WorldWideScience

Sample records for hatillo edo miranda

  1. Edo Journal of Counselling

    African Journals Online (AJOL)

    Edo Journal of Counselling, the official publication of Edo Chapter of Counselling ... The Mediating Impact of Personality and Socio-Economic Status in the ... Fostering Adolescents' Interpersonal Behaviour: An Empirical Assessment of ...

  2. Revenge of tiny Miranda

    International Nuclear Information System (INIS)

    Goldreich, P.; Nicholson, P.

    1977-01-01

    Reference is made to Dermott and Gold (Nature 267: 590 (1977)) who proposed a resonance model for the rings of Uranus. They assumed that the rings are composed of small particles librating about stable resonances determined by pairs of satellites, either Ariel and Titania or Ariel and Oberon. They dismissed as insignificant resonances involving 'tiny Miranda'. It is reported here that, by a wide margin, the strongest resonances are all associated with Miranda. It is also shown that the hypothesis that the rings are made up of librating particles, whilst original and ingenious, is incorrect. (author)

  3. Generators for Miranda

    Energy Technology Data Exchange (ETDEWEB)

    Angiolini, G.; Borgna, H.; Garcia, A.; Fernandez, M.; Piriz, H.; Verdu, C. [IMPSA Hydrogenerators (Argentina)

    2000-10-01

    The three generators at the Miranda hydroelectric power plant on the Araguari river northwest of Belo Horizonte in the state of Minas Gerais began operation in 1998. All the electromechanical equipment for the project was supplied by IMPSA. The generators, which are driven by Francis turbines, are vertical shaft, three-phase, salient-pole synchronous machines with an output of 137 MVA. The generators successfully completed a series of studies and trials before commercial operation began and Companhia Energetica de Minas Gerais (CEMIG) is considering increasing the operation power to 150 MVA. The specification and design of the electrical aspects, stator winding, rotor, bearings, shaft line, generator cooling system, excitation system and monitoring systems are described. Electromagnetic requirements and acceptance testing results are given in two summary tables.

  4. Salto de Miranda, Asturias

    Directory of Open Access Journals (Sweden)

    Vilanova Bosch, José Luis

    1964-07-01

    Full Text Available The water from the rivers Pigüeña and Somiedo is collected and conducted to the Salto de Miranda hydroelectric power station. The civil engineers Constructora Hidrocivil, S. A., carried out the project for the owners of this power station. Hidroeléctrica Cantábrica, S. A. The project is situated in the mountains, where a small dam collects the water. This is then led through a long conduit to the entry of the pressure pipes leading to the turbines. The water later flows back to the original river course. The total pressure head is 410 ms, and the mean volume of water which is exploited is 15 m3/sec. As the author is planning to publish additional articles describing specific aspects of the problem, no attempt is made here to emphasize the importance of many significant features of this project. In carrying out this project, the contractors devoted great care to the planning of the various constructional steps, in order that no delay in one particular operation should hold up the progress in the rest of the work.La entidad propietaria del Salto de Miranda es Hidroeléctrica del Cantábrico, S. A.; e Hidrocivil, S. A., participó muy activamente en la ejecución de los trabajos de obra e ingeniería civil. Fue una labor tan recia y tenaz de todos los que participaron en esta gran tarea, y tan elogioso su trabajo, su constante espíritu y voluntad de superación, que a ellos, obreros y técnicos, me debo sin reservas y con sinceridad. El éxito es suyo. Éxito basado en labor de equipo, perfecta compenetración de los binomios «hombre-hombres» «máquina-hombres». Quiero agradecer a la Compañía de Construcciones Hidráulicas y Civiles la oportunidad que me brindó de dirigir estos trabajos, que forjaron en mí una experiencia técnica y la satisfacción de una rendida colaboración. En otros números de esta revista espero poder extenderme, con mayor detalle, en otros aspectos específicos de esta importante obra.

  5. Clay Bells: Edo Inspiration

    Science.gov (United States)

    Wagner, Tom

    2010-01-01

    The ceremonial copper and iron bells at the Smithsonian's National Museum of African Art were the author's inspiration for an interdisciplinary unit with a focus on the contributions various cultures make toward the richness of a community. The author of this article describes an Edo bell-inspired ceramic project incorporating slab-building…

  6. Argumentation in Miranda v. Arizona.

    Science.gov (United States)

    Benoit, William L.

    1991-01-01

    Investigates the argumentation advanced in briefs, oral arguments, and the Supreme Court's opinion in the case of Miranda versus Arizona. Considers the background of the case, analyzes the argumentation and its influences on the court, and stresses the importance of viewing the Supreme Court as an active participant in the decision-making process.…

  7. Archives: Edo Journal of Counselling

    African Journals Online (AJOL)

    Items 1 - 6 of 6 ... Archives: Edo Journal of Counselling. Journal Home > Archives: Edo Journal of Counselling. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register · Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives. 1 - 6 of 6 Items. 2011 ...

  8. Investigating Miranda waiver decisions: An examination of the rational consequences.

    Science.gov (United States)

    Blackwood, Hayley L; Rogers, Richard; Steadham, Jennifer A; Fiduccia, Chelsea E

    2015-01-01

    Millions of custodial suspects waive their Miranda rights each year without the benefit of legal counsel. Miranda understanding, appreciation, and reasoning abilities are essential to courts' acceptance of Miranda waivers (Grisso, 2003; Rogers & Shuman, 2005). The question posed to forensic psychologists and psychiatrists in the disputed Miranda waivers is whether a particular waiver decision was knowing, intelligent, and voluntary. Despite the remarkable development of Miranda research in recent decades, studies have generally focused on understanding and appreciation of Miranda rights, but with comparatively minimal emphasis on Miranda reasoning and attendant waiver decisions. Research on defendants' decisional capacities constitutes a critical step in further developing theoretical and clinical models for Miranda waiver decisions. The current study evaluated Miranda waiver decisions for 80 pretrial defendants from two Oklahoma jails to study systematically how rational decision abilities affect defendants' personal waiver decisions. In stark contrast to what was expected, many defendants were able to identify a rational decisional process in their own legal cases, yet cast such reasoning aside and chose a completely contradictory Miranda waiver decision. Published by Elsevier Ltd.

  9. Impact of acid mine drainage from mining exploitations on the Margajita River basin and the Hatillo reservoir (Dominican Republic)

    International Nuclear Information System (INIS)

    Grandia, F.; Salas, J.; Arcos, D.; Archambault, A.; Cottard, F.

    2009-01-01

    Mining of the Pueblo Viejo high-sulphidation epithermal deposit (Dominican Republic) leads to environmental impact due to the formation of acid mine drainage associated with the oxidative dissolution of sulphides and sulpho salts. In addition to the very low pH, the acid waters are capable of transporting away from the mining areas high concentrations of metals and metalloids in solution. In the present work, a geochemical study of sediments deposited in the Hatillo reservoir is carried out. This reservoir is fed by the Margajita and Yuna streams which transport leachates from the Pueblo Viejo and Falcondo-Bonao (Cr-Ni) mining areas, respectively. The results show that these sediments have very high concentrations of Fe, Al and sulphate, along with significant amounts of As, Zn and Te, which are of especial environmental concern. The main contributor to this metal discharge into the reservoir is the Margajita stream, whereas the Yuna stream does not transport significant amounts of metals in solution due to its neutral pH, although it is likely that metals such as Mn, Cr, Ni and Co can be mobilised as a particulate. (Author) 5 refs.

  10. MIRANDA - Music Information Retrieval And Data Acquisition

    DEFF Research Database (Denmark)

    Lehn-Schiøler, Tue; Petersen, Kaare Brandt; Hansen, Lars Kai

    2006-01-01

    In this report we present a music data harvesting system based on a plug-in for a popular music player. When a user is playing a song using the plug-in, information about the song is anonymously submitted to a server. The data gathered using MIRANDA is intended to be released to the MIR community....... We argue that even though content-based data is of interest to the community, also meta data and usage data can be important for research in music similarity....

  11. Memoria cultural etnobotánica en la vereda El Hatillo, cabecera municipal El Paso, Departamento del Cesar-Colombia

    Directory of Open Access Journals (Sweden)

    Dino Carmelo Manco-Jaraba

    2015-07-01

    Full Text Available Background: Ethnobotany studies the knowledge produced by the interaction between society and the use of plants that have been transmitted between generations and are still preserved in the different sectors of the rural community of the El Hatillo, Jurisdiction of La Loma de calentura, Town of El Paso, Cesar. Currently, very few ethnobotanical studies have been done in Colombia: ethnobotanical studies in the central Andes: Spread of knowledge about the use of plants by characteristics of the informants, use of plants by farmer groups in the tropical belt of Paramillo National Natural Park, and utility and value in use of ethnobotany, a study in the state of Putumayo, among others. Therefore, there is a need for further studies to be done throughout the Colombian territory, as many of these communities are currently being affected by mining and military activities among others. Objective: This research was conducted with the aim of rescuing the ethnobotanical knowledge. Methods: For collection, classification and preservation of popular ethnobotanical knowledge, tools like the plant spreadsheet model, community interviews, focus groups, pictures, videos, audio and taxonomic samples were used. Results: 44 samples of plants with different uses were obtained, each one with its own scientific name and family. The most common use was medicinal, the most used part is the leaf, and the way of preparation is cooking. Conclusion: Currently, this community must to be be relocated because it is affected by the direct environmental impact due to coal dust release as well as vibrations due to mining blast, which affects surface waters, groundwater and soil composition.

  12. Juveniles' Miranda comprehension: Understanding, appreciation, and totality of circumstances factors.

    Science.gov (United States)

    Zelle, Heather; Romaine, Christina L Riggs; Goldstein, Naomi E S

    2015-06-01

    This study examined juvenile justice-involved youths' understanding and appreciation of the Miranda warnings' rights to silence and legal counsel using the Miranda Rights Comprehension Instruments (Goldstein, Zelle, & Grisso, 2012). It also examined the relationships between totality of circumstances factors and understanding and appreciation of rights. Data were collected from 183 youths (140 boys) in pre- and postadjudication facilities in 2 states. Overall, youths demonstrated greater difficulty on measures of appreciation than understanding, with particular deficits in their abilities to comprehend the abstract concept of the right to silence. Results varied slightly by instrument, highlighting the importance of a multimodal assessment of these complex abilities. Examination of totality of circumstances factors identified relationships between some factors (e.g., age, verbal IQ, academic achievement) and Miranda comprehension, but revealed that other factors (e.g., gender, number of previous arrests) were not significantly related to Miranda understanding or appreciation. The findings support a nuanced conceptualization of Miranda rights comprehension that acknowledges the complexity of understanding and appreciating the warnings. Empirical analyses also support the continued use of some totality of circumstances factors and abandonment of others. Findings underscore the necessity of multimodal assessment and interpretation when conducting capacity to waive Miranda rights evaluations. (c) 2015 APA, all rights reserved).

  13. Prevalence of onchocerciasis in Edo State, Nigeria | Onowhakpor ...

    African Journals Online (AJOL)

    Objective: To determine the prevalence of onchocerciasis in endemic areas in Edo State,Nigeria. Methodology: A descriptive cross-sectional study was conducted among 658 respondents residing in onchocerciasis endemic areas of Edo State using a pre-tested interviewers' administered questionnaire and examination of ...

  14. Gender issues in human trafficking in Edo State, Nigeria | Osezua ...

    African Journals Online (AJOL)

    Gender issues in human trafficking in Edo State, Nigeria. ... in order to capture family dynamics and power relations and women status in ... The paper concluded that efforts targeted towards eradicating existing gender inequality in the region ...

  15. Factors influencing breastfeeding practices in Edo state, Nigeria ...

    African Journals Online (AJOL)

    In Nigeria however, young infants may not benefit from such a practice as a ... The purpose of this study was to determine factors influencing breastfeeding practices in Edo State, Nigeria. ... Only 20 per cent practiced exclusive breastfeeding.

  16. phytoplankton diversity indices of Osse River, Edo State, Nigeria

    African Journals Online (AJOL)

    USER

    The phytoplankton diversity indices of Osse River, Edo State, Nigeria, were investigated monthly from January ... In terms of abundance, Bacillariophyceae had the highest distribution of phytoplankton (79.00%), ...... erosion beach in Lagos.

  17. The Economic Potentials of Pineapple Marketing in Edo State, Nigeria.

    African Journals Online (AJOL)

    The Economic Potentials of Pineapple Marketing in Edo State, Nigeria. ... Agricultural marketing involves numerous lines of activities, which if well developed can sustain livelihood. It is in line with this ... EMAIL FULL TEXT EMAIL FULL TEXT

  18. Determinants of Revenue Derived from Pineapple Marketing in Edo ...

    African Journals Online (AJOL)

    Determinants of Revenue Derived from Pineapple Marketing in Edo State, Nigeria. ... The results showed that an average pineapple marketer has a mean volume of 98 dozens and incurred a variable ... EMAIL FULL TEXT EMAIL FULL TEXT

  19. Structure, conduct and performance of Plantain Marketing in Edo ...

    African Journals Online (AJOL)

    Structure, conduct and performance of Plantain Marketing in Edo State, Nigeria. ... marketing system, assess its performance and estimate the cost and returns in plantain marketing. ... EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT

  20. Pure intuition: Miranda Fricker on the economy of prejudice

    Directory of Open Access Journals (Sweden)

    Jesús ZAMORA BONILLA

    2008-01-01

    Full Text Available Two aspects of Miranda Fricker’s book are criticised: the implicit assumption that ethical theory can solve fundamental problems in epistemology, and the excessive reliance on testimony as a fundamental source of knowledge. Against the former, it is argued that ethical theories are based on cultural prejudices to a higher extent than epistemological theories. Against the latter, argumentation is proposed as a more important epistemic practice than testimony.

  1. Importancia de la proporcionalidad en nadadores federados del estado Miranda

    OpenAIRE

    Ortega de Mancera, Alicia; Ledezma, Thaís

    2005-01-01

    La natación es un deporte con grandes y continuas exigencias físicas durante el entrenamiento, clave para el éxito deportivo. Sin embargo algunos autores plantean la existencia de rasgos de proporcionalidad que en cierta forma caracterizan a los nadadores elite e influyen en una mejor "performance". El objetivo es analizar las proporciones consideradas propias de los nadadores elite y establecer si las mismas caracterizan a los nadadores del Estado Miranda. Se evaluaron 183 deportistas, 67 ni...

  2. Fluid volcanism on Miranda and Ariel - Flow morphology and composition

    Science.gov (United States)

    Schenk, Paul M.

