results in a coarsening of Cu-rich particles. The alloy with 0.11 wt% Sc exhibits enhanced mechanical properties and age hardening effect. Transmission electron microscopy (TEM investigations on the alloy with 0.11 wt% Sc have suggested that a large amount of Al3(Sc, Zr particles precipitated at the earlier aging may inhibit recrystallization effectively.

  13. Homogenization and Recrystallization of Al-6Mg Alloys with and without Sc and Zr

    Institute of Scientific and Technical Information of China (English)

    姜锋; 尹志民; 黄伯云; 贺跃辉; 陈苏里

    2004-01-01

    Plates of Al-6Mg alloys with and without scandium were prepared by semi-continuous cast, homogenization, hot-rolled, cold-rolled and annealing. Based on studying of effects of temperature and time on hardness and conductivity during homogenization, it was found that homogenization of ingot with Sc and Zr can result in dispersion strengthening. Recrystallization temperature of alloys was studied by hardness method and optical metallographic method. Staring recrystallization temperature of Al-6Mg alloys with Sc and Zr is 375 ℃, increasing by 150 ℃ than Al-6Mg alloys without Sc and Zr. Mechanical properties (σb, σ0.2, δ) of hot-rolled alloy with Sc and Zr are 400 MPa, 280 MPa and 18%; cold-rolled and anneal alloy with Sc and Zr are 420 MPa, 310 MPa and 12% respectively.

  14. Chryse 'Alien Head'

    Science.gov (United States)

    2005-01-01

    26 January 2004 This Mars Global Surveyor (MGS) Mars Orbiter Camera (MOC) image shows an impact crater in Chryse Planitia, not too far from the Viking 1 lander site, that to seems to resemble a bug-eyed head. The two odd depressions at the north end of the crater (the 'eyes') may have formed by wind or water erosion. This region has been modified by both processes, with water action occurring in the distant past via floods that poured across western Chryse Planitia from Maja Valles, and wind action common occurrence in more recent history. This crater is located near 22.5oN, 47.9oW. The 150 meter scale bar is about 164 yards long. Sunlight illuminates the scene from the left/lower left.

  15. NASA head sworn in

    Science.gov (United States)

    James C. Fletcher was sworn in on May 12, 1986, as administrator of the National Aeronautics and Space Administration (NASA). At a news conference after he was sworn in, Fletcher said that NASA would deal with both its technical problems and its procedural problems before the shuttle will fly again. According to press accounts, he stressed that funds should be made available to replace the Challenger orbiter, which was lost in an explosion on January 28.Fletcher, who had also headed the agency from 1971 to 1977, succeeds James M. Beggs, who was indicted in December 1985 for conspiring to defraud the federal government while serving as a senior executive at the General Dynamics Corporation.

  16. Scandium-44: benefits of a long-lived PET radionuclide available from the (44)Ti/(44)Sc generator system.

    Science.gov (United States)

    Roesch, F

    2012-07-01

    (44)Ti/(44)Sc radionuclide generators are of interest for molecular imaging. The 3.97 hours half-life of (44)Sc and its high positron branching of 94.27% may stimulate the application of (44)Sc-labeled PET radiopharmaceuticals. This review describes the current status of (44)Ti production, (44)Ti/(44)Sc radionuclide generator development, post-processing of generator eluates towards medical application, identification of ligands adequate to Sc(III) co-ordination chemistry, proof-of-principle labeling of (44)Sc-DOTA-octreotides, investigation of in vitro and in vivo parameters, and initial applications for molecular imaging - both in small animals and humans.

  17. INTERVIU CU DOAMNA SIMONA CAROBENE, ADMINISTRATORUL SC PROIECT MOZAIC SRL

    Directory of Open Access Journals (Sweden)

    Gheorghe Pascaru

    2013-12-01

    Full Text Available Fabrica de mozaic, înregistrată la Oficiul Registrului Comerţului în aprilie 2012 a luat fiinţă în cadrul unui proiect cu finanţare europeană nerambursabilă și are în prezent statutul de unitate protejată autorizată. În cadrul acesteia sunt angajați 10 tineri post instituţionalizați, pentru care integrarea în viaţa socială şi profesională este dificilă. Întreprinderea socială SC Proiect Mozaic SRL este rezultatul întâlnirii dintre sectorul social, non-profit şi sectorul business, deoarece are la bază un parteneriat cu un important grup de firme din domeniul construcţiilor şi amenajărilor interioare din București. În paralel cu activitatea de producţie a mozaicului, ocazional, Proiect Mozaic oferă către clienți și servicii de ambalare și asamblare produse.

  18. Preliminary Tests Of The Decris-sc Ion Source

    CERN Document Server

    Efremov, A; Bechterev, V; Bogomolov, S L; Bondarenko, P G; Datskov, V I; Dmitriev, S; Drobin, V; Lebedev, A; Leporis, M; Malinowski, H; Nikiforov, A; Paschenko, S V; Seleznev, V; Shishov, Yu A; Smirnov, Yu; Tsvineva, G; Yakovlev, B; Yazvitsky, N Yu

    2004-01-01

    A new "liquid He-free" superconducting Electron Cyclotron Resonance Ion Source DECRIS-SC, to be used as injector for the IC-100 small cyclotron, has been designed by FLNR and LHE JINR. The main feature is that a compact refrigerator of Gifford-McMahon type is used to cool the solenoid coils. For the reason of very small cooling power at 4.2 K (about 1 W) our efforts were to optimize the magnetic structure and minimize an external heating of the coils. The maximum magnetic field strength is 3 T and 2 T in injection and extraction region respectively. For the radial plasma confinement a hexapole made of NdFeB permanent magnet is used. The source will be capable of ECR plasma heating using different frequencies (14 GHz or 18 GHz). To be able to deliver usable intensities of solids, the design is also allow axial access for evaporation oven and metal samples using the plasma sputtering technique. Very preliminary results of the source test are presented.

  19. Spectrophotometric Distances to Galactic H\\,{\\sc{ii}} Regions

    CERN Document Server

    Moisés, A P; Figuerêdo, E; Blum, R D; Conti, P S; Barbosa, C L

    2010-01-01

    We present a near infrared study of the stellar content of 35 H\\,{\\sc{ii}} regions in the Galactic plane. In this work, we have used the near infrared domain $J-$, $H-$ and $K_{s}-$ band color images to visually inspect the sample. Also, color-color and color-magnitude diagrams were used to indicate ionizing star candidates, as well as, the presence of young stellar objects such as classical TTauri Stars (CTTS) and massive young stellar objects (MYSOs). We have obtained {\\it Spitzer} IRAC images for each region to help further characterize them. {\\it Spitzer} and near infrared morphology to place each cluster in an evolutionary phase of development. {\\it Spitzer} photometry was also used to classify the MYSOs. Comparison of the main sequence in color-magnitude diagrams to each observed cluster was used to infer whether or not the cluster kinematic distance is consistent with brightnesses of the stellar sources. We find qualitative agreement for a dozen of the regions, but about half the regions have near infr...

  20. Transition energy and oscillator strength of Sc18+ion

    Institute of Scientific and Technical Information of China (English)

    Wang Zhi-Wen; Yang Di; Hu Mu-Hong; Han Qiu-Ju; Li Jin-Ying

    2005-01-01

    The transition energies and the dipole oscillator strengths for the 1s22s-1s2np (2 ≤ n ≤ 9) and 1s22p-1s2nd (3≤n ≤ 9) of lithium-like Sc18+ ion are calculated by using the full core plus correlation method. The fine structure splittings of 1s2np and 1s2nd (n ≤ 9) states are determined from the expectation values of spin-orbit and spin-otherorbit interaction operators. The quantum defects of these series, as function of principal quantum number n, are obtained. The agreement between the f-values obtained from three alternative formulae is excellent. Comparisons of our results with experimental data available in the literature are carried out. Combining the single-channel quantum defect theory with the discrete oscillator strengths obtained in this work, this paper obtains the behaviour of discrete oscillator strengths and oscillator strength densities corresponding to the bound-free transitions adjacent to ionization threshold.

  1. Final Technical Report for DE-SC0012297

    Energy Technology Data Exchange (ETDEWEB)

    Dell' Antonio, Ian [Brown Univ., Providence, RI (United States)

    2017-08-01

    This is the final report on the work performed in award DE-SC0012297, Cosmic Frontier work in support of the LSST Dark Energy Science Collaboration's work to develop algorithms, simulations, and statistical tests to ensure optimal extraction of the dark energy properties from galaxy clusters observed with LSST. This work focused on effects that could produce a systematic error on the measurement of cluster masses (that will be used to probe the effects of dark energy on the growth of structure). These effects stem from the deviations from pure ellipticity of the gravitational lensing signal and from the blending of light of neighboring galaxies. Both these effects are expected to be more significant for LSST than for the stage III experiments such as the Dark Energy Survey. We calculate the magnitude of the mass error (or bias) for the first time and demonstrate that it can be treated as a multiplicative correction and calibrated out, allowing mass measurements of clusters from gravitational lensing to meet the requirements of LSST's dark energy investigation.

  2. Domain structure and phase transition in Sc-doped zirconia

    Energy Technology Data Exchange (ETDEWEB)

    Brunauer, G.; Boysen, H.; Frey, F. [Institute for Crystallography und Applied Mineralogy, LMU Muenchen, Munich (Germany); Ehrenberg, H. [Institute for Materials Science, TU Darmstadt, Darmstadt (Germany)

    2002-01-21

    The temperature dependence of the domain structure associated with the ferroelastic phase transition (Fm{sup 3-bar}m{r_reversible}R{sup 3-bar}m) in ZrO{sub 2} doped with 11% Sc{sub 2}O{sub 3} has been determined from a peak shape analysis of high-resolution synchrotron x-ray powder diffraction data. In the temperature region of coexisting phases the observed characteristic anisotropic broadening and asymmetry of the lines is modelled by three different phases: a main rhombohedral phase, a distorted rhombohedral phase with a smaller c/a ratio, and a cubic phase. The latter two are assigned to the internal structure of the domain walls between two adjacent twin domains. The size and amount of the cubic phase show an initially slow increase with temperature followed by a very steep increase and a slow one after that. The size of the (main) rhombohedral domains remains nearly constant, while (micro-) strain in the distorted regions gradually decreases. (author)

  3. Post-Heading Heat Stress in Rice of South China during 1981-2010.

    Science.gov (United States)

    Shi, Peihua; Tang, Liang; Wang, Lihuan; Sun, Ting; Liu, Leilei; Cao, Weixing; Zhu, Yan

    2015-01-01

    Frequent extreme heat events are the serious threat to rice production, but the historical trend of heat stress associated with phenology shift and its impact on rice yield over a long period are poorly known. Based on the analysis of observed climate and phenology data from 228 stations in South China during 1981-2010, the spatio-temporal variation of post-heading heat stress was investigated among two single-season rice sub-regions in the northern Middle and Lower Reaches of Yangtze River (S-NMLYtz) and Southwest Plateau (S-SWP), and two double-season early rice sub-regions in the southern Middle and Lower Reaches of Yangtze River (DE-SMLYtz) and Southern China (DE-SC). Post-heading heat stress was more severe in DE-SMLYtz, west S-NMLYtz and east S-SWP than elsewhere, because of rice exposure to the hot season during post-heading stage. The spatial variation of post-heading heat stress was greater in single-season rice region than in double-season early rice region due to the greater spatial variation of heading and maturity dates. Post-heading heat stress increased from 1981 to 2010 in most areas, with significant increases in the east of double-season early rice region and west S-SWP. Phenology shift during 1981-2010 mitigated the increasing trends of heat stress in most areas, but not in west S-SWP. Post-heading heat stress played a dominated role in the reduction of rice yield in South China. Grain yield was more sensitive to post-heading heat stress in double-season early rice region than that in single-season rice region. Rice yield decreased by 1.5%, 6.2%, 9.7% and 4.6% in S-NMLYtz, S-SWP, DE-SMLYtz and DE-SC, respectively, because of post-heading heat stress during 1981-2010, although there were some uncertainties. Given the current level and potential increase of post-heading heat stress in South China, the specific adaptation or mitigation strategies are necessary for different sub-regions to stabilize rice production under heat stress.

  4. Post-Heading Heat Stress in Rice of South China during 1981-2010.

    Directory of Open Access Journals (Sweden)

    Peihua Shi

    Full Text Available Frequent extreme heat events are the serious threat to rice production, but the historical trend of heat stress associated with phenology shift and its impact on rice yield over a long period are poorly known. Based on the analysis of observed climate and phenology data from 228 stations in South China during 1981-2010, the spatio-temporal variation of post-heading heat stress was investigated among two single-season rice sub-regions in the northern Middle and Lower Reaches of Yangtze River (S-NMLYtz and Southwest Plateau (S-SWP, and two double-season early rice sub-regions in the southern Middle and Lower Reaches of Yangtze River (DE-SMLYtz and Southern China (DE-SC. Post-heading heat stress was more severe in DE-SMLYtz, west S-NMLYtz and east S-SWP than elsewhere, because of rice exposure to the hot season during post-heading stage. The spatial variation of post-heading heat stress was greater in single-season rice region than in double-season early rice region due to the greater spatial variation of heading and maturity dates. Post-heading heat stress increased from 1981 to 2010 in most areas, with significant increases in the east of double-season early rice region and west S-SWP. Phenology shift during 1981-2010 mitigated the increasing trends of heat stress in most areas, but not in west S-SWP. Post-heading heat stress played a dominated role in the reduction of rice yield in South China. Grain yield was more sensitive to post-heading heat stress in double-season early rice region than that in single-season rice region. Rice yield decreased by 1.5%, 6.2%, 9.7% and 4.6% in S-NMLYtz, S-SWP, DE-SMLYtz and DE-SC, respectively, because of post-heading heat stress during 1981-2010, although there were some uncertainties. Given the current level and potential increase of post-heading heat stress in South China, the specific adaptation or mitigation strategies are necessary for different sub-regions to stabilize rice production under heat stress.

  5. Demographic Ageing on Croatian Islands

    Directory of Open Access Journals (Sweden)

    Ivo Nejašmić

    2013-08-01

    Full Text Available This paper analyses the changes in the population structure of the Croatian islands by age, warns of the degree of ageing, provides spatial differentiation of this process and presents perspective of ageing at the level of settlement. Typing of population ageing is based on scores and has seven types. The total island population in 2011 belongs to the type 5 – very old population. Almost a half of the settlements (out of 303 have been affected by the highest levels of ageing (types 6 and 7. It was found that a quarter of island settlements will become “dead villages” in a foreseeable future; most of them are on small islands but also in the interior of larger islands. These are villages decaying in every respect, in which the way of life, as we know it, veins and goes out. The present ageing villagers are their last residents in most cases. Eve¬rything suggests that demographic recovery of the islands is not possible with the forces in situ. It is important to strike a balance between the needs and opportunities in order to successfully organize life on the islands, both small and large ones, and the fact is that there is a continuing disparity, which is especially profound in small islands. A sensitive and selective approach is needed to overcome the unfavourable demographic trends. Therefore it is necessary to respect the particularities of indi¬vidual islands and island groups in devising development strategy. Solutions to the problems must come of the local and wider community in synergy with relevant professional and scientific institutions. However, if the solutions are not found or measures do not give results, if the islands are left to desorganisation and senilisation, a part of the islands will become a wasteland. With regard to the value of this area whose wealth are people in the first place, this would be an intolerable civilization decline.

  6. Island biodiversity conservation needs palaeoecology

    DEFF Research Database (Denmark)

    Nogué, Sandra; de Nascimento, Lea; Froyd, Cynthia A.

    2017-01-01

    The discovery and colonization of islands by humans has invariably resulted in their widespread ecological transformation. The small and isolated populations of many island taxa, and their evolution in the absence of humans and their introduced taxa, mean that they are particularly vulnerable to ...... and the introduction of non-native species. We provide exemplification of how such approaches can provide valuable information for biodiversity conservation managers of island ecosystems....

  7. Late colonization of Easter Island.

    Science.gov (United States)

    Hunt, Terry L; Lipo, Carl P

    2006-03-17

    Easter Island (Rapa Nui) provides a model of human-induced environmental degradation. A reliable chronology is central to understanding the cultural, ecological, and demographic processes involved. Radiocarbon dates for the earliest stratigraphic layers at Anakena, Easter Island, and analysis of previous radiocarbon dates imply that the island was colonized late, about 1200 A.D. Substantial ecological impacts and major cultural investments in monumental architecture and statuary thus began soon after initial settlement.

  8. Downregulation of the Musca domestica peptidoglycan recognition protein SC (PGRP-SC) leads to overexpression of antimicrobial peptides and tardy pupation.

    Science.gov (United States)

    Gao, Yifu; Tang, Ting; Gu, Jihai; Sun, Lingling; Gao, Xiaobin; Ma, Xianyong; Wang, Xiaochun; Liu, Fengsong; Wang, Jianhui

    2015-10-01

    PGRP (peptidoglycan recognition protein) is a conserved protein family that recognizes the peptidoglycan in bacterial cell wall and causes the activation of various innate immune responses. Previous studies have reported that PGRP-SCs in Drosophila dampen the activation of Immune Deficiency (Imd) pathway to microbial infection, and participate in the lifespan extension of the insects. To facilitate understanding the function of PGRP-SCs from an evolutionary angle, we identified and functionally characterized the PGRP-SC gene in the housefly Musca domestica, a species that has adapted to a septic environment much harsher than the natural habitat of Drosophila. The gene designated as MdPGRP-SC was found most abundantly expressed in the 3rd instar larvae, and is expressed at this developmental stage predominantly in the gut. MdPGRP-SC was virtually unchanged in whole larvae after a septic injury at the second larval instar, while two antimicrobial peptides (AMPs), diptericin and attacin, were upregulated in the first 24h but not later. Through dsRNA microinjection, MdPGRP-SC was knocked down by RNA interference (RNAi), and caused the significant increased expression of diptericin and attacin. The pupation of MdPGRP-SC-depleted larvae was severely suppressed compared to controls. Opposite to the expression trend of MdPGRP-SC, a spontaneous active expression of diptericin and attacin was found in pre-pupae but not in third instar larvae. Taken together, our study reveals that downregulation of MdPGRP-SC leads to the overexpression of the AMPs, and is involved in the larvae-to-pupa transition of housefly.

