WorldWideScience

Sample records for havashenasi aludegi-ye hava

  1. Data of evolutionary structure change: 1JNFA-2HAVA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1JNFA-2HAVA 1JNF 2HAV A A EKTVRWCAVNDHEASKCANFRDSMKKVLPEDGPRIICVK...KASYLDCIKAIAAHEADAVTLDAGLVHEAGLTPNNLKPVVAEFYGSKENPKTFYYAVALVKKGSNFQLNELQGKKSCHTGLGRSAGWNIPIGLLLCDLPEPRKPLEKA...AANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAP...GTRKPVEEYANCHLARAPNHAVVTRKDKEACVHKILRQQQHLFGSNVTDCSGNFCLFRSETKDLLFRDDTVCLAKLHDRNT...GG EEE EEEEEEHHHHHHHHHHHHHHHHH EEEE HHHHH HHHHHHHHHH HHHHHHHHH EVID>

  2. Hava Filtrasyonu Amacıyla Kullanılan Tekstillerin Verimlilikleri ve Toz Tutma Kapasiteleri

    Directory of Open Access Journals (Sweden)

    Gonca Alan

    2013-04-01

    Full Text Available Son yıllarda artan nüfusa ve gelişen teknolojiye bağlı olarak hava kirliliği canlıların sağlığını tehdit eden ciddi bir sorun haline gelmiştir. İç ve dış ortamlarda maruz kalınan havanın kalitesi insan sağlığı üzerinde oldukça büyük öneme sahiptir. Farklı tiplerdeki kirleticilerden arınmış temiz hava solumak adına hava filtrasyonu uygulamaları hayatımızda geniş yer bulmaktadır. Bu nedenle filtrasyon verimliliğinin ölçülmesi, verimlilik ölçümü ile ilgili standartlar, işlem kalitesinin saptanması ve filtre malzemesinin konstrüksiyonunun optimum hale getirilmesi açısından araştırmacıların ilgisini çekmiştir. Bu yazıda genel olarak verimlilik ölçüm yöntemleri ve hava filtrasyonu ile ilgili standartlar detaylandırılmış ve başlıca hava filtrasyonu uygulama alanları sunulmuştur.

  3. Kuşlarda Hava Keselerinin (Sacci pneumatici) Morfolojisi ve Fonksiyonel Özellikleri.

    OpenAIRE

    ERDOĞAN, Serkan; Kilinç, Mehmet

    2009-01-01

    Hava keseleri doğrudan akciğerler ile bağlantı sağlayan ince membranöz yapılar olup solunum sistemi hacminin büyük kısmını oluşturmaktadır. Bu derlemede kuşlara özgü yapılar olan hava keselerinin morfolojik ve fonksiyonel özellikleri açıklanmıştır.

  4. Dilovası’nda hava kirliliğinin meteorolojik açıdan analizi

    OpenAIRE

    Murat DEMİR

    2015-01-01

    Hava kirliliği, havadaki yabancı maddelerin normalin üzerindeki miktar ve yoğunluğa ulaşmasıdır. Gün geçtikçe, hava kirliliği tüm dünyada olduğu gibi Türkiye için de ciddi bir sorun haline gelmektedir. Hızlı nüfus artışı, ulaşım, trafik, endüstriyel faaliyetler ve düzensiz şehirleşme gibi sebeplerden dolayı, büyük şehirlerin kirlilik problemleri her geçen gün artmaktadır.

    Dilovası da coğrafi konum olarak hava kirliliğinin en üst seviyede yaşandığı yerlerden biridir....

  5. OTOMOBİL İÇİNDEKİ HAVA HIZI VE HAREKETLERİNİN ISIL KONFOR ŞARTLARINA ETKİSİNİN İNCELENMESİ

    Directory of Open Access Journals (Sweden)

    Ömer KAYNAKLI

    2003-03-01

    Full Text Available Bu çalışmada, insan vücudunun çeşitli kısımlarından olan ısı kayıpları, üretilen ter miktarı ve buna bağlı olarak deri ıslaklıkları belirlenmiş ve bunların ısıl konfor şartlarına etkisi incelenmiştir. Vücut üzerindeki hava hızlarının ve giyilen giysilerin ısıl ve buharlaşma dirençlerinin farklılığı göz önünde bulundurularak 16 alt kısma ayrılan insan vücudunun her bir kısmının çevreyle olan ısı ve kütle transferinin simülasyonu yapılmıştır. Kurulan modelin geçerliliği deneysel bir çalışmanın sonuçlarıyla karşılaştırılarak ortaya konduktan sonra ısı transfer katsayısı, duyulur ve gizli ısı kayıpları, deri ıslaklığı ve tahmini memnuniyetsizlik oranı PPD'nin değişimi, farklı hava hızı, sıcaklığı ve giysi grupları için incelenmiştir. Sonuç olarak, hava hızları arttıkça vücut üzerindeki ortalama deri ıslaklıkları azalmaktadır ve ısı transfer katsayıları hava hızı ile arttığından vücuttan çevreye olan duyulur ve gizli ısı kayıpları artmaktadır. Ancak duyulur ısı kaybındaki artış gizli ısı kaybına göre daha fazla olmaktadır. Hava hızlarından en çok etkilenen parametre ise PPD indeksi olmuştur.

  6. Prematüre infantlarda uzamış kardiyopulmoner resusitasyondan sonra gelişen hava embolisi, Air embolism after prolonged cardiopulmonary resuscitation in a preterm infant

    OpenAIRE

    ÖZALKAYA, ELİF; KARATEKİN, GÜNER; TOPÇUOĞLU, SEVİLAY; TÜTEN, APDULHAMİT; GÖKMEN, TÜLİN

    2018-01-01

    Bu yazıyı silerek türkçe özeti bu boşluğa yapıştırınız. Ayrıca İngilizce başlık ve özeti de üst satırdaki En[isteğe bağlı] yazan yere tıklayıp o kısma ekleyiniz.(ingilizce başlık ve özet isteğe bağlı değil zorunludur)Sistemikhava embolisi yenidoğanda çoğunlukla idiopatik hava infüzyonu, nekrotizanenterokolitve pulmoner kaçak sendromlarına bağlı gelişmektedir. 28 haftalık 1355 gramdoğan kız bebekte postnatal 9. gününde klinik sepsise sekonder apne ve kardiyopulmonerarrest gelişti. 30 dk kardiy...

  7. HAVA ŞARJLI KÜÇÜK GÜÇLÜ BİR STİRLİNG MOTORUNUN DENEYSEL OLARAK İNCELENMESİ

    Directory of Open Access Journals (Sweden)

    Can ÇINAR

    2004-01-01

    Full Text Available Bu çalışmada, imal edilen hava şarjlı, küçük güçlü ? tipi bir Stirling motoru deneysel olarak incelenmiştir. Motor 800, 900 ve 1000 °C olmak üzere 3 farklı sıcak kaynak sıcaklığında, 1, 1.5, 2, 2.5, 3 ve 3.5 bar şarj basınçlarda test edilmiştir. Deneylerde motor gücünün, motor devri, şarj basıncı ve sıcak kaynak sıcaklığı ile değişimi iki farklı ısı transferi yüzey alanı için incelenmiştir. Maksimum çıkış gücü 1000 °C sıcak kaynak sıcaklığında, 3 bar şarj basıncında 441 dev./dak ve 58 W olarak elde edilmiştir. Yüksüz motor devri 846 1/min olarak ölçülmüştür.

  8. Tek Atamalı Ana Dağıtım Üssü Yerleşim Problemine Yeni Bir Yaklaşım ve Hava Kargo Uygulaması

    Directory of Open Access Journals (Sweden)

    Asuman Özger

    2013-02-01

    Full Text Available Bu çalışmada özellikle hava aracı ve havayolu taşımacılığının sektörel karakteristikleri dikkate alınarak ağ tasarımı problemlerinde kullanılabilecek yeni kısıtlar geliştirilmiştir. Buna paralel olarak, yeni kısıtlar kapasite sınırı olmayan tek atamalı p-ana dağıtım üssü medyan problemi geleneksel modeline eklenmiş ve karma tamsayılı yeni bir model ortaya konmuştur. Çalışmanın amacı yeni kısıtların ana dağıtım üssü yerleşimine etkisini analiz etmektir. Geliştirilen modelin testi hava kargo taşımacılık istatistikleri ile A300-B4 ve F27-500 uçaklarına ait veriler kullanılarak gerçekleştirilmiştir. Analizler sonucunda geliştirilen yeni kısıtların ve kullanılan uçak tipinin ana dağıtım üssü yer seçimlerini önemli ölçüde etkilediği görülmüştür.

  9. Kütüphanelerde İç Hava Kalitesinin İncelenmesi: Marmara Üniversitesi Merkez Kütüphanesi=An Investigation of the Indoor Air Quality in Libraries: Marmara University Central Library

    Directory of Open Access Journals (Sweden)

    Güssün Güneş

    2015-12-01

    Full Text Available Bu çalışmada Marmara Üniversitesi Merkez Kütüphanesi’nde iç ortam hava kalitesi incelenmiştir. İç ortam hava kalitesinin yetersizliği bireylerin çalışma verimlerini düşürebildiği gibi çeşitli sağlık sorunlarına da sebep olabilmektedir. İç ortam hava kalitesini etkileyen önemli kirletici kaynaklarından bir tanesi de partikül maddelerdir. İç hava ortamında bulunan partikül madde (PM, boyutlarına göre (PM10, PM2.5, PM1 insan sağlığını etkileyen hava kirleticilerden biridir. İç ortam hava kirleticileri oranı binaya, yaşanılan bölgeye ve mevsimsel dönemlere göre değişim göstermektedir. Partikül maddeye uzun süre maruz kalındığında göz, burun ve boğaz tahrişi, kaşınma, alerji, kanser, solunum yolu hastalıkları, kalp problemleri gibi çeşitli sağlık sorunlarının oluşumuna yol açabilmektedir. Çalışmamızda kütüphane binasının iç hava ortamında bulunan havadaki 10 mikrondan küçük çaptaki partiküllerin (PM10 kütüphane çalışanları ve kullanıcılarının sağlığına etkisi belirlenmiştir. 05/01/2014-01/06/2014 tarihleri arasında PM10 konsantrasyonu ve kullanıcı sayısı verileri toplanmıştır. PM10 için 2014 kış aritmetik ortalaması 23 μg/m3 ve maksimum değer 130 μg/m3 iken, ilkbaharda aritmetik ortalama 19 μg/m3 ve maksimum değer 127 μg/m3’tür. 05/01/2014-01/06/2014 tarihleri arasında kütüphaneye giren kişi sayısı 09:00-18:59 saatleri arasında ortalama 228 ve maksimum 546’dır. 19:00-08:59 saatleri arasında ise aritmetik ortalama 94 ve maksimum 312 kişi olmuştur. Toz konsantrasyonu ve kullanıcı sayıları karşılaştırıldığında ikisinde de sınav dönemlerinde toz artışı gözlenmiştir. Hem gündüz, hem de gece için PM10 konsantrasyonları ile kişi sayısı arasında korelasyonun yüksek olduğu gözlenmiştir. Dolayısıyla kütüphanedeki kişi sayısı arttıkça havadaki toz miktarı da artmaktadır. Hava Kalitesi

  10. Karabük İlindeki Hava Kirliliğinin Doğal Gaz Kullanımı İle Değişimi

    Directory of Open Access Journals (Sweden)

    Abdülaziz YILDIZ

    2012-12-01

    Full Text Available ÖzetFosil kaynaklı yakıtların kullanımı, hava kirliliğine sebebiyet veren en önemli unsurlardan bir tanesidir. Bu yakıtların bilinçsizce kullanılması sonucunda çevre problemlerine özellikle de hava kirliliğine neden olmaktadır. Yapılan bu çalışmada, Karabük ilinin doğalgaz kullanmaya başlamadan önceki ve doğalgaza geçiş ile hava kirlilik parametreleri (SO2 ve PM10 incelenmiştir. Doğal gaz kullanımının hava kalitesine etkisi araştırılmıştır. İlde ısınma ihtiyacını karşılamak için kömür, fuel-oil ve mazot kullanılırken 2010 yılı itibariyle doğal gaza geçilmiştir. Doğal gazın kullanılmaya başlanmasıyla bu yakıtların kullanımı azalmıştır. Çalışmanın sonunda, Hava Kalitesi Değerlendirme ve Yönetimi Yönetmeliğinde (HKDYY belirtilen, SO2 için 250 μg/m3 değerinin doğal gaz kullanımına geçilmeden önce bazı aylarda üzerinde olduğu görülmüş ve doğal gaz kullanılmaya başlanmasından sonraki dönemlerde ise 250 μg/m3 değerinin aşılmadığı görülmüştür. PM10 için yönetmelikte belirtilen 200 μg/m3 değerinin kış sezonunda aşıldığı tespit edilmiştir. 2010 yılında Doğal gaz kullanımına geçiş ile birlikte bu değerde tekrar bir düşüş gözlenmiştir. Doğal gaz kullanım oranı artıkça havadaki SO2 ve PM10 değerlerinde ciddi düşüşler olduğu gözlenmiştir.AbstractThe Usage of fossil origin fuels is one of the most important cause of air pollution. The usage of these fuels unconsciously causes environmental problems especially air pollution. In this study air pollution parameters (SO2 ve PM10 were analyzed before and after the usage of natural gas in Karabuk. The effect of usage natural gas on air quality is researched. In this city before 2010 coal, foul-oil and diesel were used to provide heat demanded then it is started using natural gas by 2010.With starting the usage of natural gas, the usage of these kind of fuels (coal, foul

  11. Karabük İçin Dış Duvar Optimum Yalıtım Kalınlığının Enerji Tasarrufu Ve Hava Kirliliğine Etkileri

    Directory of Open Access Journals (Sweden)

    Ali Etem Gürel

    2012-12-01

    Full Text Available ÖzetBina dış duvarlarında yapılacak ısı yalıtım uygulamaları, yakıt tüketimini düşürerek enerji tasarrufu sağlamanın yanında, fosil kaynaklı yakıt kullanımından kaynaklanan ve hava kirliliğine neden olan emisyonların düşürülmesinde de son derece etkilidir. Bu çalışmada Karabük’te kömür ve doğalgaz kullanımında dış duvar optimum yalıtım kalınlığı tespitinin ekonomik ve çevresel analizi yapılmıştır. Çalışmanın ekonomik boyutu, yaşam döngüsü maliyet analizine (LCCA dayanan P1-P2 yöntemi ile gerçekleştirilmiştir. Çalışmanın sonuçları, yakıt olarak kömür kullanıldığında optimum yalıtım kalınlığı ve enerji tasarrufunun sırasıyla 0.134 m ve 117.14 TL/m² olduğunu göstermiştir. Yakıt olarak doğalgaz kullanımında ise bu değerler sırasıyla 0.116 m ve 88.39 TL/m² olarak bulunmuştur. Optimum yalıtım kalınlığının hava kirliliğine olan etkileri incelendiğinde, yalıtımsız bina dış duvarında hesaplanan CO2 ve SO2 emisyonlarının yakıt tipine bağlı olarak optimum yalıtım kalınlığı noktasında %85.4’e kadar azaldığı hesaplanmıştır.AbstractHeat insulation applications carried out on external walls of building provides energy saving by decreasing fuel consumption and also quite important in decreasing emission which results from fossil-based fuel usage and causes air pollution. In this study, economic and environmental analyses were done for determination of external wall optimum thickness in using coal and natural gas usage in Karabük. Economic extent of the study was done with P1-P2 method which is based on life cycle cost analysis (LCCA. The results show that optimum insulation thickness and energy saving are 0.134 m and 117.14 TL/m² respectively when coal is used as a fuel. These values are 0.116 m and 88.39 TL/m² when natural gas is used as fuel. When the effects of optimum insulation thickness on air pollution are observed, CO2

  12. Büyükbaş Hayvan Atıkları için Kurulacak Havasız Çürütme Tesisinin Ekonomik Analizi

    Directory of Open Access Journals (Sweden)

    Tamer Coşkun

    2012-12-01

    Full Text Available Özet Büyükbaş hayvan atıkları, içeriğindeki yüksek katı madde, organik kirlilik ve patojen mikroorganizmalar sebebiyle halk sağlığı açısından olumsuz etkiler yapabilecek bir atıktır. Bu çalışmada havasız çürütme ile atıkların stabilize edilerek biyogaz elde edilmesi ve çürümüş atıkların toprakta doğal gübre olarak kullanılmasını içeren bir yönetim modeli uygulanmıştır. Bunun için pilot ölçekli bir havasız çürütme reaktörü işletilmiş ve çürümüş atıklar çeşitli dozlarda yonca, Macar fiğ ve arpa karışımı ile mısır silajı bitkilerinin ekildiği alanlarda doğal gübre olarak toprağa eklenmiştir. Havasız çürütme işleminde yarımcı materyal olarak mısır silajı da reaktöre beslenmiştir. Çalışma sonunda elde edilen sonuçlar ve literatür yardımıyla 1000 baş hayvan için kurulum ve işletme maliyetleri hesaplanmıştır. Kurulum maliyeti; elektrik üretim sisteminin kurulup kurulmaması açısından iki farklı değer olarak hesaplanmıştır. İşletme maliyetleri farklı tarla ürünleri ve yine elektrik sisteminin kurulup kurulmaması açılarından çeşitli durumlar için hesaplanmıştır. Sonuç olarak elde edilen en iyi sonuçlara göre; çürümüş atıklar Macar fiğ ve arpa karışımı bitkisinin ekiminde kullanıldığında kurulacak tesisin elektrik üretim sistemi de kurulduğunda 2,5 yılda, elektrik üretim sistemi kurulmadığında ise 2,1 yılda kendisini amorti ettiği bulunmuştur. Abstract Cattle manure is a potential for causing detrimental effects on human health due to its high solid matter and pathogen microorganism content. This study aims to achieve biogas production by stabilizing the waste using anaerobic digestion. Digested waste was utilized as natural fertilizer. For that reason, a pilot-scale anaerobic digestion tank was operated and digested wastes were added to soil in diverse dosages where alfalfa, the mixture of Hungarian

  13. Eskişehir’de Hava Kirliliği ve Doğal Gazın Tarihçesi: Genel Değerlendirme / History of Air Pollution and Natural Gas Usage in Eskişehir: A General Review

    Directory of Open Access Journals (Sweden)