    1991-01-01

    Several types of volcanic units have been recognized on the icy Uranian satellites Miranda and Ariel. On Miranda, ridges characterized by crest grooves are up to 10 km wide and 500 m high. A continuous flat-topped flow band also 10 km wide and 500 m high forms the outer southern margin of Elsinore Corona, which appears to comprise coalesced flow bands and ridges. On Ariel, in addition to at least one ridge unit similar to those on Miranda, flood plains material has covered the floors of deep chasmata (grabens) and an irregular depression. Flows on both satellites are characterized by linear vent geometries and distinct topographic margins, which indicate extrusion of a relatively viscous material. The topography of the flows can be used to estimate flow viscosity or yield strength using a Bingham plastic model. Extrusion viscosity estimates, incorporating plausible volcanologically based emplacement time scales and a rigid crust correction, range from 10 MP to 1 GP (10 TP in the unlikely absence of a chilled crust). Viscosity estimates are dependent on the assumed emplacement time scale, however, and could be as high as 10 PP, if a solid-state-based time scale is assumed.

  3. The role of suggestibility in determinations of Miranda abilities: a study of the Gudjonsson Suggestibility Scales.

    Science.gov (United States)

    Rogers, Richard; Harrison, Kimberly S; Rogstad, Jill E; LaFortune, Kathryn A; Hazelwood, Lisa L

    2010-02-01

    Traditionally, high levels of suggestibility have been widely assumed to be linked with diminished Miranda abilities, especially in relationship to the voluntariness of waivers. The current investigation examined suggestibility on the Gudjonsson Suggestibility Scales in a multisite study of pretrial defendants. One important finding was the inapplicability of British norms to American jurisdictions. Moreover, suggestibility appeared unrelated to Miranda comprehension, reasoning, and detainees' perceptions of police coercion. In testing rival hypotheses, defendants with high compliance had significantly lower Miranda comprehension and ability to reason about exercising Miranda rights than their counterparts with low compliance. Implications of these findings to forensic practice are examined.

  4. An evaluation of electron diamond type EDO2E and EDO3 diamond radiation detectors

    International Nuclear Information System (INIS)

    Poole, D.A.; Wilson, R.

    1977-12-01

    Observations on the response of two d.c. mode (EDO2E) and three pulse mode (EDO3) diamond probes to beta and gamma radiation are reported. In the d.c. mode, response to gamma exposure rates from 1 R h -1 to >6x10 4 R h -1 were measured, currents of approximately 5x10 -13 A and approximately 3x10 -9 A respectively at 20 0 C being observed. The dark current was approximately 3x10 -13 A at 20 0 C and doubled for every 3 to 4 0 C temperature rise. In the pulse mode the count rate was approximately linear with gamma exposure rate from 10 mR h -1 to > 300 R h -1 . The detection of beta particles was limited to energies > or approximately equal 0.8 MeV. Over the temperature range -5 0 C to 50 0 C the count rate for one probe increased by a factor of 1.25 whereas a second probe showed a decrease of 1.4. There is scope for major improvement of diamond detectors as reported by Kozlov et al (1977a) who have eliminated certain undesirable effects by careful selection and the provision of special electrodes. (author)

  5. Challenges of Local Government Administration in Edo State of ...

    African Journals Online (AJOL)

    This paper examined the fundamental problems that envelope local government administration in Edo State, and discovered that the challenges are constitutional issues. It also identified problems of graft, poor revenue generation by local authorities, and poor revenue allocation cum fiscal transfer to local governments.

  6. The Prevalence of Malaria in Edo State, Nigeria | Mordi | Nigerian ...

    African Journals Online (AJOL)

    This study determined the prevalence of malaria in Edo State, Nigeria. The study was cross-sectional, and lasted one year. Children of school ages participated in the study. Detection of malaria parasites was through thick blood film with Giemsa stain. There was a predilection for infection for children less than ten years.

  7. Economic analysis of honey production in Edo State, Nigeria ...

    African Journals Online (AJOL)

    This research work was carried out to analyze the economics of honey production in Edo State. The objectives of the study were to examine the demographic characteristics of honey production, assess the profitability of honey bee and the problems facing honey production .The list of honey farmers in the state was ...

  8. Determinants of Rural Development in Edo State, Nigeria: An ...

    African Journals Online (AJOL)

    About 70% of the total population in Nigeria lives in the rural areas, while half of this population is without proper-formal education (World Bank 2005). Data for this study which is on the Determinants of rural Development in Edo State, Nigeria were collected through the primary and secondary sources. Primary data were ...

  9. Assessment of groundwater quality of Benin City, Edo state, Nigeria ...

    African Journals Online (AJOL)

    The quality of groundwater of Benin City, Edo State, Nigeria was investigated between February and July 2008. Water samples were collected from functional bore holes from five locations (stations 1 – 5) and analyzed for physico-chemical parameters including heavy metals. Data obtained were compared with World ...

  10. Paisaje del viñedo: patrimonio y recurso

    Directory of Open Access Journals (Sweden)

    Luis Vicente Elías

    2008-01-01

    Full Text Available La propuesta de que el paisaje del viñedo sea el complemento a la visita a la bodega, siendo esta el eje del turismo del vino, es el objetivo de este trabajo. Repasando los conceptos variables de patrimonio, llegamos al paisaje del viñedo como recurso, formando parte del patrimonio natural. Pero este no se puede desvincular de los otros aspectos patrimoniales, por lo que la cultura tradicional es el soporte de la tipología de paisaje que queremos proponer y que va contrastar con los nuevos paisajes del viñedo que surgen de las recientes técnicas en los cultivos y de la actual vitivicultura, emparejada con una moderna “cultura del vino”. El análisis de las diversas normativas, que salvaguardan el paisaje y la comprobación del escaso valor legal del paisaje del viñedo, es otro puntal de este trabajo que trata de unir paisaje con cultura tradicional como recursos del Turismo del Vino, integrados en las Rutas del Vino.

  11. Investigation of Ojirami reservoir, Akoko-Edo, Southsouth, Nigeria ...

    African Journals Online (AJOL)

    Ojirami Reservoir was constructed between 1971 and 1974 for the purpose of supplying potable water to Edo North senatorial zone, Nigeria. The reservoir is aging, with evidence of siltation but relatively free of any anthropogenic activities. A study was carried out between January 2009 and December 2010 to monitor the ...

  12. Human ecotoparasitoses among some rural dwellers in Edo State ...

    African Journals Online (AJOL)

    Studies on clinical and epidemiological aspects of human ectoparasites among some rural dwellers in Edo State Nigeria were carried out between September 2002 and August 2003. A total of 910 subjects who had complained of having been infested by arthropod parasites were enrolled for this study. The study ...

  13. Loaisis in Edo State, Nigeria | Mordi | Journal of Medicine and ...

    African Journals Online (AJOL)

    The inaccessibility of the arthropod vector to humans could be advanced for the low prevalence of the disease in the state. The socio-cultural and economic factors, which predisposed to infection, were discussed as part of control measures. Keywords: Loaisis, Prevalence, Loa Loa, Edo State Nigeria Journal of Medicine ...

  14. Vicissitudes of Edo State Council for Arts and Culture Performing ...

    African Journals Online (AJOL)

    Abstract. The ding-dong charade of Edo State Council for Arts and Culture Performing Troupe (ESCFAACPT) cannot be divorced from the vacillating condition the establishment had been experiencing since its establishment. This condition is fore-grounded, first, on the cacophony of nomenclature that the council had been ...

  15. Students Perception of Cyber Crime in Edo State: Implications for ...

    African Journals Online (AJOL)

    The study determined the perception of students toward committing cyber crime the study will determine the level of success and the gender mostly prone to commit this crime. The study employed the use of descriptive survey to find out students perception towards cyber crime in Edo State. A sample of 500 students ...

  16. Socio-economic characteristics of registered cocoa farmers in Edo ...

    African Journals Online (AJOL)

    This study examined the socio-economic characteristics of registered cocoa farmers in Edo State; Nigeria. Primary data was collected using a well structured questionnaire administered to 180 registered cocoa farmers selected using a multi-stage sampling technique. Data were analyzed using descriptive statistics and ...

  17. Chemical Compositions of Soils in Parts of Edo State, Southwest ...

    African Journals Online (AJOL)

    MICHAEL HORSFALL

    www.bioline.org.br/ja. Chemical Compositions of Soils in Parts of Edo State, Southwest Nigeria and their ... the soil in agriculture and engineering (Imasuen et al. 1989b). Clay mineral ..... Unpublished Ph.D. Thesis, The. University of Western ...

  18. EOS Operations Systems: EDOS Implemented Changes to Reduce Operations Costs

    Science.gov (United States)

    Cordier, Guy R.; Gomez-Rosa, Carlos; McLemore, Bruce D.

    2007-01-01

    The authors describe in this paper the progress achieved to-date with the reengineering of the Earth Observing System (EOS) Data and Operations System (EDOS), the experience gained in the process and the ensuing reduction of ground systems operations costs. The reengineering effort included a major methodology change, applying to an existing schedule driven system, a data-driven system approach.

  19. Economic Potential of Taungya Farming System in Edo State, Nigeria

    African Journals Online (AJOL)

    The study examined the economic potential of taungya system in Edo state, using of data obtained from both primary and secondary sources with the aid of well structured questionnaires administered to 230 respondents in eight the Local Government Areas practicing taungya farming in government reserved forests.

  20. Human Trafficking in Edo State (Nigeria): A Socio- Economic Study ...

    African Journals Online (AJOL)

    The essay is derived from a field study executed in 2009. Its focus is on. Benin City inhabited mostly by the Bini group although other groups like the Ishan, Etsako, Akoko-Edo, and Owan are also well represented. It is generally believed that Bini girls/women dominate the sex export to. Europe through human trafficking.

  1. DROP OUT FROM SCHOOL AMONG GIRLS IN EDO STATE ...

    African Journals Online (AJOL)

    Elizabeth

    this paper is to investigate why girls dropout from school in Edo State. The descriptive survey ... women. It allows them greater control of their lives and provides them with skills to ... in an attempt to protect their teenage daughters, give them out to wealthy old friends. .... Counselling intervention for gender equality. A paper.

  2. Pollutant materials and pollution control at Cupertino de Miranda Foundation

    Directory of Open Access Journals (Sweden)

    A. I. Mosca

    2007-01-01

    Full Text Available Dr. António Cupertino de Miranda Foundation is the owner of a toy automobile, trains and boats collection, mainly constituted of zinc alloy (zamac.The characteristics of the displayed materials used in the exhibition, essentially wood composites and carpeting, reads to foreseeing a certain vulnerability and consequent future alteration and decay of the existing collection. This work aimed to identify some of the pollutant materials and to characterize their emissions, to develop low cost monitoring methods easily performed by the museum staff members and to propose new solutions in order to delay a possible degradation of the collection, keeping the current exhibition conditions. Among the solutions proposed are the replacement of the existing MDF with MDF free from moisture or flame resistant treatments and the introduction of RB4 activated charcoal.

  3. The European Drought Observatory (EDO): Current State and Future Directions

    Science.gov (United States)

    Vogt, Jürgen; Sepulcre, Guadalupe; Magni, Diego; Valentini, Luana; Singleton, Andrew; Micale, Fabio; Barbosa, Paulo

    2013-04-01

    Europe has repeatedly been affected by droughts, resulting in considerable ecological and economic damage and climate change studies indicate a trend towards increasing climate variability most likely resulting in more frequent drought occurrences also in Europe. Against this background, the European Commission's Joint Research Centre (JRC) is developing methods and tools for assessing, monitoring and forecasting droughts in Europe and develops a European Drought Observatory (EDO) to complement and integrate national activities with a European view. At the core of the European Drought Observatory (EDO) is a portal, including a map server, a metadata catalogue, a media-monitor and analysis tools. The map server presents Europe-wide up-to-date information on the occurrence and severity of droughts, which is complemented by more detailed information provided by regional, national and local observatories through OGC compliant web mapping and web coverage services. In addition, time series of historical maps as well as graphs of the temporal evolution of drought indices for individual grid cells and administrative regions in Europe can be retrieved and analysed. Current work is focusing on validating the available products, developing combined indicators, improving the functionalities, extending the linkage to additional national and regional drought information systems and testing options for medium-range probabilistic drought forecasting across Europe. Longer-term goals include the development of long-range drought forecasting products, the analysis of drought hazard and risk, the monitoring of drought impact and the integration of EDO in a global drought information system. The talk will provide an overview on the development and state of EDO, the different products, and the ways to include a wide range of stakeholders (i.e. European, national river basin, and local authorities) in the development of the system as well as an outlook on the future developments.

  4. High Lassa Fever activity in Northern part of Edo State, Nigeria ...

    African Journals Online (AJOL)

    The purpose was to establish simple statistics of the effects of lassa fever in northern part of Edo State, Nigeria. Lassa fever activity in the northern part of Edo state, Nigeria, was confirmed in 2004 by laboratory analysis of samples sent to Bernhard–Nocht Institute (BNI) for Tropical Medicine Hamburg, Germany.

  5. Traces of warping subsided tectonic blocks on Miranda, Enceladus, Titan

    Science.gov (United States)

    Kochemasov, G.

    2007-08-01

    sharp difference between uplifted and subsided blocks presents Miranda having very sharp relief range. Subsided areas (coronas) are strongly folded, uplifted areas strongly degassed what was witnessed by numerous craters of various sizes (not all craters are of impact origin!). Coronas on Miranda present subsided segment and sectors. Typical is a very sharp boundary between risen (+) and fallen (-) blocks. On Enceladus the subsided (squeezed) southern pole area is characterized by "tiger stripes" - traces of contraction, young ice deposits and famous ejections of water vapor and ice. The squeezed area expels 'molten" material from interior - compare with periodically active Hawaiian volcano expelling basalts from constantly under contraction Pacific basin interior. As to the subsided Pacific basin, it is antepodean to uplifted deeply cracked and degassing Africa. On Enceladus to contracted south is opposed expanded north where past degassing is witnessed by numerous craters (not all of them are impacts!). Contraction traces are very impressive on subsided Titan's surfaces - methane filled thinly folded huge areas mainly in near equatorial regions (some scientists think that these folds are eolian dunes but they are parallel, not perpendicular to presumed winds and, besides, winds below ˜60 km in Titan's atmosphere are not detected by "Huygens") [1, 2]. This methane rich area of intensive folding is antepodean to the uplifted and mainly composed of water ice region Xanadu cut by numerous tectonically controlled dry "valleys". So, in spite of many varieties of surface features on icy satellites of the outer Solar system a common main tectonic tendency exists: opposition of subsided contracted and uplifted expanded blocks. References: [1] Kochemasov G.G. (2006)Titan's radar images: crosscutting ripples are dunes or warping surface waves?// Berlin, 22-26 Sept. 2006, EUROPLANET Sci. Conf. 1, EPSC2006-A-00045. [2] Kochemasov G.G. (2006)Planetary plains: subsidence and

  6. AUS module MIRANDA - a data preparation code based on multiregion resonance theory

    International Nuclear Information System (INIS)

    Robinson, G.S.