  9. Island mass effect in the Juan Fernández Archipelago (33°S), Southeastern Pacific

    Science.gov (United States)

    Andrade, Isabel; Sangrà, Pablo; Hormazabal, Samuel; Correa-Ramirez, Marco

    2014-02-01

    Spatial and temporal variability of the island mass effect (IME; defined as local increases of phytoplankton associated with the presence of islands) at the Juan Fernández Archipelago (JFA) is analyzed using chlorophyll-a (Chl-a) satellite data, altimetry, sea surface temperature, wind, geostrophic currents and net heat flux over a ten year period (2002-2012). The the JFA islands (Robinson Crusoe-Santa Clara (RC-SC) and Alejandro Selkirk (AS)) present wakes with significant Chl-a increases, mainly during spring time. These wakes can reach Chl-a values of one order of magnitude higher (~1 mg m-3) than the surrounding oligotrophic waters (<0.1 mg m-3). The wakes are similar to von Kármán vortex streets which have been used to explain the impact of IME on Chl-a increases in numerical models. The wakes are formed from a high productivity area in the lee of the island, extending to the oceanic region as high Chl-a patches associated with submesoscale eddies that are detached from the islands and connected by less-productive zones. This pattern coincides with previous models that predict the effects of island-generated flow perturbations on biological production variability. The IME is a recurrent feature of islands that has even been observed in decadal average fields. In such average fields, the Chl-a values in RC-SC and AS islands can exceed values found in a Control Zone (a zone without islands) by ~50% and 30%, respectively. Seasonal and interannual variability reveals that, as a consequence of the IME, the winter Chl-a maximum associated with the development of winter convection and mesoscale eddies that propagate from the continental zone, promote that the Chl-a maximum extends towards spring. The IME has an impact on the island on both a local as well as a more regional scale that affects an area of ~40,000 km2 (1°Latitude×4°Longitude) centered on the islands. The transport of high productivity patches associated with submesoscale eddies may be responsible

  10. The head-mounted microscope.

    Science.gov (United States)

    Chen, Ting; Dailey, Seth H; Naze, Sawyer A; Jiang, Jack J

    2012-04-01

    Microsurgical equipment has greatly advanced since the inception of the microscope into the operating room. These advancements have allowed for superior surgical precision and better post-operative results. This study focuses on the use of the Leica HM500 head-mounted microscope for the operating phonosurgeon. The head-mounted microscope has an optical zoom from 2× to 9× and provides a working distance from 300 mm to 700 mm. The headpiece, with its articulated eyepieces, adjusts easily to head shape and circumference, and offers a focus function, which is either automatic or manually controlled. We performed five microlaryngoscopic operations utilizing the head-mounted microscope with successful results. By creating a more ergonomically favorable operating posture, a surgeon may be able to obtain greater precision and success in phonomicrosurgery. Phonomicrosurgery requires the precise manipulation of long-handled cantilevered instruments through the narrow bore of a laryngoscope. The head-mounted microscope shortens the working distance compared with a stand microscope, thereby increasing arm stability, which may improve surgical precision. Also, the head-mounted design permits flexibility in head position, enabling operator comfort, and delaying musculoskeletal fatigue. A head-mounted microscope decreases the working distance and provides better ergonomics in laryngoscopic microsurgery. These advances provide the potential to promote precision in phonomicrosurgery. Copyright © 2011 The American Laryngological, Rhinological, and Otological Society, Inc.

  11. Eye-based head gestures

    DEFF Research Database (Denmark)

    Mardanbegi, Diako; Witzner Hansen, Dan; Pederson, Thomas

    2012-01-01

    A novel method for video-based head gesture recognition using eye information by an eye tracker has been proposed. The method uses a combination of gaze and eye movement to infer head gestures. Compared to other gesture-based methods a major advantage of the method is that the user keeps the gaze...

  12. Kansas: Early Head Start Initiative

    Science.gov (United States)

    Center for Law and Social Policy, Inc. (CLASP), 2012

    2012-01-01

    Kansas Early Head Start (KEHS) provides comprehensive services following federal Head Start Program Performance Standards for pregnant women and eligible families with children from birth to age 4. KEHS was implemented in 1998 using Child Care and Development Block Grant (CCDBG) quality set-aside dollars augmented by a transfer of federal…

  13. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... bear denotes child-specific content. Related Articles and Media MR Angiography (MRA) Magnetic Resonance, Functional (fMRI) - Brain Head and Neck Cancer Treatment Brain Tumor Treatment Magnetic Resonance Imaging (MRI) Safety Alzheimer's Disease Head Injury Brain Tumors Images related to Magnetic ...

  14. Clinical trials in head injury

    NARCIS (Netherlands)

    Narayan, RK; Michel, ME

    2002-01-01

    Traumatic brain injury (TBI) remains a major public health problem globally. In the United States the incidence of closed head injuries admitted to hospitals is conservatively estimated to be 200 per 100,000 population, and the incidence of penetrating head injury is estimated to be 12 per 100,000,

  15. Renewable energy islands in Europe

    Energy Technology Data Exchange (ETDEWEB)

    Oestergaard, Iben [ed.

    1998-12-31

    This publication includes a compiled presentation of various aspects concerning the possible transformation of some European islands into renewable energy communities and these projects were presented by a selection of pioneer islands at the first European Seminar on Renewable Energy Islands, held on the Danish island of Samsoee, 29-30 June 1998. This issue has increased in importance with the presentation of the ambitious EU-White Paper: `Energy for the future: Renewable Sources of Energy` which was adopted in 1998. One of the key elements of the strategy for an accelerated implementation of renewable energy is to transform 100 localities within Europe into communities which are to be 100% self-sufficient with renewable energy before 2010. In line with this strategy, the Danish Government appointed the island of Samsoe towards the end of 1997 to be the first `official` Danish, renewable energy island. This is to serve as a demonstration project for other local communities, both in Denmark as well as in the rest Europe. Gothland, Madeira, Canary Islands, Cape Verde, Arki, Crete, Minorca and Orkney Islands were represented. Environmental advantages of wind, solar and wave power for distant island communities were indicated. Serious savings would be achieved by limitation of fossil fuel import and utilization of local resources. (EG)

  16. Avance normativo del SC 8 de AENOR “Conservación, restauración y rehabilitación de edificios” = Standardisation Advance of AENOR SC 8 “Conservation, Restoration and Rehabilitation of Buildings”

    OpenAIRE

    Recopar, Editor

    2014-01-01

    Avance normativo del SC 8 de AENOR “Conservación, restauración y rehabilitación de edificios” = Standardisation Advance of AENOR SC 8 “Conservation, Restoration and Rehabilitation of Buildings”

  17. Radiolabeling of DOTATOC with the long-lived positron emitter {sup 44}Sc

    Energy Technology Data Exchange (ETDEWEB)

    Pruszynski, Marek; Majkowska-Pilip, Agnieszka [Centre of Radiochemistry and Nuclear Chemistry, Institute of Nuclear Chemistry and Technology, Dorodna 16, 03-195 Warszawa (Poland); Loktionova, Natalia S.; Eppard, Elisabeth [Institute of Nuclear Chemistry, Johannes Gutenberg-University of Mainz, Fritz-Strassmann-Weg 2, D-55128 Mainz (Germany); Roesch, Frank, E-mail: frank.roesch@uni-mainz.de [Institute of Nuclear Chemistry, Johannes Gutenberg-University of Mainz, Fritz-Strassmann-Weg 2, D-55128 Mainz (Germany)

    2012-06-15

    The positron-emitting radionuclide {sup 44}Sc with a half-life of 3.97 h and a {beta}{sup +} branching of 94.3% is of potential interest for clinical PET. As so far it is available from a {sup 44}Ti/{sup 44}Sc generator in Mainz, where long-lived {sup 44}Ti decays to no-carrier-added (nca) {sup 44}Sc. The {sup 44}Sc is a trivalent metal cation and should be suitable for complexation with many well established bifunctional chelators conjugated to peptides or other molecular targeting vectors. Thus, the aim of this work was to investigate the potential of {sup 44}Sc for labeling of DOTA-conjugated peptides. DOTA-D-Phe{sup 1}-Tyr{sup 3}-octreotide (DOTATOC) was used as a model molecule to study and optimize labeling procedure. Reaction parameters such as buffer conditions, concentration of peptide, pH range, reaction temperature and time were optimized. Addition of 21 nmol of DOTATOC to {sup 44}Sc in ammonium acetate buffer pH 4.0 provided labeling yields >98% within 25 min of heating in an oil-bath at 95 Degree-Sign C. This time can be reduced to 3 min only by applying microwave supported heating. {sup 44}Sc-DOTATOC was found to be stable in 0.9% NaCl, PBS pH 7.4, fetal calf and human serums, and also in the presence of competing metal cations (Fe{sup 3+}, Ca{sup 2+}, Cu{sup 2+}, Mg{sup 2+}), as well as other ligand competitors, like EDTA and DTPA, even after almost 25 h incubation at 37 Degree-Sign C. Present study shows that nca {sup 44}Sc forms stable complexes with the macrocyclic ligand DOTA and that {sup 44}Sc-DOTATOC and analog targeting vectors may be synthesized for further preclinical and clinical investigations. - Highlights: Black-Right-Pointing-Pointer Labeling of somatostatin analouges with positron emitter {sup 44}Sc was tested. Black-Right-Pointing-Pointer DOTATOC was labeled with {sup 44}Sc isotope. Black-Right-Pointing-Pointer Optimal conditions for {sup 44}Sc-DOTATOC synthesis were found. Black-Right-Pointing-Pointer Stability of {sup 44}Sc

  18. 超导ECR离子源DECRIS-SC2%Project of the Superconducting ECR Ion Source DECRIS-SC2

    Institute of Scientific and Technical Information of China (English)

    V.V.Bekhterev; V.V.Seleznev; A.Shishov; G.P.Tsvineva; N.YU.Yazvitsky; B.I.Yakovlev; S.L.Bogomolov; V.I.Datskov; V.M.Drobin; S.N.Dmitriev; A.A.Efremov; V.N.Loginov; A.N.Lebedev; H.Malinowski

    2007-01-01

    A new compact version of the"liquid He-free"superconducting Electron Cyclotron Resonance Ion Source,to be used as an injector for the U-400M cyclotron,is presently under construction at the FLNR in collaboration with LHE(JINR).The axial magnetic field of the source is created by the superconducting magnet,and the NdFeB hexapole is used for the radial plasma confinement.The microwave frequency of 14GHz will be used for ECR plasma heating.The DECRIS-SC2 superconducting magnet is designed for the induction of a magnetic field on the axis of the source of up to 1.4T (extraction side) and 1.9T (injection side) at nominal current of 75A.Cooling of the coils is carried out by GM cryocooler with cooling power of 1W at the temperature 4.5K.The basic design features of the superconducting magnet and of the ion source are presented.The main parts of the source are in production.The first beam test of the source is expected in the beginning of 2007.

  19. A {sup 44}Ti/{sup 44}Sc radionuclide generator for potential application of {sup 44}Sc-based PET-radiopharmaceuticals

    Energy Technology Data Exchange (ETDEWEB)

    Filosofov, D.V. [Joint Institute of Nuclear Research, Dubna (Russian Federation). DLNP; Loktionova, N.S.; Roesch, F. [University of Mainz (Germany). Institute of Nuclear Chemistry

    2010-07-01

    {sup 44}Ti/{sup 44}Sc radionuclide generators are of interest for molecular imaging. The 3.97 h half-life of {sup 44}Sc and its high positron branching of 94% may stimulate the application of {sup 44}Sc labelled PET radiopharmaceuticals. However, both {sup 44}Ti production and {sup 44}Ti/{sup 44}Sc generator design represent challenges for basic radiochemistry. About 5 mCi (185 MBq) of {sup 44}Ti were obtained via the Sc(p, 2n) nuclear reaction. {sup 44}Ti was separated from 1.5 g of massive scandium targets in multi-step procedures, including exchange chromatography on cation exchange resin (AG 50W-X8, 200-400 mesh, H{sup +}-form). In order to design a robust {sup 44}Ti/{sup 44}Sc generator concept, distribution coefficients of Ti(IV) and Sc(III) on both AG 1-X8 (200-400 mesh, Cl{sup -}-form) and AG 50W-X8 (200-400 mesh, H{sup +}-form) resins eluted with HCl and HCl/H{sub 2}C{sub 2}O{sub 4} solution of various concentrations were investigated systematically. Optimal conditions for efficient separations of both radionuclides have been determined for AG 1-X8 resin and mixtures of 0.07 M HCl and 0.005 M H{sub 2}C{sub 2}O{sub 4}. A 5 mCi generator was prepared on an AG 1-X8 column (H=150 mm, D=3 mm, V{sub 0}=0.55 mL). The system achieved elution of 180 MBq {sup 44}Sc in 20 mL of eluate solution. The breakthrough of {sup 44}Ti is 90 Bq. This corresponds to an excellent separation factor of 2 x 10{sup 6}. In the context of long-term stability of {sup 44}Ti/{sup 44}Sc generators, a ''reverse'' type of washing steps after each elution using 0.07 M HCl/0.005 M H{sub 2}C{sub 2}O{sub 4} mixtures appeared to be essential. (orig.)

  20. Islands and non-islands in native and heritage Korean

    Directory of Open Access Journals (Sweden)

    Boyoung eKim

    2016-02-01

    Full Text Available To a large extent, island phenomena are cross-linguistically invariable, but English and Korean present some striking differences in this domain. English has wh-movement and Korean does not, and while both languages show sensitivity to wh-islands, only English has island effects for adjunct clauses. Given this complex set of differences, one might expect Korean/English bilinguals, and especially heritage Korean speakers (i.e. early bilinguals whose L2 became their dominant language during childhood to be different from native speakers, since heritage speakers have had more limited exposure to Korean, may have had incomplete acquisition and/or attrition, and may show significant transfer effects from the L2. Here we examine islands in heritage speakers of Korean in the U.S. Through a series of four formal acceptability experiments comparing these heritage speakers with native speakers residing in Korea, we show that the two groups are remarkably similar. Both show clear evidence for wh-islands and an equally clear lack of adjunct island effects. Given the very different linguistic environment that the heritage speakers have had since early childhood, this result lends support to the idea that island phenomena are largely immune to environmental influences and stem from deeper properties of the processor and/or grammar. Similarly, it casts some doubt on recent proposals that islands are learned from the input.

  1. Seabirds of Easter Island, Salas y Gómez Island and Desventuradas Islands, southeastern Pacific Ocean

    OpenAIRE

    Flores,Marcelo A; Roberto P Schlatter; Rodrigo Hucke-Gaete

    2014-01-01

    We reviewed available information on seabirds inhabiting Easter Island, Salas y Gómez Island and Desventuradas Islands and their adjacent waters through an analysis of published and grey literature. Results obtained indicate that a total of 37 species are present in the study area and that, among the orders represented, the Procellariiformes and Charadriiformes are the dominant taxa (29 species). Moreover, the family Procellariidae is represented by 13 species and Laridae by 7 species. There ...

  2. The submental island flap.

    Science.gov (United States)

    Sterne, G D; Januszkiewicz, J S; Hall, P N; Bardsley, A F

    1996-03-01

    The submental island flap is a reliable source of skin of excellent colour, contour and texture match for facial resurfacing and leaves a well hidden donor site. The flap is safe, rapid and simple to raise. We report on its use in 12 cases of facial or intraoral reconstruction. Complications were few. However, there was one case of complete flap loss following its use in a reverse flow manner, due to the presence of an unreported, but constant, valve in the venous system of the face. We believe this flap to be a worthwhile addition to the existing surgical armamentarium.

  3. Organizations as Designed Islands

    Directory of Open Access Journals (Sweden)

    Pasquale Gagliardi

    2009-05-01

    Full Text Available The literature and practice of organizational design are mostly based on simplistic conceptions which ignore recent theoretical developments in organizational studies. Conceiving of organizations as ‘designed islands’, it is argued, can contribute to a more solid theoretical foundation to organization theory, viewed as normative science. Relying on the work of Peter Sloterdijk, who describes the forms of life in space in terms of spheres, the heuristic power of the island metaphor is explored. What can be learnt from the art of isolating in order to construct lived organizational environments is then discussed, and the paradoxical relationship between connection and isolation is highlighted.