    Nazmi Oruç

    2012-12-01

    Full Text Available Bu çalışmanın temel amacı Eskişehir kent merkezinde son 30 yılda hava kirliliği ve doğalgaz uygulamaları konusunun irdelenmesidir. Genel olarak kış aylarında ısınma amacıyla kalitesiz kömür kullanımı, plansız ve düzensiz kentleşme ve olumsuz iklim faktörlerine bağlı olarak ortaya çıkan hava kirliliği 1980’li yıllarda Eskişehir’de de yaşanmaya başlanmıştır. Kent merkezindeki ilk hava kirliliği ölçümleri Eskişehir Devlet Mühendislik-Mimarlık Akademisi tarafından 20 Ocak - 20 Nisan, 1982 ve 1 Aralık 1982 - 28 Şubat, 1983 tarihleri arasında asidimetrik yöntemle yapılan SO2 ölçümleridir. Bu süreler içerisinde, Arifiye Mahallesinde ölçülen 24 saatlik ortalama değerlere göre SO2 derişiminin 22-727 µg/m3 arasında değiştiği, aritmetik ortalamanın ise 304 µg/m3 olduğu belirlenmiştir. Sağlık Bakanlığı’nca 1985-1990 yılları arasında Köprübaşı mevkiinde yapılan hava kirliliği ölçümlerinde Hava Kirliliği Kontrol Yönetmeliğinde (HKKY SO2 için verilen Kısa Vadeli Sınırın(KVS= 400 µg/m3 aşıldığı gün sayısı Aralık 1986 de 11, Ocak 1987 de 22, Şubat 1988 de 5, Aralık 1989 de 3, Ocak 1990 da 19 ve Şubat 1990 da ise 11 gün olarak verilmiştir. Eskişehir İl Çevre Durum Raporu’nda 1992-2009 yılları arasında 1992-1993, 1993-1994 ve 1994-1995 kış dönemlerinde, SO2 için verilen Kısa Vadeli Sınır değerinin özellikle Aralık, Ocak ve Şubat aylarında aşıldığı, 1995-1996 döneminden sonraki yıllarda ise Uzun Vadeli Sınır Değeri (UVS olan 150’nin de altına düştüğü kaydedilmiştir. Hava kirliliğindeki bu azalışın temel nedeni 1996 yılından itibaren sanayide tamamen ve evsel ısınmada pek çok bölgede doğal gaza geçilmesiyle ilgilidir. Bu arada son 20 yılda Anadolu Üniversitesi Çevre Mühendisliği Bölümünce hava kirliliği konusunda çok detaylı bilimsel araştırmalar yapılmış ve 2010 yılında Eski

  14. Karabük İlindeki Hava Kirliliğinin Doğal Gaz Kullanımı İle Değişimi / The Change of Air Pollution in Karabuk with the Usage of Natural Gas

    Directory of Open Access Journals (Sweden)

    Yusuf CAY

    2012-12-01

    Full Text Available Fosil kaynaklı yakıtların kullanımı, hava kirliliğine sebebiyet veren en önemli unsurlardan bir tanesidir. Bu yakıtların bilinçsizce kullanılması sonucunda çevre problemlerine özellikle de hava kirliliğine neden olmaktadır. Yapılan bu çalışmada, Karabük ilinin doğalgaz kullanmaya başlamadan önceki ve doğalgaza geçiş ile hava kirlilik parametreleri (SO2 ve PM10 incelenmiştir. Doğal gaz kullanımının hava kalitesine etkisi araştırılmıştır. İlde ısınma ihtiyacını karşılamak için kömür, fuel-oil ve mazot kullanılırken 2010 yılı itibariyle doğal gaza geçilmiştir. Doğal gazın kullanılmaya başlanmasıyla bu yakıtların kullanımı azalmıştır. Çalışmanın sonunda, Hava Kalitesi Değerlendirme ve Yönetimi Yönetmeliğinde (HKDYY belirtilen, SO2 için 250 μg/m3 değerinin doğal gaz kullanımına geçilmeden önce bazı aylarda üzerinde olduğu görülmüş ve doğal gaz kullanılmaya başlanmasından sonraki dönemlerde ise 250 μg/m3 değerinin aşılmadığı görülmüştür. PM10 için yönetmelikte belirtilen 200 μg/m3 değerinin kış sezonunda aşıldığı tespit edilmiştir. 2010 yılında Doğal gaz kullanımına geçiş ile birlikte bu değerde tekrar bir düşüş gözlenmiştir. Doğal gaz kullanım oranı artıkça havadaki SO2 ve PM10 değerlerinde ciddi düşüşler olduğu gözlenmiştir. The Change of Air Pollution in Karabuk with the Usage of Natural Gas The Usage of fossil origin fuels is one of the most important cause of air pollution. The usage of these fuels unconsciously causes environmental problems especially air pollution. In this study air pollution parameters (SO2 ve PM10 were analyzed before and after the usage of natural gas in Karabuk. The effect of usage natural gas on air quality is researched. In this city before 2010 coal, foul-oil and diesel were used to provide heat demanded then it is started using natural gas by 2010.With starting the usage of

  15. Hava Kirliliğine Neden Olan PM10 ve SO2 Maddesinin Yapay Sinir Ağı Kullanılarak Tahmininin Yapılması ve Hata Oranının Hesaplanması (025201) (1-6)

    OpenAIRE

    KAPLAN, Yalçın; SARAY, Umut; AZKESKİN, Erman

    2015-01-01

    Gelişen Dünya’da sanayinin ve insan nüfusunun artması çevre kirliliği açısından risk oluşturmaktadır. Bu çalışmada, hava kirliliğine neden olan Kükürt Dioksit (SO₂) ve Partikül Madde (PM10) verileri kullanılarak, PM10 ve SO2 tahmini yapılmıştır. Ayrıca metot olarak Yapay Sinir Ağları (YSA) geri beslemeli ağ yapısı içinde Levenberg - Marquardt öğrenme algoritması kullanılmıştır. Bulunan sonuçlar ile gerçek değerler karşılaştırılmış ve ortalama karekök hatası (OKH) bulunmuştur. Bulunan OKH değe...

  16. Farklı Çalışma Ortamlarında Oluşabilecek Hava Kirliliğinin Çalışanların Sağlığı Üzerindeki Etkileri / The Effects of Air Pollution on Workers’ Health In Different Work Places

    Directory of Open Access Journals (Sweden)

    Simge Taner

    2012-12-01

    Full Text Available Endüstriyel ve endüstriyel olmayan (okul, ofis, fotokopi merkezleri, restoran vb. çalışma alanlarındaki hava kalitesi, çalışma ortamında bulunan personelin sadece konforu için değil, sağlığı için de büyük önem taşımaktadır. İç ortam hava kalitesi değerlendirmesi yapılırken genellikle sıcaklık, nem oranı, hava akım hızı, kükürtdioksit (SO2, karbondioksit (CO2, solunabilinir asılı partikül madde (PM, hidrojen sülfür (H2S, uçucu organik bileşikler (VOC, azot oksitler (NOx, karbonmonoksit (CO, ozon (O3, radon, hidrojenflorür, formaldehitler (HCHO, mikrobiyal kontrol gibi parametrelerin analizleri yapılmaktadır. Yapılan bu analizler sonucunda elde edilen veriler eşliğinde, çalışanların sağlığı hakkında daha doğru ve emin adımlar atılabilir. Bu durum çevresel analizlerin, işçi sağlığı ve iş güvenliği prensipleriyle birebir örtüştürülmesinin gerekliliğini gözler önüne sermektedir. Özellikle metal işleme, demir-çelik vb. imalat ortamlarında, diğer çalışma ortamlarına göre çok daha fazla kirletici parametre tanımlanabilir. Bu ortamlarda yapılacak ortam ölçümlerinin doğruluğu, çalışma bölgesinin temizlenmesi ve yeterli koruma önlemlerinin alınması konusunda işverenlere kolaylık tanımaktadır. Ülkemizde yalnızca imalat sektörleri değil maden ocakları da çevre ve insan sağlığı açısından ciddi riskler taşımaktadır. Maden ocaklarında çalışanların sağlıklarının korunması adına yapılması gerekli ortam ölçümlerinin yeterli düzeyde olmadığı bilinmektedir. Bu durum maden sektöründe çalışan kişilerin meslek hastalıklarına yakalanma riskini arttırmaktadır. Bu çalışmada ülkemizde iş sahası bakımından geniş bir alana sahip olan maden ve metal sektörlerindeki iç ortam hava kalitesini olumsuz yönde etkileyen parametreler irdelenerek, sözü edilen sektörlerde çalışanların sağlıklarının korunmas

  17. Büyükbaş Hayvan Atıkları için Kurulacak Havasız Çürütme Tesisinin Ekonomik Analizi / The Economical Analysis of Cattle Manure Treatment by Anaerobic Digestion Process

    Directory of Open Access Journals (Sweden)

    Tamer Coşkun

    2012-12-01

    Full Text Available Büyükbaş hayvan atıkları, içeriğindeki yüksek katı madde, organik kirlilik ve patojen mikroorganizmalar sebebiyle halk sağlığı açısından olumsuz etkiler yapabilecek bir atıktır. Bu çalışmada havasız çürütme ile atıkların stabilize edilerek biyogaz elde edilmesi ve çürümüş atıkların toprakta doğal gübre olarak kullanılmasını içeren bir yönetim modeli uygulanmıştır. Bunun için pilot ölçekli bir havasız çürütme reaktörü işletilmiş ve çürümüş atıklar çeşitli dozlarda yonca, Macar fiğ ve arpa karışımı ile mısır silajı bitkilerinin ekildiği alanlarda doğal gübre olarak toprağa eklenmiştir. Havasız çürütme işleminde yarımcı materyal olarak mısır silajı da reaktöre beslenmiştir. Çalışma sonunda elde edilen sonuçlar ve literatür yardımıyla 1000 baş hayvan için kurulum ve işletme maliyetleri hesaplanmıştır. Kurulum maliyeti; elektrik üretim sisteminin kurulup kurulmaması açısından iki farklı değer olarak hesaplanmıştır. İşletme maliyetleri farklı tarla ürünleri ve yine elektrik sisteminin kurulup kurulmaması açılarından çeşitli durumlar için hesaplanmıştır. Sonuç olarak elde edilen en iyi sonuçlara göre; çürümüş atıklar Macar fiğ ve arpa karışımı bitkisinin ekiminde kullanıldığında kurulacak tesisin elektrik üretim sistemi de kurulduğunda 2,5 yılda, elektrik üretim sistemi kurulmadığında ise 2,1 yılda kendisini amorti ettiği bulunmuştur. The Economical Analysis of Cattle Manure Treatment by Anaerobic Digestion Process Cattle manure is a potential for causing detrimental effects on human health due to its high solid matter and pathogen microorganism content. In this study, it was aimed to achieve biogas production by stabilizing the waste using anaerobic digestion. Digested waste was utilized as natural fertilizer. For that reason, a pilot-scale anaerobic digestion tank was operated and digested wastes

  18. Karabük İli Hava Polenlerinin Mevsimsel Değişimleri

    OpenAIRE

    Kaplan, Ayşe; Özdoğan, Yasin

    2015-01-01

    Karabük atmosferinin polenleri 1 Ocak 2006-31 Aralık 2007 yılları arasında iki yıl boyunca incelendi. Pollenler iki durham aracı kullanılarak örneklendi. Çalışmada 45 taksona ait polen kaydedildi. Bir cm2’ye düşen toplam polen sayısı 2006 yılında 3877±280.65, 2007 yılında ise 4022±259.50 olarak bulundu. Ağaç polenleri 2006 yılında cm2 de 3515±225.53 adet, 2007 yılında 3635±220.98 adet saptandı. Otsu bitki polenleri 2006 yılında cm2 de 355±54.12 adet, 2007 yılında 375±37.42 adet belirlendi. İk...

  19. Çanakkale Cephesi Hava Harekâtının SWOT ve PEST Analizi Yöntemi ile İncelenmesi

    Directory of Open Access Journals (Sweden)

    Osman Yalçın

    2015-01-01

    Full Text Available Although it started fast in the West Front in Europe, WWI stuck at some time. The idea of cutting the burden on Germans in the West Front and directing some of the power they fight against towards the East Front also had an effect on triggering Ottoman Fronts to activate. First touch in Gallipoli Battle occurred in November 3, 1914 in Seddülbahir and Kumkale when the Allies bombarded the bastions. The Turkish Army lost 81 martyrs 5 of whom were officers. Gallipoli Battle is the first battle when land force, navy, and air force fought jointly in Turkish history. It is also the first time when Turkish air force took responsibility in a joint operation with other allies. Therefore, this battle was unique in that there were many things happenning first time in history. The battle is still under scrutiny in terms of military, political, ecomonics, strategical, futurist, and demographic issues, etc. In this study, the battle was analyzed through SWOT and PEST which are actually rare in the methodology of history. In the analyses, strengths and weaknesses of the issue has been handled. Moreover, comparison of political, economical, social, and technological aspect of the issue have been analyzed as well. Innovation and demographic aspects could have been also included in the study but these two sub-headings are the topics of another study. Gallipoli Battle is important in terms of both Turkish and world history. With the visits to the battle area, patriotic feelings and unity in Turkey is promoted while the peaceful atmosphere of peace is portrayed to those who participated in the battle some 100 years ago.

  20. Hava Yolu Yolcularının Kabiniçi Hizmet Algılarının Değerlendirmesi: Türk Hava Yolları Örneği (Evaluation of Airline Passangers' Perceptions of In-Cabin Services: Turkish Airlines Example

    Directory of Open Access Journals (Sweden)

    Onur GÖRKEM

    2016-03-01

    Full Text Available Airline industry is facing an intense competition as the number of companies, fleet sizes and the network of flight destinations increase with each passing day. In order to maintain or increase market share, the quality of service is an important component of competitiveness. In this study, passengers’ evaluation of in-cabin services, which have significant impact on their purchase decisions, were analyzed. The study sample consisted of 501 passengers who travelled with THY (Turkish Airlines. The data were gathered from an online questionnaire hosted by Skytrax, an England based consultancy and brand positioning firm. Regression, correlation and variance (ANOVA tests were used to analyze data. Findings indicate that American, European and AsiaPacific passengers’ evaluation showed significant differences with regard to either incabin service dimensions or price-value perceptions.

  1. 75 FR 32920 - Publication of State Plan Pursuant to the Help America Vote Act

    Science.gov (United States)

    2010-06-10

    ... administrative complaint procedure and improvements to the administration of elections for federal office, and... Overseas Voter Empowerment Act (MOVE Act). In accordance with HAVA section 254(a)(12), all the state plans...

  2. Beckwith-Wiedemann Sendromlu Olguya Anestezik Yaklaşım: Olgu sunumu

    OpenAIRE

    Erdoğan, M. Ali; Yücel, Aytaç; Bucak, Nizamettin; Şanlı, Mukadder; Begeç, Zekine; Ersoy, M. Özcan

    2015-01-01

    Beckwith-Wiedemann sendromu; eksofalos, makroglossi, hipoglisemi, organomegali, omfalosel ve gigantizim gibi çeşitli anomalileri içerir. Beckwith-Wiedemann sendromlu olgular sıklıkla infant dönemde cerrahiye gereksinim duyarlar. Anestezi yönetimindeki temel problemler sıklıkla; zor hava yolu ve hipoglisemidir. Makroglossinin maske ventilasyonu ve entübasyonu zorlaştırabileceği akılda tutularak indüksiyondan önce zor hava yolu hazırlığı yapılmalıdır. Dikkatli intraoperatif glukoz takibi hipogl...

  3. Download this PDF file

    African Journals Online (AJOL)

    (4,5) hava been reported. It has been found that several of the dicobelt (II) complexes of the coie'cial diporphyrins catalyze the four—electron reduction of dioxygen to water (6—10). In our laboratories we. have synthesized a hybrid porphyrin—like ligand 1 that allows the incorporation of two metals within one macrocyclic ...

  4. 75 FR 12256 - United States, et al. v. Election Systems and Software, Inc.; Proposed Final Judgment and...

    Science.gov (United States)

    2010-03-15

    ..., service marks, service names, slogans, domain names, logos and trade dress); the unregistered trademark..., trade secrets, service marks, service names, slogans, domain names, logos, and trade dress), data... next few years, despite the exhaustion of HAVA funding. V. TRADE AND COMMERCE A. The Relevant Product...

  5. Combinatorial Markov Random Fields and Their Applications to Information Organization

    Science.gov (United States)

    2008-02-01

    the Valley: Prof. Hava Siegelmann, the Katz family, the Shenhar family, the Ofir family, the Avishay family, Susan Moser , Yariv Levy, Nati Lenchner...projects/comraf 3http://cs.waikato.ac.nz/ml/weka 119 Category # of images Category # of images Birds 152 Christianity 191 Desert 172 Islam 96 Flowers 165

  6. Bosphoruse doktriin ja Euroopa Liidu liitumine Euroopa inimõiguste konventsiooniga / Andra Laurand

    Index Scriptorium Estoniae

    Laurand, Andra

    2012-01-01

    Bosphoruse ehk võrdväärse kaitse doktriinist, mis pärineb Euroopa Inimõiguste Kohtu 2005. aasta otsusest Bosphorus Hava Yollari vs. Iirimaa. Artikkel põhineb 2011. aastal valminud uurimistööl „Võrdväärse kaitse doktriin Euroopa Inimõiguste Kohtu praktikas“

  7. AND COBALT (II)

    African Journals Online (AJOL)

    (4,5) hava been reported. It has been found that several of the dicobelt (II) complexes of the coie'cial diporphyrins catalyze the four—electron reduction of dioxygen to water (6—10). In our laboratories we. have synthesized a hybrid porphyrin—like ligand 1 that allows the incorporation of two metals within one macrocyclic ...

  8. Moe ja kunsti piirimail / Tanel Veenre

    Index Scriptorium Estoniae

    Veenre, Tanel, 1977-

    2011-01-01

    Näitus "Uus Põhjamaade moeillustratsioon" Rotermanni kvartalis 18. sept.-ni. Osalevad Marju Tammik, Anu-Samarüütel-Long, Kätlin Kaljuvee ja Leana Salvet Eestist, Laura Laine ja Minni Havas Soomest, Lovisa Burfitt ja Cecilia Carlstedt Rootsist. Moejoonise ja -illustratsiooni ajaloost

  9. Role of Iranian Traditional Medicine in the Prevention of Respiratory Infectious Diseases.

    Science.gov (United States)

    Soroushzadeh, Sayed Mohammad Ali; Khiveh, Ali; Gerayelimalek, Valiollah

    2016-05-01

    In order to define appropriate plans for respiratory infectious diseases, in accordance with Iranian traditional medicine, one should cover the topic of "havae vabai". "Havae vabai" is related to the epidemics of respiratory infectious diseases. This study is a review of the role of Iranian traditional medicine in the prevention of respiratory infectious diseases .Resources of traditional medicine with the keyword "havae vabai" were reviewed in Noor digital library. The perspective of traditional medicine for the prevention of disease in "havae vabai" is based on self-recuperation and air modification. Items that are mentioned are; refine the surrounding air, move to a proper space, live in a house with no source of water like fountains and limited flow of air, air-drying, use air freshener, smell fruit sticks, use in-house plants, and place a cloth soaked with vinegar in front of the nose. For self-recuperation, reducing body moisture with proper foods and drugs or with vomiting, diarrhea, phlebotomy, wet-cupping, reduction in food and drink intake, avoiding sexual intercourse, bathing, heavy exercise, inactivity, overeating, hunger, thirst, milk, sweets, fish, fatty foods, fruits especially juicy fruits are recommended. The food that tends to have a sour taste, eating meat cooked with sour taste like vinegar is suggested. The use of the solutions offered in traditional medicine to control air is helpful as it can reduce epidemics, such as influenza; that yearly kills many patients with a heavy financial burden.