    1977-07-01

    MIRANDA is a data preparation module of the AUS reactor neutronics scheme and is used to prepare multigroup cross-section data which are pertinent to a particular reactor system from a general purpose multigroup library of cross sections. The cross-section library has been prepared from ENDF/B and includes temperature dependent data and resonance cross sections represented by subgroup parameters. The MIRANDA module includes a multiregion resonance calculation in slab, cylinder or cluster geometry, a homogeneous Bsub(L) flux solution, and a group condensation facility. Interaction with other AUS modules, particularly for burnup calculations, is provided. (Author)

  7. Dynamics of the Uranian and Saturnian satellite systems - a chaotic route to melting Miranda?

    International Nuclear Information System (INIS)

    Dermott, S.F.; Malhotra, R.B; Murray, C.D.

    1988-01-01

    Miranda's anomalously large inclination, in conjunction with the postaccretional resurfacing of both Miranda and Ariel and anomalously large eccentricities characterizing the inner Uranian satellites, are presently held to suggest the disruption of resonant configurations that once existed in this satellite system. Classical analytical methods for the dynamics of resonance are here used to demonstrate how temporary capture into a second- or higher-order resonance can generate large increases in eccentricity and inclination on comparatively short time-scales. Such capture into resonance may result in chaotic motion. 66 references

  8. Interpretación palinofacial a partir de la identificación de la materia orgánica de los carbones del manto 160, bloque Norte– Mina el Hatillo, departamento del Cesar

    Directory of Open Access Journals (Sweden)

    Elias Ernesto Rojas-Martinez

    2013-01-01

    Full Text Available In the exploitation phase of the mantle160 in the north block of the mine El Hatillo (Department of Cesar, were detected in vertical and lateral changes in coal quality, which affects the operation in that area, to establish whe the this variability related to the palaeoenvironment sand source of organic matter that generated them, 22 samples were taken for the lithotypes identified in block 4 points north palinofacial undergoing interpretation by identifying organic matter, through analysis thin – film visual from non – oxidative methods. The determination of palynomorphs, fitoclastos mainly amorphous and organic matter, managed to establish the presence of three palynofacies, palynofacies1, comprising Botryococcus, fitoclastos amorphous, fungal spores and cuticles, palynofacies 2: consisting of pollen grains, translucent fitoclastos biostructures not algae, fitoclastos biostructures translucent, opaque equidimensional fitoclastos, secretions and palynofacies 3: consists of foraminifera, fitoclastos amorfizados, spores, fungal hyphae and fluorescent amorphous organic matter, this analysis established that palinofacial the paleoenvironment of formation of the coals resulted in continental coast lines with important events in marine fluctuations.

  9. Festival of Curses: A Traditional Crime Control Method In Edo State –Nigeria

    OpenAIRE

    Rashidi Akanji Okunola; Adediran Daniel Ikuomola

    2016-01-01

    Festivals and ceremonies are part and parcel of African culture, usually in all its pump, merriment and pageantry. However, with the increasing wave of criminal activities in Nigeria especially in Edo state, festivals and ceremonies are being redefined and conceptualized in practice. Only recently a new festival ‘Festival of Curses’ was brought to the fore in combating crime in Edo state. The study therefore seeks to explain the festival as a traditional mechanism in crime control, the nature...

  10. ECONOMIC DENIAL OF SUSTAINABILITY (EDOS ATTACK ON CLOUD – A SURVEY

    Directory of Open Access Journals (Sweden)

    A. Somasundaram

    2016-12-01

    Full Text Available Cloud computing is a promising technology aims to provide reliable, customized and quality of service computation environments for cloud users in terms of Software as a Service-SaaS , Plat- form as a Service-PaaS and Infrastructure as Service-IaaS, which is provided on the pay per use basis. Cloud computing enables services to be deployed and accessed globally on demand with little maintenance by providing QoS as per service level agreement (SLA of customer. However, due to elasticity of resources, cloud systems are facing severe security problems. One of the most serious threats to cloud computing is EDoS (economic Distributed Denial of Service aims to consume the cloud resource by attacker and impose financial burden to the legitimate user, where integrity, availability and confidentiality of the cloud services are never compromised but affects the accountability which leads to inaccurate billing. Since the billing models of cloud services may not be mature enough to properly account for an EDoS attack. These paper surveys, the different techniques that generate, detect and mitigate the EDoS Attack on Cloud.

  11. Miranda v. Arizona” (1966) und die effektive Garantie der Selbstbelastungsfreiheit – zwei Mythen des amerikanischen Verfassungsrechts? / Philipp Wittmann

    Index Scriptorium Estoniae

    Wittmann, Philipp

    2014-01-01

    USA Ülemkohtu lahenditest, mis annavad õiguse keelduda iend süüdistavate ütluste andmisest. Kohtulahendist asjas "Miranda v Arizona" alates on politseil kohustus kinnipeetavatele ja ülekuulatavatele anda teada nende vaikimisõigusest

  12. Examining the role of interrogative suggestibility in Miranda rights comprehension in adolescents.

    Science.gov (United States)

    McLachlan, Kaitlyn; Roesch, Ronald; Douglas, Kevin S

    2011-06-01

    This study aimed to further clarify the association between interrogative suggestibility and Miranda rights comprehension in adolescents; in particular, we examined whether intellectual ability (IQ) serves as a mediator of this relationship. Participants completed Grisso's Miranda Instruments, the Wechsler Abbreviated Scale of Intelligence, and the Gudjonsson Suggestibility Scale. Many youth demonstrated poor comprehension of their rights, particularly younger and less intellectually capable adolescents. Both yield and shift components of interrogative suggestibility were inversely related to rights comprehension; however, IQ fully mediated these relationships. Neither demographic variables (gender, ethnicity, socio-economic status after controlling for IQ, and English as a second language (ESL) status) nor previous police experience were significantly associated with rights comprehension in the present sample. The implications of these findings are discussed.

  13. Doctor Ramón Luis Miranda Torres, su relación con las neurociencias

    OpenAIRE

    Hodelín Tablada,Ricardo

    2005-01-01

    Objetivo: en el presente trabajo se reseña la relación del doctor Ramón Luis Miranda con las neurociencias, dirigido a destacar su inclinación por estas disciplinas. Desarrollo: conocido en la historiografía médica como el médico de José Martí el apóstol cubano el doctor Ramón Luis Miranda Torres, se destacó en otros aspectos poco divulgados, por lo que opinamos que no se le ha otorgado su verdadera dimensión. Nacido en la ciudad de Matanzas, Cuba, estudió medicina en Francia y desde sus años...

  14. Irrigation Capability Evaluation of Illushi Floodplain, Edo State, Nigeria

    Directory of Open Access Journals (Sweden)

    A.S. Umweni

    2014-06-01

    Full Text Available Many irrigation projects, especially in the developing tropical regions, are embarked upon without any land capability assessment, resulting in avoidable and undesirable ecological consequences. The aim of this study is to assess the irrigation capability potentials of the soils of a rice growing Illushi/Ega community in Edo State of Nigeria. Soils of Illushi/Ega (200 ha were studied to establish their irrigation capabilities. Water samples were collected from the rivers within and near the sites at the proposed points of intake structures and analyzed for salinity (ECw, permeability (SAR and ion toxicity [Chlorine (Cl and Boron (B]. Gravity irrigation suitability assessment was carried out following the guidelines of the United States Bureau for Land Reclamation (USBR, 1953 and FAO (1979. Results showed that about 5.5 % of the land was non-irrigable, 11.5 % was marginally irrigable, 30.5% was moderately irrigable and 52.5 % highly irrigable.Thus about 83 % of the total land area was found to be irrigable. The results of analyses of irrigation water [ECw, SAR and Cl and B (ion toxicity problems in water sources were 0.1 – 0.7 dS m-1, 1.2 – 1.7, 0.6 – 1.8 cmol kg-1 and 0.5 – 0.7 mg kg-1] also show that there is no indication of salinity or ion toxicity problem.

  15. Parasites of edible land snails in Edo State, Nigeria

    Directory of Open Access Journals (Sweden)

    Igbinosa I. B.

    2016-12-01

    Full Text Available Land snails are sources of protein to man and are hosts to a number of parasites. It is imperative that the roles of the snail hosts and parasites are clearly defined. Before then however, the parasites of the different land snails collected in any locality should be identified. Land snails were collected in the wild in both dry and wet seasons. The internal organs and the faeces were examined for the presence of parasite. In the rainy season of 2015, a total of 272 snails were collected across four major towns (Benin, Uromi, Ekpoma and Auchi in Edo State, Nigeria, while in the dry season, fewer snails (n=91 were handpicked. The snail species seen are: Achatina achatina (Linnaeus, 1758, Achatina fulica (Férussac, 1821, Acharchatina marginata (Swainson, 1982, Limicolaria aurora (Jay, 1839, L. flammea (Müller, 1774 and Limicolariopsis spp. The larvae of Strongyloides stercoralis were isolated from the various snail species with overall prevalence of 54.04 %. Snails positive with Alaria mesocercariae were L. aurora, L. flammea and Limicolariopsis spp. Additionally, few L. flammea were positive of the cercariae of Drocoelium dedriticum. Meanwhile, some samples of A. fulica harboured larvae of Angiostrongylus cantonesis, sporocysts of Fasciola gigantica and Schistosoma mansoni. Therefore, these edible snails could pose serious health hazard to man and animals by serving as a possible alternative parasite transmission route.

  16. Sob a sombra de Carmen Miranda e do carnaval: brasileiras em Los Angeles Under the shadow of Carmen Miranda and carnival: brazilian women in Los Angeles

    Directory of Open Access Journals (Sweden)

    Bernadete Beserra

    2007-06-01

    Full Text Available Neste artigo, analiso como brasileiras de classes média e média alta em Los Angeles lidam com o fenômeno da exotização das suas imagens. Observo que, embora originalmente articuladas a partir de Hollywood (Carmen Miranda nos limites da hierarquia entre as nações e do colonialismo, essas imagens são hoje alimentadas e recriadas também pelos próprios brasileiros. Uma das idéias centrais que defendo aqui é que embora tais imagens inicialmente restrinjam a ação das brasileiras, uma vez que sempre impõem o diálogo com os seus conteúdos, elas não o fazem permanentemente, ou seja, no processo de integração há espaço para a negociação de outras imagens e conteúdos e isto depende de fatores que vão além da exotização em si.This article discusses how middle and upper-middle class Brazilian women deal with their exoticized images in Los Angeles. It points out that although originally articulated from Hollywood (Carmen Miranda, within the limits of the hierarchy of nations and colonialism, today these images are also fed and recreated by Brazilians. One of the central ideas presented is that, despite constraining the movements and actions of the women, imposing on them the need to dialogue with their content, these exotic images do not do it permanently. In other words, in the process of integration, there is always room for negotiation of other images and contents that depend on factor other than exoticization itself.

  17. Second generation of ``Miranda procedure'' for CP violation in Dalitz studies of B (and D and τ) decays

    Science.gov (United States)

    Bediaga, I.; Miranda, J.; dos Reis, A. C.; Bigi, I. I.; Gomes, A.; Otalora Goicochea, J. M.; Veiga, A.

    2012-08-01

    The “Miranda procedure” proposed for analyzing Dalitz plots for CP asymmetries in charged B and D decays in a model-independent manner is extended and refined in this paper. The complexity of Cabibbo-Kobayashi-Maskawa CP phenomenology through order λ6 is needed in searches for new dynamics (ND). Detailed analyses of three-body final states offer great advantages: (i) They give us more powerful tools for deciding whether an observed CP asymmetry represents the manifestation of ND and its features. (ii) Many advantages can already be obtained by the Miranda procedure without construction of a detailed Dalitz plot description. (iii) One studies CP asymmetries independent of production asymmetries. We illustrate the power of a second generation Miranda procedure with examples with time integrated rates for Bd/B¯d decays to final states KSπ+π- as trial runs, with comments on B±→K±π+π-/K±K+K-.

  18. MIRANDA - a module based on multiregion resonance theory for generating cross sections within the AUS neutronics code system

    International Nuclear Information System (INIS)

    Robinson, G.S.

    1985-12-01

    MIRANDA is the cross-section generation module of the AUS neutronics code system used to prepare multigroup cross-section data which are pertinent to a particular study from a general purpose multigroup library of cross sections. Libraries have been prepared from ENDF/B which are suitable for thermal and fast fission reactors and for fusion blanket studies. The libraries include temperature dependent data, resonance cross sections represented by subgroup parameters and may contain photon as well as neutron data. The MIRANDA module includes a multiregion resonance calculation in slab, cylinder or cluster geometry, a homogeneous B L flux solution, and a group condensation facility. This report documents the modifications to an earlier version of MIRANDA and provides a complete user's manual

  19. Quality of life among female workers in edo state: consideration of ...

    African Journals Online (AJOL)

    This study examined the role of age, marital status and job-type on quality of Life amonge female workers in Edo State (N =188). Results from t-test revealed that female teachers reported better quality of life than female police officer, married female workers reported better quality of life than single female workers, while ...

  20. The pain of labour: Perspectives of traditional birth attendants in Edo ...

    African Journals Online (AJOL)

    Objective: To determine the concept of labour pain and its relief in a cultural setting using the perspectives of Traditional Birth Attendants (TBAs). Design: Cross Sectional Comparative Study. Setting: An urban area (Benin City) and a semi-urban town (Auchi) in Edo State, Nigeria. Subjects: Traditional Birth Attendants in an ...

  1. Physio-Chemical Analysis of Industrial Effluents in parts of Edo ...

    African Journals Online (AJOL)

    Physio-Chemical Analysis of Industrial Effluents in parts of Edo States Nigeria. ... Journal of Applied Sciences and Environmental Management ... particularly, surface water results from all activities of man involving indiscriminate waste disposal from industry such as effluents into waterways, waste, agricultural waste, and all ...

  2. Efficiency of resource-use in Cassava production in Edo state, Nigeria

    African Journals Online (AJOL)

    This study employed the use of the Maximum Likelihood Estimation Technique in estimating the efficiency of resource-use in cassava production in Edo State. Data used for the study were sourced through the cost-route method of data collection, based on a stratified random sampling technique. The average farm size of ...