  4. Pine Island Glacier, Antarctica

    Science.gov (United States)

    2001-01-01

    This pair of MISR images of the Pine Island Glacier in western Antarctica was acquired on December 12, 2000 during Terra orbit 5246. At left is a conventional, true-color image from the downward-looking (nadir) camera. The false-color image at right is a composite of red band data taken by the MISR forward 60-degree, nadir, and aftward 60-degree cameras, displayed in red, green, and blue colors, respectively. Color variations in the left (true-color) image highlight spectral differences. In the multi-angle composite, on the other hand, color variations act as a proxy for differences in the angular reflectance properties of the scene. In this representation, clouds show up as light purple. Blue to orange gradations on the surface indicate a transition in ice texture from smooth to rough. For example, the bright orange 'carrot-like' features are rough crevasses on the glacier's tongue. In the conventional nadir view, the blue ice labeled 'rough crevasses' and 'smooth blue ice' exhibit similar coloration, but the multi-angle composite reveals their different textures, with the smoother ice appearing dark purple instead of orange. This could be an indicator of different mechanisms by which this ice is exposed. The multi-angle view also reveals subtle roughness variations on the frozen sea ice between the glacier and the open water in Pine Island Bay.To the left of the 'icebergs' label are chunks of floating ice. Additionally, smaller icebergs embedded in the frozen sea ice are visible below and to the right of the label. These small icebergs are associated with dark streaks. Analysis of the illumination geometry suggests that these streaks are surface features, not shadows. Wind-driven motion and thinning of the sea ice in the vicinity of the icebergs is one possible explanation.Recently, Robert Bindschadler, a glaciologist at the NASA Goddard Space Flight Center discovered in Landsat 7 imagery a newly-formed crack traversing the Pine Island Glacier. This crack is

  5. Turbidity Current Head Mixing

    Science.gov (United States)

    Hernandez, David; Sanchez, Miguel Angel; Medina, Pablo

    2010-05-01

    A laboratory experimental set - up for studying the behaviour of sediment in presence of a turbulent field with zero mean flow is compared with the behaviour of turbidity currents [1] . Particular interest is shown on the initiation of sediment motion and in the sediment lift - off. The behaviour of the turbidity current in a flat ground is compared with the zero mean flow oscilating grid generated turbulence as when wave flow lifts off suspended sediments [2,3]. Some examples of the results obtained with this set-up relating the height of the head of the turbidity current to the equilibrium level of stirred lutoclines are shown. A turbulent velocity u' lower than that estimated by the Shield diagram is required to start sediment motion. The minimum u' required to start sediment lift - off, is a function of sediment size, cohesivity and resting time. The lutocline height depends on u', and the vorticity at the lutocline seems constant for a fixed sediment size [1,3]. Combining grid stirring and turbidty current head shapes analyzed by means of advanced image analysis, sediment vertical fluxes and settling speeds can be measured [4,5]. [1] D. Hernandez Turbulent structure of turbidity currents and sediment transport Ms Thesis ETSECCPB, UPC. Barcelona 2009. [2] A. Sánchez-Arcilla; A. Rodríguez; J.C. Santás; J.M. Redondo; V. Gracia; R. K'Osyan; S. Kuznetsov; C. Mösso. Delta'96 Surf-zone and nearshore measurements at the Ebro Delta. A: International Conference on Coastal Research through large Scale Experiments (Coastal Dynamics '97). University of Plymouth, 1997, p. 186-187. [3] P. Medina, M. A. Sánchez and J. M. Redondo. Grid stirred turbulence: applications to the initiation of sediment motion and lift-off studies Physics and Chemistry of the Earth, Part B: Hydrology, Oceans and Atmosphere. 26, Issue 4, 2001, Pages 299-304 [4] M.O. Bezerra, M. Diez, C. Medeiros, A. Rodriguez, E. Bahia., A. Sanchez-Arcilla and J.M. Redondo. Study on the influence of waves on

  6. Authenticated, private, and secured smart cards (APS-SC)

    Science.gov (United States)

    Szu, Harold; Mehmood, Amir

    2006-04-01

    From historical perspective, the recent advancements in better antenna designs, low power circuitry integrations and inexpensive fabrication materials have made possible a miniature counter-measure against Radar, a clutter behaving like a fake target return called Digital Reflection Frequency Modulation (DRFM). Such a military counter-measure have found its way in the commerce as a near field communication known as Radio Frequency Identification (RFID), a passive or active item tag T attached to every readable-writable Smart Card (SC): Passports ID, medical patient ID, biometric ID, driver licenses, book ID, library ID, etc. These avalanche phenomena may be due to the 3 rd Gen phones seeking much more versatile & inexpensive interfaces, than the line-of-sight bar-code optical scan. Despite of the popularity of RFID, the lacking of Authenticity, Privacy and Security (APS) protection restricted somewhat the wide spread commercial, financial, medical, legal, and militarily applications. Conventional APS approach can obfuscate a private passkey K of SC with the tag number T or the reader number R, or both, i.e. only T*K or R*K or both will appear on them, where * denotes an invertible operation, e.g. EXOR, but not limited to it. Then, only the authentic owner, knowing all, can inverse the operation, e.g. EXOR*EXOR= I to find K. However, such an encryption could be easily compromised by a hacker seeking exhaustively by comparison based on those frequently used words. Nevertheless, knowing biological wetware lesson for power of pairs sensors and Radar hardware counter-measure history, we can counter the counter-measure DRFM, instead using one RFID tag per SD, we follow the Nature adopting two ears/tags, e.g. each one holding portions of the ID or simply two different ID's readable only by different modes of the interrogating reader, followed by brain central processor in terms of nonlinear invertible shufflers mixing two ID bits. We prefer to adopt such a hardware

  7. Asthma and Native Hawaiians/Pacific Islanders

    Science.gov (United States)

    ... Population Profiles > Native Hawaiian/Other Pacific Islander > Asthma Asthma and Native Hawaiians/Pacific Islanders Native Hawaiians/Pacific Islanders are 70 percent more likely to have asthma as non-Hispanic whites. National data for this ...

  8. Stroke and Native Hawaiians/Pacific Islanders

    Science.gov (United States)

    ... Population Profiles > Native Hawaiian/Other Pacific Islander > Stroke Stroke and Native Hawaiians/Pacific Islanders Native Hawaiians/Pacific ... non-Hispanic white adults to die from a stroke in 2010. In general, Native Hawaiian/Pacific Islander ...

  9. Rain on small tropical islands

    Science.gov (United States)

    Sobel, A. H.; Burleyson, C. D.; Yuter, S. E.

    2011-04-01

    A high-resolution rainfall climatology based on observations from the Tropical Rainfall Measuring Mission's Precipitation Radar (PR) instrument is used to evaluate the influence of small tropical islands on climatological rainfall. Islands with areas between one hundred and several thousand km2 are considered in both the Indo-Pacific Maritime Continent and Caribbean regions. Annual mean climatological (1997-2007) rainfall over each island is compared with that over the surrounding ocean region, and the difference is expressed as a percentage. In addition to total rainfall, rain frequency and intensity are also analyzed. Results are stratified into two 12 h halves of the diurnal cycle as well as eight 3 h periods, and also by a measure of each island's topographic relief. In both regions, there is a clear difference between larger islands (areas of a few hundred km2 or greater) and smaller ones. Both rain frequency and total rainfall are significantly enhanced over larger islands compared to the surrounding ocean. For smaller islands the enhancement is either negligibly small, statistically insignificant, or, in the case of Caribbean rain frequency, negative. The enhancement in total rainfall over larger islands is partly attributable to greater frequency and partly to greater intensity. A diurnal cycle in island enhancement is evident in frequency but not intensity, except over small Caribbean islands where the converse is true. For the larger islands, higher orography is associated with greater rainfall enhancements. The orographic effect is larger (percentagewise) in the Caribbean than in the Maritime Continent. Orographic precipitation enhancement manifests more strongly as increased frequency of precipitation rather than increased intensity and is present at night as well as during the day. The lack of a clear diurnal cycle in orographic enhancement suggests that much of the orographic rainfall enhancement is attributable to mechanically forced upslope flow

  10. Synthesis and Isolation of the Titanium-Scandium Endohedral Fullerenes-Sc2 TiC@Ih -C80 , Sc2 TiC@D5h -C80 and Sc2 TiC2 @Ih -C80 : Metal Size Tuning of the Ti(IV) /Ti(III) Redox Potentials.

    Science.gov (United States)

    Junghans, Katrin; Ghiassi, Kamran B; Samoylova, Nataliya A; Deng, Qingming; Rosenkranz, Marco; Olmstead, Marilyn M; Balch, Alan L; Popov, Alexey A

    2016-09-05

    The formation of endohedral metallofullerenes (EMFs) in an electric arc is reported for the mixed-metal Sc-Ti system utilizing methane as a reactive gas. Comparison of these results with those from the Sc/CH4 and Ti/CH4 systems as well as syntheses without methane revealed a strong mutual influence of all key components on the product distribution. Whereas a methane atmosphere alone suppresses the formation of empty cage fullerenes, the Ti/CH4 system forms mainly empty cage fullerenes. In contrast, the main fullerene products in the Sc/CH4 system are Sc4 C2 @C80 (the most abundant EMF from this synthesis), Sc3 C2 @C80 , isomers of Sc2 C2 @C82 , and the family Sc2 C2 n (2 n=74, 76, 82, 86, 90, etc.), as well as Sc3 CH@C80 . The Sc-Ti/CH4 system produces the mixed-metal Sc2 TiC@C2 n (2 n=68, 78, 80) and Sc2 TiC2 @C2 n (2 n=80) clusterfullerene families. The molecular structures of the new, transition-metal-containing endohedral fullerenes, Sc2 TiC@Ih -C80 , Sc2 TiC@D5h -C80 , and Sc2 TiC2 @Ih -C80 , were characterized by NMR spectroscopy. The structure of Sc2 TiC@Ih -C80 was also determined by single-crystal X-ray diffraction, which demonstrated the presence of a short Ti=C double bond. Both Sc2 TiC- and Sc2 TiC2 -containing clusterfullerenes have Ti-localized LUMOs. Encapsulation of the redox-active Ti ion inside the fullerene cage enables analysis of the cluster-cage strain in the endohedral fullerenes through electrochemical measurements.

  11. Compuestos perazufrados de platino(II) con ditioéteres y tiolatos fluorados. Estructuras cristalinas de [Pt(SC6F5)2 (p-C6H4FSCH2CH2-p-SC6H4F)], [Pt(p-SC6HF4)...

    OpenAIRE

    Jorge Bautista; Agusti Bertran; Sylvain Bernès; Ubaldo Duran; Hugo Torrens

    2003-01-01

    En este articulo se describen la síntesis y caracterización de los compuestos cis-[PtCl2(RfSCH2CH2SRf)], Rf = C6F5, p-SC6HF4, o-SC6H4F, m-SC6H4F, p-SC6H4F, m-SC6H4(CF3), y las reacciones de estos compuestos con (SC6F5)– y (p-SC6HF4)– que generan cis- [Pt(SC6F5)2(RfSCH2CH2SRf)] y cis-[Pt(p-SC6HF4) 2(RfSCH2CH2 SRf)], Rf = o-SC6H4F, m-SC6H4F, p-SC6H4F, m-SC6H4(CF3). Para estos compuestos, los datos de RMN de 19F obtenidos a diferentes temperaturas, muestran la presencia e interconversion de isóm...

  12. One-neutron knockout from {sup 51-55}Sc

    Energy Technology Data Exchange (ETDEWEB)

    Schwertel, S.; Maierbeck, P.; Gernhaeuser, R.; Bildstein, V.; Boehmer, M.; Eppinger, K.; Faestermann, T.; Friese, J.; Fabbietti, L.; Maier, L.; Winkler, S. [Technische Universitaet Muenchen, Physik Department E12, Garching (Germany); Kruecken, R. [Technische Universitaet Muenchen, Physik Department E12, Garching (Germany); TRIUMF, Vancouver (Canada); University of British Columbia, Department of Physics and Astronomy, Vancouver (Canada); Kroell, T. [Technische Universitaet Muenchen, Physik Department E12, Garching (Germany); Technische Universitaet Darmstadt, Institut fuer Kernphysik, Darmstadt (Germany); Alvarez-Pol, H.; Benjamim, E.A.; Benlliure, J.; Caamano, M.; Cortina-Gil, D.; Gascon, M.; Kurtukian, T.; Perez, D.; Rodriguez-Tajes, C. [Universidade de Santiago de Compostela, Departamento de Fisica de Particulas, Santiago de Compostela (Spain); Aksouh, F.; Aumann, T.; Behr, K.; Boretzky, K.; Bruenle, A.; Chatillon, A.; Chulkov, L.V.; Geissel, H.; Gerl, J.; Gorska, M.; Kojouharov, I.; Klimkiewicz, A.; Kurz, N.; Nociforo, C.; Schaffner, H.; Simon, H.; Stanoiu, M.; Suemmerer, K.; Weick, H. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Borge, M.J.G.; Pascual-Izarra, C.; Perea, A.; Tengblad, O. [CSIC, Instituto de Estructura de la Materia, Madrid (Spain); Buerger, A. [University of Oslo, SAFE/OCL, Oslo (Norway); CEA, Gif-sur-Yvette (France); Casarejos, E.; Brown, B.A. [University of Vigo, Vigo (Spain); Enders, J.; Schrieder, G. [Technische Universitaet Darmstadt, Institut fuer Kernphysik, Darmstadt (Germany); Hansen, P.G. [Michigan State University, NSCL, East Lansing, Michigan (United States); Jonson, B.; Nyman, G. [Chalmers Tekniska Hoegskola och Goeteborgs Universitet, Experimentell Fysik, Goeteborg (Sweden); Kanungo, R. [TRIUMF, Vancouver (Canada); GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Saint Mary' s University, Halifax (Canada); Kiselev, O. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Johannes Gutenberg Universitaet, Mainz (Germany); Paul Scherrer Institut, Villigen (Switzerland); Larsson, K. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Chalmers Tekniska Hoegskola och Goeteborgs Universitet, Experimentell Fysik, Goeteborg (Sweden); Le Bleis, T. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); IN2P3-CNRS/Universite Louis Pasteur, Institut Pluridisciplinaire Hubert Curien, Strasbourg Cedex 2 (France); Mahata, K. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Paul Scherrer Institut, Villigen (Switzerland); Nilsson, T. [Technische Universitaet Darmstadt, Institut fuer Kernphysik, Darmstadt (Germany); Chalmers Tekniska Hoegskola och Goeteborgs Universitet, Experimentell Fysik, Goeteborg (Sweden); Prochazka, A. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Comenius University, Faculty of Mathematics and Physics, Bratislava (Slovakia); Rossi, D. [Johannes Gutenberg Universitaet, Mainz (Germany); Sitar, B. [Comenius University, Faculty of Mathematics and Physics, Bratislava (Slovakia); Otsuka, T. [University of Tokyo, Hongo, Bunkyo-ku, Department of Physics, Tokyo (Japan); Tostevin, J.A. [University of Surrey, Department of Physics, Faculty of Engineering and Physical Sciences, Guildford (United Kingdom); Rae, W.D.M. [Garsington, Oxfordshire (United Kingdom)

    2012-12-15

    Results are presented from a one-neutron knockout experiment at relativistic energies of {approx} 420 A MeV on {sup 51-55}Sc using the GSI Fragment Separator as a two-stage magnetic spectrometer and the MINIBALL array for gamma-ray detection. Inclusive longitudinal momentum distributions and cross-sections were measured enabling the determination of the contributions corresponding to knockout from the {nu}p{sub 1/2}, {nu}p{sub 3/2}, (L = 1) and {nu}f{sub 7/2}, {nu}f{sub 5/2} (L = 3) neutron orbitals. The observed L = 1 and L = 3 contributions are compared with theoretical cross-sections using eikonal knockout theory and spectroscopic factors from shell model calculations using the GXPF1A interaction. The measured inclusive knockout cross-sections generally follow the trends expected theoretically and given by the spectroscopic strength predicted from the shell model calculations. However, the deduced L = 1 cross-sections are generally 30-40% higher while the L = 3 contributions are about a factor of two smaller than predicted. This points to a promotion of neutrons from the {nu}f{sub 7/2} to the {nu}p{sub 3/2} orbital indicating a weakening of the N = 28 shell gap in these nuclei. While this is not predicted for the phenomenological GXPF1A interaction such a weakening is predicted by recent calculations using realistic low-momentum interactions V{sub low} {sub k} obtained by evolving a chiral N3LO nucleon-nucleon potential. (orig.)

  13. Validity evaluation of Sc x Al1-x N material constants based on SAW characteristics

    Science.gov (United States)

    Tang, Gongbin; Han, Tao; Zhang, Qiaozhen; Yamazaki, Kenta; Omori, Tatsuya; Hashimoto, Ken-ya

    2016-11-01

    This paper is aimed at examining the validity of material constants reported for use in surface acoustic wave (SAW) device simulations. First, based on the full set of material constants calculated by first principle, bulk acoustic wave velocities are calculated for Sc x Al1-x N and compared with published experimental results. Then, the effects of the Sc x Al1-x N material constants with different Sc content on acoustic characteristics are calculated and the influence of shear vibrations on SAW characteristics are recognized. Then, a series of SAW devices are fabricated on Sc x Al1-x N film/Si substrate structure with various Cu and ScAlN thicknesses h Cu and h ScAlN, respectively, and measured variations of phase velocity V and effective electromechanical coupling factor K\\text{e}2 with these parameters are compared with the calculation. The fairly well-agreed results indicate a reliable set of Sc x Al1-x N material constants for SAW device simulations.

  14. Production, purification, and characterization of scFv TNF ligand fusion proteins.

    Science.gov (United States)

    Fick, Andrea; Wyzgol, Agnes; Wajant, Harald

    2012-01-01

    Single-chain variable fragments (scFvs) specific for tumor-associated cell surface antigens are the most broadly used reagents to direct therapeutic or diagnostic effector molecules, such as toxins, radioisotopes, and CD3-stimulating scFvs, to tumors. One novel class of effector molecules that can be targeted to tumors by scFvs are ligands of the tumor necrosis factor (TNF) family. Typically, these molecules have apoptosis inducing and/or immune stimulating properties and are therefore highly attractive for cancer treatment. N-terminal fusion of scFvs does not interfere with the receptor binding capabilities of TNF ligands and thus allows the straightforward generation of scFv TNF ligand fusion proteins. We report here a protocol for the purification of eukaryotically produced scFv TNF ligand fusion proteins based on affinity chromatography on anti-Flag agarose and further describe assays for the determination of the targeting index of this type of scFv-targeted proteins.

  15. Differential dynamics of splicing factor SC35 during the cell cycle

    Indian Academy of Sciences (India)

    Kaushlendra Tripathi; Veena K Parnaik

    2008-09-01

    Pre-mRNA splicing factors are enriched in nuclear domains termed interchromatin granule clusters or nuclear speckles. During mitosis, nuclear speckles are disassembled by metaphase and reassembled in telophase in structures termed mitotic interchromatin granules (MIGs). We analysed the dynamics of the splicing factor SC35 in interphase and mitotic cells. In HeLa cells expressing green fluorescent protein (GFP)-SC35, this was localized in speckles during interphase and dispersed in metaphase. In telophase, GFP-SC35 was highly enriched within telophase nuclei and also detected in MIGs. Fluorescence recovery after photobleaching (FRAP) experiments revealed that the mobility of GFP-SC35 was distinct in different mitotic compartments. Interestingly, the mobility of GFP-SC35 was 3-fold higher in the cytoplasm of metaphase cells compared with interphase speckles, the nucleoplasm or MIGs. Treatment of cells with inhibitors of cyclin-dependent kinases (cdks) caused changes in the organization of nuclear compartments such as nuclear speckles and nucleoli, with corresponding changes in the mobility of GFP-SC35 and GFP-fibrillarin. Our results suggest that the dynamics of SC35 are significantly influenced by the organization of the compartment in which it is localized during the cell cycle.