  10. 75 FR 13265 - Request for Public Comment on Maintenance of Expenditure (MOE) Proposed Policy as Amended on 2-19-10

    Science.gov (United States)

    2010-03-19

    ... COMMISSION Request for Public Comment on Maintenance of Expenditure (MOE) Proposed Policy as Amended on 2-19.... SUMMARY: The EAC seeks public comment on a Maintenance of Expenditure (MOE) Proposed Policy as Amended on... funds provided under the Help America Vote Act (HAVA). EAC issues this notice according to a policy...

  11. State and Local Government Organizations and the Formation of the Help America Vote Act

    OpenAIRE

    Daniel J. Palazzolo; Fiona R. McCarthy

    2005-01-01

    Several state and local government organizations lobbied Congress during the formation of the Help America Vote Act (HAVA). This article distinguishes between “general” government organizations (those that represent the general interests of state and local governments) and “functionalist” organizations (those that implement specific programs or functions). Whereas generalists sought to advance “spatial” interests, functionalists sought to advance “administrative” interests. We also apply theo...

  12. Role of Iranian Traditional Medicine in the Prevention of Respiratory Infectious Diseases

    Science.gov (United States)

    Soroushzadeh, Sayed Mohammad Ali; Khiveh, Ali; Gerayelimalek, Valiollah

    2016-01-01

    Background: In order to define appropriate plans for respiratory infectious diseases, in accordance with Iranian traditional medicine, one should cover the topic of “havae vabai”. “Havae vabai” is related to the epidemics of respiratory infectious diseases. Methods: This study is a review of the role of Iranian traditional medicine in the prevention of respiratory infectious diseases .Resources of traditional medicine with the keyword “havae vabai” were reviewed in Noor digital library. Results: The perspective of traditional medicine for the prevention of disease in “havae vabai” is based on self-recuperation and air modification. Items that are mentioned are; refine the surrounding air, move to a proper space, live in a house with no source of water like fountains and limited flow of air, air-drying, use air freshener, smell fruit sticks, use in-house plants, and place a cloth soaked with vinegar in front of the nose. For self-recuperation, reducing body moisture with proper foods and drugs or with vomiting, diarrhea, phlebotomy, wet-cupping, reduction in food and drink intake, avoiding sexual intercourse, bathing, heavy exercise, inactivity, overeating, hunger, thirst, milk, sweets, fish, fatty foods, fruits especially juicy fruits are recommended. The food that tends to have a sour taste, eating meat cooked with sour taste like vinegar is suggested. Conclusion: The use of the solutions offered in traditional medicine to control air is helpful as it can reduce epidemics, such as influenza; that yearly kills many patients with a heavy financial burden. PMID:27516687

  13. An Association Between Air Quality and COPD in Ahvaz, Iran

    Directory of Open Access Journals (Sweden)

    Mohammadi

    2015-01-01

    Full Text Available Context Ahvaz, capital city of Khuzestan province, with a population of more than 1 million people is very famous in standpoint of air pollution. Nitrogen dioxide is emitted from vehicles and industries which can have short and long term effects on citizens. Evidence Acquisition Data were taken from Ahvaz Department of Environment (ADoE. Stations were Naderi, Behdasht Ghadim, Havashenasi, and Mohitzist. The COPD attributed to nitrogen dioxide in Ahvaz city, Iran, in 2011 were calculated by utilizing relative risk and baseline incidence related to health end point nitrogen dioxide. Data were analyzed by SPSS ver 16. Results The highest and lowest annually average nitrogen dioxide concentrations during 2011 were 70 and 21 μg/m3, respectively. The Bureau of Meteorology “Havashenasi” and head office of ADoE “Mohitzist” had the highest and the lowest nitrogen dioxide concentrations during 2011, respectively. Approximately 4% of the hospital admission for COPD happened when the nitrogen dioxide concentration was > 10 μg/m3. Low percentage of the observed health endpoints was associated with low concentration of measured nitrogen dioxide. Conclusions Using alternative energy sources, such as solar cooking and electrical heating is effective, as is using fuels such as kerosene or coal rather than biomass. Higher relative risk value can depict mismanagement in urban air quality. The lower level of relative risk value may be achieved if some control strategies for reducing nitrogen dioxide emission are used.

  14. Phase Engineering of Perovskite Materials for High-Efficiency Solar Cells: Rapid Conversion of CH3NH3PbI3to Phase-Pure CH3NH3PbCl3via Hydrochloric Acid Vapor Annealing Post-Treatment.

    Science.gov (United States)

    Zhou, Weiran; Zhou, Pengcheng; Lei, Xunyong; Fang, Zhimin; Zhang, Mengmeng; Liu, Qing; Chen, Tao; Zeng, Hualing; Ding, Liming; Zhu, Jun; Dai, Songyuan; Yang, Shangfeng

    2018-01-17

    Organometal halide CH 3 NH 3 PbI 3 (MAPbI 3 ) has been commonly used as the light absorber layer of perovskite solar cells (PSCs), and, especially, another halide element chlorine (Cl) has been often incorporated to assist the crystallization of perovskite film. However, in most cases, a predominant MAPbI 3 phase with trace of Cl - is obtained ultimately and the role of Cl involvement remains unclear. Herein, we develop a low-cost and facile method, named hydrochloric acid vapor annealing (HAVA) post-treatment, and realize a rapid conversion of MAPbI 3 to phase-pure MAPbCl 3 , demonstrating a new concept of phase engineering of perovskite materials toward efficiency enhancement of PSCs for the first time. The average grain size of perovskite film after HAVA post-treatment increases remarkably through an Ostwald ripening process, leading to a denser and smoother perovskite film with reduced trap states and enhanced crystallinity. More importantly, the generation of MAPbCl 3 secondary phase via phase engineering is beneficial for improving the carrier mobility with a more balanced carrier transport rate and enlarging the band gap of perovskite film along with optimized energy level alignment. As a result, under the optimized HAVA post-treatment time (2 min), we achieved a significant enhancement of the power conversion efficiency (PCE) of the MAPbI 3 -based planar heterojunction-PSC device from 14.02 to 17.40% (the highest PCE reaches 18.45%) with greatly suppressed hysteresis of the current-voltage response.

  15. Riia, Euroopa ja euroopalik ruum / Reet Varblane

    Index Scriptorium Estoniae

    Varblane, Reet, 1952-

    2004-01-01

    Riia skulptuurikvadriennaal "Euroopa ruum" Riia Arsenalis, Läti raudteemuuseumis ja linnaruumis 4. VI-25. VII. Kuraatorid Kristaps Gulbis, Aigars Bikse. Preemia saanud ungari rühmituse Little Warsaw (Balint Havas, Andras Galik) tööst "Marmori tänav" ning Gints Gabransi (Läti), Tulay Schakiri (Soome), Eestit esindanud Daniela, Paul Rodgersi, Ekke Väli, Jüri Ojaveri jt. töödest. Tagasivaates 1950-ndate skulptuuri linnaruumi paigutatud fotode kaudu esindas Eestit Arseni Mölder. Heli Ryhäneni ja Anne Meskaneni näitusest "Skulptuurid" Tallinna Kunstihoone galeriis

  16. An estimation of COPD cases and respiratory mortality related to Ground-Level Ozone in the metropolitan Ahvaz during 2011

    Directory of Open Access Journals (Sweden)

    Sahar Geravandi

    2016-02-01

    Full Text Available Background & Aims of the Study :  Ground-Level Ozone (GLO is the component of one of greatest concern that threatened human health in both developing as well as developed countries. The GLO mainly enters the body through the respiration and can cause decrements in pulmonary complications, eye burning, shortness of breath, coughing, failure of immune defense, decreases forced vital capacity, reduce lung function of the lungs and increase rate of mortality. Ahwaz with high emission air pollutants because of numerous industries is one of the metropolitan Iranian polluted. The aim of this study is evaluate to Chronic Obstructive Pulmonary Disease (COPD and respiratory mortality related to GLO in the air of metropolitan Ahvaz during 2011. Materials & Methods: We used the generalized additive Air Q model for estimation of COPD and respiratory mortality attributed to GLO pollutant. Data of GLO were collected in four monitoring stations Ahvaz Department of Environment. Raw data processing by Excel software and at final step they were converted as input file to the Air Q model for estimate number of COPD Cases and respiratory mortality. Results: According to result this study, The Naderi and Havashenasi had the highest and the lowest GLO concentrations. The results of this study showed that cumulative cases of COPD and respiratory mortality which related to GLO were 34 and 30 persons, respectively. Also, Findings showed that approximately 11 % COPD and respiratory mortality happened when the GLO concentrations was more than 20 μg/m 3 . Conclusions: exposure to GLO pollution has stronger effects on human health in Ahvaz. Findings showed that there were a significant relationship between concentration of GLO and COPD and respiratory mortality. Therefore; the higher ozone pollutant value can depict mismanagement in urban air quality.  

  17. KUMAŞLARlN DOKUNMASIZ KALDlRlLMASlNDA ARALIK-BASlNÇ İLlŞKİSİNİN İNCELENMESİ

    Directory of Open Access Journals (Sweden)

    BABÜR ÖZÇELİK

    2000-06-01

    Full Text Available Bu araştırmada bir nozul (meme sistemi yardımıyla kumaşların dokunmasız olarak kaldırılması incelenmiştir. Kumaşların kaldınlması, belirli bir basınca ve debiye sahip hava tarafından sağ l anmı ştır . Bu havanın kaldırılacak kumaş yüzeyine hızla çarpması sonucu, nozttl ile k aldı rıl acak kumaş yüzeyi arasında bir vakum oluşmakta ve kumaşlar dokunmasız olarak kaldınln1aktadır. Bu araşt ırmada hava basıncına bağlı olarak nozul-kumaş aralığının değişimi incelenmiş ve sonuçlar değerfendiri Imiştir.

  18. ISI BORULU GÜNEŞ KOLLEKTÖRÜ İLE KURUTMA

    Directory of Open Access Journals (Sweden)

    Hikmet DOĞAN

    1999-01-01

    Full Text Available Bu araştırmada, kurutmada güneş enerjisinden daha iyi faydalanabilmek için güneş kolektöründe ısı borusu kullanılmıştır. Isı boruları ile güneşten alınan enerji kurutma havasına aktarılmış, bu sıcak hava, kurutulmak istenilen materyalin üzerine salınmıştır. Kurutulmak istenen materyal bünyesindeki su, sıcak havanın etkisiyle buharlaştırılarak, kurutma gerçekleştirilmiştir. Yapılan deneyler neticesinde kurutma olayı güneşin direkt radyasyon etkisinden uzak, gölgede kurutulduğu için, ürün üzerinde, dışarıdaki serbest güneşte kurutmada görülen bazı mahzurlar ortadan kalkmıştır. Ayrıca kuruma süresinin de dışarıdaki serbest kurutmaya göre kısaldığı tespit edilmiştir.

  19. Düzce İli Atmosferinin Polen ve Spor Dağılımının İncelenmesi

    OpenAIRE

    Serbes, Ayşe Belgin; Kaplan, Ayşe

    2014-01-01

    Bu çalışma 1 Ocak 2006 / 1 Ocak 2007 tarihleri arasında Düzce ili havasında yapılan bir yıllık aeropalinolojik çalışma olup, polen ve sporların neden olduğu alerjik hastalıkların teşhis ve tedavisinde hekimlere yardımcı olmayı amaçlamaktadır. Düzce ili Yimpaş A.Ş binası üzerine yerleştirilen iki farklı Durham cihazı kullanılarak Gravimetrik yöntemle elde edilen preparatlar incelenmiştir. Düzce ili atmosferindeki polen ve sporların hangi taksonlarına ait oldukları saptanmış ve morfolojik tanım...

  20. Dural ectasia of the optic nerve sheath: is it always benign?

    Directory of Open Access Journals (Sweden)

    Berker Bakbak

    2009-11-01

    Full Text Available Berker Bakbak1, Hava Dönmez2, Tülay Kansu3, Hayyam Kiratli41Hacettepe University Institute of Neurological Sciences and Psychiatry, Neuro-ophthalmology Unit, Ankara, Turkey; 2Diskapi Yildirim Beyazid Education and Research Hospital Neurology Clinic, Ankara, Turkey; 3Hacettepe University Medical Faculty, Department of Neurology, Neuro-Ophthalmology Unit, Ankara, Turkey; 4Hacettepe University Medical Faculty, Department of Ophthalmology, Ocular Oncology Unit, Ankara, TurkeyAbstract: A 36-year-old woman with a 3-month history of progressive visual loss had papilledema, dilatation of the optic nerve sheaths and normal cerebrospinal fluid pressures. She was diagnosed as dural ectasia of the optic nerve sheaths and surgical decompression was performed. In this case report, severe visual loss is described as a serious complication of this rare disease and the importance of early surgical intervention is emphasized.Keywords: optic nerve, dural ectasia, meningocele

  1. Estudos bioecológicos de Syphraea uberabensis (Coleoptera: Chrysomelidae Bechyné 1956

    Directory of Open Access Journals (Sweden)

    Charles Wikler

    2005-06-01

    Full Text Available Tibouchina herbacea (DC. Cog. é uma planta ornamental introduzida propositadamente no arquipélago do Havaí e, devido à ausência de inimigos naturais e condições edafo-climáticas adequadas, está se dispersando rapidamente pelas florestas nativas e regiões úmidas das principais ilhas havaianas. Por ser originária do Brasil, foram realizadas diversas viagens exploratórias em busca de por inimigos naturais específicos que pudessem controlar esta planta. Dentre os agentes selecionados com impacto e potencial de especificidade à T. herbacea encontra-se Syphraea uberabensis (Bechyne, 1955 (Coleoptera: Chrysomelidae. Este trabalho visa estudos sobre a biologia, ecologia e especificidade deste inseto e também uma avaliação criteriosa dos possíveis impactos causados por este inimigo natural na população da planta.

  2. Patau sendromu ön tanılı pediyatrik olguda anestezik yönetim: Olgu sunumu ve literatüre kısa bir bakış

    OpenAIRE

    F, Demir H; A, Erakgün; A, Çertuğ

    2013-01-01

    Patau sendromu (trizomi 13) multipl organ sistem anomalileri ile seyreden bir kromozomal sendromdur. En sık bulguları kraniyofasyal ve kardiyak anomalilerdir. Patau sendromlu olgular anesteziyologlar açısından, hava yolu kontrolünün güçlüğü, pozisyon vermede zorluk, ağır olgularda sıvı tedavisinin düzenlenmesinde güçlük gibi sorunlar nedeni ile özelliklidir. 2 aylık kız hastaya konjenital katarakt nedeni ile acil cerrahi operasyon uygulandı. Patau sendromu ön tanısı ile izlenen hastada ASD, V...

  3. Heliconia Cut Flower Production – a 2 year study in Hawaii

    Directory of Open Access Journals (Sweden)

    RICHARD A. CRILEY

    2008-07-01

    Full Text Available As plantas de 20 cultivares ou espécies comerciais do helicônia foram plantadas na Fazenda Experimental de Waimanalo (Oahu da Universidade de Havaí como parte de um estudo da pesquisa no crescimento e na produção da flor. Neste trabalho são relatados os resultados da produtividade e da periodicidade de 18 espécies e cultivares de helicônia. em julho 1999, cinco plantas de cada genótipo foram plantadas em vasos de 7,6 litros dispostos em afastamentos de 2,5 m na fileira e 3 m entre fileiras. Um mês mais tarde, as brotações foram etiquetadas e observadas a cada

  4. Geri Dönüşüm Lifler İçeren Süprem Kumaşların Isıl Konfor Özelliklerinin İncelenmesi

    Directory of Open Access Journals (Sweden)

    Gizem CELEP

    2016-01-01

    Full Text Available Bu çalışmada orijinal (ORJ ve geri dönüşüm (GD pamuk lifleri kullanılarak, %100 ORJ, %100 GD ve 50/50 ORJ/GD pamuk lifleri içeren iplikler üretilmiş ve bu iplikler ile üretilen süprem kumaşların ısıl konfor özellikleri incelenmiştir. Bu amaçla konfeksiyonda açığa çıkan kumaş kırpıntılarından elde edilen geri dönüşüm pamuk lifleri ve orijinal pamuk lifleri open-end rotor iplik eğirme sisteminde eğrilmiş ve bu ipliklerden süprem kumaşlar üretilmiştir. Geri dönüşüm ve orijinal pamuk ipliklerinden elde edilen bu kumaşların ısıl konfor özelliklerini karşılaştırmak amacıyla; ısıl iletkenlik, ısıl direnç, ısıl soğurganlık ve hava geçirgenlik özellikleri ölçülmüştür. Kumaşlarda geri dönüşüm pamuk liflerinin kullanımının kumaşların ısıl direnç değerlerini arttırdığı; ısıl iletkenlik, hava geçirgenliği ve ısıl soğurganlık değerlerini düşürdüğü gözlenmiştir. Geri dönüşüm liflerinden örülmüş süprem kumaşların ısıl direnç değerlerinin yüksek olmasının ve ilk temasta daha sıcak bir his vermesinin orijinal liflerden üretilen kumaşlara göre kullanım alanına bağlı olarak üstünlük sağladığı düşünülmektedir.

  5. DOLGULU BİR KOLONUN PERFORMANS ANALİZİ : ORİFİZMETRE KALİBRASYONU

    Directory of Open Access Journals (Sweden)

    Aynur ŞENOL

    2003-01-01

    Full Text Available Bu çalışmada, dolgu çapı 6.25 mm, ıslanabilen dolgu dış yüzey alanı 2.3 cm2, spesifik yüzey alanı ap = 1037.3 m2/m3 ve boşluk kesri ? = 0.545 m2/m3 geometrik özelliklere sahip halkalı dolgu maddesinin işletme parametreleri 9 cm iç çapındaki cam bir destilasyon kolonunda araştırılmıştır. Trikloretilen/n-heptan sistemini kullanarak, muhtelif kolon basınç düşüşü (buhar hızı değerlerine karşılık dolgu maddesinin ayırma etkinliği (HETP ve gaz fazı transfer birimi yüksekliği, HOG sonsuz refluks çalışma koşulları altında test edilmiştir. BravoFair'ın etkin fazlar arası yüzey alanı (ae yaklaşımı ile Onda'nın ıslak yüzey alanı (aw ve kütle transfer katsayısımodelleri aracılığı ile, değişik buhar yükü değerlerine karşılık dolgunun ayırma etkinliği teorik olarak analiz edilmiştir. Buhar yükleme faktörü olarak Eckert'in boğulma hızı modeline göre hesaplanan %boğulma oranı(%Fl niceliği kullanılmıştır. Ayrıca, kolon kuru basınç düşüşü denemelerinde yer alan "orifizmetre" hava debisi ölçü aletinin kalibrasyonuna yönelik olarak, aletteki kapiler (orifiz çapı (d ve manometrik cıva seviyesi farkına (?ho dayalı bir hava hızı korelasyonu türetilmiştir.