  3. Mathematics Teachers' Use of Ethnomathematics Approach in Mathematics Teaching in Edo State

    Science.gov (United States)

    Aikpitanyi, Lucky Aiwuyor; Eraikhuemen, Lucy

    2017-01-01

    The study investigated mathematics teachers' use of ethnomathematics approach to teaching. Descriptive survey research was used with a target population of all mathematics teacher in all public secondary schools in Oredo, Egor and Ikpoba-Okha local government areas of Edo State out of which 121 mathematics teachers in 42 randomly selected public…

  4. Attitude of Local Dwellers towards Ecotourism in the Okomu National Park, Edo State Nigeria

    Directory of Open Access Journals (Sweden)

    Digun-Aweto Oghenetejiri

    2015-12-01

    Full Text Available Ensuring local community support for national parks is viewed as a paramount ingredient for conservation and sustainability. This is advocated for the park to meet its conservation goals. The Okomu National Park (ONP, Edo State, Nigeria, is one of such protected areas of lush green rain forest requiring conservation.

  5. Costs and return analysis in rubber latex production in Edo State ...

    African Journals Online (AJOL)

    The study examined the costs and return analysis in rubber latex production in Edo Sate, Nigeria. Multi-stage sampling method was adopted to select 96 smallholder rubber framers for the study. The first stage was a purposive sampling of two LGAs and then simple random sampling of 6 villages each from the two LGA.

  6. A study of blood and gastro-intestinal parasites in Edo state | Mordi ...

    African Journals Online (AJOL)

    A four-year study to determine the prevalence of both blood and gastro-intestinal parasites of man was done in all the eighteen local government areas of Edo State, Nigeria. The study, which commenced in January of 2000, ended in December of 2004. Of the 136,360 samples examined, 1000 that is 0.7% had parasites.

  7. Youth sexuality and youth age at first sexual intercourse in Edo ...

    African Journals Online (AJOL)

    ... significant (p>0.05), using the chi-square statistic. Finally, it is advocated that such information is important to stakeholders for helping the youth who would certainly not be able to face the challenges of adulthood when they engage in early sexual activity. Keywords: Youth, Sexuality, Age, Sexual Intercourse, Edo Central ...

  8. Prevalence of diseases among sheep and goats in Edo State, Nigeria

    African Journals Online (AJOL)

    Clinical records of small ruminant (Sheep and Goat) diseases treated were collected from the veterinary clinics, Ministry of Agriculture and Natural Resources of three Local Government areas in Edo state, for a period of five years (1997-2002). To identify the disease occurrence and prevalence as it militates against the ...

  9. Poultry production constraints: the case of Esan West LGA of Edo ...

    African Journals Online (AJOL)

    Poultry production constraints: the case of Esan West LGA of Edo State, Nigeria. ... They also identified the lack of good quality water, and proper marketing outlets. High cost and at times ... By so doing, their resources `can be pooled together for meaningful development of their farms and the poultry industry in general.

  10. Political Empowerment of Women through Literacy Education Programmes in EDO and Delta States, Nigeria

    Science.gov (United States)

    Olomukoro, Caroline O.; Adelore, Omobola O.

    2015-01-01

    The study examined the political empowerment of women through literacy education programmes in Edo and Delta States in the South-South Geopolitical zone of Nigeria. A sample of 1022 women was randomly drawn from the different levels of literacy classes organised by the Agency of Adult and Nonformal Education and non-governmental and private…

  11. Reflexiones sobre el viaje de Francisco de Miranda al Imperio Otomano

    Directory of Open Access Journals (Sweden)

    Mehmet Necati Kutlu

    2007-01-01

    Full Text Available Francisco de Miranda, en sus viajes por Europa, permanció casi tres meses en el Imperio Otomano (en Esmirna y Estambul. En sus escritos, el político venezolano se refirió especialmente a la vida social y cultural, a la economía y al ejército y a la defensa de Turquía. Por ello, el conocimiento de primera mano de estos aspectos parece la motivación fundamental de su estancia, sin que sea posible señalar ninguna gestión en busca de apoyo a la causa de la independencia americana.Francisco de Miranda, in his travels across Europe, visited for almost three months the Ottoman Empire (Izmir and Istambul. In his writings, the Venezuelan politician dealt especially with social and cultural life, the economy and the army and defence of the country. This is why the first-hand knowledge of these aspects seems to be the main reason of his stay; instead, it is not possible to find any step in the search of support for the American independence.

  12. A educação hebraica segundo Theobaldo Miranda Santos

    Directory of Open Access Journals (Sweden)

    Rodrigo Augusto de Souza

    2015-01-01

    Full Text Available Este trabalho tem por objetivo apresentar a educação hebraica segundo o pensamento de Theobaldo Miranda Santos (1904-1971. Para tanto, investigaremos o capítulo do manual didático “Noções de História da Educação” que tratou exclusivamente desse tema. Buscamos problematizar o tratamento oferecido pelo intelectual ao tema da educação hebraica. Considerando que Theobaldo publicou seu manual didático pela primeira vez em 1945, no período de hegemonia de ideologias como o fascismo e o nazismo, procuramos compreender as nuances da educação hebraica de acordo com seu pensamento. Essas ideologias demonstravam grande preocupação com a chamada “questão judaica”, que já havia sido apontada por Karl Marx (1818-1883 ainda durante o século XIX, na Alemanha. O surgimento do antissemitismo no plano político foi uma característica desse período histórico. O tratamento oferecido por Theobaldo Miranda Santos ao tema da educação hebraica consiste no objeto dessa investigação.

  13. Similar rates of protein adaptation in Drosophila miranda and D. melanogaster, two species with different current effective population sizes

    Directory of Open Access Journals (Sweden)

    Bachtrog Doris

    2008-12-01

    Full Text Available Abstract Background Adaptive protein evolution is common in several Drosophila species investigated. Some studies point to very weak selection operating on amino-acid mutations, with average selection intensities on the order of Nes ~ 5 in D. melanogaster and D. simulans. Species with lower effective population sizes should undergo less adaptation since they generate fewer mutations and selection is ineffective on a greater proportion of beneficial mutations. Results Here I study patterns of polymorphism and divergence at 91 X-linked loci in D. miranda, a species with a roughly 5-fold smaller effective population size than D. melanogaster. Surprisingly, I find a similar fraction of amino-acid mutations being driven to fixation by positive selection in D. miranda and D. melanogaster. Genes with higher rates of amino-acid evolution show lower levels of neutral diversity, a pattern predicted by recurrent adaptive protein evolution. I fit a hitchhiking model to patterns of polymorphism in D. miranda and D. melanogaster and estimate an order of magnitude higher selection coefficients for beneficial mutations in D. miranda. Conclusion This analysis suggests that effective population size may not be a major determinant in rates of protein adaptation. Instead, adaptation may not be mutation-limited, or the distribution of fitness effects for beneficial mutations might differ vastly between different species or populations. Alternative explanation such as biases in estimating the fraction of beneficial mutations or slightly deleterious mutation models are also discussed.

  14. El mundo del libro: Miranda y la revolución francesa Junio de 1967

    Directory of Open Access Journals (Sweden)

    Caracciolo Parra Pérez

    1967-06-01

    Full Text Available Debemos agradecer a la generosidad sin límites del gran historiador venezolano, Héctor Parra Márquez, pariente cercano en lo espiritual y consanguíneo de Parra Pérez, el tener en nuestra Biblioteca, con dedicatoria que nos honra, la obra "MIRANDA Y LA REVOLUCION FRANCESA" en II Tomos, que escribiera el gran crítico e historiador venezolano Caracciolo Parra Pérez, cuya obra es un estuario gigantesco para hallar las rutas, los nombres, porfías, hazañas, frustraciones, de esta América de lentos sones cobrizos, renovadas esperanzas, ácidas porfías, ambivalencias, derrotas y éxitos, eruptivas pasiones, marcos dorados de leyenda, trabajo de hombres sudorosos en la briega emancipadora, intelectuales ilusos, forjadores de esperanzas, y siempre prontos a "recibir las bofetadas"

  15. Consuming Carmen Miranda: Dislocations and Dissonances in the Reception of an Icon

    Directory of Open Access Journals (Sweden)

    Fernando de Figueiredo Balieiro

    2017-02-01

    Full Text Available From the perspective of cultural studies, in its dialogs with feminist and queer studies, this article analyzes the identification of various publics with Carmen Miranda based on the consumption of her filmic, musical and artistic products, accessing her professional trajectory in its imbrication with its various forms of reception. The focus will be on the negotiations of the artist with her publics, touching on how her career involved reconfigurations concerning aspects of gender, race and sexuality. It is based on a perspective that considers the dynamism of mass culture, considering possibilities for various forms of appropriation of cultural products, as well as shifts and dissonances in receptions. To analyze these aspects, the paper focuses on feminine receptions in Brazil and the United States, and those of a male homosexual public contemporary to her career.

  16. Notícia de romances, folhetos e folhas volantes na terra de Miranda

    Directory of Open Access Journals (Sweden)

    António Bárbolo Alves

    2008-11-01

    Full Text Available Au Portugal la « littérature de colportage » est appelée « literatura de cordel », « folhas volantes » ou « folhetos ». Dans la région Terra de Miranda, à l'extrême nord-est du Portugal, ces livres populaires ont circulé jusqu'à la moitié du XX siècle mais, malheureusement, ils ont presque totalement disparu. Dans cet article, guidés par la mémoire et le savoir d'une conteuse, on essaiera de retrouver quelques traces de ces « folhetos » : leurs caractéristiques techniques et poétiques, les sujets les plus importants et la langue (étant donné que dans cette région on parle aussi le mirandais.

  17. Francisco de Miranda: Precursor de la independencia o espía al servicio de Inglaterra

    Directory of Open Access Journals (Sweden)

    Ángel Rafael Lombardi Boscán

    2006-09-01

    Full Text Available Francisco de Miranda es una de las grandes figuras emblemticas de la Historia de Venezuela. En nuestro medio le consideramos el adalid de la libertad continental en contra de la Monarquía hispnica. Hace doscientos años que intentó invadir a Venezuela y fracasó (1806; aunque contribuyó a crear las condiciones para la transición de colonia a republica. Aquí llevamos a cabo un acercamiento a su vida como conspirador bajo la dicotomía y paradoja de servir tanto a los intereses geopolíticos ingleses como a la causa de la libertad republicana.

  18. Some parameters of thyroid function in Dutch-Miranda rats submitted to chronic treatment of lithium

    International Nuclear Information System (INIS)

    Frankenfeld, T.G.P.; Moura, E.G. de; Rosenthal, D.

    1986-01-01

    Some aspects of thyroid function in rats whose blood lithium levels were maintained are investigated. At therapeutic levels during 1,5 to 2 months. Adult young male rats (isogenic Dutch-Miranda) of the same litter were randomly distributed into paired experimental and control groups of 3 animals. The animals were fed comercial chow and received tap water or LiCl 12,5 mM in distiled water to drink, ad-libitum. At the end of experimental period each animal received an intraperitoneal tracer dosis of I-131 (5-6 uCi), 72 h later their thyroids were removed, weighed and counted to determine the I-131 uptake. The pooled thyroids of each group were homogeneized and supernadant and particulate fractions were separed by centrifugation. TPO activity was determined in the pseudosolubilized particulate feaction. (Author) [pt

  19. Calibration of System Input Volume and Non-Revenue Water Index in Edo North, Nigeria

    OpenAIRE

    Philipa O. Idogho; Olotu Yahaya

    2013-01-01

    Water scarcity is a serious problem in developing world. It could be physical scarcity or economic water shortage. The output of physicsbased study conducted in Edo North, Nigeria revealed that physical water losses in the water distribution network have compounded the accessibility and affordability of safe drinking water. Water supply and loss variables such as Water Supply (WS) Physical Water Loss (WLρ) Apparent Water Loss (WLE) Water Loss Reduction Index (WLRI) and Av...

  20. Sino-Japanese Interaction via Chinese Junks in the Edo Period

    OpenAIRE

    MATSUURA, Akira

    2010-01-01

    To maintain its policy of national isolation during the Edo period, Japan restricted contact with the outside world to Dutch merchant ships and Chinese junks at the Japanese port of Nagasaki. Sino-Japanese interaction consisted not only of trade in goods, but also of cultural and scholarly exchanges. This paper will examine how this unofficial trade affected both Japan and China from a cultural perspective.

  1. Silk and Sakoku : a simulation analysis of industrial location in Edo period Japan

    OpenAIRE

    ATSUMI, Toshihiro

    2012-01-01

    Japan closed itself to international trade from the 17^ century to the mid-19^ century during the Edo period, known as the Sakoku. After the closure, industries dispersed from western coastal cities to inland areas in western and eastern Japan. This paper investigates how the Sakoku may have aff ected industrial locations within Japan by applying a footloose entrepreneur type geography model to an economy with agricultural raw materials in a continuous space setting. The simulations based on ...

  2. Anion size and isotope effects in (EDO-TTF)2XF6

    International Nuclear Information System (INIS)

    Nakano, Yoshiaki; Yamochi, Hideki; Saito, Gunzi; Uruichi, Mikio; Yakushi, Kyuya

    2009-01-01

    (EDO-TTF) 2 PF 6 is a quasi one-dimensional molecular conductor and undergoes a peculiar metal-insulator (MI) transition. The phase transition mechanism is cooperative among Peierls, charge ordering, and anion ordering transitions, which is accompanied with a distinct molecular deformation. (EDO-TTF) 2 XF 6 (X = P (1h), As (2h), Sb (3h)) showed that the transition temperature (T MI ) and the width of thermal hysteresis (ΔT MI ) were systematically changed depending on the anion size, i.e., the T MI decreased in order of 279.0 K (1h), 270.8 K (2h), and 242 K (3h) and the ΔT MI increased in order of 1.0 K (1h), 5.5 K (2h), and 14 K (3h). The deuterated salts, (EDO-TTF-d 2 ) 2 XF 6 (X = P (1d) and As (2d)), showed higher T MI of 282.0 (1d) and 274.0 K (2d) and narrower ΔT MI of 0.0 (1d) and 5.0 K (2d) than the undeuterated 1h and 2h, respectively. X-ray analysis revealed the anisotropic thermal expansion of unit cell. The linear relationship between ΔT MI and volume change at T MI was found.