  16. Growth and Holographic Storage Properties of Sc, Fe Co-Doped Lithium Niobate Crystals

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    The holographic storage properties of Fe (0.03% (mass fraction) Fe2O3):LiNbO3 doped with Sc at different levels (0, 1%, 2%, 3%) were investigated.The Sc threshold concentration in Fe:LiNbO3 was implied to be about 3%(mole fraction) because O-H vibration absorption peak of Sc (3%):Fe:LiNbO3 was at 3508 cm-1, compared with 3484 cm-1 of crystals with lower Sc doping level.Sc(3%):Fe:LiNbO3 exhibited higher optical damage resistance ability.The threshold intensity (wavelength 488 nm) of Sc (3%):Fe:LiNbO3 was 2.2×102 W·cm-2, two orders of magnitude higher than that of Fe:LiNbO3.Holographic storage properties of the crystals were determined in an extraordinary polarized laser of wavelength 632.8 nm by a two-wave coupling method.It was found that in terms of holographic storage properties, the optimal doping concentration of Sc was 2%(mole fraction) among this crystal series.

  17. CERN Technical Training 2004: New Short Courses (SC) on Microsoft Outlook

    CERN Multimedia

    Monique Duval

    2004-01-01

    The CERN Technical Training programme is now proposing a new format for courses on Microsoft Outlook. Three two-hours Short Courses (SC) will cover basic and advanced functionalities of the recommended mail client for email at CERN. Each module can be followed independently. The next scheduled sessions will take place as follows: Outlook (SC I): E-mail. Next session: 31.8.2004 (9h00-11h00) Outlook (SC II): Calendar, Tasks and Notes. Next session: 31.8.2004 (14h00-16h00) Outlook (SC III): Meetings and Delegation. Next session: 7.9.2004 (14h00-16h00) In particular, SC I will cover how to open, create and send email, work with attachments, use stationery, organise mail, and work with the address book, SC II will show how to work with the calendar, tasks and notes, and SC III will cover how to organise and manage meetings, work with meeting requests, share tasks, and use email and calendar delegation. The number of participants to each session is limited to 8. The instructor is English-French bilingual, and she...

  18. CERN Technical Training 2004: New Short Courses (SC) on Microsoft Outlook

    CERN Multimedia

    Monique Duval

    2004-01-01

    The CERN Technical Training programme is now proposing a new format for courses on Microsoft Outlook. Three two-hours Short Courses (SC) will cover basic and advanced functionalities of the recommended mail client for email at CERN. Each module can be followed independently. The next scheduled sessions will take place as follows: Outlook (SC I): E-mail. Next session: 22.10.2004 (9h00-11h00) Outlook (SC II): Calendar, Tasks and Notes. Next session: 22.10.2004 (14h00-16h00) Outlook (SC III): Meetings and Delegation. Next session: 9.11.2004 (14h00-16h00) In particular, SC I will cover how to open, create and send email, work with attachments, use stationery, organise mail, and work with the address book, SC II will show how to work with the calendar, tasks and notes, and SC III will cover how to organise and manage meetings, work with meeting requests, share tasks, and use email and calendar delegation. The number of participants to each session is limited to 8. The instructor is English-French bilingual, and...

  19. Technical Training: CERN Technical Training 2004 - New Short Courses (SC) on Microsoft Outlook

    CERN Multimedia

    Monique Duval

    2004-01-01

    The CERN Technical Training programme is now proposing a new format for courses on Microsoft Outlook. Three two-hours Short Courses (SC) will cover basic and advanced functionalities of the recommended mail client for email at CERN. Each module can be followed independently. The next scheduled sessions will take place as follows: Outlook (SC I): E-mail. Next session: 31.8.2004 (9h00-11h00) Outlook (SC II): Calendar, Tasks and Notes. Next session: 31.8.2004 (14h00-16h00) Outlook (SC III): Meetings and Delegation. Next session: 7.9.2004 (14h00-16h00) In particular, SC I will cover how to open, create and send email, work with attachments, use stationery, organise mail, and work with the address book, SC II will show how to work with the calendar, tasks and notes, and SC III will cover how to organise and manage meetings, work with meeting requests, share tasks, and use email and calendar delegation. The number of participants to each session is limited to 8. The instructor is English-French bilingual, and s...

  20. CERN Technical Training 2004: New Short Courses (SC) on Microsoft Outlook

    CERN Multimedia

    Monique Duval

    2004-01-01

    The CERN Technical Training programme is now proposing a new format for courses on Microsoft Outlook. Three two-hours Short Courses (SC) will cover basic and advanced functionalities of the recommended mail client for email at CERN. Each module can be followed independently. The next scheduled sessions will take place as follows: Outlook (SC I): E-mail. Next session: 22.10.2004 (9h00-11h00) Outlook (SC II): Calendar, Tasks and Notes. Next session: 22.10.2004 (14h00-16h00) Outlook (SC III): Meetings and Delegation. Next session: 9.11.2004 (14h00-16h00) In particular, SC I will cover how to open, create and send email, work with attachments, use stationery, organise mail, and work with the address book, SC II will show how to work with the calendar, tasks and notes, and SC III will cover how to organise and manage meetings, work with meeting requests, share tasks, and use email and calendar delegation. The number of participants to each session is limited to 8. The instructor is English-French bilingual, and...

  1. New separation method of no-carrier-added {sup 47}Sc from titanium targets

    Energy Technology Data Exchange (ETDEWEB)

    Bartos, B.; Majkowska, A.; Kasperek, A.; Krajewski, S.; Bilewicz, A. [Institute of Nuclear Chemistry and Technology, Warszawa (Poland). Nuclear Chemistry and Radiochemistry Center

    2012-07-01

    Radionuclides with medium energy beta emission and a several day half-life are attractive candidates for radioimmunotherapy. Among the most promising in this category is {sup 47}Sc produced by fast neutron irradiation (E{sub n} > 1 MeV) of titanium target with high energy neutrons in {sup 47}Ti(n,p){sup 47}Sc nuclear reaction. In the previously reported production scheme the dissolution of the TiO{sub 2} target in hot concentrated H{sub 2}SO{sub 4} and evaporation of the resulting solution were the most time-consuming steps. The present paper describes new, simple and efficient production method of {sup 47}Sc, where the slow dissolution of the target is avoided. After irradiation in fast neutron flux {sup 47}TiO{sub 2} and Li{sub 2}{sup 47}TiF{sub 6} targets were dissolved in HF solutions. Next {sup 47}Sc was separated from the target using anion exchange resin Dowex 1 with 0.4 M HF + 0.06 M HNO{sub 3} solution as eluent. The eluted {sup 47}Sc was adsorbed on cation exchange resin and eluted with 0.5 M of ammonium acetate. The 47Sc separation yield in the proposed procedure is about 90% with the separation time less than 2 h. The obtained no-carrier-added {sup 47}Sc was used to label DOTATATE conjugate with 96% labeling yield. (orig.)

  2. Differential Attack on Five Rounds of the SC2000 Block Cipher

    Institute of Scientific and Technical Information of China (English)

    Ji-Qiang Lv

    2011-01-01

    The SC2000 block cipher has a 128-bit block size and a user key of 128,192 or 256 bits,which employs a total of 6.5 rounds if a 128-bit user key is used.It is a CRYPTREC recommended e-government cipher in Japan.In this paper we address how to recover the user key from a few subkey bits of SC2000,and describe two 4.75-round differential characteristics with probability 2-126 of SC2000 and seventy-six 4.75-round differential characteristics with probability 2-127.Finally,we present a differential cryptanalysis attack on a 5-round reduced version of SC2000 when used with a 128-bit key; the attack requires 2125.68 chosen plaintexts and has a time complexity of 212575 5-round SC2000 encryptions.The attack does not threat the security of the full SC2000 cipher,but it suggests for the first time that the safety margin of SC2000 with a 128-bit key decreases below one and a half rounds.

  3. Chronic Hypoxia Suppresses the Co2 Response of Solitary Complex (Sc) Neurons from Rats

    Science.gov (United States)

    Nichols, Nicole L.; Wilkinson, Katherine A.; Powell, Frank L.; Dean, Jay B.; Putnam, Robert W.

    2009-01-01

    We studied the effect of chronic hypobaric hypoxia (CHx; 10-11% O2) on the response to hypercapnia (15% CO2) of individual solitary complex (SC) neurons from adult rats. We simultaneously measured the intracellular pH and firing rate responses to hypercapnia of SC neurons in superfused medullary slices from control and CHx-adapted adult rats using the blind whole cell patch clamp technique and fluorescence imaging microscopy. We found that CHx caused the percentage of SC neurons inhibited by hypercapnia to significantly increase from about 10% up to about 30%, but did not significantly alter the percentage of SC neurons activated by hypercapnia (50% in control versus 35% in CHx). Further, the magnitudes of the responses of SC neurons from control rats (chemosensitivity index for activated neurons of 166±11% and for inhibited neurons of 45±15%) were the same in SC neurons from CHx-adapted rats. This plasticity induced in chemosensitive SC neurons by CHx appears to involve intrinsic changes in neuronal properties since they were the same in synaptic blockade medium. PMID:19619674

  4. Radiolabeling of DOTATOC with the long-lived positron emitter 44Sc.

    Science.gov (United States)

    Pruszyński, Marek; Majkowska-Pilip, Agnieszka; Loktionova, Natalia S; Eppard, Elisabeth; Roesch, Frank

    2012-06-01

    The positron-emitting radionuclide (44)Sc with a half-life of 3.97 h and a β(+) branching of 94.3% is of potential interest for clinical PET. As so far it is available from a (44)Ti/(44)Sc generator in Mainz, where long-lived (44)Ti decays to no-carrier-added (nca) (44)Sc. The (44)Sc is a trivalent metal cation and should be suitable for complexation with many well established bifunctional chelators conjugated to peptides or other molecular targeting vectors. Thus, the aim of this work was to investigate the potential of (44)Sc for labeling of DOTA-conjugated peptides. DOTA-D-Phe(1)-Tyr(3)-octreotide (DOTATOC) was used as a model molecule to study and optimize labeling procedure. Reaction parameters such as buffer conditions, concentration of peptide, pH range, reaction temperature and time were optimized. Addition of 21 nmol of DOTATOC to (44)Sc in ammonium acetate buffer pH 4.0 provided labeling yields >98% within 25 min of heating in an oil-bath at 95°C. This time can be reduced to 3 min only by applying microwave supported heating. (44)Sc-DOTATOC was found to be stable in 0.9% NaCl, PBS pH 7.4, fetal calf and human serums, and also in the presence of competing metal cations (Fe(3+), Ca(2+), Cu(2+), Mg(2+)), as well as other ligand competitors, like EDTA and DTPA, even after almost 25 h incubation at 37°C. Present study shows that nca (44)Sc forms stable complexes with the macrocyclic ligand DOTA and that (44)Sc-DOTATOC and analog targeting vectors may be synthesized for further preclinical and clinical investigations. Copyright © 2012 Elsevier Ltd. All rights reserved.

  5. Synergistic capture of Clostridium botulinum Type A neurotoxin by scFv antibodies to novel epitopes

    Energy Technology Data Exchange (ETDEWEB)

    Gray, Sean A.; Barr, John R.; Kalb, Suzanne R.; Marks, James D.; Baird, Cheryl L.; Cangelosi, Gerard A.; Miller, Keith D.; Feldhaus, Michael J.

    2011-10-01

    A non-immune library of human single chain fragment variable (scFv) antibodies displayed on Saccharomyces cerevisiae was screened for binding to the Clostridium botulinum neurotoxin serotype A binding domain [BoNT/A (Hc)] with the goal of identifying scFv to novel epitopes. To do this, an antibody-mediated labeling strategy was used in which antigen-binding yeast clones were selected after labeling with previously characterized monoclonal antibodies (MAbs) specific to the Hc. Twenty unique scFv clones were isolated that bound Hc. Of these, three also bound to full-length BoNT/A toxin complex with affinities ranging from 5 nM to 170 nM. Epitope binning showed that the three unique clones recognized at least two epitopes that were distinct from one another and from the detection MAbs. After production in E. coli, the scFv were coupled to magnetic particles and tested for their ability to capture BoNT/A holotoxin using an Endopep-MS assay. In this assay, toxin captured by scFv coated magnetic particles was detected by incubation of the complex with a peptide containing a BoNT/A-specific cleavage sequence. Mass spectrometry was used to detect the ratio of intact peptide to cleavage products as evidence for toxin capture. When tested individually, each of the scFv showed a weak positive Endopep-MS result. However, when the particles were coated with all three scFv simultaneously, they exhibited significantly higher Endopep-MS activity, consistent with synergistic binding. These results demonstrate novel approaches toward the isolation and characterization of scFv antibodies specific to unlabeled antigen. They also provide evidence that distinct scFv antibodies can work synergistically to increase the efficiency of antigen capture onto a solid support.

  6. Abusive Head Trauma (Shaken Baby Syndrome)

    Science.gov (United States)

    ... Your 1- to 2-Year-Old Abusive Head Trauma (Shaken Baby Syndrome) KidsHealth > For Parents > Abusive Head ... babies tend to cry the most. How These Injuries Happen Abusive head trauma results from injuries caused ...

  7. Heads Up: Concussion in Youth Sports

    Medline Plus

    Full Text Available ... Learn More about the Brain and How it Works Order Free Copies of CDC's “Heads Up” Educational ... Up! Prevent Concussions Prevent Head Injuries Sports Safety Students Play Safe Youth Sports Safety PROMOTIONAL MATERIALS "Heads ...

  8. Head Lice: Treatment Frequently Asked Questions (FAQs)

    Science.gov (United States)

    ... kill head lice? Which medicine is best? Is mayonnaise effective for treating head lice? CDC does not ... to determine if suffocation of head lice with mayonnaise, olive oil, margarine, butter, or similar substances is ...

  9. Flow cytometry-based methods for assessing soluble scFv activities and detecting pathogen antigens in solution

    Energy Technology Data Exchange (ETDEWEB)

    Gray, Sean; Weigel, Kris M.; Miller, Keith D.; Ndung' u, Joseph; Buscher, Philippe; Tran, Thao N.; Baird, Cheryl L.; Cangelosi, Gerard A.

    2010-04-01

    Novel methods are reported for evaluating and utilizing single chain fragment variable (scFv) antibodies derived from yeast-display libraries. Yeast-display was used to select scFv specific to invariant surface glycoproteins (ISG) of Trypanosoma brucei. A limiting step in the isolation of scFv from nonimmune libraries is the conversion of highly active yeast-displayed scFv into soluble antibodies that can be used in standard immunoassays. Challenges include limited solubility or activity following secretion and purification of scFv. For this reason, few scFv derived from yeast-display platforms have moved into development and implementation as diagnostic reagents. To address this problem, assays were developed that employ both yeastdisplayed and secreted scFv as analytical reagents. The first is a competitive inhibition flow cytometry (CIFC) assay that detects secreted scFv by virtue of its ability to competitively inhibit the binding of biotinylated antigen to yeast-displayed scFv. The second is an epitope binning assay that uses secreted scFv toidentify additional yeast-displayed scFv that bind nonoverlapping or noncompeting epitopes on an antigen. The epitope binning assay was used not only to identify sandwich assay pairs with yeast-displayed scFv, but also to identify active soluble scFv present in low concentration in a crude expression extract. Finally, a CIFC assay was developed that bypasses entirely the need for soluble scFv expression, by using yeast displayed scFv to detect unlabeled antigen in samples. These methods will facilitate the continued development and practical implementation of scFv derived from yeast-display libraries.

  10. An Island Called Cuba

    Directory of Open Access Journals (Sweden)

    Jean Stubbs

    2011-06-01

    Full Text Available Review of: An Island Called Home: Returning to Jewish Cuba. Ruth Behar, photographs by Humberto Mayol. New Brunswick NJ: Rutgers University Press, 2007. xiii + 297 pp. (Cloth US$ 29.95 Fidel Castro: My Life: A Spoken Autobiography. Fidel Castro & Ignacio Ramonet. New York: Scribner/Simon & Schuster, 2008. vii + 724 pp. (Paper US$ 22.00, e-book US$ 14.99 Cuba: What Everyone Needs to Know. Julia E. Sweig. New York: Oxford University Press, 2009. xiv + 279 pp. (Paper US$ 16.95 [First paragraph] These three ostensibly very different books tell a compelling story of each author’s approach, as much as the subject matter itself. Fidel Castro: My Life: A Spoken Autobiography is based on a series of long interviews granted by the then-president of Cuba, Fidel Castro, to Spanish-Franco journalist Ignacio Ramonet. Cuba: What Everyone Needs to Know, by U.S. political analyst Julia Sweig, is one of a set country series, and, like Ramonet’s, presented in question/answer format. An Island Called Home: Returning to Jewish Cuba, with a narrative by Cuban-American anthropologist Ruth Behar and photographs by Cuban photographer Humberto Mayol, is a retrospective/introspective account of the Jewish presence in Cuba. While from Ramonet and Sweig we learn much about the revolutionary project, Behar and Mayol convey the lived experience of the small Jewish community against that backdrop.

  11. The Museum of Piano Island

    Institute of Scientific and Technical Information of China (English)

    LURUCAI

    2004-01-01

    GULANGYU, the island of pianos in southeast Xiamen, has more than 500 pianos. In the island's Shuzhuang Garden is the Gulangyu Piano Museum.Spread out over 2,000 square meters of land, the museum has on exhibit more than 70 pianos from the UK, France, Germany and Austria.