  6. Edirne’de süpürge üretimi çalışanlarında SO2 etkisinin değerlendirilmesi - 2012/Evaluation of SO2 effetcs among workers of the broom-making business in Edirne-2012

    Directory of Open Access Journals (Sweden)

    Ufuk berberoğlu

    2013-08-01

    Full Text Available Özet Amaç: İşyeri ortam havasında bulunan SO2, çalışanların özellikle solunum sistemini etkileyen bir gazdır. Bu araştırma, Edirne’de süpürge üretiminde çalışanların, islemede kullanılan SO2 den etkilenme durumlarını değerlendirmek amaçlanmıştır. Yöntem: Araştırma 2012 Ocak-Şubat aylarında Edirne’de gerçekleştirilmiştir. Oluşturulan veri toplama formu ile süpürgeciler sitesinde çalışan 25 kişiden ve konfeksiyon işinde çalışan 25 kişiden veri toplanmıştır. Demografik bilgiler, solunum sistemi öykü-fizik muayeneleri ve solunum fonksiyon testleri sonucunda elde edilen veriler araştırmacılar tarafından hazırlanan veri formuna kaydedilmiştir. Kükürt dioksit kullanılarak, isleme ve sarartma işleminin yapıldığı odaların iç ortam havasında ise, GasAlertMicro 5 marka cihaz ile SO2 düzeyi ölçülmüştür. Bulgular: SO2’ye maruz kalan ve kalmayan grupların yaş ortalamaları (sırasıyla 47.6±1.2, 45.2±3.4 ve sigara kullanma oranları (%64, %64 benzer idi (p>0.05. SO2’ye maruz kalanlarda balgam (%32 ve %16, p<0.05 ve öksürük varlığı (%24 ve %12, p<0.05, diğer gruptan anlamlı olarak yüksek bulunurken, zorlu solunum (%20 ve %20, p>0.05 ve patolojik solunum sesi varlığı (% 12 ve % 12, p>0.05 benzer bulunmuştur. Çalışanlarda, solunum fonksiyon testlerinden FEV1, FVC, FEV1/FVC, MEF (FEF25-75% değerleri, kontrol grubuna göre anlamlı olarak düşük bulunmuştur (hepsi için p<0.05. Sonuç: İsleme odalarında ölçülen SO2 düzeyi DSÖ ve NIOSH standartlarına göre yüksek bulunmuştur. İşyeri ortam havasında izin verilen değerlerin üzerinde bulunan SO2, çalışanların sağlığını, öncelikle de solunum sistemini etkilemektedir. Çalışanlar, bu risk etmeni konusunda bilgilendirilmeli ve korunma yöntemlerine ilişkin olarak eğitilmelidir. SO2’nin yoğun olduğu isleme bölümünde, havalandırma sistemlerinin iyileştirilmesinin yanı sıra, bu

  7. SÜREKLİ REJİM ENERJİ DENGESİ MODELİNE GÖRE ISIL KONFOR BÖLGELERİ

    Directory of Open Access Journals (Sweden)

    Ömer KAYNAKLI

    2003-01-01

    Full Text Available Bu çalışmada, sürekli rejim enerji dengesi modeli için verilen, vücut ile çevre arasındaki ısı geçişi denklemlerinden ve ısıl konfor ile vücuttaki fizyolojik kontrol mekanizmalarının etkilerini ifade eden ampirik bağıntılardan yararlanarak, insanların ısıl konfor şartlarını etkileyen sıcaklık, bağıl nem, hava hızı, metabolik aktivite ve giysi yalıtım dirençleri gibi parametrelerin değişimi ve birbirine etkileri incelenmiştir. ASHRAE Standart 55 - 1992'nin vermiş olduğu, bir ortamın konforlu olarak nitelendirilebilmesi için memnun olmayanların yüzdesinin (PPD % 10'u aşmaması gerektiği göz önünde tutularak insanların farklı şartlarda konforlu hissedebilmeleri için ısıl konfor bölgeleri çıkarılmış ve sonuçlar grafikler halinde sunulmuştur.

  8. Paper Records and Electronic Audits: A Step Towards Regaining Voter Trust

    Directory of Open Access Journals (Sweden)

    Mohammed Awad

    2010-04-01

    Full Text Available The shortcomings of the voting systems used in the 2000 presidential election raised the awareness of the need to replace these systems. As a result, with the funds of Help America Vote Act (HAVA, many US states switched to Direct Recording Electronic (DRE voting systems before the 2004 elections. Unfortunately these paperless voting machines were not as secure and efficient as state officials had hoped. Since their implementation, many studies have shown the threats of these systems and their flaws. While some data security experts tried to improve these voting systems, many discouraged their use and recommended more transparent methods.Although, several countries in Europe and around the world have successfully utilized E-voting, many US districts and states still don’t trust this technology and are returning to paper ballots. In this paper, we will propose a new system as a solution to the current problems. This approach combines the advantages of both paper ballots and Direct Recording Electronic (DRE voting systems while avoiding the major flaws of these systems.

  9. Sollama Esnasında Taşıt ve Yol ile İlgili Faktörlerin Karar Ağacı Yöntemiyle İrdelenmesi

    OpenAIRE

    Baha Vural KÖK; Necati KULOĞLU

    2005-01-01

    Bu çalışmada, sollama esnasında meydana gelen kafa kafaya çarpışmada yol ve taşıt özellikleri incelenerek en önemli faktörler karar ağacı yöntemiyle irdelenmiştir. Bu amaçla sollama yapacak taşıtın, önündeki taşıtın ve karşıdan gelen taşıtın hızlarını, karşıdan gelen taşıt ile sollama yapacak taşıt arasındaki mesafeyi, yolun eğimini, taşıt ağırlığını ve gücünü esas alan değişkenlerle matlap programı kullanılarak toplam 15625 veri oluşturulmuştur. Hava direnç katsayısı ve yol sürtünme katsayıl...

  10. Vote-by-Phone: An Investigation of a Usable and Accessible IVR Voting System

    Directory of Open Access Journals (Sweden)

    Danae Holmes

    2016-11-01

    Full Text Available One of the main goals of the Help America Vote Act (HAVA was to ensure that voters with disabilities could vote privately and independently. However, the current state of most voting methods does not allow for private and independent voting for everyone. In response to this issue, we tested a remote IVR voting system developed by Author 1 and Author 2 (2013, with an added audio speed adjustment feature and synthetic voice to increase usability and accessibility, especially for visually impaired voters (Pinter, 2011. The focus of this research was to examine the viability and usability of the IVR voting system as an accessible voting platform for visually impaired voters. The system was tested by users with and without visual impairments, and usability was measured using the three ISO 9241-11 usability metrics (ISO 9241-11, 1998 of efficiency (time to complete a ballot, effectiveness (accuracy, and satisfaction (subjective usability. Results indicate that the IVR voting system could be a viable voting alternative to other established voting methods, with similar performance among sighted and visually impaired users.

  11. Adolpho Lutz: um esboço biográfico

    Directory of Open Access Journals (Sweden)

    Benchimol Jaime Larry

    2003-01-01

    Full Text Available Este artigo retrata as origens familares e a trajetória de Adolpho Lutz (1855-1940 até sua transferência para o Instituto Oswaldo Cruz (IOC, em 1908. Utiliza o cientista como fio condutor para a análise da instituição das medicinas pasteuriana e tropical no Brasil. Examina seus estudos superiores e de aperfeiçoamento na Europa germânica, suas atividades como clínico e como investigador de temas relacionados à helmintologia, parasitologia, veterinária e bacteriologia no interior de São Paulo, sua estada no leprosário de Molokai, no Havaí, e controvérsias médicas de que participou durante o período em que chefiou o Instituto Bacteriológico de São Paulo, especialmente aquelas concernentes ao cólera, às disenterias, à febre tifóide, à malária e à febre amarela.

  12. Cold Ironing Yöntemi; Marport Limanı Uygulaması

    Directory of Open Access Journals (Sweden)

    N. Hakan PEKŞEN

    2014-06-01

    Full Text Available Deniz taşımacılığı, bilinen en çevre dostu taşımacılık türü olmasına rağmen, büyüyen deniz trafiği neticesinde gemi emisyonlarının sebep olduğu hava kirliliği ve bunların olumsuz etkileri kayda değer bir şekilde artmaktadır. Egzoz emisyonlarından kaynaklanan sera gazları ve hava kirleticileri; küresel ısınmaya, asit yağmurlarına ve hava kalitesinin azalmasına neden olarak, insan sağlığı üzerinde ciddi olumsuz etkilere sahiptir. Bu konuda, MARPOL 73/78 Sözleşmesinin EK-VI: Gemilerden Kaynaklanan Hava Kirliliği’nin Önlenmesine İlişkin Kurallar isimli protokolüyle, gemilerin egzoz gazlarından çıkan başlıca azot-oksit (NOX ve kükürt-oksit (SOX gibi emisyonların küresel ve özel bölgeler ilanı ile bölgesel boyutta sınırlandırılmasına ilişkin düzenlemeler getirilmiş olup Türkiye 26.02.2013 tarihinde kabul edilen 6438 sayılı Kanun ile bu protokole taraf olmuştur. “Gemilerden Kaynaklanan Emisyonların Azaltılması IPA Eşleşme Projesi” ve diğer resmi çalışmalar ile Marmara Denizinin en kısa sürede Emisyon Kontrol Alanı (ECA olarak özel bölge ilan edilmesi gündemdedir. Marmara Denizi ve Türk Boğazlarının ECA bölgesi ilan edilmesinden sonra, bu rotayı kullanacak olan gemilerin, ya içeriğindeki kükürt oranı %1 m/m den fazla olamayan fuel oil kullanması ya da alternatif teknoloji ve yöntemler kullanarak ana makine ve yardımcı makinelerinden salınan egzoz gazındaki toplam kükürt oksit miktarını 4.0 g SOX/kWh oranına düşürmesi gerekecektir. 2015 yılından sonra, bu rakamlar sırasıyla %0,1 m/m S ve 0,4 g SOX/kWh seviyesine düşecektir. Ayrıca mevcut “Bazı Akaryakıt Türlerindeki Kükürt Oranının Azaltılmasına İlişkin Yönetmelik” hükümlerine göre, Türk Karasularındaki rıhtımlarda bulunan gemilerin, kükürt miktarı kütlece %0,1’i aşan denizcilik yakıtlarını hali hazırda kullanmamaları gerekmektedir. Gemilerin

  13. A (desconstrução identitária da figura feminina na música ‘Algo Por Você’ dos Engenheiros do Hawaii

    Directory of Open Access Journals (Sweden)

    Josiany Sotolani da Silva

    2012-04-01

    Full Text Available A proposta deste artigo é analisar a construção (ou desconstrução da identidade feminina feita na música Algo por você, dos Engenheiros do Hawaii. Numa breve introdução, contextualizamos sobre a influência da música em nossas vidas. Dado este fato, justificamos a escolha pela música aqui estudada, pois se trata de uma letra riquíssima de sentidos e significações. Ela tira o „véu‟, sem tal pretensão, sobre quem precisa fazer algo por quem. É um grito de guerra à busca da própria mulher pela sua identidade, a que ela acha que foi perdida pela história, e que só depende dela para recuperar. A música foi analisada sob a luz da análise de discurso, sob os conceitos de sujeito, identidade e formações discursivas.Palavras-chave: letras; linguística; Análise de Discurso; música; figura feminina; Engenheiros do Havaí.

  14. FARKLI FREN DİSKLERİNDE OLUŞAN ISI DEĞİŞİMİNİN FRENLEME KUVVETLERİNE ETKİLERİ

    Directory of Open Access Journals (Sweden)

    Mesut DÜZGÜN

    2009-01-01

    Full Text Available Bu çalışmada iki farklı soğutmalı fren diski üretilerek bunların normal fren diski ile frenleme performansları ve ısı oluşumları deneysel olarak incelenmiştir. Ani frenlemeler ile frenleme kuvvetleri ve sürekli frenleme şartlarında sıcaklıklar ölçülmüştür. On dört farklı pedal kuvvetinde ani frenleme testleri ve sekiz farklı frenleme şartlarında ise frenleme sıcaklıkları test edilmiştir. Test sonuçlarına göre hava soğutma uygulaması, frenleme kuvvetini % 42,6 artırmakla birlikte şartlara bağlı olarak oluşan ısıyı da % 31,5 azaltmaktadır.

  15. A comparative study on cancer prevention principles between Iranian traditional medicine and classic medicine

    Directory of Open Access Journals (Sweden)

    Mehrdad Zeinalian

    2016-01-01

    Full Text Available Cancer is one of the three main causes of mortality in most human communities whose prevalence is being increased. A significant part of health budget in all countries has been allocated to treat the cancer, which is incurable in many cases. It has led the global health attitude to cancer prevention. Many cancer-related risk factors have been identified for which preventive recommendations have been offered by international organizations such as World Health Organization. Some of the most important of these risk factors are smoking and alcohol consumption, hypercaloric and low-fiber diet, obesity, inactivity, environmental and industrial pollution, some viral infections, and hereditary factors. Exact reviewing of Iranian-Islamic traditional medicine (IITM resources determines that preventive rules, which named as six essential rules (Sitteh-e-Zarurieah are abundantly found, including all identified cancer-related risk factors. These preventive rules are: Air (Hava, body movement and repose, sleep and wakefulness, food and drink, evacuation and retention, and mental movement and repose (A′raz-e-Nafsani. The associated risk factors in classic medicine are: Smoking and air pollution, sedentary life, sleep disturbance, improper nutrition and alcohol, chronic constipation, and psychoneurotic stresses. Moreover, these rules are comprehensive enough to include many of the other harmful health-related factors whose roles have been confirmed in the occurrence of different diseases, except cancer. Apparently, cancer prevention in Iran would be more successful if the sextet necessary rules of IITM are promoted among the populations and health policy makers.

  16. Quantifying Differences in Health Care Consumption for the Management of Multiple Sclerosis Within Privately and Publicly Insured Health Care Programs.

    Science.gov (United States)

    Livingston, Terrie; Fay, Monica; Iyer, Ravi; Wells, Wendy; Pill, Michael W

    2016-12-01

    Multiple sclerosis (MS) is a chronic and debilitating disease of the central nervous system that affects more than 570,000 persons in the United States and 2.3 million worldwide. Since most individuals experience initial symptoms between the ages of 20 and 40 years, MS can have a significant effect on health care consumption, quality of life, productivity, and employment over the long-term disease course. Opportunities exist to better understand how benefit design and other nonclinical factors can affect health care delivery and associated costs. To observe and report variances in health care consumed for the treatment of MS in patients enrolled in privately (commercial) and publicly (Medicaid) funded health insurance programs. In a retrospective analysis using Havas Gemini's proprietary MS Benchmarks Disease-Modeling Process and IMS LifeLink Health Plan Claims and Longitudinal Prescriptions databases, integrated medical and pharmacy claims data were analyzed to select patients with a diagnosis of MS during the 2012 calendar year. Comorbidities were determined using ICD-9-CM codes present on medical claims. Prescription drug use was evaluated by pharmacy claims and drug-specific billing codes. 19,984 patients with MS were identified-18,269 from commercial payers and 1,715 from Medicaid. Although total annual costs related to the care of MS for the groups reflected a relatively small difference ($31,107 commercial; $33,344 Medicaid), costs associated with specific service categories varied greatly. Pharmacy costs were considerably less in the Medicaid group; however, inpatient and emergency room costs were as much as 5 times higher. Overall use of disease-modifying treatments (DMTs) in the Medicaid group was seen in 32.5% of patients and 52.1% in the commercial patient group. Thus, lower pharmacy costs in the Medicaid group were possibly related to lesser use of DMTs among that group of patients. This analysis illustrates that notable variances exist in consumption

  17. Violin Pedagogy and the Physics of the Bowed String

    Science.gov (United States)

    McLeod, Alexander Rhodes

    The paper describes the mechanics of violin tone production using non-specialist language, in order to present a scientific understanding of tone production accessible to a broad readership. As well as offering an objective understanding of tone production, this model provides a powerful tool for analyzing the technique of string playing. The interaction between the bow and the string is quite complex. Literature reviewed for this study reveals that scientific investigations have provided important insights into the mechanics of string playing, offering explanations for factors which both contribute to and limit the range of tone colours and dynamics that stringed instruments can produce. Also examined in the literature review are significant works of twentieth century violin pedagogy exploring tone production on the violin, based on the practical experience of generations of teachers and performers. Hermann von Helmholtz described the stick-slip cycle which drives the string in 1863, which replaced earlier ideas about the vibration of violin strings. Later, scientists such as John Schelleng and Lothar Cremer were able to demonstrate how the mechanics of the bow-string interaction can create different tone colours. Recent research by Anders Askenfelt, Knut Guettler, and Erwin Schoonderwaldt have continued to refine earlier research in this area. The writings of Lucien Capet, Leopold Auer, Carl Flesch, Paul Rolland, Kato Havas, Ivan Galamian, and Simon Fischer are examined and analyzed. Each author describes a different approach to tone production on the violin, representing a different understanding of the underlying mechanism. Analyzing these writings within the context of a scientific understanding of tone production makes it possible to compare these approaches more consistently, and to synthesize different concepts drawn from the diverse sources evaluated.

  18. An in silico high-throughput screen identifies potential selective inhibitors for the non-receptor tyrosine kinase Pyk2

    Directory of Open Access Journals (Sweden)

    Meirson T

    2017-05-01

    Full Text Available Tomer Meirson, Abraham O Samson, Hava Gil-Henn Faculty of Medicine in the Galilee, Bar-Ilan University, Safed, Israel Abstract: The non-receptor tyrosine kinase proline-rich tyrosine kinase 2 (Pyk2 is a critical mediator of signaling from cell surface growth factor and adhesion receptors to cell migration, proliferation, and survival. Emerging evidence indicates that signaling by Pyk2 regulates hematopoietic cell response, bone density, neuronal degeneration, angiogenesis, and cancer. These physiological and pathological roles of Pyk2 warrant it as a valuable therapeutic target for invasive cancers, osteoporosis, Alzheimer’s disease, and inflammatory cellular response. Despite its potential as a therapeutic target, no potent and selective inhibitor of Pyk2 is available at present. As a first step toward discovering specific potential inhibitors of Pyk2, we used an in silico high-throughput screening approach. A virtual library of six million lead-like compounds was docked against four different high-resolution Pyk2 kinase domain crystal structures and further selected for predicted potency and ligand efficiency. Ligand selectivity for Pyk2 over focal adhesion kinase (FAK was evaluated by comparative docking of ligands and measurement of binding free energy so as to obtain 40 potential candidates. Finally, the structural flexibility of a subset of the docking complexes was evaluated by molecular dynamics simulation, followed by intermolecular interaction analysis. These compounds may be considered as promising leads for further development of highly selective Pyk2 inhibitors. Keywords: virtual screen, efficiency metrics, MM-GBSA, molecular dynamics

  19. POMZA AGREGALI TAŞIYICI HAFİF BETONUN MEKANİK ÖZELLİKLERİNİN İNCELENMESİ

    Directory of Open Access Journals (Sweden)

    Selçuk TÜRKEL

    2007-03-01

    Full Text Available Bu çalışmada, Kayseri bölgesine ait pomza agregası kullanılarak taşıyıcı amaçlı hafif betonlar üretilmiştir. Hafif beton karışımlarında bağlayıcı madde olarak CEM I 42.5 çimentosu ve mineral katkı olarak silis dumanı ve uçucu kül kullanılmıştır. Hafif betonlar üzerinde taze durumda çökme, birim hacim ağırlık ve hava içeriği deneyleri gerçekleştirilmiştir. Sertleşmiş hafif betonların ise basınç dayanımı, eğilme dayanımı ve yarmada çekme dayanımı belirlenmiştir. Test edilen sonuçlar, pomza agregası kullanılarak ACI 213R-87'de taşıyıcı hafif betonlar için belirtilen 17.2 MPa dayanım değerinin oldukça üzerinde dayanım değerine sahip taşıyıcı hafif betonlar üretilebileceğini göstermiştir. Ayrıca bu çalışmada üretilen hafif betonlar, TS EN 206-1 standardında hafif betonlar için belirtilen LC 20/22 ve LC 25/28 dayanım sınıflarını sağlamaktadır.