  3. Simulación basada en SMA de sistemas originalmente representados con EDO

    Directory of Open Access Journals (Sweden)

    Ekaitz Zulueta Guerrero

    2011-10-01

    Full Text Available Resumen: En el presente trabajo se expone una metodología para modelar mediante un Sistema Multi-Agente (SMA sistemas biológicos y fisiológicos dinámicos con variables cuantificadas discretas, como el crecimiento y decrecimiento de poblaciones o el modelado epidemiológico de enfermedades. Se muestra un procedimiento para transformar un sistema de Ecuaciones Diferenciales Ordinarias (EDO (que modela un entorno de forma correcta en un SMA equivalente mediante un esquema basado en el método de Monte Carlo. Se utiliza un caso práctico fundamentado en un modelo matemático de Leucemia Mieloide Crónica (LMC para comparar la metodología basada en agentes con el modelado tradicional basado en un sistema de EDO. Se realiza una simulación con cada modelo (SMA y EDO y se compara los resultados obtenidos con ambas metodologías. Palabras clave: Ecuaciones diferenciales, modelo basado en agentes, Monte Carlo

  4. Miranda: cultura griega, estudios clásicos, relación con Andrés Bello

    Directory of Open Access Journals (Sweden)

    Miguel Castillo Didier

    2005-12-01

    Full Text Available Francisco de Miranda (1750-1816, precursor, herói e mártir da Independência da América Hispânica, estudou a língua grega e reuniu uma vasta biblioteca, com mais de 170 autores gregos. A idéia de liberdade para a américa espanhola surgiu nele em 1781, ligada a sua profunda admiração pela Grécia, na qual nasceu a liberdade. Aí está porque em sua longa viagem através da Europa, em 1786, apesar das ameaças e dos perigos, ele viajou para a Grécia, que gemia sob a dominação otomana. Ele desejava conhecer os lugares onde haviam nascido as idéias de liberdade e democracia, onde um pequeno povo havia vencido um gigantesco império absolutista. Miranda visitou o Pireu, Atenas, Corinto, Salamina, Maratona e depois Esmirna e Constantinopla. Escreveu um jornal muito interessante de sua viagem à Grécia. Em 1792, Miranda serviu na França, quando a Revolução Francesa ainda não tinha abandonado os ideais libertários. Lá, Miranda defendeu os princípios republicanos e a divisão dos poderes, invocando não Montesquieu, mas o exemplo da Grécia antiga. Pedro Grase iniciou com Miranda seu estudo da tradição humanista na América Latina e prossegue com Andrés Bello (1781-1816, o grande sábio que estudou a língua grega na biblioteca de Miranda, em Londres, e que se tornou latinista e helenista. Bello compartilha de sua convicção de que o estudo do latim e do grego e da cultura clássica está na base de toda a cultura sólida.

  5. Angélica Velázquez Guadarrama. Primitivo Miranda y la construcción visual del liberalismo

    Directory of Open Access Journals (Sweden)

    José David Cortés Guerrero

    2014-01-01

    Full Text Available Este no es un libro de historia del arte. Es un libro sobre como el arte se contextualiza en procesos históricos y los puede explicar, interpretar y dar sentido. Angélica Velázquez explora varias de las pinturas del artista mexicano decimonónico Primitivo Miranda para indagar por la visión que tenía aquel sobre el liberalismo. Miranda nació en Tula, hoy Estado de Hidalgo, en 1822. Desde temprano, dio muestras de algún talento artístico que comenzó a perfeccionar en Ciudad de México en la Academia de San Carlos. En 1841, y con el apoyo tanto de la Academia como de varios mecenas, viajo a Roma para continuar sus estudios, beneficio que recibieron en esos años varios de sus compañeros de la Academia. En la Ciudad Eterna estuvo bajo el tutelaje de los artistas Giovanni Silvagni y Francesco Coghetti. Por diversos motivos, Miranda no completo los seis años de estudios en Roma y regreso en 1848 a México.

  6. Accelerated pseudogenization on the neo-X chromosome in Drosophila miranda

    KAUST Repository

    Nozawa, Masafumi

    2016-11-29

    Y chromosomes often degenerate via the accumulation of pseudogenes and transposable elements. By contrast, little is known about X-chromosome degeneration. Here we compare the pseudogenization process between genes on the neo-sex chromosomes in Drosophila miranda and their autosomal orthologues in closely related species. The pseudogenization rate on the neo-X is much lower than the rate on the neo-Y, but appears to be higher than the rate on the orthologous autosome in D. pseudoobscura. Genes under less functional constraint and/or genes with male-biased expression tend to become pseudogenes on the neo-X, indicating the accumulation of slightly deleterious mutations and the feminization of the neo-X. We also find a weak trend that the genes with female-benefit/male-detriment effects identified in D. melanogaster are pseudogenized on the neo-X, implying the masculinization of the neo-X. These observations suggest that both X and Y chromosomes can degenerate due to a complex suite of evolutionary forces.

  7. (Recognizing Mondoñedo: The Past Projects Itself as Future

    Directory of Open Access Journals (Sweden)

    Freire Paz, Elena

    2009-12-01

    Full Text Available The author approaches the current socio-cultural reality in the town of Mondoñedo (province of Lugo, Galicia, Spain by considering the rapid economic, social and cultural changes that have taken place there over the past few decades. Whereas from an outside perspective the global economic process has resulted in the transformation of certain cultural patterns everywhere, the changes occurred inside any cultural system have brought about the inception of an interesting strategy of a clearly cultural character. Local development in Mondoñedo nowadays rests on making the most of specific cultural resources so as to prompt and energize an area affected by a sharp population decline. The current context also includes the loss of the town’s provincial hegemony to Lugo, the capital, the demise of primary activities and the meagre implementation of secondary activities.

    La autora se acerca a la realidad socio-cultural actual creada en Mondoñedo, ciudad del interior de la provincia de Lugo (Galicia, España, teniendo en cuenta las bruscas transformaciones económicas, sociales y culturales acontecidas en las últimas décadas. Si, desde una perspectiva externa, el movimiento económico global ha motivado la transformación de determinadas pautas culturales en todo el mundo, los cambios propiciados desde el interior de cualquier sistema cultural han repercutido en la génesis de una interesante planificación de marcado carácter cultural. El desarrollo local de la zona gira en torno al aprovechamiento de determinados recursos culturales como impulsores y dinamizadores de un territorio estrangulado por un fuerte descenso poblacional, la pérdida de consideración hegemónica de la villa frente a la capitalidad de la provincia, el abandono del sector primario y la escasez de actividades del sector secundario.

  8. Manifestation of the Kabuki actors’ gender in woodblock prints of the Edo Period

    Directory of Open Access Journals (Sweden)

    Beata ROMANOWICZ

    2015-06-01

    Full Text Available The connection between Kabuki theatre and Japanese woodblock prints of the Edo period (1603–1868, especially in their portraits of actors called yakusha­‑e, offers an exceptional opportunity to analyse perceptions of the sex of the actor: as the hero of the drama, as well as the character performed on the stage. Both phenomena flourished in the Edo period and had a crucial impact on the visual art of the time, inspiring pictures of the Floating World (Jap. Ukiyo­‑e. The images on Ukiyo­‑e woodblock prints serve as a pretext for approaching the matter of whether to portray an actor as a performer (a man or as the character performed by him (which could also be a woman, as in the case of the onnagata actor. The author focuses on the actors’ identification with their own sex (only men appeared on the Kabuki stage and on cases of breaking the convention between the real actor and his stage emploi. In the first part, the paper discusses the historical background of Kabuki theatre, which was invented by a woman (Izumo‑no Okuni and then after a few government edicts, was allowed to be performed on the stage only by adult men. Since the Kabuki tradition has successfully continued until today, apart from surveys of theatrical archives, the author supports her arguments by also referring to contemporary phenomena, especially the Kabuki performances she has watched in Japan (in such theatres as: Kabuki‑za, Minami‑za, the National Theatre in Tokyo, and Zenshin‑za, and through interviews with actors and people of the theatre. In parallel, Ukiyo­‑e images of the Edo period are studied, with core research from the National Museum in Kraków, Poland, and its collection of Japanese woodblock prints (including over 4600 original works from the Edo Period, and with special attention paid to the yakusha­‑e portrait by Utagawa Kuniyoshi.

  9. Salto de Miranda. Trabajos de excavación de la galería

    Directory of Open Access Journals (Sweden)

    Vilanova Bosch, José Luis

    1964-12-01

    Full Text Available The first article of this series was published in issue N.° 162 of «Informes de la Construcción», under the title «Salto de Miranda». The present article deals with the work of excavating the gallery. Modern practice requires that to do this type of work successfully the auxiliary material should be most carefully studied beforehand. N.° 164 of the this magazine has included a paper entitled «Recent progress in the auxiliary material for underground gallery excavation», summarising the most recent type of machinery now available in the market. Since the Grand Coulee Dam was built by the Bureau of Reclamation, where essentially new techniques were introduced, including minimum times for maximum progress, these new procedures and equipment have been generally adopted throughout the world. To this must be added the urgent and increasing demands for electric power, and the vast amounts of money involved in these hydroelectric projects, which explain the rapid adoption of automatic procedures in this kind of work. In this paper the author explains how, using the means available to him, he sought to coordinate the various constructional tasks, to get as near as possible to the most economic working cycle. Underground ventilation is an acute problem, and involves the safety of those working inside the tunnel. The author explains, in simple terms, how the theory of fluids and air circulation can affect the rational and practical solution of providing adequate air supply for the health and comfort of the underground worker. To attain this end, however, a considerable mechanical and economic investment is necessary.En el número 163 de Informes de la Construcción se publicó el primer trabajo de esta serie, con el título de «Salto de Miranda». En éste se trata de la ejecución de la excavación en galería, para cuyo éxito las técnicas modernas exigen un depurado estudio del mater ial auxiliar. En el número 164 apareció también un art

  10. Reproductive Patterns in the Non-Breeding Season in Asinina de Miranda Jennies.

    Science.gov (United States)

    Quaresma, M; Silva, S R; Payan-Carreira, R

    2015-10-01

    This study aims to characterize the reproductive patterns in Asinina de Miranda jennies during the non-breeding season. Reproductive activity was surveyed in 12 females, aged between 3 and 18 years old, using ultrasound and teasing with a jack. The animals were monitored from September to April, six in each consecutive year. Of these 12 females, nine showed disruption to the normal pattern of ovarian activity during the non-breeding season. Loss of normal cyclicity included anoestrus (41.7%), silent ovulatory oestrus (25%), and persistence of corpus luteum (8.3%). Only three females maintained a regular cyclic pattern with oestrous behaviour during the non-breeding season. Anoestrus began in early November and lasted for an average of 147 ± 28 days (113-191 days), ending near to the spring equinox. Onset of silent oestrous cycles began more erratically, between October and February. In both groups the first behavioural ovulation of the year occurred around the time of the spring equinox. Disrupted reproductive activity was preceded by a shorter oestrous cycle only in females entering anoestrus. The mean follicle size in the first ovulation of the year was larger than in the reproductive season (44.7 ± 2.45 mm vs 39.2 ± 3.60 mm) in anoestrous jennies with protracted oestrus. Though age and body condition score (BCS) were associated, changes in BCS below a threshold of four points (for anoestrus) and five points (for silent oestrus) contributed greatly to disruption of reproductive cycles. BCS in females with regular oestrous cycles during the winter season remained unchanged or exceeded five points prior to the winter solstice. © 2015 Blackwell Verlag GmbH.

  11. Festival of Curses: A Traditional Crime Control Method In Edo State –Nigeria

    Directory of Open Access Journals (Sweden)

    Rashidi Akanji Okunola

    2016-02-01

    Full Text Available Festivals and ceremonies are part and parcel of African culture, usually in all its pump, merriment and pageantry. However, with the increasing wave of criminal activities in Nigeria especially in Edo state, festivals and ceremonies are being redefined and conceptualized in practice. Only recently a new festival ‘Festival of Curses’ was brought to the fore in combating crime in Edo state. The study therefore seeks to explain the festival as a traditional mechanism in crime control, the nature of the festival, the factors that led to its emergence in the 21st century, the level of acceptance and its impact in reducing criminal activities in the State. The study employed principally secondary literature and in-depth interviews among a cross section of the Bini. Major findings revealed that immediately after the festival of curses, a lot of criminals in the state besieged the Bini Monarch’s Palace to confess their atrocities; and pleaded for forgiveness. There was an overwhelming acceptance of the festival irrespective of the people’s religious affiliations to Christianity and Islam as a result of the potency and sudden drop in crime during the period. The study concludes that the festival should be taken as a mechanism of crime control and policing in Nigeria.

  12. An exploration of life experiences of left behind wives in Edo State, Nigeria

    Directory of Open Access Journals (Sweden)

    Adediran Daniel Ikuomola

    2015-06-01

    Full Text Available Research emphasising effects of migration on left behind families often focus on implications of absent fathers, particularly in Africa and areas with historic male migration. Yet, information on the experiences of left behind wives in a patriarchal and familial setting is scanty. This Study explore the socio-cultural challenges facing wives of migrants (Bini women, in Edo State, Nigeria. Specifically it examines the stigmatised experiences and the effect of cultural constrains on women adjustment to life in the absence of their husbands. Drawing on qualitative data collected from in-depth interviews with twenty-one (21 left-behind wives in Benin, Edo State. The study shows how women are confronted with traditions and the need to readjust their lives amidst cultural and familial cooperations and constrains. Narratives buttressed on the excessive surveillance through significant others and the renegotiation of living arrangements based on patriarchal values and expectations. Life adjustment was described as stigmatic, hectic and demanding in maintaining the home front.

  13. Vocational Interest as a Correlate of Re-Entry of Girls into School in Edo State, Nigeria: Implications for Counselling

    Science.gov (United States)

    Alika, Ijeoma Henrietta; Egbochuku, Elizabeth Omotunde

    2012-01-01

    The study investigated the relationship between vocational interest socio-economic status and re-entry of girls into school in Edo State. The research design adopted was correlational because it sought to establish the relationship between the independent variable and the dependent variable. A sample size of 306 girls who re-enrolled in institutes…

  14. Teachers' Attitude towards Special Need Students in Secondary Schools in North Senatorial District of Edo State, Nigeria

    Science.gov (United States)

    Offor, Dianarose Iyeoma; Akinlosotu, Nathaniel Toyosi

    2017-01-01

    The study investigated attitude towards special need students (SNS) among teachers in public secondary schools in Edo Central Senatorial District. The study was undertaken to determine the teachers' attitude and the influence of gender, educational specialisation and experience on their attitude towards SNS. A total of 369 (50%) of the 739…

  15. Edo Mihevc – urbanist, arhitekt in oblikovalec. Vrednotenje povojnega urbanizma slovenske obale

    Directory of Open Access Journals (Sweden)

    Jasna Kralj Pavlovec

    1999-01-01

    Full Text Available Edo Mihevc (1911–1985 je bil eden protagonistov slovenske moderne arhitekture po drugi svetovni vojni in eden Plečnikovih študentov, ki se je ločil od njegove manire ter zakorakal na pot samoizraznosti in iskanja skladja med modernizmom, regionalizmom in humanistično filozofijo. Pomen njegovega prispevka slovenski arhitekturi in kulturi je predstavljen skozi perspektivo večrazsežnostne dejavnosti, s poudarkom na vlogi urbanista slovenske obale. Posamezni deli iz njegovega opusa so predstavljeni z vidika časa nastanka, uporabe in arhitekturne vrednosti, pomen in vloga zamisli ter trendov pa skozi dela. V luči sodobnih doktrin varovanja kulturne dediščine, pravočasna ocena in minimalno varstvo njegove arhitekture mora biti doseženo, tudi za mojstrovine iz bližnje preteklosti.