  12. Neoproterozoic granitoids on Wrangel Island

    Science.gov (United States)

    Luchitskaya, M. V.; Sergeev, S. A.; Sokolov, S. D.; Tuchkova, M. I.

    2016-07-01

    Based on geochronological U-Pb studies, the age of Wrangel Island granitoids was estimated as Neoproterozoic (Cryogenian). Some granitoids contain zircons with inherited cores with an estimated age of 1010, 1170, 1200, and >2600 Ma, assuming the presence of ancient (Neoarchean-Mesoproterozoic) rocks in the Wrangel Island foundation and their involvement in partial melting under granitoid magma formation.

  13. Promising electron mobility and high thermal conductivity in Sc2CT2 (T = F, OH) MXenes.

    Science.gov (United States)

    Zha, Xian-Hu; Zhou, Jie; Zhou, Yuhong; Huang, Qing; He, Jian; Francisco, Joseph S; Luo, Kan; Du, Shiyu

    2016-03-21

    MXenes, the new 2D transition metal carbides and nitrides, have recently attracted extensive attention due to their diverse applications and excellent performances. However, the thermal and electrical properties of most MXene materials are yet to be studied. In this work, we investigate the electrical and thermal properties of semiconducting Sc2CT2 (T = F, OH) MXenes using first-principles calculations. Both of the Sc2CT2 (T = F, OH) MXenes are determined to show excellent carrier mobilities. The electron mobility in the Sc2CF2 MXene is found to be strongly anisotropic at room temperature, with values of 5.03 × 10(3) and 1.07 × 10(3) cm(2) V(-1) s(-1) in the zigzag and armchair directions, respectively. The predicted electron mobility in the zigzag direction of the Sc2CF2 is nearly four-fold that in the armchair direction of the promising semiconductor phosphorene. In contrast to Sc2CF2, Sc2C(OH)2 presents approximately isotropic electron mobility. The values at room temperature in the zigzag and armchair directions are calculated as 2.06 × 10(3) cm(2) V(-1) s(-1) and 2.19 × 10(3) cm(2) V(-1) s(-1), respectively. In regard to the thermal properties, the thermal conductivities of the Sc2CT2 (T = F, OH) MXenes have been determined. The predicted values are higher than those of most metals and semiconducting low-dimensional materials, such as monolayer MoS2 and phosphorene. In particular, the room-temperature thermal conductivity along the Sc2CF2 armchair direction has been determined to be as high as 472 W m(-1) K(-1) based on a flake length of 5 μm, which is even higher than that of the best traditional conductor silver. The corresponding value in the zigzag direction of Sc2CF2 is calculated to be 178 W m(-1) K(-1). The thermal conductivity in Sc2C(OH)2 is less anisotropic and lower compared to that in Sc2CF2. The room-temperature value in the armchair (zigzag) direction is determined to be 173 W m(-1) K(-1) (107 W m(-1) K(-1)). Based on their excellent

  14. The Fifth Annual Sc2.0 and Synthetic Genomes Conference: Synthetic Genomes in High Gear.

    Science.gov (United States)

    Walker, Roy S K; Cai, Yizhi

    2016-09-16

    The Sc2.0 project is perhaps the largest synthetic biology project in the public domain, and ultimately aims to construct a new version of the humble brewer's yeast, Saccharomyces cerevisiae. Each year, the Sc2.0 consortium gather to discuss progress in this ambitious project and highlight new developments at the forefront of synthetic genome engineering. This viewpoint summarizes some of the key moments of the 2016 conference, including updates on the Sc2.0 project itself, mammalian synthetic biology, DNA assembly automation, HGP-Write and a panel discussion on the social and ethical perspectives of synthetic biology.

  15. Sc-Si normal incidence mirrors for a VUV interval of 35-50 nm

    CERN Document Server

    Uspenskii, Y A; Vinogradov, A V; Fedorenko, A I; Kondratenko, V V; Pershin, Y P; Zubarev, E N; Mrowka, S; Schäfers, F

    2000-01-01

    The Sc/Si multilayers are suggested as high-reflectivity coatings for a VUV interval of 35-50 nm. Fabricated mirrors show the normal incidence reflectivity of 30-50% which is high enough to effectively manipulate the beams of synchrotron radiation and compact discharge and laser-driven X-ray lasers. The obtained values are not, however, limiting for the Sc/Si coatings. Theoretical estimations as well as electron microscopy studies of Sc-Si interfaces indicate a large potential for further raising the reflectivity.

  16. Assembly of a supercrystal (SC) of the CMS endcap electromagnetic calorimeter

    CERN Multimedia

    J. Williams et al., RAL

    2004-01-01

    The first three pictures show the insertion of the first three rows of crystals into the supercrystal SC03 on Jan. 2004 and the completion of the SC endstops. Fig. 4 shows a complete supercrystal and Fig. 5 its components (alveolar, interface plate, housing, optical fibre, insert, crystal and VPT, endstop). A set of 25 inserts is shown in Fig. 6, while Fig. 7 shows housing, interface plates and inserts. Finally, a SC rear view showing the Vacum Phototriode (VPT) wires through the inserts can be seen in Fig. 8. Fig. 9 and 10 show two supercrystals under test on Dee F and R, respectively.

  17. Valence electron structure analysis of refining mecha-nism of Sc and Ti additions on aluminum

    Institute of Scientific and Technical Information of China (English)

    LI PieJie; YE YiCong; HE LiangJu

    2009-01-01

    The mechanism of the difference of refining effect between Sc and Ti adding to aluminum can not be explained substantially with traditional theory. Valence electron structures of AI-Ti and Al-Sc alloys have been studied by using the empirical electron theory of solids and molecules (EET). The covalent bond electron numbers and interfacial electron density differences are calculated. The conclusion is that, in the two alloys, different covalent bond electron numbers of nucleation particles, and different electron densities on the interface between the second phase particles and the matrix, fundamentally lead to the difference of refining effect between Sc and Ti adding to aluminum.

  18. Ionic conductivity of co-doped Sc2O3-ZrO2 ceramics

    DEFF Research Database (Denmark)

    Omar, Shobit; bin Najib, Waqas; Chen, Weiwu

    2012-01-01

    The oxide ionic conductivity of Sc0.18Zr0.82O1.91 doped with 0.5 mol.% of both Yb2O3 and In2O3 is evaluated at various temperatures in air. Among various co-doped compositions, In0.02Sc0.18Zr0.80O1.90 exhibits the highest grain ionic conductivity followed by Yb0.02Sc0.18Zr0.80O1.90 at 500°C. Howe...

  19. AAZTA: an ideal chelating agent for the development of {sup 44}Sc PET imaging agents

    Energy Technology Data Exchange (ETDEWEB)

    Nagy, Gabor; Szikra, Dezso; Trencsenyi, Gyoergy [Scanomed Ltd., Debrecen (Hungary); University of Debrecen, Medical Imaging Clinic (Hungary); Fekete, Aniko [University of Debrecen, Medical Imaging Clinic (Hungary); Garai, Ildiko [Scanomed Ltd., Debrecen (Hungary); Giani, Arianna M.; Negri, Roberto [Dipartimento di Scienze del Farmaco, Universita del Piemonte Orientale, Novara (Italy); Masciocchi, Norberto [Dipartimento di Scienza e Alta Tecnologia e To.Sca.Lab, Universita degli Studi dell' Insubria, Como (Italy); Maiocchi, Alessandro; Uggeri, Fulvio [Bracco Imaging spa, Bracco Research Centre, Colleretto Giacosa (Italy); Toth, Imre [Department of Inorganic and Analytical Chemistry, University of Debrecen (Hungary); Aime, Silvio [Dipartimento di Biotecnologie Molecolari e Scienze della Salute, Centro di Imaging Molecolare e Preclinico, Universita degli Studi di Torino (Italy); Giovenzana, Giovanni B. [Dipartimento di Scienze del Farmaco, Universita del Piemonte Orientale, Novara (Italy); CAGE Chemicals srl, Novara (Italy); Baranyai, Zsolt [Bracco Imaging spa, Bracco Research Centre, Colleretto Giacosa (Italy); Department of Inorganic and Analytical Chemistry, University of Debrecen (Hungary)

    2017-02-13

    Unprecedented fast and efficient complexation of Sc{sup III} was demonstrated with the chelating agent AAZTA (AAZTA=1,4-bis(carboxymethyl)-6-[bis(carboxymethyl)] amino-6-methylperhydro-1,4-d iazepine) under mild experimental conditions. The robustness of the {sup 44}Sc(AAZTA){sup -} chelate and conjugated biomolecules thereof is further shown by in vivo PET imaging in healthy and tumor mice models. The new results pave the way towards development of efficient Sc-based radiopharmaceuticals using the AAZTA chelator. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  20. Synthesis of Perovskite ScMnO3 under High Temperature and Pressure

    Science.gov (United States)

    Yu, Tian; Gao, Peng; Tyson, Trevor A.

    2012-02-01

    Perovskite type ScMnO3 was synthesized under high temperature and pressure starting with hexagonal ScMnO3. The detail of the structure is examined by synchrotron x-ray diffraction and IR spectroscopy at room temperature. A highly distorted perovskite phase which is similar to the structure of LaMnO3 is identified by XRD Rietveld Refinement. Due to the small Sc ion radius, each Mn site has a distorted MnO6 polyhedron. This work is supported by DOE Grant DE-FG02-07ER46402.

  1. Magnetic properties of Sc{sub x}Ti{sub 1-x}Fe{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Kessler, M. [Lab. de Cristallographie, CNRS, 38 - Grenoble (France); Deportes, J. [Lab. Louis Neel, CNRS, 38 - Grenoble (France); Ouladdiaf, B. [Institut Laue-Langevin, 38 - Grenoble (France); Sayetat, F. [Lab. de Cristallographie, CNRS, 38 - Grenoble (France)

    1995-02-09

    The magnetic properties and their thermal dependences of Sc{sub 0.1}Ti{sub 0.9}Fe{sub 1.96}, Sc{sub 0.1}Ti{sub 0.9}Fe{sub 2} and Sc{sub 0.1}Ti{sub 0.9}Fe{sub 2.04} are compared with those of TiFe{sub 2}. The substitution changes the iron-iron distances. Consequently, the Fe atoms on the 6h site show in addition to the antiferromagnetic component a small ferromagnetic one, and a weak magnetic moment appears on the 2a site. ((orig.)).

  2. Crystal structure of triple oxides HO/sub 2/ScNbO/sub 7/ and Sm/sub 2/ScTaO/sub 7/

    Energy Technology Data Exchange (ETDEWEB)

    Filip' ev, V.S.; Cherner, Ya.E.; Bunina, O.A.; Seregin, V.F.

    The structure of new Ho/sub 2/Sc NbO/sub 7/ and Sm/sub 2/ScTaO/sub 7/ compounds synthesized by the three-stage roasting at 1100-1350 deg C was investigated. Powdergrams of the synthesized compounds indicated to be like the cubic structure of pyrochlore type. Periods of unit cells were determined by Bragg reflex angles. The dependence of unreliability factor on values of the position parameter of oxygen x atoms was calculated. Data were obtained that indirectly indicated a substantial disorder in the disposition of Ho and Sc atoms over A and B positions. Values of bond lengths and valence angles were presented.

  3. Comparison of Head Scatter Factor for 6MV and 10MV flattened (FB) and Unflattened (FFF) Photon Beam using indigenously Designed Columnar Mini Phantom.

    Science.gov (United States)

    Ashokkumar, Sigamani; Nambi Raj, N Arunai; Sinha, Sujit Nath; Yadav, Girigesh; Thiyagarajan, Rajesh; Raman, Kothanda; Mishra, Manindra Bhushan

    2014-07-01

    To measure and compare the head scatter factor for flattened (FB) and unflattened (FFF) of 6MV and 10MV photon beam using indigenously designed mini phantom. A columnar mini phantom was designed as recommended by AAPM Task Group 74 with low and high atomic number materials at 10 cm (mini phantom) and at approximately twice the depth of maximum dose water equivalent thickness (brass build-up cap). Scatter in the accelerator (Sc) values of 6MV-FFF photon beams are lesser than that of the 6MV-FB photon beams (0.66-2.8%; Clinac iX, 2300CD) and (0.47-1.74%; True beam) for field sizes ranging from 10 × 10 cm(2) to 40 × 40 cm(2). Sc values of 10MV-FFF photon beams are lesser (0.61-2.19%; True beam) than that of the 10MV-FB photons beams for field sizes ranging from 10 × 10 cm(2) to 40 × 40 cm(2). The SSD had no influence on head scatter for both flattened and unflattened beams and irrespective of head design of the different linear accelerators. The presence of field shaping device influences the Sc values. The collimator exchange effect reveals that the opening of the upper jaw increases Sc irrespective of FB or FFF photon beams and different linear accelerators, and it is less significant in FFF beams. Sc values of 6MV-FB square field were in good agreement with that of AAPM, TG-74 published data for Varian (Clinac iX, 2300CD) accelerator. Our results confirm that the removal of flattening filter decreases in the head scatter factor compared to flattened beam. This could reduce the out-of-field dose in advanced treatment delivery techniques.

  4. Lanthanide-doped NaScF4 nanoprobes: crystal structure, optical spectroscopy and biodetection

    Science.gov (United States)

    Ai, Yu; Tu, Datao; Zheng, Wei; Liu, Yongsheng; Kong, Jintao; Hu, Ping; Chen, Zhuo; Huang, Mingdong; Chen, Xueyuan

    2013-06-01

    Trivalent lanthanide ions (Ln3+)-doped inorganic nanoparticles (NPs) as potential luminescent bioprobes have been attracting tremendous interest because of their unique upconversion (UC) and downconversion (DC) luminescence properties. NaScF4, as an important host material, has been rarely reported and its crystal structure remains unclear. Herein, based on the single crystal X-ray diffraction, the space group of NaScF4 crystals was determined to be P31 containing multiple sites of Sc3+ with crystallographic site symmetry of C1, which was verified by high-resolution photoluminescence spectroscopy of Eu3+ at low temperature (10 K). Furthermore, monodisperse and size-controllable NaScF4:Ln3+ NPs were synthesized via a facile thermal decomposition method. The biotinylated NaScF4:Er3+/Yb3+ NPs were demonstrated for their applications as a heterogeneous UC luminescence bioprobe to detect avidin with a detection limit of 180 pM. After bioconjugation with amino-terminal fragment (ATF) of urokinase plasminogen activator (uPA), NaScF4:Ln3+ NPs also exhibited specific recognition of cancer cells overexpressed with uPA receptor (uPAR, an important marker of tumor biology and metastasis), showing great potentials in tumor-targeted bioimaging.Trivalent lanthanide ions (Ln3+)-doped inorganic nanoparticles (NPs) as potential luminescent bioprobes have been attracting tremendous interest because of their unique upconversion (UC) and downconversion (DC) luminescence properties. NaScF4, as an important host material, has been rarely reported and its crystal structure remains unclear. Herein, based on the single crystal X-ray diffraction, the space group of NaScF4 crystals was determined to be P31 containing multiple sites of Sc3+ with crystallographic site symmetry of C1, which was verified by high-resolution photoluminescence spectroscopy of Eu3+ at low temperature (10 K). Furthermore, monodisperse and size-controllable NaScF4:Ln3+ NPs were synthesized via a facile thermal

  5. Islanded operation of distributed networks

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    This report summarises the findings of a study to investigate the regulatory, commercial and technical risks and benefits associated with the operation of distributed generation to power an islanded section of distributed network. A review of published literature was carried out, and UK generators were identified who could operate as part of an island network under the existing technical, regulatory, and safety framework. Agreement on case studies for consideration with distributed network operators (DNOs) is discussed as well as the quantification of the risks, benefits and costs of islanding, and the production of a case implementation plan for each case study. Technical issues associated with operating sections of network in islanded mode are described, and impacts of islanding on trading and settlement, and technical and commercial modelling are explored.

  6. Return of the talking heads

    DEFF Research Database (Denmark)

    Reinecke Hansen, Kenneth; Bro, Peter; Andersson, Ralf

    2016-01-01

    The present article suggests that the brief history of Western television news dramaturgy can be expounded as three major waves: from the early days of the talking heads in the studio, over the narrativization of the field report to a (re-)current studio- and field-based talking heads format....... In order to analyze the latest development entering the third wave, we propose a theoretically based dramaturgical model for the television news item. The analysis concludes that, with the current ‘return’ of the talking heads format, the pre-produced and pre-packaged bulletin program about past events...

  7. Anaphylaxis Due to Head Injury

    Directory of Open Access Journals (Sweden)

    Bruner, Heather C.

    2015-05-01

    Full Text Available Both anaphylaxis and head injury are often seen in the emergency department, but they are rarely seen in combination. We present a case of a 30-year-old woman who presented with anaphylaxis with urticaria and angioedema following a minor head injury. The patient responded well to intramuscular epinephrine without further complications or airway compromise. Prior case reports have reported angioedema from hereditary angioedema during dental procedures and maxillofacial surgery, but there have not been any cases of first-time angioedema or anaphylaxis due to head injury. [West J Emerg Med. 2015;16(3:435–437.

  8. Boxing-related head injuries.

    Science.gov (United States)

    Jayarao, Mayur; Chin, Lawrence S; Cantu, Robert C

    2010-10-01

    Fatalities in boxing are most often due to traumatic brain injury that occurs in the ring. In the past 30 years, significant improvements in ringside and medical equipment, safety, and regulations have resulted in a dramatic reduction in the fatality rate. Nonetheless, the rate of boxing-related head injuries, particularly concussions, remains unknown, due in large part to its variability in clinical presentation. Furthermore, the significance of repeat concussions sustained when boxing is just now being understood. In this article, we identify the clinical manifestations, pathophysiology, and management of boxing-related head injuries, and discuss preventive strategies to reduce head injuries sustained by boxers.