  20. Biyometrik Güvenlik Sistemlerinin İncelenmesi

    Directory of Open Access Journals (Sweden)

    Nursel YALÇIN

    2015-02-01

    Full Text Available Biyometrik sistemler, bireylerin fiziksel ve davranışsal özelliklerini tanımlayarak kimliklendirme yapan sistemlerdir. En yaygın kullanılanları ise parmak izi, el geometrisi, ses, retina, yüz, imza vb. biyometriklerdir. Bu sistemler günümüzde hava alanlarında, fabrikalarda ve yüksek güvenlik gerektiren binalar gibi alanlarda, giriş çıkışları kontrol etmede ya da girilen verileri onaylama gibi süreçlerde kullanılmaktadır. Bunun yanında yaşam içerisinde bireylerin hayatını kolaylaştıracak akıllı sistemlerde, dijital fotoğraf makinelerinde, e-ticarette, kriminal incelemelerde vb. birçok alanda kullanılmaktadır. Her bir sistemin kendi içerisinde avantajları ve dezavantajları bulunmaktadır. Bu nedenle bu tür teknolojilerin başarısını belirlemek özellikle güvenliğin ön planda olduğu durumlarda kritik faktörler öngörmek çalışmalara yardımcı olacaktır. Bu çalışmada da genel olarak kullanılan biyometrik sistemler araştırılmış ve incelenen güncel çalışmalar içerisinde bu sistemlerle ilgili karşılaşılan sorunlara, biyometrik sistemlerinin birbirlerine göre avantajlarına yer verilmiş ve değerlendirmelerde bulunulmuştur.

  1. Avaliação do potencial alelopático de folhas de Passiflora cincinnata Mast. (Passifloraceae

    Directory of Open Access Journals (Sweden)

    F. Oliveria

    2014-11-01

    Full Text Available A alelopatia é um fenômeno pouco estudado no Cerrado. Assim, o objetivo deste trabalho foi verificar o potencial alelopático de extratos foliares de Passiflora cincinnata sobre o desenvolvimento inicial de espécies modelos. Para isso, o extrato etanólico bruto e frações hexânica, acetato de etila e metanólica, em diferentes concentrações (0, 250, 500, 1000, 2000 e 4000mgL-1 foram utilizadas em bioensaios de germinação e crescimento de alface (Lactuca sativa var. Grand rapids e milho (Zea mays var. Havaí.. Diariamente, avaliou-se o percentual de germinação e o Índice de Velocidade de Germinação (IVG. O crescimento da radícula/raiz primária e do hipocótilo/coleóptilo foram medidos três dias após a protusão radicular. O experimento foi em fatorial (4x6, utilizando delineamento inteiramente casualizado, com cinco repetições. Os resultados demonstraram que não houve efeito significativo dos tratamentos sobre a germinação e IVG de alface, enquanto que o extrato etanólico bruto inibiu o comprimento do hipocótilo de alface, em 16,5%, comparado à frações hexânica e, em 16,8%, em relação às frações acetato de etila e metanólica. Não verificou-se efeito significativo dos tratamentos sobre milho. Assim, conclui-se que folhas de P. cincinnata apresentam atividade alelopática sobre o comprimento de alface, não promovendo efeito sobre milho.

  2. The relationship of language and emotion: N400 support for an embodied view of language comprehension.

    Science.gov (United States)

    Chwilla, Dorothee J; Virgillito, Daniele; Vissers, Constance Th W M

    2011-09-01

    According to embodied theories, the symbols used by language are meaningful because they are grounded in perception, action, and emotion. In contrast, according to abstract symbol theories, meaning arises from the syntactic combination of abstract, amodal symbols. If language is grounded in internal bodily states, then one would predict that emotion affects language. Consistent with this, advocates of embodied theories propose a strong link between emotion and language [Havas, D., Glenberg, A. M., & Rinck, M. Emotion simulation during language comprehension. Psychonomic Bulletin & Review, 14, 436-441, 2007; Niedenthal, P. M. Embodying emotion. Science, 316, 1002-1005, 2007]. The goal of this study was to test abstract symbol vs. embodied views of language by investigating whether mood affects semantic processing. To this aim, we induced different emotional states (happy vs. sad) by presenting film clips that displayed fragments from a happy movie or a sad movie. The clips were presented before and during blocks of sentences in which the cloze probability of mid-sentence critical words varied (high vs. low). Participants read sentences while ERPs were recorded. The mood induction procedure was successful: Participants watching the happy film clips scored higher on a mood scale than those watching the sad clips. For N400, mood by cloze probability interactions were obtained. The N400 cloze effect was strongly reduced in the sad mood compared with the happy mood condition. Furthermore, a difference in late positivity was only present for the sad mood condition. The mood by semantic processing interaction observed for N400 supports embodied theories of meaning and challenges abstract symbol theories that assume that processing of word meaning reflects a modular process.

  3. TWO IMPORTANT DEVELOPMENT THROUGHT THE TUSKISH HISTORY IN THE 20 TH CENTURY: THE RISING OF AVIATION AND A LEADER TÜRK TARİHİ BAKIMINDAN 20. YÜZYILDA İKİ ÖNEMLİ GELİŞME:“HAVACILIĞIN VE BİR LİDERİN DOĞUŞU”

    Directory of Open Access Journals (Sweden)

    Osman YALÇIN

    2011-06-01

    Full Text Available Planes are one of the most important discoveries of the 20th century. This was the last period of the Ottman Empire. This was also the first years of Mustafa Kemal Atatürk’s military life.Turkish government used the airplane in military field firstly in Balkan Wars. Ottoman Empire bought about 450-500 airplanes between 1912-1918 years. Turkish air forces was the one of the first establishments that constituted by parlement at the independence war years. Ever pressed Greek air force, enemy planes were not adducted to Turkish frontline. Ottoman aviation was abolished in 1920. Atatürk became aware of the aviation with his for seeing and the experiences that for he considered important of aviation for making the country strong and independent during his life. But he also foresaw his country insufficiency at substructure and between 1923-1938 air war industry consider important. Therefore flying of younger generation has been seen as a security of the Turkey sky.One of the mottos of Mustafa Kemal ATATURK “Future is in the skies” was also a sign of his foreseing as a strategist which effects continues even today Uçaklar 20. yüzyılın başında icat edilen önemli gelişmelerden biridir. Bu tarih Osmanlı Devleti’nin son zamanlarına denk gelmektedir. Mustafa Kemal Atatürk’ün ise mesleki hayatının ilk yıllarına rastlamıştır.Türk Devleti uçağı askeri alanda ilk defa Balkan Savaşlarında kullanmıştır. Osmanlı Devleti ordusu envanterine 1912–1918 arasında yaklaşık 450–500 uçak alınmıştır. Osmanlı havacılığı 1920 yılında lağv edilmiştir. İstiklâl Savaşı yıllarında Büyük Millet Meclisi’nin teşkilatını kurduğu ilk birimlerden biri Hava Kuvvetleri Teşkilatı olmuştur. İstiklâl Savaşı’nda, Yunanlıların hava gücü daima baskı altında tutulmuş, düşman uçakları Türk cephesine yaklaştırılmamıştır. Atatürk, askerlik hayatındaki tecrübeleri ve öngörüleri ile havac

  4. Adolpho Lutz and controversies over the transmission of leprosy by mosquitoes Adolpho Lutz e as controvérsias sobre a transmissão da lepra por mosquitos

    Directory of Open Access Journals (Sweden)

    Jaime L. Benchimol

    2003-01-01

    Full Text Available During his years of study in Switzerland and Germany, Adolpho Lutz published his first articles on zoology, clinical practice, and therapeutics. In Limeira, São Paulo, he began studies on animal and human diseases caused by germs and parasites. In 1885-86, Lutz traveled to Hamburg to study the morphology of germs related to skin diseases, in conjunction with Paul Gerson Unna, one of Germany's foremost dermatologists. He proposed the inclusion of Hansen's and Koch's bacilli in a new genus. In 1889, Unna nominated his student as physician-in-chief of the Leper Settlement on Molokai Island, Hawaii. From then on, Lutz sustained the theory that the disease was transmitted by mosquitoes. He conducted research to prove this theory when he was head of the Instituto Bacteriológico de São Paulo (1893-1908 and, later, after he moved to the Instituto Oswaldo Cruz (1908-1940. Although this research was not successful, on commissions and at congresses in which he participated until his death in October 1940, he still held to his conviction that leprosy was transmitted by mosquitoes.Quando estudava na Suíça e Alemanha, Adolpho Lutz publicou os primeiros trabalhos sobre zoologia, clínica e terapêutica. Em Limeira, São Paulo, iniciou estudos sobre doenças humanas e animais causadas por germes e parasitas. Em 1885-86, viajou para Hamburgo para estudar microrganismos relacionados a doenças de pele sob a orientação de Paul Gerson Unna, um dos mais renomados dermatologistas alemães. Propôs a inclusão dos bacilos de Hansen e Koch num novo gênero. Em 1889, Unna indicou seu discípulo como chefe dos serviços médicos do Leprosário de Molokai, no Havaí. Lutz passou a defender a transmissão da doença por mosquitos. Realizou pesquisas para provar esta teoria depois que assumiu a chefia do Instituto Bacteriológico de São Paulo (1893-1908 e, sobretudo, após a transferência para o Instituto Oswaldo Cruz (1908-1940. Apesar de não terem sido bem

  5. Peyzaj Planlamada Biyoklimatik Konfor Alanların Belirlenmesi: Cide Kıyı Şeridi Örneği

    Directory of Open Access Journals (Sweden)

    Mehmet Cetin

    2016-09-01

    Full Text Available Genellikle insanlar sıcaklık, yağış, nem ve rüzgâr gibi çevre şartlarının belirli aralıklarda olduğu durumlarda kendilerini daha sağlıklı ve dinamik hissederler. Bu değerlerin insanlar için uygun aralıklarda olması Biyoklimatik konfor olarak isimlendirilir. Biyoklimatik konfor uygun değer aralığında olmadığında insanlar o alanlarda rahatsız olur ve alandan uzaklaşmak isterler. Dolayısıyla turizm amaçlı olarak kullanılan alanlarda Biyoklimatik konfor oldukça önemlidir. Bu çalışmada, Kastamonu-Cide kıyı şeridinin Biyoklimatik konfor haritalamasının yapılması ve böylece benzer yapıda ki kıyı alanlarında yapılacak benzer çalışmalara altlık oluşturulması amaçlanmıştır. Bu amaçla, Cide’nin bulunduğu bölgenin iklim verilerinden; fizyolojik eşdeğer sıcaklık endeksine göre Biyoklimatik konfor haritaları üretilmiştir. Alanın Biyoklimatik konfor yapısını belirlemek için, iklimsel veriler meteoroloji istasyonundan toplanmıştır. Elde edilen veriler Rayman 1,2 vasıtasıyla değerlendirilmiş ve coğrafi bilgi sistemi (CBS yazılımları yardımıyla termal algı haritaları üretmek için kullanılmıştır. Çalışma sonucunda psikolojik eşit sıcaklık değerlerine göre, açık hava rekreasyon faaliyetleri için en uygun dönemler ve bölgeler termal algı haritaları vasıtasıyla tespit edilmiştir. Kısaca sonuç yazılmalıdır.

  6. Development and evaluation of a service-learning model for preclinical student education in cardiovascular disease prevention

    Directory of Open Access Journals (Sweden)

    Shah NS

    2016-03-01

    Full Text Available Nilay S Shah,* Jasmine Rassiwala,* Allison L Ducharme-Smith, David A Klein, Ashley S Kim, Claudia Leung, Rabih Dahdouh, Stephen Havas Department of Preventive Medicine, Northwestern University Feinberg School of Medicine, Chicago, IL, USA  *These authors contributed equally to this workBackground: Cardiovascular diseases are the leading cause of preventable morbidity and mortality in the USA. Medical schools must prepare trainees to address prevention, including improving ability in counseling patients to modify lifestyle risk factors. Most medical students do not receive significant training or clinical experience in preventive medicine until the clinical years of medical school. To enhance student education in disease prevention and lifestyle counseling, and simultaneously target cardiovascular disease prevention in high-risk Chicago neighborhoods, the Northwestern University Feinberg School of Medicine and Chicago Department of Public Health with support from the GE Foundation, developed the Keep Your Heart Healthy program.Methods: Medical students participated in intensive faculty-led training. They subsequently screened local residents to identify and counsel for cardiovascular disease risk factors. Fifty-one predominantly preclinical medical students screened residents of the Humboldt Park and North Lawndale neighborhoods in Chicago, IL, at 31 screening events from August to December 2013. Fifty students (98% response rate completed a survey assessing the educational value of various program components following the pilot.Results: Of all respondents, 92% of students reported improved knowledge of cardiovascular disease prevention and 94% reported improved knowledge of vulnerable populations and health equity. The majority (88% reported that their participation supplemented material they learned in the classroom. Eighty-six percent of students reported that their encounters with community participants were of educational value

  7. OTOMATİK YÖNLENDİRMELİ ARAÇ (OYA SİSTEMLERİ VE DEPO BAKIMINDA ROTALAMA PROBLEMİ

    Directory of Open Access Journals (Sweden)

    Fatih YİĞİT

    2003-02-01

    Full Text Available Fabrika otomasyonunun tam otomasyona geçiş aşamasında malzeme taşıma sistemleri oldukça önem taşır. Malzeme taşıma sistemleri arasında en fazla teknolojik gelişmeler otomatik yönlendirmeli araçlar (OYA üzerinde yoğunlaşmıştır. OYA'lar birim yükü dışarıdan gelen rehber sinyaller vasıtasıyla bir yerden başka bir yere taşıyan sürücüsüz araçlardır. Bu araçlar sahip oldukları esneklik özellikleri ile günümüzde hizmet sektöründen üretim sektörüne bir çok alanda kullanılabilmektedir. Bu çalışmada, hava araçlarına ait parçaların (AH-1W model helikopterin bakım, onarım ve yenileştirme işlemlerinin yapıldığı depo bakım atölyelerinde (aviyonik atölyeleri parçaların etkin ve hızlı bir şekilde dağıtılıp toplanması işlemlerinde OYA'ların kullanımı le alınarak OYA tasarımı ve OYA'ların rotalanması problemi incelenmiştir. OYA'ların rotalanması problemi gezgin satıcı problemi ile benzer bir problemdir. Bu problem 0-1 tamsayılı programlama modeli olarak modellenmiş ve LINGO paket programı kullanılarak çözülmüştür.

  8. Three-minute constant rate step test for detecting exertional dyspnea relief after bronchodilation in COPD

    Directory of Open Access Journals (Sweden)

    Borel B

    2016-11-01

    Full Text Available Benoit Borel,1,2 Courtney A Wilkinson-Maitland,3 Alan Hamilton,4 Jean Bourbeau,5 Hélène Perrault,6 Dennis Jensen,3,5,7 François Maltais2 1Laboratoire HAVAE, Université de Limoges, Limoges, France; 2Centre de Recherche, Institut Universitaire de Cardiologie et de Pneumologie de Québec, Université Laval, Québec, 3Clinical Exercise and Respiratory Physiology Laboratory, Department of Kinesiology and Physical Education, McGill University, Montréal, QC, 4Boehringer Ingelheim (Canada Limited, Burlington, ON, 5Respiratory Epidemiology and Clinical Research Unit, Montreal Chest Institute, McGill University Health Center, Montreal, QC, 6Faculty of Health Sciences, University of Ottawa, Ottawa, ON, 7Translational Research in Respiratory Diseases Program, Research Institute of the McGill University Health Centre, Montreal, QC, Canada Background: The aim of this study was to evaluate the responsiveness of the 3-minute constant rate step test (3-MST to detect the relief of exertional dyspnea (respiratory discomfort after acute bronchodilation in COPD patients. Patients and methods: A total of 40 patients with moderate-to-severe COPD (mean forced expiratory volume in 1 second: 45.7 (±14.7, % predicted performed four 3-MSTs at randomly assigned stepping rates of 14, 16, 20 and 24 steps/min after inhalation of nebulized ipratropium bromide (500 µg/salbutamol (2.5 mg and saline placebo, which were randomized to order. Patients rated their intensity of perceived dyspnea at the end of each 3-MST using Borg 0–10 category ratio scale. Results: A total of 37 (92.5%, 36 (90%, 34 (85% and 27 (67.5% patients completed all 3 minutes of exercise at 14, 16, 20 and 24 steps/min under both treatment conditions, respectively. Compared with placebo, ipratropium bromide/salbutamol significantly decreased dyspnea at the end of the third minute of exercise at 14 steps/min (by 0.6±1.0 Borg 0–10 scale units, P<0.01 and 16 steps/min (by 0.7±1.3 Borg 0–10 scale

  9. Importance of fundamental sp, sp2, and sp3 hydrocarbon radicals in the growth of polycyclic aromatic hydrocarbons.

    Science.gov (United States)

    Shukla, Bikau; Koshi, Mitsuo

    2012-06-05

    The most basic chemistry of products formation in hydrocarbons pyrolysis has been explored via a comparative experimental study on the roles of fundamental sp, sp(2), and sp(3) hydrocarbon radicals/intermediates such as ethyne/ethynyl (C(2)H(2)/C(2)H), ethene/ethenyl (C(2)H(4)/C(2)H(3)), and methane/methyl (CH(4)/CH(3)) in products formations. By using an in situ time-of-flight mass spectrometry technique, gas-phase products of pyrolysis of acetylene (ethyne, C(2)H(2)), ethylene (ethene, C(2)H(4)), and acetone (propanone, CH(3)COCH(3)) were detected and found to include small aliphatic products to large polycyclic aromatic hydrocarbons (PAHs) of mass 324 amu. Observed products mass spectra showed a remarkable sequence of mass peaks at regular mass number intervals of 24, 26, or 14 indicating the role of the particular corresponding radicals, ethynyl (C(2)H), ethenyl (C(2)H(3)), or methyl (CH(3)), in products formation. The analysis of results revealed the following: (a) product formation in hydrocarbon pyrolysis is dominated by hydrogen abstraction and a vinyl (ethenyl, C(2)H(3)) radical addition (HAVA) mechanism, (b) contrary to the existing concept of termination of products mass growth at cyclopenta fused species like acenaphthylene, novel pathways forming large PAHs were found succeeding beyond such cyclopenta fused species by the further addition of C(2)H(x) or CH(3) radicals, (c) production of cyclopenta ring-fused PAHs (CP-PAHs) such as fluoranthene/corannulene appeared as a preferred route over benzenoid species like pyrene/coronene, (d) because of the high reactivity of the CH(3) radical, it readily converts unbranched products into products with aliphatic chains (branched product), and (e) some interesting novel products such as dicarbon monoxide (C(2)O), tricarbon monoxide (C(3)O), and cyclic ketones were detected especially in acetone pyrolysis. These results finally suggest that existing kinetic models of product formation should be modified to include

  10. Türkiye’de Limon Üretim Bölgesine Yakın Yerlerde Kullanılan Doğal Depoların Mevcut Durumu ile Sıcaklık ve Nem Durumlarının Araştırılması

    Directory of Open Access Journals (Sweden)

    İhsan CANAN

    2015-12-01

    Full Text Available Bu araştırma ile; iki muhafaza sezonu boyunca Mersin ili yayla limon depoları ve Ürgüp Ortahisar’daki depoların iç ve dış sıcaklığı ile oransal nem değerleri incelerek mevcut durumları ortaya konmuş, eksik ve yanlış uygulamalar tespit edilmiş ve halen Ürgüp depolarına götürülen limonların üretim bölgesinde depolanma imkanları araştırılmıştır. Mersin ili yayla limon depoları oransal nem konusunda yeterlidir ancak özellikle Temmuz ve Ağustos aylarında limon depolamak için birkaç derece (15-19 °C sıcaktır. Bu aylarda gerektiğinde serinletme yapılmalıdır. Ortahisar depolarının sıcaklık değerlerinin limon muhafazası için çok uygundur, ancak diğer kalite kriterleri ve derim sonrası kayıpların yayla depoları ile aynı, hatta bazı durumlarda daha fazla olduğu görülmektedir. Ortahisar depolarında yüksek oransal nem vardır ve depo havası yeterince tahliye edilememektedir. Tüm depolarda Aralık ayında limon taşımak için depo içi sıcaklıklar düşüktür ve bu ayda limon taşımak için gerektiğinde ısıtma yapılmalıdır. Tüm depolarda havalandırma sorunları vardır ve havalandırma en iyi olacak şekilde tedbirler alınmalıdır.