  16. Pyxiloricaria menezesi, a new genus and species of mailed catfish from Rio Miranda and Rio Cuiabá, Brazil (Pisces, Siluriformes, Loricariidae)

    NARCIS (Netherlands)

    Isbrücker, I.J.H.; Nijssen, H.

    1984-01-01

    Pyxiloricaria menezesi n. gen., n. sp., is described and illustrated from Rio Miranda (Est. Mato Grosso do Sul) and from Rio Cuiabá (Est. Mato Grosso), Brazil. It is assigned to the subtribe Planiloricariina of the tribe Loricariini, subfamily Loricariinae. A comparison is made with sympatric

  17. ESTILOS FLUVIAIS E EVIDÊNCIAS DE MUDANÇAS AMBIENTAIS NA PLANÍCIE DO RIO MIRANDA, PANTANAL

    Directory of Open Access Journals (Sweden)

    Eder Renato Merino

    2013-03-01

    Full Text Available O rio Miranda é um importante afluente do rio Paraguai e tem grande parte de seu curso na planície do Pantanal. O rio tem sinuosidade média a alta, sendo do tipo meandrante na maior parte do seu percurso em domínio aluvial. Com base nos padrões do canal e da planície, três segmentos fluviais com diferentes estilos foram caracterizados e descritos. Ainda nos domínios do planalto, o rio forma um cinturão de meandros numa planície agradacional, que está confinada em vale no embasamento cristalino. O rio deixa de correr num cinturão de meandros ao adentrar no Pantanal, para formar um cordão composto por canal e diques marginais que se destaca pela elevação mais alta em relação à planície agradacional, que se torna mais larga ao deixar o vale confinado. Paleocinturões de meandros e grandes meandros abandonados com dimensões superiores às dos canais atuais, existentes nas planícies agradacionais, permitem interpretar importantes mudanças ambientais e paleohidrológicas ocorridas a partir do Pleistoceno tardio. No seu baixo curso o rio volta a correr num cinturão de meandros, porem inciso em depósitos aluviais mais antigos, o que denuncia a natureza degradacional da planície distal do rio. Esta planície é palco da ação erosiva de fluxos de águas em lençol durante as inundações e de incisão por rede de pequenos canais tributários que drenam a planície depois das cheias. A avulsão ocorrida na altura do Morro do Azeite desempenhou importante papel na configuração do traçado do canal atual do rio Miranda, deslocando em 20 km para norte sua foz no rio Paraguai.  Palavras Chave – Rio Miranda, Pantanal, rio meandrante

  18. Digital Literacy Skills Among Librarians In University Libraries In The 21st Century In Edo And Delta States Nigeria

    OpenAIRE

    Emiri; Ogochukwu T.

    2015-01-01

    Abstract Libraries all over the world have been faced with the evolving technological advancement globalization and digitization of information. These have led to library automation digital and virtual libraries. This paper discussed the contemporary digital literacy skills DLS among librarians in university libraries the 21st century in Edo and Delta States of Southern Nigeria. The study was guided by six objectives and research questions and one hypothesis. The design of the study is descri...

  19. Test of the Practicality and Feasibility of EDoF-Empowered Image Sensors for Long-Range Biometrics.

    Science.gov (United States)

    Hsieh, Sheng-Hsun; Li, Yung-Hui; Tien, Chung-Hao

    2016-11-25

    For many practical applications of image sensors, how to extend the depth-of-field (DoF) is an important research topic; if successfully implemented, it could be beneficial in various applications, from photography to biometrics. In this work, we want to examine the feasibility and practicability of a well-known "extended DoF" (EDoF) technique, or "wavefront coding," by building real-time long-range iris recognition and performing large-scale iris recognition. The key to the success of long-range iris recognition includes long DoF and image quality invariance toward various object distance, which is strict and harsh enough to test the practicality and feasibility of EDoF-empowered image sensors. Besides image sensor modification, we also explored the possibility of varying enrollment/testing pairs. With 512 iris images from 32 Asian people as the database, 400-mm focal length and F/6.3 optics over 3 m working distance, our results prove that a sophisticated coding design scheme plus homogeneous enrollment/testing setups can effectively overcome the blurring caused by phase modulation and omit Wiener-based restoration. In our experiments, which are based on 3328 iris images in total, the EDoF factor can achieve a result 3.71 times better than the original system without a loss of recognition accuracy.

  20. Test of the Practicality and Feasibility of EDoF-Empowered Image Sensors for Long-Range Biometrics

    Directory of Open Access Journals (Sweden)

    Sheng-Hsun Hsieh

    2016-11-01

    Full Text Available For many practical applications of image sensors, how to extend the depth-of-field (DoF is an important research topic; if successfully implemented, it could be beneficial in various applications, from photography to biometrics. In this work, we want to examine the feasibility and practicability of a well-known “extended DoF” (EDoF technique, or “wavefront coding,” by building real-time long-range iris recognition and performing large-scale iris recognition. The key to the success of long-range iris recognition includes long DoF and image quality invariance toward various object distance, which is strict and harsh enough to test the practicality and feasibility of EDoF-empowered image sensors. Besides image sensor modification, we also explored the possibility of varying enrollment/testing pairs. With 512 iris images from 32 Asian people as the database, 400-mm focal length and F/6.3 optics over 3 m working distance, our results prove that a sophisticated coding design scheme plus homogeneous enrollment/testing setups can effectively overcome the blurring caused by phase modulation and omit Wiener-based restoration. In our experiments, which are based on 3328 iris images in total, the EDoF factor can achieve a result 3.71 times better than the original system without a loss of recognition accuracy.

  1. Museu, comunidade e património cultural imaterial: um estudo de caso - o Museu da Terra de Miranda

    Directory of Open Access Journals (Sweden)

    Celina Bárbaro Pinto

    2013-04-01

    Full Text Available Neste artigo pretende-se abordar especificamente a relação que se pode estabelecer entre o museu e a comunidade através da valorização, tratamento, divulgação, registo e proteção do património cultural imaterial (PCI. Para tal, apresenta-se como estudo de caso duas exposições realizadas pelo Museu da Terra de Miranda (Miranda do Douro através das quais se pretende destacar conhecimentos e saberes-fazeres subjacentes aos objetos e às coleções, situando simultaneamente os mesmos no seu contexto funcional. Neste âmbito, pretende-se estabelecer uma relação mais estreita entre os aspetos material e imaterial dentro do contexto museológico, evidenciando a importância da presença do campo imaterial na interpretação e compreensão das coleções. Procurar-se-á, através dos exemplos abordados, criar um espaço de reflexão sobre a importância de uma prática museológica de cariz participativo, encabeçado por uma mudança de paradigma, preconizada pela UNESCO através da Convenção da salvaguarda do Património Cultural Imaterial e que se expressa na participação dos atores sociais/protagonistas no tratamento do PCI.

  2. Calibration of System Input Volume and Non-Revenue Water Index in Edo North, Nigeria

    Directory of Open Access Journals (Sweden)

    Philipa O. Idogho

    2013-09-01

    Full Text Available Water scarcity is a serious problem in developing world. It could be physical scarcity or economic water shortage. The output of physicsbased study conducted in Edo North, Nigeria revealed that physical water losses in the water distribution network have compounded the accessibility and affordability of safe drinking water. Water supply and loss variables such as Water Supply (WS Physical Water Loss (WLρ Apparent Water Loss (WLE Water Loss Reduction Index (WLRI and Available Water (AW were mathematically modeled to produce realistic and efficient water loss management and improve water revenue. The result of the modeling iterations show that the average physical and apparent losses of 4,000m 3 and 2,700m 3 of (WLρ and (WLE correspond to 13,200m 3 , 6,400m 3 and 0.5 of WS/SIV, AW and WLRI in 2007. Strong indication exists between the WLRI for both physical and apparent losses with the coefficient of determination R 2=0.83 and 0.99 respectively. This relationship shows that more water is being lost through real loss with average total of 59.2% and 40.8% of apparent losses. However, a reduction of Total Non-Revenue Water (TNRW from 50.7% to 10.6% was recorded between 2007 to 2011. This reduction led to a total increase of 4,400m 3 of Revenue Water, decrease in Non-Revenue Water reduction cost from 36% in 2007 to 7% in 2011 and saving of US$17,400 which could be used to provide health facility for malaria treatment for 14,500 people on daily basis. Water efficiency, and particularly drinking water loss, is a serious issue which has significant financial and economic depression; awareness in this respect is totally unrecognized by both individual and governmental sector. Generally, long-term strategies towards the reduction of water losses should continue to be sustained by Edo State government, donor agencies and some private sectors in the area of water supply in order to support the fulfillment of the Millennium Development Goals, control of

  3. Corporate social responsibility in Japan from the Edo period to the Fukushima nuclear accident

    International Nuclear Information System (INIS)

    Rolland-Piegue, E.

    2011-01-01

    Behind an apparently universal adherence to corporate social responsibility, differences in approaches are lurking with roots in distinct traditions of thought. Japanese business values date back to merchants during the Edo period and to the pioneers of Japanese capitalism during the Meiji period. They have always emphasized the diversity of all the parties - and not just shareholders - who contribute to a company's prosperity and should share in the benefits. Imported from Europe in 2003, corporate social responsibility was quickly institutionalized by Japanese firms that want to comply with international standards. This concept, Japanese-style, barely touches on social questions, which are referred to traditional values; but focuses instead on environmental issues and consumer protection. Non governmental organizations are not very active in Japan, and the state refuses to take a leading role even though its pro-business policy supports corporate social responsibility and should help, for example, diffuse the new standard, Iso-26000. Since March 2011, a new phase, laden with uncertainty, has started. The most devastating earthquake since World War II and the crisis at the Fukushima Daiichi nuclear power station should lead the Japanese to raise fundamental questions about what they expect from firms and public authorities. (author)

  4. ITN utilization among pregnant women attending ANC in Etsako West Lga, Edo State, Nigeria.

    Science.gov (United States)

    Wagbatsoma, V A; Aigbe, E E

    2010-06-01

    To determine the factors affecting utilization of ITN by pregnant women in Etsako West LGA, Edo State. A descriptive cross-sectional study design was employed. Using a systematic sampling method, a total of 385 respondents were selected from all ANC facilities in the LGA following a verbally obtained consent. Tool for data collection was a semi-structured, researcher administered questionnaire. The respondents' knowledge of cause of malaria was good, as 269 (69%) had good knowledge but only 9 (2.3%) knew its effects on the foetus. Meanwhile, ownership of ITN and its use were very low, 36 (9.3%) and 31 (8.0) respectively. The main factor affecting the use of the commodity in the LGA was unavailability of ITNs. Other factors included belief of the women on the effectiveness of the commodity, level of education, marital status and family sizes ofrespondents. Use of Insecticide treated bed net has been hampered by unavailability of the commodity. It is therefore recommended that efforts should be made to make the commodity available to reduce morbidity and mortality among this vulnerable group.

  5. EDO, Doses to Man and Organs from Reactor Operation Noble Gas and Liquid Waste Release

    International Nuclear Information System (INIS)

    Rodenas Diago, Jose; Serradell Garcia, Vicente

    1983-01-01

    1 - Description of problem or function: EDO evaluates individual and collective doses to man from atmospheric releases of noble gases and other gaseous effluents. 2 - Method of solution: The dose calculations are carried out by following the guide- lines of USNRC Regulatory Guide 1.109. Radiation exposure for maximum individuals and population are estimated within 30 km from the nuclear plant. This area is divided into 160 circular trapezoids, to which computations are referred. Four age groups, seven organs for internal dose and two for external dose have been considered. Dose calculations are done through 14 pathways, 7 for liquid effluents, one for noble gases, and 6 for the rest of gaseous effluents. 3 - Restrictions on the complexity of the problem: The following are the maximum dimension sizes preset in the code: 73 radionuclides (other than noble gases); 15 noble gases; 160 circular trapezoids; 31 chemical elements; 4 types of aquatic foods; 15 points of exposure for shorelines; 15 trapezoids influenced by each point; 4 terrestrial food pathways; 100 centres of population. Some of these limits can be varied

  6. Gender issues in contraceptive use among educated women in Edo state, Nigeria.

    Science.gov (United States)

    Osemwenkha, Sylvia Osayi

    2004-04-01

    While traditional contraception is widely used, in southern Nigerian modern contraception is a relatively recent phenomenon. Modern contraception is more wide spread among the educated and sexually active youth in Nigeria. Few studies have been done on contraception among educated women in Nigeria. This study was carried out in December 2000 to determine factors that influence the choice of contraceptives among female undergraduates at the University of Benin and Edo State University Ekpoma. Data was collected from a sample of 800 female undergraduates matched ethnic group, socio economic status, religion and rural urban residence. Subjects were selected by proportional representation and the instrument used was closed ended questionnaire. The responses obtained were analysed using Spearman Rank Correlation co-efficient and regression analysis. Findings revealed the highest correlation for availability (r =.96) vis a vis the use of various types of artificial contraceptive and cost (r =.96), next was safety (r =.95) and effectiveness (r =.95). Others were peer group influence (r =.80) and convenience (r =.77). An important step in improving women's reproductive health is the involvement of men. Health programmes should conduct campaigns to educate men about reproductive health and the role they can assume in family planning.