  9. Anatomy of mantle plumes: hot heads and cold stems

    Science.gov (United States)

    Davaille, A. B.; Kumagai, I.; Vatteville, J.; Touitou, F.; Brandeis, G.

    2012-12-01

    Recent petrological studies show evidences for secular cooling in mantle plumes: the source temperature of oceanic plateaus could be 100°C hotter than the source temperature of volcanic island chains (Herzberg and Gazel, Nature, 2009). In terms of mantle plumes, it would mean that the temperature of the plume head is hotter than that of the plume stem. This is at odd with a model where a plume head would entrain so much ambient mantle on its journey towards the Earth's surface that it would end up being considerably colder than its narrow stem. So we revisited the problem using laboratory experiments and new visualization techniques to measure in situ simultaneously the temperature, velocity and composition fields. At time t=0, a hot instability is created by heating a patch of a given radius at constant power or constant temperature. The fluids are mixtures of sugar syrups , with a strongly temperature-dependent viscosity, and salt. Rayleigh numbers were varied from 104 to 108, viscosity ratios between 1.8 and 4000, and buoyancy ratios between 0 and 2. After a stage where heat transport is by conduction only, the hot fluid gathers in a sphere and begins to rise, followed by a stem anchored on the hot patch. In all cases, temperatures in the head start with higher values than in the subsequent stem. This is also the case for the thermal instabilities rising from a infinite plate heated uniformly. However, the head also cools faster than the stem as they rise, so that they will eventually have the same temperature if the mantle is deep enough. Moreover, all the material sampled by partial melting in the plume head or stem would be coming from the heated area around the deep source, and very little entrainment from the ambient mantle is predicted. The difference in temperature between head and stem strongly depends on the mantle depth, the viscosity ratio and the buoyancy ratio. Our scaling laws predict that Earth's mantle plumes can indeed have hot heads and colder

  10. A general analytical solution for groundwater fluctuations due to dual tide in long but narrow islands

    Science.gov (United States)

    Huang, Ching-Sheng; Yeh, Hund-Der; Chang, Chia-Hao

    2012-05-01

    This paper develops a general mathematical model for describing head fluctuations in an aquifer of long but narrow islands subject to a dual tide effect. The upper boundary condition of the aquifer is represented by an equation combining the simplified free surface equation with a leakage term. Such an equation is considered as a general expression representing the upper boundary condition of a confined, unconfined, or leaky confined aquifer. The closed-form solution of the model represented by two series terms is developed by the direct Fourier method and finite Fourier sine transform. One of the series can reduce to a closed-form expression by means of contour integral and residue theorem. If the width of the island is very large, this solution gives the predicted head almost the same as that of the solution for an aquifer subject to a single tide effect. It is found that the presence of an upper aquitard produces significant vertical flow in the lower leaky confined aquifer even if the aquitard permeability is low. Neglecting such vertical flow may result in an overestimate of hydraulic head in the leaky confined aquifer. The attenuation factor and phase lag predicted from the present solution subject to the dual tide effect agree well with those estimated from 57 day head fluctuation data observed at Garden Island, Australia.

  11. Guest-induced SC-SC transformation within the first K/Cd heterodimetallic triazole complex: a luminescent sensor for high-explosives and cyano molecules.

    Science.gov (United States)

    Wang, Ying; Jia, Wei; Chen, Ran; Zhao, Xiao-Jun; Wang, Zhong-Liang

    2017-01-03

    The first K/Cd heterodimetallic complex {[Cd1.5(TTPE)1.5Cl3K(H2O)3]·3H2O}n (1b) based on triazole has been generated from {[Cd(TTPE)(HCOO)](NO3)·3DMAC·H2O}n (1) during the ion- and solvent-exchange experiment in an irreversible SC-SC transformation. Based on its luminescence properties, we have, for the first time, demonstrated that 1b is a heterodimetallic sensor for detection of high-explosives and cyano molecules.

  12. Cyclotron production of high purity (44m,44)Sc with deuterons from (44)CaCO3 targets.

    Science.gov (United States)

    Alliot, C; Kerdjoudj, R; Michel, N; Haddad, F; Huclier-Markai, S

    2015-06-01

    Due to its longer half-life, (44)Sc (T1/2 = 3.97 h) as a positron emitter can be an interesting alternative to (68)Ga (T1/2 = 67.71 min). It has been already proposed as a PET radionuclide for scouting bone disease and is already available as a (44)Ti/(44)Sc generator. (44)Sc has an isomeric state, (44 m)Sc (T1/2 = 58.6 h), which can be co-produced with (44)Sc and that has been proved to be considered as an in-vivo PET generator (44 m)Sc/(44)Sc. This work presents the production route of (44 m)Sc/(44)Sc generator from (44)Ca(d,2n), its extraction/purification process and the evaluation of its performances. Irradiation was performed in a low activity target station using a deuteron beam of 16 MeV, which favors the number of (44 m)Sc atoms produced simultaneously to (44)Sc. Typical irradiation conditions were 60 min at 0.2 μA producing 44 MBq of (44)Sc with a (44)Sc/(44 m)Sc activity ratio of 50 at end of irradiation. Separations of the radionuclides were performed by means of cation exchange chromatography using a DGA® resin (Triskem). Then, the developed process was applied with bigger targets, and could be used for preclinical studies. The extraction/purification process leads to a radionucleidic purity higher than 99.99% ((43)Sc, (46)Sc, (48)Sc < DL). (44 m)Sc/(44)Sc labeling towards DOTA moiety was performed in order to get an evaluation of the specific activities that could be reached with regard to all metallic impurities from the resulting source. Reaction parameters of radiolabeling were optimized, reaching yields over 95%, and leading to a specific activity of about 10-20 MBq/nmol for DOTA. A recycling process for the enriched (44)Ca target was developed and optimized. The quality of the final batch with regard to radionucleidic purity, specific activity and metal impurities allowed a right away use for further radiopharmaceutical evaluation. This radionucleidic pair of (44 m)Sc/(44)Sc offers a quite interesting PET radionuclide for being further

  13. Ecological explanations to island gigantism: dietary niche divergence, predation, and size in an endemic lizard.

    Science.gov (United States)

    Runemark, Anna; Sagonas, Kostas; Svensson, Erik I

    2015-08-01

    Although rapid evolution of body size on islands has long been known, the ecological mechanisms behind this island phenomenon remain poorly understood. Diet is an important selective pressure for morphological divergence. Here we investigate if selection for novel diets has contributed to the multiple independent cases of island gigantism in the Skyros wall lizard (Podarcis gaigeae) and if diet, predation, or both factors best explain island gigantism. We combined data on body size, shape, bite force, and realized and available diets to address this. Several lines of evidence suggest that diet has contributed to the island gigantism. The larger islet lizards have relatively wider heads and higher bite performance in relation to mainland lizards than would be expected from size differences alone. The proportions of consumed and available hard prey are higher on islets than mainland localities, and lizard body size is significantly correlated with the proportion of hard prey. Furthermore, the main axis of divergence in head shape is significantly correlated with dietary divergence. Finally, a model with only diet and one including diet and predation regime explain body size divergence equally well. Our results suggest that diet is an important ecological factor behind insular body size divergence, but could be consistent with an additional role for predation.

  14. Island in an island – The suggestions for transportation improvement plan for Haidian Island, Haikou, Hainan

    Directory of Open Access Journals (Sweden)

    Sia Rosalind Juo Ling

    2017-01-01

    Full Text Available Haidian Island, which situated at the Northern part of Haikou City of Hainan Province, is an island within a city. Haidian Island is unique in term of it's development which centered around an university, the Hainan University, besides some others important landmarks, such as Haikou city hospital, Baishamen municipal park, Golf Driving Range etc. All commercials, residential, recreational activities etc are planned to serve Hainan University in particular. The study, taking ‘Haidian Island Area Development Control Plan’ as case study, would like to look into the importance of transportation and traffic planning. The study used observation, site investigation and traffic study methods to gather data needed. Firstly the study analyzed the current state of transportation system for Haidian Island in accordance to the Island Development Control plan and Haikou master plan and identified the problems. Then, the study made some recommendations for these problems. The study highlighted the important of non-motorized, cycling and walking as the main transportation system for an education-based island and as supportive to domestic tourism activities found. The transportation planning suggested by the study took ‘green and low-carbon’ approaches considered the role of University as the core activity in the island.

  15. Formation Processes of Nanocomposite Strengthening Particles in Rapidly Quenched Al-Sc-Zr Alloys

    Directory of Open Access Journals (Sweden)

    A.V. Kotko

    2012-03-01

    Full Text Available Decomposition processes of supersaturated solid solution of aluminium alloys alloyed with Sc and Zr have been studied in the work. The binary hypereutectic Al-Sc alloys, hyperperitectic Al-Zr alloys and ternary Al-Sc-Zr alloys were chosen. Alloys were obtained by the melt-spinning. Melts were quenched from temperatures of Т = 1000 C and Т = 1400 ºC. The study of the structure of rapidly solidifyed binary Al alloys alloyed with Sc and Zr showed that the crystallization of anomalously supersaturated solid solution (Tquen. = 1400 ºC or the crystallization with the formation of "fan" structure (Tquen. = 1000 ºC are possible depending on the quenching temperature of the melt. The decomposition of anomalously supersaturated solid solution is continuous, with the precipitation of nano-sized spherical Al3X (X-Sc, Zr particles of L12-ordered phase which is isomorphous to matrix. It was found that the loss of thermal stability of Al-Sc alloys is due to the loss of coherence of the strengthening Al3Sc phase. In Al-Zr alloys the loss of strength is due to the formation of a stable tetragonal DO23-ordered A13Zr phase. After co-alloying of Al by Sc and Zr a bimodal grained structure was observed for the hypereutectic ternary alloy (Tquen. = 400ºC. Nano-sized grains of 50-60 nm were present on the boundaries of 1-2 µm large-sized grains. TEM shows the formation of nanocomposite Al3Zr/Al3Sc particles. The formation of Al3Zr shell changes the nature of the interfacial fit of the particle with the matrix and slows down the decomposition during the coalescence. Ternary Al-Sc-Zr alloys have significantly higher thermal stability during aging as compared to binary Al-Sc and Al-Zr alloys. Decomposition processes of supersaturated solid solution of aluminium alloys alloyed with Sc and Zr have been studied in the work. The binary hypereutectic Al-Sc alloys, hyperperitectic Al-Zr alloys and ternary Al-Sc-Zr alloys were chosen. Alloys were

  16. Zero torque gear head wrench

    Science.gov (United States)

    Mcdougal, A. R.; Norman, R. M. (Inventor)

    1976-01-01

    A gear head wrench particularly suited for use in applying torque to bolts without transferring torsional stress to bolt-receiving structures is introduced. The wrench is characterized by a coupling including a socket, for connecting a bolt head with a torque multiplying gear train, provided within a housing having an annulus concentrically related to the socket and adapted to be coupled with a spacer interposed between the bolt head and the juxtaposed surface of the bolt-receiving structure for applying a balancing counter-torque to the spacer as torque is applied to the bolt head whereby the bolt-receiving structure is substantially isolated from torsional stress. As a result of the foregoing, the operator of the wrench is substantially isolated from any forces which may be imposed.

  17. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... type your comment or suggestion into the following text box: Comment: E-mail: Area code: Phone no: ... Resonance, Functional (fMRI) - Brain Head and Neck Cancer Treatment Brain Tumor Treatment Magnetic Resonance Imaging ( ...

  18. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... it may cause some medical devices to malfunction. Most orthopedic implants pose no risk, but you should ... copied to a CD. Currently, MRI is the most sensitive imaging test of the head (particularly the ...

  19. Head, Neck, and Oral Cancer

    Science.gov (United States)

    ... a bright light and a mirror: Remove any dentures Look and feel inside the lips and the ... Early treatment may well be the key to complete recovery. Head, Neck & Oral Cancer Facts The information ...

  20. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... The teddy bear denotes child-specific content. Related Articles and Media MR Angiography (MRA) Magnetic Resonance, Functional (fMRI) - Brain Head and Neck Cancer Treatment Brain Tumor Treatment Magnetic Resonance Imaging (MRI) ...

  1. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... medically necessary. MRI may not always distinguish between cancer tissue and fluid, known as edema . MRI typically ... Brain Tumors Radiation Therapy for Head and Neck Cancer Others : American Stroke Association National Stroke Association top ...

  2. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... medically necessary. MRI may not always distinguish between cancer tissue and fluid, known as edema . MRI typically ... Brain Tumors Radiation Therapy for Head and Neck Cancer Others : American Stroke Association National Stroke Association top ...

  3. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... or headphones during the exam. MRI scanners are air-conditioned and well-lit. Music may be played ... the limitations of MRI of the Head? High-quality images are assured only if you are able ...

  4. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... the head uses a powerful magnetic field, radio waves and a computer to produce detailed pictures of ... the body being imaged, send and receive radio waves, producing signals that are detected by the coils. ...

  5. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... Us News Physician Resources Professions Site Index A-Z Magnetic Resonance Imaging (MRI) - Head Magnetic resonance imaging ( ... if possible, or removed prior to the MRI scan. Because they can interfere with the magnetic field ...

  6. New Russian science head named

    CERN Multimedia

    Levitin, C

    2000-01-01

    Ilya Klebanov, a deputy prime minister, has been appointed the country's new head of industrial and scientific policy. He will control the new Ministry for Industry, Science and Technologies (4 paragraphs).

  7. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... technologist if you have any devices or metal in your body. Guidelines about eating and drinking before ... imaging test of the head (particularly the brain) in routine clinical practice. top of page What are ...

  8. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... or potentially pose a risk, depending on their nature and the strength of the MRI magnet. Many ... is positioned around the head. If a contrast material will be used in the MRI exam, a ...

  9. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... a computer to produce detailed pictures of the brain and other cranial structures that are clearer and ... sensitive imaging test of the head (particularly the brain) in routine clinical practice. top of page What ...

  10. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... head is performed for a number of abrupt onset or long-standing symptoms. It can help diagnose ... often within less than 30 minutes from the onset of symptoms. Risks The MRI examination poses almost ...

  11. Montessori Head Start Implementation Brief.

    Science.gov (United States)

    Clifford, Alcillia; Kahn, David

    1995-01-01

    Discusses the use of the Montessori method in Head Start programs, focusing on educational environment, teacher training, parent involvement, and funding. Outlines the phased implementation of a Montessori program and provides a list of Montessori publications and organizations. (MDM)

  12. Flat Head Syndrome (Positional Plagiocephaly)

    Science.gov (United States)

    ... symmetrical, but for a variety of reasons the asymmetry becomes less apparent as well. For example, in ... a flattened head does not affect a child's brain growth or cause developmental delays or brain damage. ...

  13. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... digital cloud server. Currently, MRI is the most sensitive imaging test of the head (particularly the brain) ... contrast material in patients with very poor kidney function. Careful assessment of kidney function before considering a ...

  14. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... MRI scanners are air-conditioned and well-lit. Music may be played through the headphones to help ... Brain Tumor Treatment Magnetic Resonance Imaging (MRI) Safety Alzheimer's Disease Head Injury Brain Tumors Images related to ...

  15. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... is not harmful, but it may cause some medical devices to malfunction. Most orthopedic implants pose no ... Head? Magnetic resonance imaging (MRI) is a noninvasive medical test that physicians use to diagnose medical conditions. ...

  16. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... a computer to produce detailed pictures of the brain and other cranial structures that are clearer and ... sensitive imaging test of the head (particularly the brain) in routine clinical practice. top of page What ...

  17. Heater head for stirling engine

    Science.gov (United States)

    Corey, John A.

    1985-07-09

    A monolithic heater head assembly which augments cast fins with ceramic inserts which narrow the flow of combustion gas and obtains high thermal effectiveness with the assembly including an improved flange design which gives greater durability and reduced conduction loss.

  18. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... of the head uses a powerful magnetic field, radio waves and a computer to produce detailed pictures ... medical conditions. MRI uses a powerful magnetic field, radio frequency pulses and a computer to produce detailed ...

  19. challenges facing child headed households

    African Journals Online (AJOL)

    Mugumbate

    This research employed qualitative methods to establish the daily experiences ... family support systems that view children as society's future and as an .... children's decision-making in 30 child-headed .... fetching water from nearby boreholes.

  20. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... MRI scanners are air-conditioned and well-lit. Music may be played through the headphones to help ... page Additional Information and Resources RTAnswers.org : Radiation Therapy for Brain Tumors Radiation Therapy for Head and ...

  1. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... MRI scanners are air-conditioned and well-lit. Music may be played through the headphones to help ... page Additional Information and Resources RTAnswers.org : Radiation Therapy for Brain Tumors Radiation Therapy for Head and ...

  2. Geology and geochemistry of the Geyser Bight Geothermal Area, Umnak Island, Aleutian Islands, Alaska

    Energy Technology Data Exchange (ETDEWEB)

    Nye, C.J. (Alaska Univ., Fairbanks, AK (USA). Geophysical Inst. Alaska Dept. of Natural Resources, Fairbanks, AK (USA). Div. of Geological and Geophysical Surveys); Motyka, R.J. (Alaska Dept. of Natural Resources, Juneau, AK (USA). Div. of Geological and Geophysical Surveys); Turner, D.L. (Alaska Univ., Fairbanks, AK (USA). Geophysical Inst.); Liss, S.A. (Alaska Dept. of Natural Resources, Fairba

    1990-10-01

    The Geyser Bight geothermal area is located on Umnak Island in the central Aleutian Islands. It contains one of the hottest and most extensive areas of thermal springs and fumaroles in Alaska, and is only documented site in Alaska with geysers. The zone of hot springs and fumaroles lies at the head of Geyser Creek, 5 km up a broad, flat, alluvial valley from Geyser Bight. At present central Umnak is remote and undeveloped. This report describes results of a combined program of geologic mapping, K-Ar dating, detailed description of hot springs, petrology and geochemistry of volcanic and plutonic rock units, and chemistry of geothermal fluids. Our mapping documents the presence of plutonic rock much closer to the area of hotsprings and fumaroles than previously known, thus increasing the probability that plutonic rock may host the geothermal system. K-Ar dating of 23 samples provides a time framework for the eruptive history of volcanic rocks as well as a plutonic cooling age.