  11. ATMOSFERİK ÇÖKELME TAYİN YÖNTEMLERİ

    Directory of Open Access Journals (Sweden)

    Hanefi BAYRAKTAR

    2004-01-01

    Full Text Available Doğal ve/veya antropojenik kaynaklardan atılan kirleticilerin atmosferde çeşitli süreçlerden geçtikten sonra tekrar yeryüzeyine dönmeleri atmosferik çökelme olarak tanımlanmaktadır. Kuru ve/veya ıslak olarak gerçekleşen atmosferik çökelme, giriş yaptığı su, bitki örtüsü, toprak, çeşitli tarihi ve diğer yapılar gibi ortamlara verdiği zararlardan dolayı son yıllarda ağırlıklı olarak çalışılan konulardan biridir. Ancak atmosferik çökelme tayini çok çeşitli ve değişken parametrelerin etkisinde olduğundan tespiti oldukça zordur ve çeşitli örnekleme cihazı ve örnekleme yüzeylerine ihtiyaç duyulmaktadır. Islak çökelme manuel veya otomatik kontrollü cihazlarla örneklenebilirken, kuru çökelmede, çeşitli meteorolojik ve topografik etkileri minimize etmek için örnekleme yüzeyleri kullanılmaktadır. Yapılan çalışmalar su yüzeyli örnekleyicilerin hem kuru hem de toplam (bulk çökelmeyi örneklemede daha uygun olduğunu göstermektedir. Bu makalede, atmosferik çökelme olayı ve tayin yöntemleri özetlenmiş, çeşitli hava kirleticilerin çökelme akılarını belirlemek için geliştirilmiş toplama yüzeyleri birbirleriyle kıyaslanmıştır.

  12. Homojen Karışımlı Sıkıştırma Ateşlemeli (HCCI bir motorun tek-bölgeli modelleme yöntemi kullanılarak analizi

    Directory of Open Access Journals (Sweden)

    Halit Yaşar

    2016-12-01

    Full Text Available HCCI motorların modellenmesinde sıfır-boyutlu modeller yaygın olarak kullanılmaktadır. Bu modeller tek veya çok bölge içerebilirler. Bununla birlikte, en basit yaklaşım yanmış ve yanmamış gazı içeren tek bölge yaklaşımıdır. Bu tip sıfır-boyutlu modellerde yanma olayı Wiebe fonksiyonu ile modellenmektedir. Bu makalede, HCCI prensibine göre çalışan tek silindirli bir Ricardo Hydra motoru tek bölge yaklaşımı kullanılarak modellenmiştir. Analiz çalışmalarında SPICE (Simulated Petrol Internal Combustion Engine yazılımının modifiye edilmiş bir versiyonu olan TRICE yazılımı kullanılmıştır. Yanma analizlerinde, HCCI yanma modellerinde standart Wiebe fonksiyonu kullanımının maksimum silindir basıncının yüksek olarak tahmin edilmesi sonucunu doğurması nedeniyle, standart Wiebe fonksiyonunun modifiye edilmiş bir şekli olan Double-Wiebe fonksiyonu kullanılmıştır. Analizler, n-Heptan-Toluen karışımı için üç hava fazlalık katsayısı değerinde gerçekleştirilmiş ve elde edilen sonuçlar bir Avrupa Komisyonu Marie Curie destek programı (FP-6 projesi kapsamında Shell Araştırma Merkezine ait motor test laboratuvarında ölçülen deneysel verilerle karşılaştırılmıştır.

  13. On Darboux's approach to R-separability of variables. Classification of conformally flat 4-dimensional binary metrics

    Science.gov (United States)

    Szereszewski, A.; Sym, A.

    2015-09-01

    The standard method of separation of variables in PDEs called the Stäckel-Robertson-Eisenhart (SRE) approach originated in the papers by Robertson (1928 Math. Ann. 98 749-52) and Eisenhart (1934 Ann. Math. 35 284-305) on separability of variables in the Schrödinger equation defined on a pseudo-Riemannian space equipped with orthogonal coordinates, which in turn were based on the purely classical mechanics results by Paul Stäckel (1891, Habilitation Thesis, Halle). These still fundamental results have been further extended in diverse directions by e.g. Havas (1975 J. Math. Phys. 16 1461-8 J. Math. Phys. 16 2476-89) or Koornwinder (1980 Lecture Notes in Mathematics 810 (Berlin: Springer) pp 240-63). The involved separability is always ordinary (factor R = 1) and regular (maximum number of independent parameters in separation equations). A different approach to separation of variables was initiated by Gaston Darboux (1878 Ann. Sci. E.N.S. 7 275-348) which has been almost completely forgotten in today’s research on the subject. Darboux’s paper was devoted to the so-called R-separability of variables in the standard Laplace equation. At the outset he did not make any specific assumption about the separation equations (this is in sharp contrast to the SRE approach). After impressive calculations Darboux obtained a complete solution of the problem. He found not only eleven cases of ordinary separability Eisenhart (1934 Ann. Math. 35 284-305) but also Darboux-Moutard-cyclidic metrics (Bôcher 1894 Ueber die Reihenentwickelungen der Potentialtheorie (Leipzig: Teubner)) and non-regularly separable Dupin-cyclidic metrics as well. In our previous paper Darboux’s approach was extended to the case of the stationary Schrödinger equation on Riemannian spaces admitting orthogonal coordinates. In particular the class of isothermic metrics was defined (isothermicity of the metric is a necessary condition for its R-separability). An important sub-class of isothermic metrics

  14. İstanbul’da Tüplü Dalış Ölümleri

    Directory of Open Access Journals (Sweden)

    Aykut Taner Güven

    2004-08-01

    Full Text Available Türkiye’de tüplü dalış aktivitesi günden güne gelişmektedir. Dalıcı sayısının artmasına bağlı olarak dalışa bağlı ölümlerde de belirgin artış görülmektedir. İngiltere’de yapılan bir araştırmada yetmiş beş bin dalışta bir ölüm, beş bin dalışta bir kaza olayı meydana geldiği ortaya konmuştur. Tüplü dalış sırasında meydana gelen ölümlere günlük otopsi rutininde ender rastlanmaktadır.Adli Tıp Kurumu (ATKMorg İhtisas Dairesi’nde 1995-2001 yılları arasındaki kayıtların taranması sonucunda üç tüplü dalış ölümü olgusuna otopsi yapıldığı tespit edilmiştir. Olgular incelendiğinde olay yeri inceleme bulgularının otopsiyi yapan adli hekime ulaşmadığı, saptanan harici lezyonların orijininin karanlıkta kaldığı veya kesin ölüm nedeninin saptanamadığı görülmüştür. Gelecekte, kanıt zincirinin kopmaması için camiamızda dalış eğitimi almış, gerektiğinde olay yeri incelemesine katılabilecek bilgi birikimine sahip adli tıp uzmanlarının yer alması gerektiğine inanıyoruz. Anahtar kelimeler: Adli otopsi, tüplü dalış ölümleri, hava embolisi, barotravma, dekompresyon hastalığı.

  15. Consumo alimentar e fatores dieteticos envolvidos no processo saude e doenca de Nikkeis: revisao sistematica

    Directory of Open Access Journals (Sweden)

    Fabiana Hitomi Tanabe

    2013-06-01

    Full Text Available OBJETIVO: Analisar consumo alimentar e fatores dietéticos envolvidos no processo saúde e doença da população de nikkeis. MÉTODOS: Foi realizada revisão sistemática da literatura, com buscas nas bases de dados do Lilacs, SciELO e PubMed/Medline, referente ao período de 1997 a 2012, de estudos observacionais sobre o consumo alimentar de nikkeis. Inicialmente, foram analisados 137 títulos e resumos, sendo excluídos estudos de intervenção, aqueles que apresentavam somente níveis séricos de vitaminas e metabólitos e estudos que não contemplassem o objetivo da revisão. Desses, foram selecionados 38 estudos avaliados com base no método de Downs & Black (1998, adaptado para estudos observacionais, permanecendo 33 para análise. RESULTADOS: Foram encontrados poucos estudos sobre consumo alimentar de nikkeis fora do Havaí, dos Estados Unidos e do estado de São Paulo (principalmente em Bauru, no Brasil. Houve elevada contribuição dos lipídios no valor calórico total dos nipo-brasileiros, em detrimento dos carboidratos e das proteínas. Nos Estados Unidos, a prevalência de consumo de alimentos de alta densidade energética foi elevada em nipo-americanos. Os nisseis (filhos de imigrantes apresentaram, em média, maior consumo de produtos da dieta japonesa, enquanto os sanseis (netos de imigrantes apresentaram um perfil alimentar mais ocidentalizado. CONCLUSÕES: O consumo alimentar de nikkeis, embora ainda conservando alguns hábitos alimentares de japoneses nativos, revela alta prevalência de consumo de alimentos típicos do padrão ocidental (alimentos processados, ricos em gorduras e sódio e pobres em fibras, que pode estar contribuindo para o aumento de doenças crônicas nessa população.

  16. Madde Etkisi Şüphesi Altındaki Sürücülerde Tükürük Analizi

    Directory of Open Access Journals (Sweden)

    Serap Annette Akgür

    2006-04-01

    Full Text Available İlaç/maddelerin trafik kazalarına etkisi bir çok yayında gösterilmiştir. Son on yılda, yol üzerinde uygulanabilen madde testleriyle ilişkili birçok gelişme meydana gelmiştir. Kötüye kullanımı olan maddelerin etkisi altındaki sürücünün saptanmasına yönelik hızlı, güvenilir ve kolay uygulanabilir yol üzeri testler, ter, idrar ve tükürük gibi alternatif matriksler üzerine odaklanmıştır. Avrupa birliği ROSITA projesi (Road Side Testing Assessment, kannabinoid, opiat, amfetamin ve türevlerinin yüksek prevalans gösterdiği birçok yasadışı maddenin, farklı biyolojik matrikslerde bulunduğunu göstermiştir. Ege Üniversitesi ve İzmir Emniyet müdürlüğü’nün işbirliği ve Cozart firmasının katkılarıyla bu proje gerçekleştirilmiştir. Bu projenin amacı, bu yol üzeri uygulanan testin kullana-bilirliği ve uygulanabilirliği yanında polis tarafından karşılaşabilecek problemleri saptamaktır. Bu çalışmada trafik kontrol noktalarında randomize olarak seçilen 25 araç sürücüsünde solunum havasında etilalkol analizi yanında tükürükte kötüye kullanımı olan maddelerin analizi için Cozart Bioscience Ra-piscan 5’li tükürük panel testi (kannabinoid, amfetamin, kokain, opiat ve benzodiazepin uygulanmıştır. Kişiler gönüllü onam formunu imzalayarak çalışmaya katılmışlardır. Doğrulama GC-MS’le yapılmış; oral sıvıda MDA 65 ng/mL ve MDMA 180 ng/mL olarak bulunmuştur. Anahtar kelimeler: Madde etkisi altında taşıt sürme, yol üzeri madde testi, tükürük

  17. Düzce Üniversitesi

    Directory of Open Access Journals (Sweden)

    Aysun TUNA

    2015-06-01

    Full Text Available Çevre sorunlarının başında yer alan hızlı nüfus artışı, yoğun yapılaşma ve hatalı kent planlamaları, kentsel ekolojik dengenin bozulmasına neden olmaktadır. Kentsel açık yeşil alan sistemleri, insan ve doğa arasındaki bozulan ilişkiyi dengelemek ve kentsel yaşam koşullarını iyileştirmek gibi önemli işlevlere sahiptir. Kentlerin yaşanabilirliği, ekolojik çevre koruması, kent estetiği, eğitim ve rekreasyon gibi kent üzerinde önemli katkıları bulunan parklar, açık yeşil alan sisteminin bileşenleridir. Kentsel doku içinde birçok fonksiyona sahip olan parklar, kentsel dinlenme ve eğlenmeye olanak sağlayan rekreasyon alanlarıdır. Kentin tümüne hizmet veren ve bireylerin dinlenme, eğlenme ve sosyal etkinliklere katılma ihtiyacını karşılayan en kapsamlı rekreasyon birimleri ‘Kent Parkları’ olarak tanımlanmaktadır. Kent parkları sadece insan yaşam kalitesi üzerinde değil, yaban hayatının korunması ve geliştirilmesini sağlayan önemli habitatlardır. Bu çalışmada kent ekolojisi servislerinden biri olan kent parkları, hava filtreleme, gürültü perdeleme, mikro iklim düzenleme, rekreasyon ve kültürel kalite, sosyal ve psikolojik etkileri Türkiye’nin Eskişehir kentinde yer alan kent parkları örnekleri üzerinden değerlendirilmiştir. Kentin yaşayan dokusu olan, çeşitli fonksiyonlara sahip kent parklarının özellikleri irdelenerek, kent ekolojisi içinde yeri ve önemi vurgulanmıştır. Sonuç olarak kentsel yaşam kalitesinin arttırılması ve daha yaşanabilir kentler oluşturmak için sürdürülebilirlik ilkesinin ekolojik temel ile ele alınması ile ilgili öneriler geliştirilmiştir

  18. Efeito da fertilidade de terra preta de índio da Amazônia Central no estado nutricional e na produtividade do mamão hawaí (Carica papaya L. Effect of amazonian dark earth fertility on nutritional status and fruit production of papaya(Carica papaya L.in Central Amazonia

    Directory of Open Access Journals (Sweden)

    Newton Paulo de Souza Falcão

    2006-12-01

    Full Text Available Com o objetivo de avaliar o efeito da fertilidade de solos antropogênicos no estado nutricional e na produtividade do mamão Havaí (Carica papaya L., conduziu-se o presente estudo em um plantio, localizado na Costa do Açutuba, Iranduba, AM, em Latossolo Amarelo antrópico em plantas com oito meses de idade e no início da produção de frutos, no período de agosto a outubro de 2003. O delineamento experimental foi inteiramente casualizado, com quatro tratamentos e nove repetições, constituídos de uma amostra composta por três plantas e trinta e seis unidades experimentais, sendo os tratamentos Tpn = plantio em terra preta não adubada; Tpa = plantio em terra preta adubada; Tm1 = plantio em terra mulata não adubada; Tm2 = plantio em terra mulata com um ano de pousio. O tratamento que apresentou maior produção foi o Tpa, com média de 61,10 frutos/planta, e o que apresentou menor produção foi o Tpn, com média de 18,18 frutos/planta. A acidez potencial em todos os tratamentos apresentou-se em níveis médios, mesmo com o manejo da fertilidade praticado nos últimos anos. Observou-se um desbalanço nutricional provocado pelos altos teores de P, Ca, Mg e baixo teor de K; todos os tratamentos apresentaram teores de Zn e Mn considerados tóxicos, enquanto que o Fe apresentou níveis adequados.The effect of Amazonian dark earth fertility on the nutritional status and fruit production of a Carica papaya plantation was evaluated in Açutuba Coast, Iranduba Municipality, Amazonas, Brazil, between August and Octuber 2003, when the plantation was eight months old and just starting production. A completely randomized experimental design, with four treatments and nine replications, was used; each replication contained three plants. The treatment were: Tpn - Amazonian Dark Earth with no supplemental fertilizer; Tpa - Amazonian Dark Earth with supplemental fertilizer (3 kg aged chicken manure and 300 g dolomite per plant; Tm1 - Mulata Earth with no

  19. Initial growth of Carica papaya under irrigation with saline water in soil with bovine biofertilizerCrescimento inicial de Carica papaya sob irrigação com águas salinas em solo com biofertilizante bovino

    Directory of Open Access Journals (Sweden)

    Francisco de Oliveira Mesquita

    2012-12-01

    Full Text Available The salinity is considered the major constraint to agriculture worldwide, constituting a limiting factor to growth, plant development, agricultural productivity and soil deterioration. In this direction an experiment was carried out during the period October/2009 to February/2010, in greenhouse conditions in Areia county, Paraiba State, PB, Brazil, in order to evaluate the effects of water saline on initial growth of papaya Hawaii in non-saline substrate with bovine rich biofertilizer. The substrate was material of the first 0.10 m of a Regolitic Entisol non saline. The treatments were distributed in completely randomized in six replication using the factorial design 5 x 2, corresponding to levels of irrigation water saline: 0.5; 1.0; 2.0; 3.0 and 4.0 dS m-1, in soil without and with rich biofertilizer applied to soil in liquid form one time two days before seed sowing, at level of 10% of the substrate volume. The increment of salinity water irrigation inhibited alls variables studied in papaya’s plants, but with less range in treatments with bovine biofertilizer.A salinidade é considerada um dos principais entraves para agricultura em todo mundo, constituindose num dos fatores limitantes ao crescimento, desenvolvimento das plantas, produtividade agrícola e depauperamento do solo. Nesse sentido, um experimento foi desenvolvido no período de Outubro de 2009 a Fevereiro de 2010, em ambiente telado, no município de Areia – PB, para avaliar a influência da salinidade da água de irrigação no crescimento do mamão Havaí em substrato não salino com biofertilizante rico. O substrato utilizado foi o material dos primeiros 0,10 m de um NEOSSOLO REGOLITICO não salino. O delineamento experimental foi inteiramente casualizado em esquema fatorial 5 x 2, referente aos valores de condutividade elétrica da água de irrigação: 0,5; 1,0; 2,0; 3,0 e 4,0 dS m-1, em solo sem e com biofertilizante líquido, com seis repetições. O biofertilizante

  20. Liofilização de fatias de abacaxi: avaliação da cinética de secagem e da qualidade do produto Freeze drying of pineapple slices: evaluation of drying kinetics and product quality