  7. EDO, Doses to Man and Organs from Reactor Operation Noble Gas and Liquid Waste Release

    Energy Technology Data Exchange (ETDEWEB)

    Rodenas Diago, Jose; Serradell Garcia, Vicente [Departamento de Ingenieria Nuclear, Escuela Tecnica Superior de Ingenieros Industriales, Universidad Politecnica, Camino de Vera 2/n Apartado 2012, Valencia (Spain)

    1983-10-18

    1 - Description of problem or function: EDO evaluates individual and collective doses to man from atmospheric releases of noble gases and other gaseous effluents. 2 - Method of solution: The dose calculations are carried out by following the guide- lines of USNRC Regulatory Guide 1.109. Radiation exposure for maximum individuals and population are estimated within 30 km from the nuclear plant. This area is divided into 160 circular trapezoids, to which computations are referred. Four age groups, seven organs for internal dose and two for external dose have been considered. Dose calculations are done through 14 pathways, 7 for liquid effluents, one for noble gases, and 6 for the rest of gaseous effluents. 3 - Restrictions on the complexity of the problem: The following are the maximum dimension sizes preset in the code: 73 radionuclides (other than noble gases); 15 noble gases; 160 circular trapezoids; 31 chemical elements; 4 types of aquatic foods; 15 points of exposure for shorelines; 15 trapezoids influenced by each point; 4 terrestrial food pathways; 100 centres of population. Some of these limits can be varied.

  8. Extent of Implementation of Post-Basic Economics Curriculum in Senior Secondary Schools in Edo State

    Directory of Open Access Journals (Sweden)

    E. O. Oleabhiele

    2015-05-01

    Full Text Available This study focused on the extent of implementation of post-economics curriculum in senior secondary schools in Edo state. Two research questions and two research hypotheses were formulated to guide the study. The research designed used for the study was the descriptive survey. The population for the study were one hundred and twenty-five (125 economics teachers. A structured questionnaire was used for the collection of data for the study while the research questions were answered using the mean and standard deviation and the research hypotheses were tested using the t-test statistics at an alpha level of 0.05. The results of the study revealed that the curriculum content of economics are adequate and in line the objective of the nation on vision 20:2020. And that the instructional strategies employed by economics teachers to implement the curriculum content are appropriate as specified by the curriculum. Based on the findings, it is recommended that economics teachers should trained to select a use instructional strategies that are learners centred and that economics teachers should be encouraged to attend seminars, workshops in order to improve their teaching skills

  9. Zelleriella bromelicola, sp. n. (Protozoa: Opalinatea: Entozoário de Aparasphenodon brunoi Miranda-Ribeiro, 1920 (Anura, Hylidae de Ubatuba, São Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    Ismael Gióia

    1988-01-01

    Full Text Available Descreve-se Zelleriella bromelicola, sp. n., achada na região cecal do hilídeo Aparasphenodon brunoi Miranda-Ribeiro, infestado naturalmente com Entamoeba paulista. A célula é ovóide (105,7 um ± 1,6 x 79,3 um ± 1,9 e o núcleo tem uma massa fragmentada semi-paralela (3-5 nucléolos.Zelleriella bromelicola, sp. n., is described, from the caecal region of the hylid frog Aparasphenodon brunoi Miranda-Ribeiro, naturally infected with Entamoeba paulista. The cell is ovoid (105.7 um ± 1.6 x 79.3 um ± 1.9 and the nucleus (15.9 um ± 0.4 has a fragmented semi-parallel mass (3-5 nucleoli.

  10. La construcción de Colombeia: Francisco de Miranda y su paso por el Sacro Imperio Romano Germánico, 1785-1789

    Directory of Open Access Journals (Sweden)

    Michael Zeuske

    2017-01-01

    Full Text Available Se analiza la significación histórica de los diarios de viaje de Francisco de Miranda en los que se consigna su paso por el Sacro Imperio Romano Germánico. Tras posicionar brevemente a Miranda en la historiografía, se describe su ruta alemana del liberalismo temprano, que cobra relevancia para los estudios actuales de historia cultural y social. Se presta así atención a las experiencias de vida diaria, los procesos de transculturación y la transferencia de conocimientos entre múltiples centros/periferias. Estos viajes nutrieron decisivamente el concepto mirandino de “Colombeia” al servicio de la emancipación de la América española. Este enfoque de análisis es novedoso, ya que previamente Miranda solo ha sido tratado en la literatura, a lo sumo, bajo el sello de la biografía y el testimonio.

  11. Dos versiones de San Pascual Bailón por Carreño de Miranda

    Directory of Open Access Journals (Sweden)

    Gutiérrez Pastor, Ismael

    2002-03-01

    Full Text Available Conozco desde hace algún tiempo un lienzo de San Pascual Bailón arrodillado adorando el Santísimo Sacramento que, por sus características formales y de estilo, debe ser obra de Juan Carreño de Miranda (1627-1685, el pintor que sucedió Diego Velázquez y a Sebastián Herrera Barnuevo en el desempeño de las funciones de Pintor de Cámara de la reina viuda Doña Mariana de Austria y de su hijo el rey Carlos II. Su papel fue absolutamente fundamental en la pintura madrileña del Barroco, tanto por la progresión estilística que supone su propia obra, como por su labor de modelo y maestro de muchos pintores jóvenes de las generaciones siguientes. La pintura (fig. 1 representa a San Pascual Bailón arrodillado en el suelo, extasiado ante la contemplación de un cáliz con la hostia consagrada, que aparece posado sobre una tela roja que portan varias cabezas de querubines.…

  12. A new species of Utiaritichthys Miranda Ribeiro (Characiformes: Serrasalmidae from the Serra dos Parecis, Tapajós drainage

    Directory of Open Access Journals (Sweden)

    Thiago N. A. Pereira

    Full Text Available Utiaritichthysesguiceroi is described from the upper portion of the rio Juruena, rio Tapajós drainage, Mato Grosso State, Central Brazil. The new species distinguished from its two congeners, U. sennaebragai Miranda Ribeiro and U. longidorsalis Jégu, Tito de Morais & Santos, by having 99 to 101 perforated scales on lateral line (vs. 69 to 83, presence of 17 to19 prepelvic spines (vs. 9-13 in U. sennaebragai and 28-31 in U. longidorsalis, 20 to 21 postpelvic spines (vs. 15 to 19 in U. sennaebragai, and 14 in U. longidorsalis, and 23 to 25 circumpeduncular scales (vs. 30-48 in U. sennaebragai, and 33-35 in U. longidorsalis. Furthermore, the new species differs from U. longidorsalis by having larger interdorsal width, and adipose-fin base length (11.8-15.6 vs. 7.1-7.9% of SL, and 4.2-5.8 vs. 3.7-3.8% of SL, respectively.

  13. Distribuição e Densidade de Nasutitermes sp. (Isoptera: Termitidae em Mata Ribeirinha do Rio Miranda, Pantanal Sul-Matogrossense, Brasil

    Directory of Open Access Journals (Sweden)

    Leandro Pereira Polatto

    2009-04-01

    Full Text Available Resumo. Este trabalho teve como objetivo analisar a influência da densidade arbórea e da borda sobre a quantidade e o volume nidal dos ninhos arborícolas de Nasutitermes sp., bem como, verificar a dependência do tamanho desses ninhos e a sua região de fixação em relação à arquitetura arbórea. A coleta de dados foi realizada em outubro de 2005, em um trecho da mata ribeirinha do rio Miranda no Pantanal Miranda-Abobral, sendo feita amostragem da quantidade e volume nidal dos ninhos arborícolas de Nasutitermes sp. e verificado a densidade de árvores de dossel através do método de amostragem por parcelas ao longo de um gradiente de profundidade na mata. Outros valores de arquitetura arbórea em que o ninho servia de abrigo também foram analisados, utilizando-se o coeficiente de correlação de Spearman, o teste de Kruskal-Wallis e o Qui-Quadrado. Dentre os resultados analisados, conclui-se que os ninhos arborícolas de Nasutitermes sp. não estão distribuídos ao acaso na mata. Mas sim, pode-se inferir que a quantidade e volume nidal, os locais de fixação, construção e desenvolvimento desses ninhos arborícolas na mata ribeirinha do rio Miranda sofrem interferência da estrutura arbórea da mata estudada. Nasutitermes sp. (Isoptera: Termitidae Distribution and Density in Riverine Forest of the River Miranda, Pantanal Sul-Matogrossense, Brazil.Abstract. This work had as objectives to analyze the influence of the arboreal density and of the border on the amount and the volumetric mass of the arboreal nests of Nasutitermes sp., and to verify the dependence of the size of those nests and your fixation area in relation to the arboreal architecture. In October of 2005, in a space of the riverine forest of the river Miranda in the Pantanal of the Miranda-Abobral was accomplished the collection of data, being made sampling of the amount and volumetric mass of the arboreal nests of Nasutitermes sp., and verified the density of dossal

  14. Ultra-fast and sensitive photo-induced phase switching in (EDO-TTF)2PF6

    International Nuclear Information System (INIS)

    Chollet, Matthieu; Guerin, Laurent; Uchida, Naoki; Fukaya, Souichi; Ishikawa, Tadahiko; Koshihara, Shin-ya; Matsuda, Kazunari; Yamochi, Hideki; Ota, Akira; Saito, Gunzi

    2005-01-01

    Organic conductor (EDO-TTF) 2 PF 6 crystal having 14 filled band shows a metal (M)-insulator (I) transition accompanied with Peierls transition, charge ordering, and anion ordering at transition temperature, T C =280K. This crystal is an important and fascinating candidate for photo-induced M-I transition because the multi-instability will afford sensitivity to the tiny stimulation. We make the report of the reflectivity change in (EDO-TTF) 2 PF 6 crystal induced by the irradiation of femto-second (fs) pulsed laser (pulse width: 120fs, main wavelength: 800nm, repetition rate: 1kHz). The obtained results indicate that the highly efficient I-to-M transition occurs within 3ps in this material. Based on these results, the strong electron-lattice cooperative interaction is proved to play an essential role in the driving process of this M-I transition. Also, 14 filled materials, which show M-I transition, accompanied with the charge ordering, can be classified as fascinating candidates not only for superconductivity but also for photo-induced cooperative phenomena and application in phase switching devices

  15. Analysis of Parents/Teachers Perception of the Use of Corporal Punishment in Primary Schools in Delta and Edo State, Nigeria

    Science.gov (United States)

    Ogbe, Joseph O.

    2015-01-01

    The study was meant to analyze Parents and Teachers perception of the use of corporal punishment in primary schools in Edo/Delta state. The purpose was to find time out parents and teachers opinion on the need for continuity or to discontinue the use of corporal punishment among primary school pupils. The method was a descriptive study with the…

  16. Plasmodium falciparum malaria in pregnancy: prevalence of peripheral parasitaemia, anaemia and malaria care-seeking behaviour among pregnant women attending two antenatal clinics in Edo State, Nigeria

    NARCIS (Netherlands)

    Enato, E. F. O.; Mens, P. F.; Okhamafe, A. O.; Okpere, E. E.; Pogoson, E.; Schallig, H. D. F. H.

    2009-01-01

    SUMMARY: This study evaluated malaria care-seeking behaviour, as well as the prevalence of parasitaemia and anaemia among pregnant women attending antenatal clinics of two tertiary healthcare facilities in Edo State, Nigeria. Malaria was highly prevalent in the study group (20% by microscopy and

  17. Determinants of cord care practices among mothers in Benin City, Edo State, Nigeria.

    Science.gov (United States)

    Abhulimhen-Iyoha, B I; Ibadin, M O

    2012-01-01

    Mothers care for their infants' umbilical cord stump in various ways. Different cord care practices have been documented; some are beneficial while others are harmful. Who and what influence the cord care practiced by mothers have, however, not been fully explored particularly in the study locale. The objective of this study was to determine the factors that influence cord care practices among mothers in Benin City. The study subjects included 497 mothers who brought their babies to Well Baby/Immunization Clinic at the University of Benin Teaching Hospital (UBTH), Benin City, Edo State, between July and August 2009. A structured questionnaire served as an instrument to extract information on their biodata and possible determinants of cord care practices. Significantly older women (P=0.023), educated mothers (P=0.029), and those who had male babies (P=0.013) practiced beneficial cord stump care practices. Beneficial cord care practice increased with increasing maternal educational status. The best predictors of beneficial cord care practices are maternal level of education (P=0.029) and infant's sex (P=0.013). The use of harmful cord care practices was more common among mothers who delivered outside the Teaching hospitals. Most (71.2%) of the mothers were aware of hygienic/beneficial cord care. The choices of cord care methods eventually practiced by mothers were influenced mainly by the disposition of nurses (51.3%), participants' mothers (32.0%), and their mothers-in-law (5.8%). There was no significant relationship between cord care practice on one hand and maternal parity, tribe, and socioeconomic classes on the other. The need for female education is again emphasized. The current findings strongly justify the need for public enlightenment programs, using the mass media and health talks in health facilities, targeting not only women of reproductive age but also secondary audience like their mothers, mothers-in-law, nurses, and attendants at health facilities

  18. Las murallas de Las Cogotas y La Mesa de Miranda: apuntes a la arquitectura defensiva de los vettones

    Directory of Open Access Journals (Sweden)

    Francisco Javier José GONZÁLEZ-TABLAS SASTRE

    2010-08-01

    Full Text Available El estudio sobre los sistemas defensivos de los castros vettones y, más específicamente, el de sus murallas, ha seguido la tendencia a considerarlas como un hecho único tanto en su concepción como en su construcción. De la observación de los procesos de limpieza, consolidación y restauración de algunos de los lienzos de las murallas de Las Cogotas (Cardeñosa, Ávila y de La Mesa de Miranda (Chamartín de la Sierra, Ávila así como de los datos obtenidos en la excavación de la casa C de este último castro, se deduce que los procesos de construcción se desarrollan a lo largo del tiempo de vida de los castros, no como un acto único sino como una serie de actos vinculados al propio devenir histórico de los asentamientos. Las remodelaciones, añadidos y reparaciones de los muros debieron ser una constante en el día a día de sus habitantes, más aún en aquellos momentos en que la presencia de ejércitos numerosos y bien estructurados generó los graves conflictos que sacudieron esta región desde finales del siglo III a. C. hasta la completa pacificación e incorporación a la estructura político/administrativa romana. El conocimiento de los distintos acontecimientos históricos y su vinculación a los procesos constructivos, de remodelación o de reparación de las murallas nos permitirá llegar a un mejor conocimiento de la historia de estos pueblos.

  19. [Beginnings of the study of Western sciences, "Rangaku," in Kyoto and Osaka in close relations with the Edo school].