  3. Geochemistry of oceanic igneous rocks - Ridges, islands, and arcs - With emphasis on manganese, scandium, and vanadium

    Science.gov (United States)

    Doe, B.R.

    1997-01-01

    increasing Mn is an indication of titanomagnetite removal. Dual compatible and incompatible trends with differentiation are found chiefly for Cu, Sc, and Sr. Distinguishing mid-ocean ridge basalts (MORB), oceanic-island volcanic rocks (OIV), and island-arc volcanic rocks (IAV) may be accomplished by plots of Ce/Yb versus Ba/Ce, where OIV plot to higher values of Ce/Yb than do MORB, and IAV data plot to higher values of Ba/Ce than do those of MORB. These ratios do not seem to be significantly affected by submarine weathering.

  4. Synthesis and properties of Yb:Sc2O3 transparent ceramics

    Institute of Scientific and Technical Information of China (English)

    JIANG Benxue; HU Chen; LI Jiang; KOU Huamin; SHI Yun; LIU Wenbin; PAN Yubai

    2011-01-01

    Yb:Sc2O3 transparent ceramics were fabricated by solid-state reaction and vacuum sintering method.CaO was added as sintering aids by a high energy ball milling.Transparent nearly-fully dense samples were obtained after 1840 ℃ sintering.Using transmitted-light microscope we get the grain sizes are more than 1 00 μm.Using spectrophotometer we get the absorption coefficient centered at 975 nm was 2.65 cm-1.The phosphorescence spectra showed that the line-widths (FWHM) at 975 and 1041 nm were about 4 and 10 nm and the lifetime of Yb ions in Sc2O3 transparent ceramics was about 883 μs.According to the absorption and fluorescence band centers of Yb:Sc2O3 transparent ceramics,the level scheme of Yb3+ ions in Sc2O3 ceramics could be gotten.

  5. DiSC aitab käitumist parandada / Ain Kivesti

    Index Scriptorium Estoniae

    Kivesti, Ain

    2008-01-01

    DiSC testi abil on võimalik saada ülevaade personaalsetest käitumishoiakutest ning vastavalt olukorrale on võimalik harjumuspärast reageerimisstiili radikaalselt muuta. Kommenteerivad Jorma Sarv ja Paavo Pilv

  6. DiSC aitab käitumist parandada / Ain Kivesti

    Index Scriptorium Estoniae

    Kivesti, Ain

    2008-01-01

    DiSC testi abil on võimalik saada ülevaade personaalsetest käitumishoiakutest ning vastavalt olukorrale on võimalik harjumuspärast reageerimisstiili radikaalselt muuta. Kommenteerivad Jorma Sarv ja Paavo Pilv

  7. 76 FR 23331 - Outer Continental Shelf (OCS) Scientific Committee (SC); Announcement of Plenary Session

    Science.gov (United States)

    2011-04-26

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF THE INTERIOR Bureau of Ocean Energy Management, Regulation and Enforcement Outer Continental Shelf (OCS) Scientific Committee (SC); Announcement of Plenary Session AGENCY: Bureau of Ocean Energy Management, Regulation...

  8. 77 FR 4056 - Outer Continental Shelf (OCS) Scientific Committee (SC); Announcement of Plenary Session

    Science.gov (United States)

    2012-01-26

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF THE INTERIOR Bureau of Ocean Energy Management Outer Continental Shelf (OCS) Scientific Committee (SC); Announcement of Plenary Session AGENCY: Bureau of Ocean Energy Management (BOEM), Interior. ACTION: Notice...

  9. Local Impact Simulation of SC Wall Structures using Aircraft Engine Projectile

    Energy Technology Data Exchange (ETDEWEB)

    Chung, Chulhun; Lee, Jungwhee; Lee, Hanjoo [Dankook Univ., Yongin (Korea, Republic of); Jung, Raeyoung; Hyun, Changhun [Korea Institute of Nuclear Safety, Daejeon (Korea, Republic of)

    2013-05-15

    SC wall structure developed for nuclear power plant buildings consists of plain concrete and two steel plates on both surface of the concrete, while RC structure consists of re bar and concrete. SC structure has higher scabbing resistance than RC structure due to the action of steel plate on the rear side of impact. Therefore SC structure is known as more effective structure from the viewpoint of aircraft crash than RC structure. However, most of the recent researches and experiments about local impact damage deal with RC structures, and the effect of re bar and steel plate is not considered reasonably. Although Walter et al. and Make-work et al. suggested a formula for evaluating perforation depth of steel plate covered RC walls, most of the previous researches about SC structure are focused on perforation and scabbing due to the impact of hard projectile, rather than soft projectile such as an aircraft. In this research a soft projectile, i. e. aircraft engine, is utilized for impact simulation of RC and SC walls. To evaluate local damage of SC wall structures, parametric study with the variables of wall thickness and steel ratio of the cover plate is performed, and the results are compared with those of RC structures. Since scabbing was prevented by the steel plates, penetration mode of damage was observed in SC walls while scabbing damage was occurred in RC walls. It is confirmed that the rear steel plate not only contains concrete debris, but also reduces the internal damage of the concrete walls. Penetration depth of SC walls did not largely vary due to the increasing steel ratio, and similar results to RC walls were observed when the wall thickness is larger than a certain value since the impact resistance of SC wall is mainly governed by the thickness of concrete part. Therefore, it is expected that similar level of impact resistance to RC structure can be produced with the minimum thickness of steel plates of SC structure. According to these results, SC

  10. Mauritius - a Sustainable Island

    DEFF Research Database (Denmark)

    Larsen, Anders

    2010-01-01

    The Government of Mauritius has a long-term vision of transforming Mauritius into a sustainable Island. One important element towards the achievement of this vision is to increase the country's renewable energy usage and thereby reducing dependence on fossil fuels. Democratisation of energy...... production is determined to be the way forward. A step in this direction is to devolve upon citizens the ability and motivation to produce electricity via small-scale distributed generation (SSDG), i.e. wind, photovoltaic and hydro installations below 50 kW. Given that SSDG is more expensive per installed...... capacity than the existing much larger power plants, subsidies are needed so as to provide incentives to small independent power producers (SIPP), households and firms to invest in SSDG.The paper presents the context, the theoretical considerations and the proposed incentive schemes to enable electricity...

  11. Analytical modelling of soccer heading

    Indian Academy of Sciences (India)

    Zahari Taha; Mohd Hasnun Arif Hassan; Iskandar Hasanuddin

    2015-08-01

    Heading occur frequently in soccer games and studies have shown that repetitive heading of the soccer ball could result in degeneration of brain cells and lead to mild traumatic brain injury. This study proposes a two degree-of-freedom linear mathematical model to study the impact of the soccer ball on the brain. The model consists of a mass–spring–damper system, in which the skull, the brain and the soccer ball are modelled as a mass and the neck modelled as a spring–damper system. The proposed model was compared with previous dynamic model for soccer ball-to-head impact. Moreover, it was also validated against drop ball experiment on an instrumented dummy skull and also compared with head acceleration data from previous studies. Comparison shows that our proposed model is capable of describing both the skull and brain accelerations qualitatively and quantitatively. This study shows that a simple linear mathematical model can be useful in giving a preliminary insight on the kinematics of human skull and brain during a ball-to-head impact. The model can be used to investigate the important parameters during soccer heading that affect the brain displacement and acceleration, thus providing better understanding of the mechanics behind it.

  12. Magnetic dipole moment of the doubly closed-shell plus one proton nucleus $^{49}$Sc

    CERN Multimedia

    Gaulard, C V; Walters, W; Nishimura, K; Muto, S; Bingham, C R

    It is proposed to measure the magnetic moment of $^{49}$Sc by the Nuclear Magnetic Resonance on Oriented Nuclei (NMR-ON) method using the NICOLE on-line nuclear orientation facility. $^{49}$Sc is the neutron rich, doubly closed-shell, nucleus $^{48}$Ca plus one proton. Results will be used to deduce the effective g-factors in the $^{48}$Ca region with reference to nuclear structure and meson exchange current effects.

  13. Influence of Sc on high temperature strengthening behavior of Ti-6Al-4V alloy

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Vacuum arc melting technique was used to prepare Ti-6Al-4V alloy containing Sc (0.3% and 0.5%, mass fraction). The ingots were melted twice by vacuum self-consumable electrode arc furnace. Forging of ingots was started in β-phase region and finished in high (α+β)-phase region. Annealing after forging was performed in low (α+β)-phase region for 30 min. Isothermal high temperature compression tests were conducted using thermal simulation machine under Ar atmosphere at 850 ℃ and 1 000 ℃, and the strain rate were 0.001, 0.01, 0.1 and 1.0 s-1. Optical microscope(OM), scanning electron microscopy(SEM), energy dispersive spectrum(EDS) and transmission electron microscope(TEM) were used to study the microstructure evolution during high temperature deformation. The results show that, the peak stress value of alloys increases with increasing Sc content after deformation at 850 ℃,however, there is no obvious strengthening of Sc when the alloys are deformed at 1 000 ℃. Sc exists as Sc2O3 forms by internal oxidation during forging procedure, only minor Sc solutes in matrix. At 850 ℃, the interaction between dislocation and participated particles and twinning mechanism controls the deformation procedure accompanied recrystallization. At 1 000 ℃, the deformation of alloys containing Sc is mainly controlled by twinning, while the deformation of alloy without Sc is not only controlled by twinning,but also the interaction between dislocation and precipitated particles inside the twinning lamellar.

  14. CMS ECAL Endcap (EE) Dee Assembly - SC mounting on Dee 1

    CERN Document Server

    Cockerill, D

    2007-01-01

    Protection panels on back of Dee 1, Completion of SC mounting, 03/10/2007: Completion of SC mounting (aart from the inner 3-2-1)on the first quadrant of Dee 1 and subsequent survey. 22-28/08/2007: The first supercrystals on Dee1, Dee1 in 867 with the first column of SCs ready for mounting, Dee1 with its protection panels over the laser monitoring fibre system

  15. Early Stages of Precipitation Process in Al-(Mn-)Sc-Zr Alloy Characterized by Positron Annihilation

    KAUST Repository

    Vlach, Martin

    2015-01-29

    Thermal effects on the precipitation stages in as-cast Al-0.70 at. pct Mn-0.15 at. pct Sc-0.05 at. pct Zr alloy were studied. The role of lattice defects was elucidated by positron annihilation spectroscopy (lifetime and coincidence Doppler broadening) enabling investigation of solutes clustering at the atomic scale. This technique has never been used in the Al-Sc- and/or Al-Zr-based alloys so far. Studies by positron annihilation were combined with resistometry, hardness measurements, and microstructure observations. Positrons trapped at defects are preferentially annihilated by Sc electrons. Lifetime of trapped positrons indicates that Sc atoms segregate at dislocations. Maximum fraction of positrons annihilated by Sc electrons occurring at 453 K (180 °C) suggests that clustering of Sc bound with vacancies takes place. It is followed by peak of this fraction at 573 K (300 °C). A rise of the contribution of trapped positrons annihilated by Zr electrons starting at 513 K (240 °C) and attaining maximum also at 573 K (300 °C) confirms that Zr participates in precipitation of the Al3Sc particles already at these temperatures. The pronounced hardening at 573 K (300 °C) has its nature in the precipitation of the Al3Sc particles with a Zr-rich shell. The contribution of trapped positrons annihilated by Mn electrons was found to be negligible. © 2015, The Minerals, Metals & Materials Society and ASM International.

  16. Die 3SC Trendforschung : ein kontinuierliches Programm zur Beobachtung des soziokulturellen Wandels von Sinus Sociovision

    OpenAIRE

    Appel, Cornelia

    2003-01-01

    Die 3SC Trendforschung ist neben der Lebensweltforschung und dem daraus hervorgegangenen Modell der Sinus-Milieus ein zentraler Forschungsansatz des Heidelberger Instituts Sinus Sociovision. Sinus Sociovision, Mitglied des ADM (Arbeitskreis Deutscher Markt- und Sozialforschungsinstitute e.V.), ist eines der führenden Institute für angewandte soziokulturelle Forschung in Deutschland. Die 3SC Trendforschung ist eine von drei Säulen des Forschungs- und Beratungsangebotes von Sinus Sociovision. H...

  17. RlSC & DSP Advanced Microprocessor System Design; Sample Projects, Fall 1991

    OpenAIRE

    Fredine, John E.; Goeckel, Dennis L.; Meyer, David G.; Sailer, Stuart E.; Schmottlach, Glenn E.

    1992-01-01

    RlSC & DSP Microprocessor System Design (EE 595M) provides students with an overview of reduced instruction set (RISC) microprocessors and digital signal processing (DSP) microprocessors, with emphasis on incorporating these devices in general purpose and embedded system designs, respectively. The first half of the course emphasizes design considerations for RlSC microprocessor based computer systems; a half-semester design project focuses on design principles that could be utilized in a gene...

  18. Ghost Head Nebula

    Science.gov (United States)

    1999-01-01

    Looking like a colorful holiday card, a new image from NASA's Hubble Space Telescope reveals a vibrant green and red nebula far from Earth. The image of NGC 2080, taken by Hubble's Wide Field and Planetary Camera 2, designed and built by NASA's Jet Propulsion Laboratory, Pasadena, Calif., is available online at http://www.jpl.nasa.gov/images/wfpc . Images like this help astronomers investigate star formation in nebulas. NGC 2080, nicknamed 'The Ghost Head Nebula,' is one of a chain of star-forming regions lying south of the 30 Doradus nebula in the Large Magellanic Cloud. 30 Doradus is the largest star-forming complex in the local group of galaxies. This 'enhanced color' picture is composed of three narrow-band-filter images obtained by Hubble on March 28, 2000. The red and blue light come from regions of hydrogen gas heated by nearby stars. The green light on the left comes from glowing oxygen. The energy to illuminate the green light is supplied by a powerful stellar wind, a stream of high-speed particles coming from a massive star just outside the image. The central white region is a combination of all three emissions and indicates a core of hot, massive stars in this star-formation region. Intense emission from these stars has carved a bowl-shaped cavity in surrounding gas. In the white region, the two bright areas (the 'eyes of the ghost') - named A1 (left) and A2 (right) -- are very hot, glowing 'blobs' of hydrogen and oxygen. The bubble in A1 is produced by the hot, intense radiation and powerful stellar wind from one massive star. A2 contains more dust and several hidden, massive stars. The massive stars in A1 and A2 must have formed within the last 10,000 years, since their natal gas shrouds are not yet disrupted by the powerful radiation of the newborn stars. The Space Telescope Science Institute is operated by the Association of Universities for Research in Astronomy, Inc., for NASA, under contract with the Goddard Space Flight Center, Greenbelt, Md. The

  19. Detergents modify proteinase K resistance of PrP Sc in different transmissible spongiform encephalopathies (TSEs).

    Science.gov (United States)

    Breyer, Johanna; Wemheuer, Wiebke M; Wrede, Arne; Graham, Catherine; Benestad, Sylvie L; Brenig, Bertram; Richt, Jürgen A; Schulz-Schaeffer, Walter J

    2012-05-25

    Prion diseases are diagnosed by the detection of their proteinase K-resistant prion protein fragment (PrP(Sc)). Various biochemical protocols use different detergents for the tissue preparation. We found that the resistance of PrP(Sc) against proteinase K may vary strongly with the detergent used. In our study, we investigated the influence of the most commonly used detergents on eight different TSE agents derived from different species and distinct prion disease forms. For a high throughput we used a membrane adsorption assay to detect small amounts of prion aggregates, as well as Western blotting. Tissue lysates were prepared using DOC, SLS, SDS or Triton X-100 in different concentrations and these were digested with various amounts of proteinase K. Detergents are able to enhance or diminish the detectability of PrP(Sc) after proteinase K digestion. Depending on the kind of detergent, its concentration - but also on the host species that developed the TSE and the disease form or prion type - the detectability of PrP(Sc) can be very different. The results obtained here may be helpful during the development or improvement of a PrP(Sc) detection method and they point towards a detergent effect that can be additionally used for decontamination purposes. A plausible explanation for the detergent effects described in this article could be an interaction with the lipids associated with PrP(Sc) that may stabilize the aggregates.

  20. Structures and phase transitions of ScH3 under high pressure

    Institute of Scientific and Technical Information of China (English)

    Kong Bo; Zhou Zhu-Wen; Chen De-Liang; Ling-hu Rong-Feng

    2013-01-01

    The structures and the phase transitions of ScH3 under high pressure are investigated using first-principles calculations.The calculated structural parameters at zero pressure agree well with the available experimental data.With increasing pressure,the transition sequence hcp (GdH3-type)→ C2/m →fcc→hcp (YH3-type)→Cmcm of ScH3 is predicted first; the corresponding transition pressures at 0 K are 23 GPa,25 GPa,348 GPa,and 477 GPa,respectively.The C2/m symmetry structure is a possible candidate but not a good one as the intermediate state from hexagonal to cubic in ScH3.On the other hand,via the analysis of the structures of hexagonal ScH2.9,cubic ScH3,and cubic ScH2,we find that the repulsive interactions of H-H atoms must play an important role in the transition from hexagonal to cubic.

  1. Precise ab initio calculations of the 3d transition-metal clusters: Sc2

    Directory of Open Access Journals (Sweden)

    Ilya G. Kaplan

    2011-06-01

    Full Text Available The ground 5Σu− state of Sc2 was studied by the valence multireference configuration interaction method with single and double excitations plus Davidson correction (MRCISD(+Q at the complete basis set limit. The calculations were made under C2v symmetry restrictions, which allowed us to obtain at the dissociation limit the Sc atoms in different states (in all previous studies of Sc2 the D2h symmetry group was employed. From the Mulliken population analysis and energy calculations follows that in the ground state Sc2 dissociates in one Sc in the ground state and the other in the second excited quartet state, 4Fu. The corrected parameters of the ground potential curve are the following: Re = 5.2 bohr, De = 50.37 kcal/mol, and ωe = 234.5 cm-1. The dissociation energy in respect to the dissociation on two Sc in the ground states was estimated as De = 9.98 kcal/mol.