    Directory of Open Access Journals (Sweden)

    Ana Paula Vieira

    2012-03-01

    Full Text Available O objetivo deste trabalho foi avaliar a cinética de secagem e os parâmetros de qualidade - conteúdo de vitamina C, reidratação e textura - de fatias de abacaxi liofilizadas em função da espessura e da temperatura de congelamento. Abacaxis do tipo Havaí, variedade Smooth Cayenne, foram fatiados transversalmente em espessuras de 0,5, 1,0 e 1,5 cm. As fatias foram congeladas nas temperaturas de -14, -24 e -34 °C, sendo, em seguida, conduzidas ao liofilizador. Uma parcela das amostras era destinada ao estudo da cinética de secagem pela pesagem periódica das mesmas, enquanto outra foi reservada para os testes de qualidade. O teor de vitamina C foi quantificado por adição de ácido oxálico na amostra e titulado com 2,6-diclorofenolindofenol. O parâmetro de textura avaliado foi a dureza, por testes de compressão em texturômetro, enquanto a reidratação foi obtida pela pesagem das amostras antes e após a imersão em água destilada por 5 min. Os resultados do presente trabalho mostraram que existe uma forte dependência da cinética de secagem e dos atributos de qualidade de fatias de abacaxi liofilizadas em função das condições utilizadas durante a etapa de congelamento, mesmo sendo este classificado como congelamento lento. Por outro lado, a taxa de congelamento não é a única variável que tem influência sobre a cinética de secagem e os atributos de qualidade. A combinação de temperatura e umidade, tanto durante a liofilização propriamente dita, quanto durante a etapa de reidratação, tem influência sobre a transição vítrea do material que, por sua vez, afeta a extensão do colapso estrutural sofrido pelo produto.The aim of this study was to evaluate the drying kinetics and quality parameters - vitamin C content, rehydration and texture - of freeze dried pineapple slices, according to the thickness and temperature of freezing. Pineapples of the Hawaii type, Smooth Cayenne variety, were sliced transversely with

  1. AN EVALUATION ON THE STORY OF ÖMER SEYFETTĠN’S YALNIZ EFE WITHIN THE FRAMEWORK OF ANIMA AND ANIMUS ANİMA-ANİMUS KAVRAMLARI ÇERÇEVESİNDE ÖMER SEYFETTİN’İN YALNIZ EFE HİKÂYESİNİN DEĞERLENDİRİLMESİ

    Directory of Open Access Journals (Sweden)

    Mehmet YILMAZ

    2012-01-01

    ıĢa vurduğunda kadının eril yanı kolaylıkla tanınabilir. Ömer Seyfettin, Yunanlıların Ġzmir’e girmesi üzerine, memleketi saran matem havasının tesirinde kalmıĢ, umudunu yitirmiĢ halka ve sanatçılara, dağa çıkan kız kahraman “Yalnız Efe” kişiliğinde Türk halkının direnme gücünü göstermek istemiĢtir. Nitekim eserini İzmir iĢgalinden otuz beĢ gün sonra yayımlamaya baĢlar. Bu çalışmada Türk destanlarındaki savaĢçı kadın figüründen de yararlanılarak hikâye kahramanı, sözü edilen kavramlar bağlamında değerlendirilmiĢtir.

  2. Carbohydrate composition of ripe pineapple (cv. perola and the glycemic response in humans Composição de carboidratos do abacaxi (cv. pérola e resposta glicêmica em humanos

    Directory of Open Access Journals (Sweden)

    Beatriz Cordenunsi

    2010-03-01

    Full Text Available Brazil is the third largest producer of pineapple (Ananas comosus and the market for fresh pineapple is sustained by the Hawaii and Perola cultivars. In this work the Perola cultivar was divided into three main parts, shell, core and pulp, for characterization. Moisture in the pulp was higher (between 10 and 15% than in the shell and core. The amount of protein was higher in the core (35% than in the pulp and shell. Perola contained relatively low concentrations of total ascorbic acid in the edible parts, although higher levels of ascorbic acid in the shell. Citric acid corresponded to almost 60% of the total organic acids. The total soluble sugars [~7-12% (FW] were predominantly sucrose, fructose and glucose. The core had almost twice as much total sugar (12% than the pulp (6.8%. The amount of insoluble dietary fiber was around 1%, and the soluble fiber was less than 0.1%. The pulp showed the highest concentration of polyphenols (0.49% and antioxidant activity (33 µmol.g-1 out of the parts. The consumption of the pineapple pulp or core produced a high glycemic index (~93%, but considering the glycemic load, this fruit can be considered as low dietary.O Brasil é o terceiro maior produtor de abacaxi(Ananas comosus e as principais cultivares encontradas no mercado são Havaí e Pérola. Neste trabalho, frutas da cultivar Pérola foram divididas em casca, cerne e polpa e analisadas. A umidade da polpa foi superior (entre 10 e 15% à encontrada na casca e no cerne. A concentração de proteína foi maior no cerne (35% que na polpa e na casca. Essa cultivar contém baixas concentrações de ácido ascórbico nas partes comestíveis, no entanto a casca apresentou maiores níveis. O ácido cítrico correspondeu a aproximadamente 60% do total de ácidos orgânicos. Entre os açúcares solúveis [~7-12% (BU], a sacarose, frutose e glicose foram predominantes. O cerne continha quase o dobro dos açúcares totais (12% em relação à polpa (6,8%. A

  3. ÜRÜN YAŞAM SEYRİNDE GERİ DÖNÜŞÜMÜN ÖNEMİNİN TEORİK ÇERÇEVEDE İNCELENMESİ

    Directory of Open Access Journals (Sweden)

    Begüm ÖKTEM

    2015-09-01

    Full Text Available ÖzetTeknolojinin gelişmesi ve artan rekabet ile işletmelerin yalnızca mal veya hizmet üretmelerigünümüzde yeterli değildir. Mal ve hizmet üretimi sırasında üretim şekilleri, çevreye bakış açılarıda müşteriler tarafından izlenmektedir. Günümüzde ürünlerin ve dolayısıyla işletmelerinsürdürülebilirliğini sağlaması noktasında geri d.nüşüm ön plana çıkmıştır. Bu gerekçelerdenhareketle çalışmada ürün yaşam seyri maliyetleme yönteminde geri d.nüşümün önemi teorikçerçevede incelenmeye çalışılmıştır. Bu amaçla öncelikle temel kavramlar açıklanmış, gelenekselmaliyetleme ile ürün yaşam seyri karşılaştırılmıştır. Ardından geri d.nüşüm ve önemineyer verilerek, avantajları belirtilmiştir. Hammadde sıkıntısının yaşandığı, doğal kaynaklarıntükenme riskinin bulunduğu ve maliyetlerin yükseldiği günümüz şartlarında, işletmelerin gerid.nüşümlü ürün kullanmaları yalnızca işletmeye maliyetleri düşürmekle kalmayıp, müşterilerinde çevre bilinciyle geri d.nüşümlü ürünlere yönelmeleri sonucunda ürün satışlarının vepazar payının artmasına, işletmelerin rekabet edilebilirliğinin yükselmesine sebep olmaktadır.Çevre açısından da hava, su kirliliği azalmakta, ağaç kesimi önlenmektedir. Son yıllarda gerid.nüşüm ile yenilenebilir kaynakların oluşturulması ve sürdürülebilir üretim sağlanarak üretimsistemlerine yeni bir boyut kazandırılabilecektir.

  4. Isıtma Amaçlı Enerji Değişiminin Karabük İli İçin Araştırılması / A Research for Heating Energy Values in Karabuk Province

    Directory of Open Access Journals (Sweden)

    Mustafa ERTÜRK

    2012-12-01

    Full Text Available Bu çalışmada Devlet Meteoroloji Genel Müdürlüğü’nden temin edilen son otuz iki yılın meteorolojik veri seti kullanılmıştır. Bu veri seti ile Karabük ili ısıtma derece saat değerleri on bir farklı iç ortam referans sıcaklığına (18-28°C göre hesaplanmıştır. Karabük ili ısıtma derece saat değerleri baz alınarak seçilen iç ortam referans sıcaklığının 1-11°C üzerinde veya altında olması durumunda enerji talebindeki artışın veya azalmanın oransal olarak değişimi hesaplanmıştır. Bu çalışma konfor ortamını bozmadan iç ortam sıcaklığını yaşam alışkanlıklarımızda yapacağımız ufak düzenlemelerle çözmeyi amaçlamaktadır. Aile bütçesine, ülke ekonomisine, ülkenin enerji bağımlılığının azaltılmasına ve çevre-hava kirliliğinden dolayı oluşan küresel ısınmanın azaltılmasına önemli katkıda bulunacaktır. A Research for Heating Energy Values in Karabuk Province In this study, the data set of the past 32 years obtained from Turkish State Meteorological Services was used. With this data set, heating degree-hour values of Karabuk province were estimated according to eleven different indoor reference temperatures (18-28°C. The increase or the decrease in energy demand was estimated proportionally depending on the condition that the indoor reference temperature, which was selected based on the heating degree-hour values of Karabuk province, is above or below the range of 1-11°C. This study indicates that minor arrangements to be made pertaining to the indoor temperature without disturbing the comfort of the environment will make a significant contribution to reduce the global warming originating from environmental-air pollution as well as the energy dependency of our country.

  5. ÂŞIK VEYSEL’İN ŞİİRLERİNİ DEĞERLER EĞİTİMİ AÇISINDAN OKUMAK [READING ÂŞIK VEYSEL POEMS IN TERMS OF VALUES EDUCATION

    Directory of Open Access Journals (Sweden)

    Fatma Süreyya Kurtoğlu

    2017-09-01

    Full Text Available Son zamanlarda her türlü bilimsel ve teknolojik gelişmeye rağmen dünyada yaşanan şiddet ve korku havası, maddî ve manevî tatminsizlikler; acımasızlık, adaletsizlikler, çevrede olup bitenlere karşı duyarsızlık, mutsuzluk ve hayattan memnuniyetsizlik gibi problemler, eksikliği hissedilen değerlerin öğretimi ve aktarımını daha önemli bir hâle getirmiş; devletleri, millî ve evrensel kimi değerleri yeniden canlı ve etkili hâle getirmeye ve yaşanılan çağa uygun yeni bir takım değerler oluşturmaya; böylelikle kaybolmaya yüz tutmuş sosyal kontrolü yeniden sağlamaya sevk etmiştir. Bu düşünceyle “değerler eğitimi” tüm dünyada çok sayıda çalışmaya konu olmuştur. 1995 yılından beri ise ciddi bir şekilde üzerinde durularak ve “Yaşayan Değerler Eğitimi” adıyla projelendirilerek daha ziyade ölmeye yüz tutmuş değerler yeniden canlandırılmaya çalışılmıştır. Bu konuda ülkemizde de bu değerlerin okul aracılığıyla kazandırılabileceği düşüncesiyle ilköğretim ve ortaöğretimde okutulan tüm derslerin ders öğretim programlarında, dersle ilgilileri de düşünülerek bir takım hedef değerler belirlenmiştir. Bu çalışmada, Türk edebiyatının, millî ve manevî değerlerin aktarılmasında ve öğretilmesinde aracılık vazifesi yüklenen, muhatabı olan okuruna nasihat eden birçok esere sahip olduğu düşüncesiyle yirminci yüzyıl Türk halk edebiyatının en önemli isimlerinden birisi olan Âşık Veysel’in şiirlerini “değerler eğitimi açısından” okumaya çalıştık. 158 şiir üzerinde yaptığımız bu çalışma neticesinde Âşık Veysel’in okurlarına değer eğitimi çerçevesinde de pek çok şey söylediği ortaya çıkmıştır. Yaklaşık 900 dörtlükten oluşan bu şiirlerde değişik sıklıklarda olmak üzere altmışın üzerinde farklı değer tespit edildikten sonra bunlar, değerler eğitimi açısından de

  6. Mantıda Farklı Kurutma Yöntemlerinin Hidroksimetil Furfural (HMF Oluşumu ve Duyusal Kalite Üzerine Etkileri

    Directory of Open Access Journals (Sweden)

    Süleyman GÖKMEN

    2016-09-01

    Full Text Available Özet. Ülkemizde mantının kurutulmasında geleneksel sıcak hava yöntemleri kullanılmaktadır. Bu yöntemler üründe kalite kayıplarına neden olmaktadır. Bu nedenle kurutma işlemi için geleneksel tekniklere alternatif yöntemler araştırılmaktadır. Bu amaçla kullanılabilecek olan bir teknik infrared (IR kurutma prosesidir. Kurutma proseslerinde en önemli parametreler sıcaklık ve sıcaklığın ürün üzerine etkisidir. Sıcaklığın ürün üzerine olumsuz etkisini gösterebilecek maddelerden biri hidroksimetil furfural (HMF oluşumudur. HMF enzimatik olmayan esmerleşme reaksiyon ürünlerinden biridir. HMF miktarı arttıkça ürünün besin değerinde düşüşler meydana gelmektedir. Araştırmada, bu olumsuzlukları önlemek amacıyla mantının kurutulmasında geleneksel yönteme alternatif olarak 250 W IR kurutma yöntemi tek başına ve vakum kombinasyonu olarak uygulanmış, oluşan HMF miktarları ve ürün duyusal özellikleri araştırılmıştır. Vakumla kombine edilmiş 250 W IR kullanılarak kurutulan mantıların HMF miktarları geleneksel yönteme göre daha düşük ve duyusalkaliteleri daha yüksek bulunmuştur (P<0,01. Sonuç olarak, mantının endüstriyel üretiminde IR kurutma ve vakum uygulamasının kombine kullanımı gibi farklı kurutma metotlarının araştırılması gerektiği sonucuna varılmıştır.Anahtar Kelimeler: Mantı, HMF, infrared (IR kurutma, vakum kurutma, duyusal kaliteAbstract. Conventional hot-air drying methods are used in drying of mantı (stuffed pasta in Turkey. These methods cause quality losses in the product. Therefore search for alternative methods to the conventional drying has been underway. Infrared (IR drying process is an alternative technique for this purpose. The most important parameters in the drying processes are drying temperature and its effects on the product. Hydroxymethyl furfural (HMF formation is one of the indicators for illeffects of

  7. III Adli Bilimler Kongresi - Posterler

    Directory of Open Access Journals (Sweden)

    Adli Tıp Uzmanları Derneği ATUD

    2000-08-01

    ı TCK 418. Maddesi çerçevesinde adli tıbbi açıdan irdelenmiştir. Anahtar Kelimeler: Hepatit, AIDS, cinsel saldırılar. TAM KAN, SERUM VE SOLUNUM HAVASI ALKOL DÜZEYLERİNİN, NÖROLOJİK MUAYENE İLE BİRLİKTE DEĞERLENDİRİLMESİ Serap A. AKGÜR , Pembe ÖZTÜRK* **, Necati KIYILIOĞLU***, Beyhan EGE****, Hüseyin KARALI****. ÖZET Alkolün adli tıptaki önemini düşünerek çalışmaya gönüllü olarak katılan kişilerde solunum havasındaki, kandaki alkol düzeylerinin ölçülmesini ve nörolojik muayene ile birlikte değerlendirilmesini amaçladık. Yaş ortalaması 24 olan 25 sağlıklı gönüllüye (21’erkek 4’ü kadın yaklaşık 0.5 g/kg olacak şekilde alkol (bira içi- rildi. Belirlenen sürede nörolojik muayeneleri yapıldı, solunum havasındaki alkol düzeyleri saptandı ve kan örnekleri alındı. Tam kan ve serumda alkol düzeyi enzimatik yöntemlerle, solunum havasında ise Lion Alcolmeter AE-D3 cihazıyla ölçüldü, varyans analizi (ANOVA ile değerlendirildi. Olguların serum-alkol düzeyleri (ortalama 49.42 mg/dl, tam kan-alkol düzeylerinden (ortalama 40.74 mg/dl anlamlı derecede yüksek bulundu (pO.Ol. Solunum havası-alkol düzeyleri (ortalama 45.95 mg/dl; tam kan - alkol düzeylerinden anlamlı derecede yüksek bulunurken (p

  8. Kıpçak Söz Varlığında Mevsimler Sesasons In Kipchak Vocabulary

    Directory of Open Access Journals (Sweden)

    Murat ÖZŞAHİN

    2013-07-01

    ğlarının iklim şartlarına bağlı olarak gelişen mevsim ve mevsime bağlı olay adlandırmalarının çeşitliliği de bu yönde dikkat çekicidir. İnsan için yıl kavramı altında iki ana mevsim olduğu görülmektedir. Bunlar „güz‟ ve „ilkbahar‟dır. Bu mevsimlerin insanların ekonomik faaliyetlerini düzenledikleri, tarım işlerinin yürütülmesi için en uygun iki zaman dilimi olması bunu desteklemektedir. Özellikle renkler ile mevsimlerin ve çeşitli hava olaylarının karşılanması, dolayısıyla zamanın renkler ile tanımlanması, bütün bu lehçelerde dikkat çekici bir özellik olarak durmaktadır. Bunun yanı sıra bu lehçelerin edebî yazı dilinde bu türden kırsal yaşama ait sözlerin varlığını da göçebe yahut yarı göçebe kültürün izi olarak değerlendirmek gerekir.Bu çalışmada da temel olarak genç Kıpçak yazı dillerinin de özellikle bu iki zamana bağlı olarak oluşturduğu adlandırmalar, çeşitliliği ve türlenmeleri açısından incelenmektedir. Elde edilen veriler ışığında bazı sözlerin açıklaması yapılmıştır. Bunların yanında mevsim adlandırmalarına bağlı olarak alıntılanan sözlerin geçirdiği anlam değişmeleri de incelenerek farklılıklar belirtilmiştir.

  9. Şiir Nesir Olmayan Söz müdür? Nazım-Nesir Farkı, Şiirde Nesirleşme ve Mensur Şiirin İmkânı Üzerine “Is The Poetry The Wording Which is Not a Prose?” On Differences Of Poetry And Prose, Poetry’s Becoming Prose And Possibility of Poetry Written In Prose

    Directory of Open Access Journals (Sweden)

    Mehmet SAMSAKÇI

    2012-12-01

    anlatım şekli olan nazım ve nesrin mahiyetleri, kabiliyetleri, özellikleri ve birbirinden farkları; çeşitli şair, yazar ve akademisyenlerin görüşlerine başvurulmak suretiyle sorgulanacak ve tartışılacaktır. Zira şiir ve nesir, ayrı işleyişi, niyeti, düzeni ve etkisi olan iki farklı ifade biçimidir. Asırlar boyunca, Türk edebiyatında olduğu gibi dünya edebiyatında da şair ve yazarların bu türlerden çok defa birisini tercih etmeleri bazen de ikisini aynı eserde kullanmaları bunların kendilerine ait özellik ve imkânları olduğunu gösterir. Bunun yanında, şiirde nesir cümlesi kullanmanın, nesre ait bir mantık yürütmenin, kısaca nesirleşmenin şiire vereceği zararlar da bu çalışmanın kapması içindedir. Zira çalışmada görüleceği üzere pek çok şair ve yazar, şiir için en büyük tehlike olarak “nesir hâline gelmeyi” ve “nesirleşmeyi” göstermiş; kelime ve mısraların şiirsel değerlerinin kaybolması yani eserde basit nesir düzenin işleyişi, şiirin tabiatına, niyetine, kısaca ruhuna aykırı bulunmuştur. Bütün bunlardan başka, şiirin nesir olarak yazılıp yazılamayacağı, şiirsel niyet ve mantık taşıyan mensur eserlerin şiirden sayılıp sayılamayacağı da hâlline çalışılan problemlerdendir. 19. asır romantizmiyle beraber geldiğini düşündüğümüz serbestleşme havasının da etkisiyle şairler artık şiirin mutlaka nazımda aranmaması gerektiğini, her nazmın şiir sayılamayacağı gibi, her mensur eserin de şiir dışına atılamayacağını belirtmişler ve “mensur şiir” adıyla yeni bir türün varlığına inanmışlardır. Fakat 19. yüzyılda birbirine en uzak şairlerin bile üzerinde ittifak ettikleri bu konu üzerinde 20. yüzyıl şairlerinin farklı değerlendirmeleri karşımıza çıkacaktır.