  2. Corrosion behavior of an Al-6Mg-Sc-Zr alloy

    Institute of Scientific and Technical Information of China (English)

    XU Guangxing; TAO Binwu; LIU Jianhua; LI Songmei

    2005-01-01

    The corrosion behavior of an Al-6Mg-Sc-Zr alloy was studied and compared with that of an Al-6Mg-Zr alloy.The addition of scandium into the Al-6Mg-Zr alloy reduced the susceptibility to exfoliation corrosion. By using the constant load tensile method in a 3.5 wt.% NaCl solution, the resistance to SCC of the Al-6Mg-Sc-Zr alloy was higher than that of the Al-6Mg-Zr alloy. When the specimens were not applied with an anodic current, the Al-6Mg-Sc-Zr alloy was resistance to SCC and no brittle cracking was found on the fracture surface. When an anodic current was applied, the Al-6Mg-Sc-Zr alloy specimens failed as a result of accelerated corrosion rather than SCC. It was believed that the addition of scandium resulted in (Al3Sc, Zr) particles that greatly refmed grains and promoted the formation of homogeneous discontinuous distribution of β-phase in the alloy base, which much contributed to good corrosion resistance of the Al-6Mg-Sc-Zr alloy.

  3. The role of interplanetary shock orientation on SC/SI rise time and geoeffectiveness

    Science.gov (United States)

    Selvakumaran, R.; Veenadhari, B.; Ebihara, Y.; Kumar, Sandeep; Prasad, D. S. V. V. D.

    2017-03-01

    Interplanetary (IP) shocks interact with the Earth's magnetosphere, resulting in compression of the magnetosphere which in turn increases the Earth's magnetic field termed as Sudden commencement/Sudden impulse (SC/SI). Apart from IP shock speed and solar wind dynamic pressure, IP shock orientation angle also plays a major role in deciding the SC rise time. In the present study, the IP shock orientation angle and SC/SI rise time for 179 IP shocks are estimated which occurred during solar cycle 23. More than 50% of the Shock orientations are in the range of 140°-160°. The SC/SI rise time decreases with the increase in the orientation angle and IP shock speed. In this work, the type of IP shocks i.e., Radio loud (RL) and Radio quiet (RQ) are examined in connection with SC/SI rise time. The RL associated IP shock speeds show a better correlation than RQ shocks with SC/SI rise time irrespective of the orientation angle. Magnetic Cloud (MC) associated shocks dominate in producing less rise time when compared to Ejecta (EJ) shocks. Magneto hydrodynamic (MHD) simulations are used for three different IP shock orientation categories to see the importance of orientation angle in determining the geoeffectiveness. Simulations results reveal that shocks hitting parallel to the magnetosphere are more geoeffective as compared to oblique shocks by means of change in magnetic field, pressure and Field Aligned Current (FAC).

  4. Unraveling the Sc(3+) Hydration Geometry: The Strange Case of the Far-Coordinated Water Molecule.

    Science.gov (United States)

    Migliorati, Valentina; D'Angelo, Paola

    2016-07-05

    The hydration structure and dynamics of Sc(3+) in aqueous solution have been investigated using a combined approach based on quantum mechanical (QM) calculations, molecular dynamics (MD) simulations, and extended X-ray absorption fine structure (EXAFS) spectroscopy. An effective Sc-water two-body potential has been generated from QM calculations and then used in the MD simulation of Sc(3+) in water, and the reliability of the entire procedure has been assessed by comparing the theoretical structural results with the EXAFS experimental data. The outstanding outcome of this work is that the Sc(3+) ion forms a well-defined capped square antiprism (SAP) complex in aqueous solution, where the eight water molecules closest to the ion are located at the vertexes of a SAP polyhedron, while the ninth water molecule occupying the capping position is unusually found at a very long distance from the ion. This far-coordinated water molecule possesses a degree of structure comparable with the other first shell molecules surrounding the ion at much shorter distances, and its presence gave us the unique opportunity to easily identify the geometry of the Sc(3+) coordination polyhedron. Despite very strong ion-water interactions, the Sc(3+) hydration shell is very labile, as the far-coordinated ligand allows first shell water molecules to easily exchange their positions both inside the solvation shell and with the rest of the solvent molecules.

  5. GIPSy: Genomic island prediction software.

    Science.gov (United States)

    Soares, Siomar C; Geyik, Hakan; Ramos, Rommel T J; de Sá, Pablo H C G; Barbosa, Eudes G V; Baumbach, Jan; Figueiredo, Henrique C P; Miyoshi, Anderson; Tauch, Andreas; Silva, Artur; Azevedo, Vasco

    2016-08-20

    Bacteria are highly diverse organisms that are able to adapt to a broad range of environments and hosts due to their high genomic plasticity. Horizontal gene transfer plays a pivotal role in this genome plasticity and in evolution by leaps through the incorporation of large blocks of genome sequences, ordinarily known as genomic islands (GEIs). GEIs may harbor genes encoding virulence, metabolism, antibiotic resistance and symbiosis-related functions, namely pathogenicity islands (PAIs), metabolic islands (MIs), resistance islands (RIs) and symbiotic islands (SIs). Although many software for the prediction of GEIs exist, they only focus on PAI prediction and present other limitations, such as complicated installation and inconvenient user interfaces. Here, we present GIPSy, the genomic island prediction software, a standalone and user-friendly software for the prediction of GEIs, built on our previously developed pathogenicity island prediction software (PIPS). We also present four application cases in which we crosslink data from literature to PAIs, MIs, RIs and SIs predicted by GIPSy. Briefly, GIPSy correctly predicted the following previously described GEIs: 13 PAIs larger than 30kb in Escherichia coli CFT073; 1 MI for Burkholderia pseudomallei K96243, which seems to be a miscellaneous island; 1 RI of Acinetobacter baumannii AYE, named AbaR1; and, 1 SI of Mesorhizobium loti MAFF303099 presenting a mosaic structure. GIPSy is the first life-style-specific genomic island prediction software to perform analyses of PAIs, MIs, RIs and SIs, opening a door for a better understanding of bacterial genome plasticity and the adaptation to new traits.

  6. Bamboo Diversity in Sumba Island

    Directory of Open Access Journals (Sweden)

    KARSONO

    2005-04-01

    Full Text Available Bamboo is one of the economic plant which grow widely in the villages and have been used by the local people in the villages. Indonesia has about 10% of the world bamboo, 50% among them was endemic to Indonesia. According Widjaja (2001 Lesser Sunda Island which consists of Lombok, Sumbawa, Flores, Timor, Sumba and other small island eastern of Flores has 14 bamboo species, however, the information from the Sumba Island was lacking because of lacking data from this area except one species which was proposed by S. Soenarko in 1977 where the type specimens was collected by Iboet 443 in 1925. To fullfill data from the Sumba Island, an exploration to this area has been conducted on July 2003. The observation was done in West Sumba and East Sumba District, especially in two natioal parks at both districts. According to this inventory study in the Sumba Island, there were 10 bamboo species in Sumba Island, 1 species among them (Dinochloa sp. was a new species which has not been collected before, whereas the other species (Dinochloa kostermansiana has a new addition record from this area. The bamboo species in Sumba Island were Bambusa blumeana, Bambusa vulgaris, Dendocalamus asper, Dinochloa kostermansiana, Dinochloa sp., Gigantochloa atter, Nastus reholtumianus, Phyllostachys aurea, Schisotachyum brachycladum and Schizostachyum lima. From 10 recorded species, the genera Dinochloa and Nastus grow wild in the forest, whereas another species grow widly or cultivated in the garden. Furthermore, the genus Dinochloa was the only genus grow climbing. The endemic species found in Sumba Island was Nastus reholttumianus, whereas Dinochloa kostermansiana was also found in Flores Island.

  7. Island Bay Wilderness study area : Island Bay National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This document is a brief report on a wilderness study area located in the Island Bay National Wildlife Refuge. It discusses the history of the study area, its...

  8. Report of AAPM Therapy Physics Committee Task Group 74: in-air output ratio, Sc, for megavoltage photon beams.

    Science.gov (United States)

    Zhu, Timothy C; Ahnesjö, Anders; Lam, Kwok Leung; Li, X Allen; Ma, Chang-Ming Charlie; Palta, Jatinder R; Sharpe, Michael B; Thomadsen, Bruce; Tailor, Ramesh C

    2009-11-01

    The concept of in-air output ratio (Sc) was introduced to characterize how the incident photon fluence per monitor unit (or unit time for a Co-60 unit) varies with collimator settings. However, there has been much confusion regarding the measurement technique to be used that has prevented the accurate and consistent determination of Sc. The main thrust of the report is to devise a theoretical and measurement formalism that ensures interinstitutional consistency of Sc. The in-air output ratio, Sc, is defined as the ratio of primary collision water kerma in free-space, Kp, per monitor unit between an arbitrary collimator setting and the reference collimator setting at the same location. Miniphantoms with sufficient lateral and longitudinal thicknesses to eliminate electron contamination and maintain transient electron equilibrium are recommended for the measurement of Sc. The authors present a correction formalism to extrapolate the correct Sc from the measured values using high-Z miniphantom. Miniphantoms made of high-Z material are used to measure Sc for small fields (e.g., IMRT or stereotactic radiosurgery). This report presents a review of the components of Sc, including headscatter, source-obscuring, and monitor-backscattering effects. A review of calculation methods (Monte Carlo and empirical) used to calculate Sc for arbitrary shaped fields is presented. The authors discussed the use of Sc in photon dose calculation algorithms, in particular, monitor unit calculation. Finally, a summary of Sc data (from RPC and other institutions) is included for QA purposes.

  9. CRANIOROFACIAL AND HEAD INJURY MANAGEMENT :A RESIDENTS PERSPECTIVE

    Directory of Open Access Journals (Sweden)

    MOHAMMAD AKHEEL

    2013-10-01

    Full Text Available Everyday, men, women and children suffer head injuries. A car accident, a fall from height or sports injury can range in severity from concussion to coma. Traumatic Brain Injury (TBI can be fatal,dangerous and survivors, can show persistent problems that significantly affect their livelihood and well-being. India has rather unenviable distinction of having the highest rate of head injury in the world. In India, more than 100,000 lives are lost every year with over 1 million suffering from serious head injuries, to be addressed by a handful number of craniofacial and neurosurgeons , as craniofacial neurosciences in India is new and rapidly expanding discipline and one has to be competent and razor sharp in applying its cognitive base and principles, and residency as is always described as an island in shades of grey, and in India it means higher pressure, higher stress loads, lesser patience, and longer quantum of time spent at work with sleepless nights and merciless bosses.

  10. [Illustrations of visceral referred pain. "Head-less" Head's zones].

    Science.gov (United States)

    Henke, C; Beissner, F

    2011-04-01

    Reviewing anatomical, physiological and neurological standard literature for illustrations of referred visceral pain only one type of illustration can frequently be found, which is referred to as Treves and Keith. In fact, the original illustration as a model for most current pictures stems from the German edition of Sir Frederick Treves' famous book "Surgical Applied Anatomy" from 1914, which was reillustrated for didactical reasons for the German readership. While neither Treves and Keith nor the German illustrator Otto Kleinschmidt ever published any work on referred pain this illustration must have been adapted or copied from older sources by the illustrator. Therefore the comprehensive systematic original works before 1914 were reviewed, namely those of Sir Henry Head and Sir James Mackenzie. Due to the name of the phenomenon in the German literature of Head's zones, the illustrations were expected to be based mainly on Head's work. However, a comparison of all available illustrations led to the conclusion that Kleinschmidt chiefly used information from Mackenzie as a model for his illustration. Due to the inexact reproduction of Mackenzie's work by the illustrator some important features were lost that had been reported by the original authors. These include the phenomenon of Head's maximum points, which nowadays has fallen into oblivion.Therefore current charts, based on the illustration by Kleinschmidt from 1914, lack experimental evidence and appear to be a simplification of the observational results of both Head's and Mackenzie's original systematic works.

  11. Heads Up: Concussion in Youth Sports

    Medline Plus

    Full Text Available ... in Spanish [Podcast: 1:27 minutes] Send a Health eCard Heads Up! Prevent Concussions Prevent Head Injuries ... in Spanish [Podcast: 1:27 minutes] Send a Health eCard Heads Up! Prevent Concussions Prevent Head Injuries ...

  12. Two-gap superconductivity in R2Fe3Si5 (R=Lu, Sc and Sc5Ir4Si10

    Directory of Open Access Journals (Sweden)

    Tsuyoshi Tamegai, Yasuyuki Nakajima, Tsuyoshi Nakagawa, Guoji Li and Hisatomo Harima

    2008-01-01

    Full Text Available R2Fe3Si5 (R= Sc, Y, Lu contains nonmagnetic iron and has a relatively high superconducting transition temperature Tc among iron-containing superconductors. An anomalous temperature dependence of specific heat C(T has been reported for polycrystalline samples down to 1 K. We have grown R2Fe3Si5 single crystals, confirmed the anomalous C(T dependence, and found a second drop in specific heat below 1 K. In Lu2Fe3Si5, we can reproduce C(T below Tc, assuming two distinct energy gaps 2Δ 1/kBTc = 4.4 and 2Δ 2/kBTc = 1.1, with nearly equal weights, indicating that Lu2Fe3Si5 is a two-gap superconductor similar to MgB2. Hall coefficient measurements and band structure calculation also support the multiband contributions to the normal-state properties. The specific heat in the Sc2Fe3Si5 single crystals also shows the two-gap feature. R5Ir4Si10 (R = Sc, rare earth is also a superconductor where competition between superconductivity and the charge-density wave is known for rare earths but not for Sc. We have performed detailed specific heat measurements on Sc5Ir4Si10 single crystals and found that C(T deviates slightly from the behavior expected for weak-coupling superconductors. C(T for these superconductors can also be reproduced well by assuming two superconducting gaps.

  13. Heading for a fall? Management of head injury in infants.

    LENUS (Irish Health Repository)

    Williamson, M

    2010-09-01

    Head injury is one of the commonest reasons for infants (< 1 year) to attend the Emergency Department (ED). Clinical management varies considerably and concern about non accidental injury results in a high admission rate in some hospitals. Information was obtained on 103 children under one year of age presenting to the ED with head injury in a prospective study. The average age was 6.7 months and 57% of patients were male. Twenty eight babies had skull x rays with 1 skull fracture diagnosed. None required CT brain scan. Ninety eight (94%) were discharged home from the ED. There were no unplanned returns, readmissions or adverse events. The incidence of traumatic brain injury in children under one year of age presenting with head injury is low and the majority can be safely discharged home.

  14. Hawaiian Islands Wilderness proposal announcement

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This document is a letter from the Bureau of Sport Fisheries and Wildlife stating that documents pertaining to the Hawaiian Islands Wilderness proposal have been...

  15. Papahanaumokuakea - Laysan Island Restoration 2011

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This project supports restoration activities at Laysan Island. Staff and volunteers continue efforts to eradicate alien invasive species such as Indian dropseed...

  16. Synthesizing knowledge of ocean islands

    Science.gov (United States)

    Jefferson, Anne J.; Lees, Jonathan M.; McClinton, Tim

    2011-11-01

    AGU Chapman Conference on the Galápagos as a Laboratory for the Earth Sciences; Puerto Ayora, Galápagos, Ecuador, 25-30 July 2011 An inspiration for Darwin's theory of evolution, the Galápagos Islands and surrounding waters are a natural laboratory for a wide range of Earth science topics. The Galápagos are perfectly situated for geophysical and geochemical investigations of deep-Earth processes at a hot spot, and proximity to a spreading center allows exploration of hot spot-ridge interactions. Several highly active volcanoes show rapid deformation facilitating investigation of melt transport paths and volcanic structure. The islands exhibit a range of ages, eruptive styles, and climatic zones that allow analysis of hydrogeologic and geomorphic processes. The Galápagos Islands are a World Heritage Site and are an ideal setting for developing an integrated biological and geological understanding of ocean island evolution.

  17. Papahanaumokuakea - Laysan Island Restoration 2009

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This project will support restoration activities at Laysan Island. Staff and volunteers continue efforts to eradicate alien invasive species such as Indian dropseed...

  18. Papahanaumokuakea - Laysan Island Restoration 2010

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The Goal of the Laysan Island Restoration is to restore Laysan to a "Pristine" state which would require minimal monitoring and habitat for Endemic Endangered...

  19. Three Mile Island Accident Data

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Three Mile Island Accident Data consists of mostly upper air and wind observations immediately following the nuclear meltdown occurring on March 28, 1979, near...

  20. Submarine Landslides at Santa Catalina Island, California

    Science.gov (United States)

    Legg, M. R.; Francis, R. D.

    2011-12-01

    5-km down the escarpment, dropping about 550-m and leaving a 1.2-km wide by 30-m deep trench behind in its wake. High-resolution multichannel seismic reflection profiles (MCS) show a finely-layered internal structure of the slide and deformation in the underlying slope sediments. The head scarp area appears to be a bedrock outcrop, possibly exposed metamorphic basement of the Catalina Schist based on island outcrops in this area and the laminated internal structure. The toe of the slide block coincides with a youthful fault that shows west-side up (upward facing) separation, suggesting that an existing seafloor fault scarp may have halted the slide. Possibly a large earthquake that formed the scarp also triggered the slide. Another fault with west-side up displacement exists about 3-km behind (east of) the toe of the slide and deforms the seafloor, which we suggest represents post-slide seafloor fault rupture. A large bedrock slide traveling more than 5-km laterally and dropping more than 500-m likely represents a catastrophic failure and rapid slip capable of producing a locally destructive tsunami. A thin veneer of sediment, less than 15-m, may cover the slide block, but higher resolution data are required to more accurately measure sediment cover and estimate the slide age.