  10. ENVIRONMENTAL AWARENESS AND SENSITIVITY IN AYTÜL AKAL’S CHILD BOOKS AYTÜL AKAL’IN ÇOCUK KİTAPLARINDA ÇEVRE BİLİNCİ VE DUYARLIĞI

    Directory of Open Access Journals (Sweden)

    Hülya YAZICI OKUYAN

    2012-06-01

    olan aileden, eğitimcilere, yerel yönetimlerden vatandaşlara kadar toplumun her kesiminden ve her yaştan insana çok büyük sorumluluklar ve görevler düşmektedir. Çevre eğitimi sürecinde çocuk kitaplarının önemi yadsınamaz; çünkü yazılı ve görsel öğeleri, anlatım dilinin olanaklarıyla çocuğa göre olan bir kurgu içinde sunma başarısı gösteren çocuk kitaplarının en önemli yazınsaleğitsel işlevlerinden biri de çocuklara yaşam ve insan gerçekliğinin sezdirilmesidir. Bu çalışmada, Aytül Akal’ın ilköğretim dönemine yönelik çocuk kitaplarında, çevre eğitiminin önemli bir konusu olan çevre sorunlarına ne düzeyde yer verildiğinin belirlenmesi amaçlanmıştır. Araştırmada, nitel araştırma yöntemi tercih edilmiş olup Aytül Akal’ın 4 çocuk romanı ve 31 masal kitabında bulunan toplam 64 çocuk masalı içerik analizi yöntemiyle çözümlenmiştir. Yazarın incelenen kitaplarında hava, su, toprak ve gürültü kirliliğine yönelik çevre sorunlarına yer verdiği belirlenmiştir. Buna karşın kitaplarda flora-faunanın bozulmasına ve kültürel çevre sorunlarına yönelik bir ifadeye rastlanmamıştır.

  11. II. Meşrutiyet Devri Pedagoglarından Sabri Cemil ve Amelî Fenn-i Tedris’i The Pedagogue of Second Constittional Period “Sabri Cemil And His Work of Art “Amelî Fenn-i Tedris”

    Directory of Open Access Journals (Sweden)

    Hamza ALTIN

    2013-03-01

    Cemil, II. Meşrutiyetin ilanı sırasında Dârülmuallimîn-i Rüşdi’de müdürlük vazifesini yürütmekte idi. Balkan Savaş’ından sonra Bursa ve Şam’da görev yaptı. Sabri Cemil’in en çok tanınan eseri 1326 yılında Üsküp’te yayınlandığı bilinen Amelî Fenn-i Tedris isimli kitabıdır. İnsana ekmek, su, hava lazım olduğu gibi eğitimimin de zaruri olduğunu söyleyen Sabri Cemil’in düşüncesine göre eğitim anahtarının açamayacağı kilit yoktur. Ona göre muallimin yollarından en emin olanı öğrenciye öğrenmek hevesinin kazandırılmasıdır. Dikkat edilmesi gereken önemli hususlardan biri de öğrenci eğitim alırken yalnız okuma yazma makinesi olmamalı aynı zamanda ahlaklı, soru soran ve araştıran bir kimse olmalıdır. Aynı zamanda eğitim çocuğa şahsiyet kazandırmalıdır. Eğitimde yalnızca teorik bilgileri uygun bulmayan Sabri Cemil, bunun yeterli olamayacağını aynı zamanda tatbikata da yer verilmesi gerektiğini düşünmekteydi. Ayrıca çocukların eğitim öğretiminde aceleye karşı çıkan Sabri Cemil, çocuklara yaşına göre muamele yapılması taraftarıydı. Eğitimde ev ödevlerinin önemini savunan Sabri Cemil, özelikle yazılı ev ödevlerinin öğrencilerin öğrendiklerini pekiştirme açısından çok faydalı olduğunu iddia etmekteydi. Sabri Cemil’in fikrince bir milletin ve devletin yükselmesinde veya yıkılmaya yüz tutmasında o memleketteki öğretmenlerin büyük payı vardır. Ona göre muallimlerde bulunması gereken iki tane temel özellik olmalıdır; muallimler evvela ciddi bir tahsil görmelidirler, ikinci olarak ise öğrendiklerini vatan evlatlarına öğretmede hiçbir fedakârlıktan çekinmemelidirler.

  12. ARAB FAMILIES IN EXILE IN KIRŞEHİR BETWEEN 1914–1918 1914–1918 YILLARI ARASINDA KIRŞEHİR’DE BULUNAN SÜRGÜN ARAP AİLELERİ

    Directory of Open Access Journals (Sweden)

    Ahmet GÜNDÜZ

    2011-01-01

    geldikten sonra hastalanmışlardır. Vermiş oldukları dilekçelerinde Kırşehir’in havasıyla ve suyu ile uyum sağlamadıklarını özellikle belirtmişler ve vermiş oldukları dilekçelerine doktor raporunu da eklemişlerdir. Bunun içindir ki Kırşehir dışındaki şehirlere gönderilmelerini talep etmişlerdir. İncelenen belgeler Kırşehir’e sürgüne gönderilen kişi veya aileler neden gönderilmişler sorusuna da cevap vermektedir. Örneğin askerlik sebeplerinden dolayı, zararlı ve sabıkalı kişilerden olmalarından dolayı, bazı fesat ve kindar kimselerin tesirleri neticesinde, sahte para meselesinden dolayı, casusluk, bazı açıklamalar göre Divan-ı Harp kararıyla, devlete hizmet etmiş şahıslardan oldukları halde kanunî soruşturmadan dolayı gibi nedenlerden Kırşehir’e sürgüne gönderilmişlerdir.Kırşehir’e sürgün olarak gönderilen Arap aileler 1918 tarihinde yapılan genel af’tan faydalanarak memleketlerine gitmişlerdir.

  13. Şeyl Gazı (Kaya Gazı ve Çevresel Etkileri

    Directory of Open Access Journals (Sweden)

    Nazan YALCIN ERİK

    2016-11-01

    Full Text Available Özet. Son yıllarda şeyl formasyonlarından doğal gaz üretimi (şeyl gaz karadaki hidrokarbon (petrol ve gaz arama ve üretimlerindeki en hızlı gelişen eğilimdir. Şeyl gaz operasyonlarında teknolojik gelişmeler özellikle Amerika’da son birkaç yılda daha da hızlanmış ve bu süreç küresel olarak ilerlemeye devam etmektedir. Petrol ve gaz sektöründeki yeni gelişmeler çevre ve sosyo-ekonomik alanda, özellikle de doğal gaz gelişiminin yeni olduğu alanlarda birçok değişimi de beraberinde getirmiştir. Şeyl gaz ile ilgili çevresel etkiler küresel ve yerel düzeylerde etkili olmaktadır. Bunlar iklim değişikliği, sera gazı (GHG emisyonları, yerel hava kalitesi, su temini, su kalitesi, sismik aktivite, yerleşim yeri ve toplumsal etkilerdir. Yoğun kuyu aralıkları, operasyonlardan dolayı oluşan gürültü, artan kamyon trafiği halk ve çevre için düşünülmesi gereken diğer konuları oluşturmaktadır. Bazı çevresel etkiler ise yeni teknolojik gelişmeleri kullanarak azaltılmıştır. Örneğin, şeyl gazı üretimi sırasındaki sera gazları azaltılmaya başlanmış ve tatlı su ihtiyacı ise operasyonda kullanılan suyun arıtılması ve yeniden kullanılmasının yaygınlaşması sonucunda azalmaya başlamıştır. Sismik aktivitenin önlenmesi gibi diğer konular ise hala detaylı inceleme ve araştırmaya ihtiyaç duymaktadır. Anahtar Kelimeler: Şeyl gazı, hidrokarbon, çevre kirliliği, sera gazı, doğal gaz, su kirliliği Abstract. In recent years, natural gas production from shale formations (shale gas is one of the most rapidly expanding trends in onshore hydrocarbon (oil and gas exploration and production. Especially in the United States the development of technology within shale gas operations has been rapid within the last few years and is still ongoing globally. New developments about oil and gas sector create change to the environmental and socio-economic view, particularly in those

  14. Depo Gazı Enerji Üretim Tesisi Baca Gazı Atık Isısının Seralarda Değerlendirilmesi: İstanbul Örneği / Utilization of Waste Heat in Energy Production Plant from Landfill Gas at Greenhouses – Case Study in Istanbul

    Directory of Open Access Journals (Sweden)

    Volkan Enç

    2012-12-01

    Kullanımı Projesi” kapsamında yürütülmüştür. Bu kapsamda; çevre, tarım ve enerji sektörü için, atık ısı ve atık maddelerin değerlendirilmesini içeren çevresel ve ekonomik açıdan sürdürülebilir eko yenilikçi bir sistemin oluşturulması amaçlanmıştır. Bu çalışmada İBB Odayeri Düzenli Depolama Sahasında depo gazından elektrik enerjisi üretim tesisinden çıkan baca gazının değerlendirilmesine ve mevsimlik çiçek üretim serasının kurulmasına ilişkin süreçler yer almaktadır. Kurulması düşünülen seranın ısıl hesaplamaları yapılmıştır. Yapımda kullanılacak her malzemenin sebep olduğu ısı kayıpları ve hacim kaynaklı hava değişimine bağlı ısıl kayıplar göz önüne alınarak gerekli ısı miktarı belirlenmiştir. Depo Gazı Enerji Üretim Tesisinden elektrik üretim faaliyeti sonucu egzoz gazı atmosfere verilmektedir. Bu gazın değerlendirilmesi için baca gazı emisyon ölçümü ve analizi yapılmıştır. Analiz sonuçlarına göre yaklaşık 470 °C sıcaklıktaki gazın geri kazanımı için gerekli ısıl hesaplamalar yapılmıştır. Egzoz gazının emisyon ölçümü için CO, CO2, O2, SO2, NO, NO2 ve NOx Tayini Elektrokimyasal Hücre Metodu ile, Bacada Hız ve Debi Tayini ise S Tipi Pitot Tüpü ile gerçekleştirilmiştir. Bacalarda oluşan atık ısının kullanımı için sistem alternatifleri araştırılmıştır. Proje ile ilgili olarak hava-su ısı değiştiriciler incelenmiştir. Analiz sonuçları ve seranın ihtiyacı olan enerji miktarına göre ekonomizer ya da eşanjör ölçüleri hesaplanmış, malzeme çeşidi tespit edilmiş, sistemin dizaynı ve imalatı yapılmıştır. Atık ısı geri kazanım ünitesinde ısıtılan su, pompalar vasıtasıyla seraya iletilecektir. Isı İletim sistemi ısı kayıpları minimuma düşürecek şekilde dizayn edilecek, sera içinde bulunan otomasyon sistemi vasıtasıyla ihtiyaç duyulan zaman dilimlerinde seraya sıcak su beslemesi

  15. Dergilerden Özetler

    Directory of Open Access Journals (Sweden)

    Osman Eren Karpuzoğlu

    1999-12-01

    Full Text Available SES MERMİLERİNİN SEBEP OLDUĞU ÖLÜMCÜL BOYUN YARALARI Fatal neck injuries caused by blank cartridges. Rothscbild MA, Vendura K. Forensic Sci Int 1999 Apr 26; 101(2: 151-9. Start tabancalarından atılan ses mermilerinin yol açtığı ölümcül boyun yaralanmaları olan üç olguyu inceledik. Silahlar ses veya gözyaşartıcı gaz mermileriyle doldurulmuştu. Ne gerçek mermi ne de herhangi bir çeşit projektil materyal içermiyorlardı. Üç olgu da atış anında temas içeriyordu. Silahların ateşlenmesi sırasında ortaya çıkan gaz basıncı üç olguda da geniş yara kaviteleri açılmasına yol açmıştı. Bütün kurbanlar servikal damarların rüptiire olması sonucu kan kaybından öldü, hava embolisi yoktu. Bir olguda, bir adam kendini sekiz kez iki farklı start tabancası ile vurmuştu ve yaralar her silah için, boyunda bıraktığı namlu iziyle uyumluydu. İNTİHAR İÇİN ONDÖRT ATIŞ Fourteen shots for a suicide. Boxho P. Forensic Sci Int 1999 Apr 12; 101(1: 71-7. 56 yaşında bir adam evinin mutfağında bir kan göletinin içinde bilinçsiz olarak bulundu. Bulgulara göre, 22 kalibrelik uzun namlulu tüfekle 14 el ateş ederek kendi göğsünü önden arkaya, sağdan sola, ve neredeyse yatay trajeler izleyen şekilde vurmuştu. Bütün mermi çekirdekleri göğsün sol tarafına girmiş, ve sol koltukaltının arka kısmının hemen altından dışarı çıkmıştı. Bir tanesi sol koluna girmiş ve sol hu- merusunu kırmıştı. Bulgulara ve kan lekelerinin pozisyonlarına göre, adamın tüfeği duvara, bir borunun üzerine dayadığını düşünüyoruz. İki şarjörü göğsüne boşaltacak şekilde ateş etmişti. Her atıştan önce tüfeğin kolunu kurması gerekiyordu. Yeniden doldurmak için, yakındaki üzerinde kan izleri görülen masadan mermileri almıştı. Tekrar doldururken koltuğuna oturmuş ve ayağa kalkmak isterken koltuğun kan lekeleri görülen kollarına dayanmıştı. Koluna giren

  16. Editor’s Valediction

    Directory of Open Access Journals (Sweden)

    Serpil Salaçin

    2000-04-01

    ündemi belirlendi. Gündem; Adli Tıp Uzmanları Derneği’nin bir yayın organı çıkarması tartışılacaktı. Görevler üstlenildi. Bir hummalı çalışmadır sürdü.... Kelimelere aktarırken basitleşiyor. Oysa saat sınırı olmayan, küçük tartışma oturumlarıydı onlar. Beyin fırtınaları yapılıyordu. Nerede mi toplanıyorduk? Çoğunlukla Şebnem’in evinde. Kim bilir kaç hafta sonu Cumaıtesi-Pazar boyunca sürüp giden masa başı çalışmalar idi. Dergi şekillenmeye başlamıştı. Yayına kabul şartlan, danışma kurulu üyeleri ve yazarlarla iletişimde kullanılacak formların oluşturulması, yayınlanacak makalenin basım formatı, danışma kurulunun oluşturulması.. Bir dizi şimdi kolay gibi gelen işlerdi çabalanan. Katkıda bulunması yararlı olacak arkadaş sayısı da artmıştı. Artık evde toplanamayacaktık. Toplantıları İstanbul Tıp Fakültesi Adli Tıp Anabilim Dalının toplantı salonuna aldık. Nedense o yıl hava çok soğuktu. Hafta sonu olduğundan ısıtma sistemi de çalışmıyordu. Tartışmalar, kararlar ve yine tartışmalar sonunda kayıttan basıma sorumluluk paylaşımı ve iş akışı yapıldı. Danışma kuruluna davet yazıları yazıldı. Kabuller gelmeye başlamıştı. Derginin ilk sayı çalışmaları sürüyordu. İlk dergi örneği çıktığındaki heyecanımızı ben aktaramam. Ama orada olup bu heyecanı paylaşanlar anımsayacaklardır. Çok hoş bir sevinç ve sürekliliğini sağlamak adına çok ciddi sorumluktu. Hep ileriye yönelik strateji üretmeye çabalamaktı. Bunlar okunurken ya da ben yazarken çok romantik bir üslup gibi görünebilir. Ama o günden beri bu derginin yaşamasına gereksinim olduğuna inanan çok özverili çalışan bir grup arkadaşımızın yapmayı sürdürdüğü çalışmalar, fizik alt yapı ve finans kaynağı yönünden düşünülür ise çok romantik bir iş. Hele birlikte oluştunılanlara katkıda bulunmayıp ya da içinde olup da dışında imiş gibi ele

  17. Editörden Veda

    Directory of Open Access Journals (Sweden)

    Serpil Salaçin

    2000-04-01

    ündemi belirlendi. Gündem; Adli Tıp Uzmanları Derneği’nin bir yayın organı çıkarması tartışılacaktı. Görevler üstlenildi. Bir hummalı çalışmadır sürdü.... Kelimelere aktarırken basitleşiyor. Oysa saat sınırı olmayan, küçük tartışma oturumlarıydı onlar. Beyin fırtınaları yapılıyordu. Nerede mi toplanıyorduk? Çoğunlukla Şebnem’in evinde. Kim bilir kaç hafta sonu Cumaıtesi-Pazar boyunca sürüp giden masa başı çalışmalar idi. Dergi şekillenmeye başlamıştı. Yayına kabul şartlan, danışma kurulu üyeleri ve yazarlarla iletişimde kullanılacak formların oluşturulması, yayınlanacak makalenin basım formatı, danışma kurulunun oluşturulması.. Bir dizi şimdi kolay gibi gelen işlerdi çabalanan. Katkıda bulunması yararlı olacak arkadaş sayısı da artmıştı. Artık evde toplanamayacaktık. Toplantıları İstanbul Tıp Fakültesi Adli Tıp Anabilim Dalının toplantı salonuna aldık. Nedense o yıl hava çok soğuktu. Hafta sonu olduğundan ısıtma sistemi de çalışmıyordu. Tartışmalar, kararlar ve yine tartışmalar sonunda kayıttan basıma sorumluluk paylaşımı ve iş akışı yapıldı. Danışma kuruluna davet yazıları yazıldı. Kabuller gelmeye başlamıştı. Derginin ilk sayı çalışmaları sürüyordu. İlk dergi örneği çıktığındaki heyecanımızı ben aktaramam. Ama orada olup bu heyecanı paylaşanlar anımsayacaklardır. Çok hoş bir sevinç ve sürekliliğini sağlamak adına çok ciddi sorumluktu. Hep ileriye yönelik strateji üretmeye çabalamaktı. Bunlar okunurken ya da ben yazarken çok romantik bir üslup gibi görünebilir. Ama o günden beri bu derginin yaşamasına gereksinim olduğuna inanan çok özverili çalışan bir grup arkadaşımızın yapmayı sürdürdüğü çalışmalar, fizik alt yapı ve finans kaynağı yönünden düşünülür ise çok romantik bir iş. Hele birlikte oluştunılanlara katkıda bulunmayıp ya da içinde olup da dışında imiş gibi ele