    Science.gov (United States)

    Murata, T

    2001-01-01

    Beginnings of the study of Western sciences, "Rangaku," in Kyoto and Osaka in the late 18th century are reviewed. Profiles and achievements of several active learners are briefly described; they include Koishi Genzui (Osaka-Kyoto), Tsuji Ranshitsu (Kyoto), Kimura Kenkadō (Osaka), and Hashimoto Sōkichi (Osaka). Genzui, after having successfully made good relations with Sugita Genpaku and Ohtsuki Gentaku, leading masters of the Edo school, played a role of an advocator for promoting "Rangaku" in Osaka and Kyoto. As a result, Kenkadō attained the publication of his book "Ikkaku Sankō," a monograph of the Western crude drug unicorn, with the help of Gentaku, who had translated a Dutch reference into Japanese for him. Ranshitsu and Sōkichi were taught the Dutch language by Gentaku; Sōkichi is known as the founder of "Rangaku" in Osaka.

  20. "edo jal̀qkina üts̀varòkaetus ma vaelda ..." : [luuletused] / Andreas Kalkun

    Index Scriptorium Estoniae

    Kalkun, Andreas, 1977-

    2002-01-01

    Sisu: "edo jal̀qkina üts̀varòkaetus ma vaelda ..." ; "tsirguq ku kiviq no satassõ taivast aràlaq ..." ; "vahtsõq silmäq pitsitä pääluu sisse ..." ; "tõppõ tõmmat haigõst ma haarõt jal̀ki ..." ; "arsatas njago sisse aigopiteh ..." ; "rühkeq yks jumalat pallõlda jaloh ..." ; "mu süä om no süüdläne täǹtäseq kuvvõ ..." ; "halvaq haavaq häitsese veiga silmih. Eluloolisi andmeid autori kohta lk. 379

  1. Chronic kidney disease in Nigeria: an evaluation of the spatial accessibility to healthcare for diagnosed cases in Edo State

    Directory of Open Access Journals (Sweden)

    Osaretin Oviasu

    2016-05-01

    Full Text Available Chronic kidney disease (CKD is a growing problem in Nigeria, presenting challenges to the nation’s health and economy. This study evaluates the accessibility to healthcare in Edo State of CKD patients diagnosed between 2006 and 2009. Using cost analysis techniques within a geographical information system, an estimated travel time to the hospital was used to examine the spatial accessibility of diagnosed patients to available CKD healthcare in the state. The results from the study indicated that although there was an annual rise in the number of diagnosed cases, there were no significant changes in the proportion of patients that were diagnosed at the last stage of CKD. However, there were indications that the travel time to the hospital for CKD treatment might be a contributing factor to the number of diagnosed CKD cases. This implies that the current structure for CKD management within the state might not be adequate.

  2. Manejo de biodiversidad vegetal y el control biológico de insectos-plaga: caso de un viñedo orgánico.

    Directory of Open Access Journals (Sweden)

    Nicholls Clara I.

    2000-12-01

    Full Text Available En el manejo de plagas es factible incrementar poblaciones de enemigos naturales, diversificando el hábitat. En los agroecosistemas es reconocida la importancia de la vegetación marginal para la sobrevivencia de parasitoides y predatores. En cultivos comercialees de viñedos, manejados orgánicamente, se adelantó este trabajo, se establecieron corredores de 65 especies diferentes de plantas con flores. Los cultivos de cobertura se sembraron en hilera por medio cada año. Los viñedos recibieron en promedio 2 toneladas de compost por hectárea. Para el control de enfermedades se empleó preventivamente azufre. Se pretendió precisar si el corredor de 200 metros de largo, podría incrementar el control biológico de insectos plaga en el viñedo. Se evaluó la contribución del corredor como proveedor de recursos alimenticios alternativos, consistentes, abundantes y bien distribuidos de enemigos naturales. Se comprobó la utilidad del corredor para incrementar los niveles poblacionales de insectos benéficos.

  3. Digital Literacy Skills Among Librarians In University Libraries In The 21st Century In Edo And Delta States Nigeria

    Directory of Open Access Journals (Sweden)

    Emiri

    2015-08-01

    Full Text Available Abstract Libraries all over the world have been faced with the evolving technological advancement globalization and digitization of information. These have led to library automation digital and virtual libraries. This paper discussed the contemporary digital literacy skills DLS among librarians in university libraries the 21st century in Edo and Delta States of Southern Nigeria. The study was guided by six objectives and research questions and one hypothesis. The design of the study is descriptive survey and the population consists of all librarians from university libraries in the aforementioned states in Nigeria. The instrument used to generate data is the questionnaire and the date generated was analyzed using simple percentages and frequency count for research questions and SPSS version 14.0. The findings show that electronic mailing social networking use of PDAs mobile phones and internet surfing are the major DLS amongst librarians. It was also discovered that librarians acquired DLS through colleagues assistance trial and error IT programmes and formal education while librarians level of use of DLS is low amongst other findings. Researcher recommends that management of university libraries should provide training for librarians so as to help update their knowledge in application of digital skills and digital skill competence should be giving more attention during recruitment of librarians amongst others.

  4. Knowledge and practice of food hygiene and safety among food handlers in fast food restaurants in Benin City, Edo State.

    Science.gov (United States)

    Isara, A R; Isah, E C

    2009-09-01

    To assess the knowledge and practice of food hygiene and safety among food handlers in fast food restaurants in Benin City, Edo State. A descriptive cross-sectional study was carried out among 350 respondents who were selected by means of a systematic sampling method and interviewed using a semi-structured researcher-administered questionnaire. An observational checklist was thereafter used to inspect their personal hygiene status. The mean age of the food handlers was 26.4 +/- 6.1 years. Two hundred and twenty eight (65.1%) were females while 34.9% were males. A majority (98%) of the respondents had formal education. There was good knowledge and practice of food hygiene and safety among the respondents. Knowledge was significantly influenced by previous training in food hygiene and safety (p = 0.002). Food handlers who had worked for longer years in the fast food restaurants had better practice of food hygiene and safety (p = 0.036). The level of education of respondents did not significantly influenced their practice of food hygiene and safety (p = 0.084). Although, 299 (85.4%) food handlers were generally clean, skin lesions was seen in 4 (7.3%) of them. This study showed good knowledge and practice of food hygiene and safety by food handlers in the fast food restaurants in Benin City, but there is need for improvement through training and retraining of food handlers by the management of the restaurants and the local government authorities.

  5. Vid, viñedos y vino en Sefarad : cultivo elaboración y comercio de un vino diferenciador

    Directory of Open Access Journals (Sweden)

    Ana María Rivera Medina

    2007-01-01

    Full Text Available Las comunidades hebreas peninsulares, a lo largo de la Edad Media, desarrollaron un complejo sistema de cultivo, elaboración y comercio del vino acorde con prescripciones religiosas ligadas al concepto de pureza. De ahí, que vista su importancia pretendemos analizar su función como bebida en las festividades religiosas y celebraciones; la jurisprudencia relativa a la propiedad, el cultivo y la elaboración del vino judío; y finalmente, mostrar cómo las comunidades sefardíes o sus individuos acceden a la tierra, cómo se trabajan estos viñedos y se genera una industria subsidiaria, a pesar de las diversas restricciones que se imponen desde una sociedad mayoristamente cristiana.The Hebrew communities of the Iberian peninsula, along the Middle Ages, developed a complex system for the cultivation, elaboration and trade of the wine, in agreement with religious prescriptions tied to the concept of purity. In reason to its importance, we will analyze its function like drink in the religious festivities and other celebrations; the jurisprudence relative to the property, cultivation and elaboration of the Jewish wine; and, finally, we will show how the sefardíes communities or their individuals consent to the earth, how these vineyards are worked and a subsidiary industry is generated, in spite of the diverse restrictions that are imposed from a society of Christian majority.

  6. Energía renovable e hidrógeno generados in situ para riego y movilidad en viñedos

    Directory of Open Access Journals (Sweden)

    Carroquino Javier

    2017-01-01

    Full Text Available La energía utilizada en agricultura es fuente de emisiones de gases de efecto invernadero. Para reducir las producidas por el uso de gasóleo y electricidad, el proyecto europeo LIFE REWIND aborda el suministro desde fuentes renovables. Para ello, se ha caracterizado la demanda energética y recursos renovables en viñedo y bodega. Se ha buscado el diseño óptimo económico y medioambiental de la generación. Se ha instalado un prototipo en una explotación vitivinícola, con generación fotovoltaica, incluyendo un conjunto flotante sobre una balsa. Esto evita el uso de terreno, reduce la pérdida de agua de la balsa y mejora el rendimiento de los paneles fotovoltaicos. La electricidad producida alimenta la depuración de agua y el bombeo de riego por goteo del viñedo. Con la energía sobrante, un electrolizador produce hidrógeno mediante electrólisis del agua, que es utilizado por un vehículo todoterreno con pila de combustible. Los resultados muestran la viabilidad técnica y económica de los sistemas autónomos de energía renovable para alimentar el riego estacional en los viñedos. Así se evitan las extensiones indiscriminadas de la red y los grupos electrógenos diésel. Adicionalmente se muestra la posibilidad de reemplazar el gasóleo por electricidad o hidrógeno producido en la propia explotación.

  7. THE TYPES OF PLANS AND INTERIOR DESIGN AT MEMORIAL CLOISTERS OF DAITOKU-JI AND MYOSHIN-JI TEMPLES IN KYOTO IN THE EDO PERIOD [1596~1868] -The Development and Changes of the Sanctuary-

    Directory of Open Access Journals (Sweden)

    Antariksa Antariksa

    2003-01-01

    Full Text Available In the early Edo period the number of memorial cloisters (tacchu increased, especially, at Daitoku-ji and Myôshin-ji temples. As a consequence, the hondô (kyakuden, hojo were further developed in all aspects of architectural style, interior design and plan. This study will attempt to clarify the types of plans at memorial cloisters of both temples, by analyzing the arrangement and composition of the sanctuary, during the Edo period. In that period, the requirement of the rooms was interlaced with the function, and even dependent upon everyday life and the activities of religious services.

  8. Recapturing Traditional Culture - A Survey of Uvinmi Body Tattoo as a Curative Procedure in Esanland, Edo State, Nigeria

    Directory of Open Access Journals (Sweden)

    Fatimah Mohammed Palmer

    2015-08-01

    Full Text Available Body tattooing in traditional Nigerian culture was basically believed to be used for identification as well as aesthetic purposes. In some cultures, such as seen amongst the traditional ethnic Hausa and Fulani people, permanent facial marks were used to identify slaves within a community and also used to enhance the beauty and appearance of the women folk especially. In the southern part of Nigeria, amongst the Yorubas, it is used as a tribal identification symbol that provides information about the individual, as well as some culturally-related beliefs. The use of tattoos among the Esan ethnic people transcends the purposes of identification and enhancement of physical appearance as discovered. Thus this study examines the use of tattoo as a curative process for the illness called Udeh among the Esan ethnic people of Edo state Nigeria. Udeh is an illness associated with infection of the spleen. Data was collected through visitation of traditional healing venues, oral interview of some traditional doctors and elders as well as direct observation of the treatment processes. Findings indicated that the practice of Uvinmi has been in existence from time immemorial and it is a familial profession inherited from generation to generation as the most effective medium for treating spleen related diseases among the Esan people. It was also discovered contemporarily modern medical anaesthesia is employed to help reduce the agony felt in the process of blade incision as practiced by one of the traditional doctors. Recommendation made include an indebt study of the herbs used during and after treatment to gauge its efficacy on Western medicinal practices as well as proper sterilisization processes on incision equipments and procedures amongst others.

  9. O arranjo arquivístico como escrita: uma reflexão sobre a narrativa em imagens a partir do Fundo Pedro Miranda no Arquivo Público e Histórico de Ribeirão Preto

    Directory of Open Access Journals (Sweden)

    Eduardo Ismael Murguia

    Full Text Available Reflete sobre algumas questões importantes para o arranjo de fotografias em arquivos. Considera-se aqui o arranjo arquivístico um ato de comunicação e, como tal, se estrutura através do enunciado narrativo da vida e obra de José Pedro Miranda, intelectual e historiador que na segunda metade do século XX produziu e acumulou vasta documentação sobre Ribeirão Preto, em especial um número significativo de fotografias. E através deste propõe-se analisar a narrativa circunscrita no âmbito das fotografias coletadas por José Pedro Miranda. Para tanto se discute o estatuto documental da fotografia, destacando que em um ambiente de arquivo a fotografia adquire significado na série além da unidade, e que portanto, os conjuntos fotográficos construídos por José Pedro Miranda tornam-se expressão e materialidade de sua compreensão e produção intelectual. Interpretações sobre a construção de bibliotecas como narrativas são utilizadas como alusão a uma possibilidade de entendimento dos arquivos pessoais.

  10. Uranium and thorium series disequilibrium in quaternary carbonate deposits from the Serra da Bodoquena and Pantanal do Miranda, Mato Grosso do Sul State, central Brazil

    International Nuclear Information System (INIS)

    Ribeiro, Fernando Brenha; Roque, Arnaldo; Boggiani, Paulo Cesar; Flexor, J.-M.

    2001-01-01

    Activities of gamma-ray emitting members of the uranium ( 238 U) and thorium ( 232 Th) series were measured in a quaternary limestone deposit that outcrops in the southeastern Pantanal Matogrossense Basin and in quaternary tufas deposited at the drainage of the Serra da Bodoquena. It is a first step in a study of the mobilization of uranium and thorium series and its relation to surface hydrology, in a region where carbonate deposits are being continuously dissolved and reprecipitated. The obtained results show that all these deposits are characterized by very low concentrations of uranium and thorium. The 238 U/ 226 Ra and 228 Th/ 228 Ra activity ratios are significantly different than 1.0, indicating that both series are in radioactive disequilibrium. Although the Serra da Bodoquena deposits seem to be very recent, their very fine granulation and high porosity suggest that they behave as open systems for geochemical exchanges of uranium and thorium series members. The Pantanal do Miranda limestone has a radiocarbon age of 3900 yr BP. Since the thorium series is in disequilibrium it is also concluded that this deposit behaves as an open system for geochemical exchanges

  11. Soil Nutrient Dynamics under Old and Young Cocoa, Coffee and Cashew Plantations at Uhonmora, Edo State, Nigeria

    Directory of Open Access Journals (Sweden)

    Rotimi Rufus Ipinmoroti

    2014-06-01

    Full Text Available A study was conducted to assess nutrient dynamics of soils under old and young cocoa, coffee and cashew plantations and the leaf nutrient contents of the crops at Uhonmora, Edo State, Nigeria for proper cultural and soil fertility management of the plantations. Soil and crop leaf samples were collected from each plantation using a random sampling technique. The samples were analyzed using standard procedures for sand, silt, clay, pH (H2O, electrical conductivity (EC, total N, available P, K, Ca, Mg, Na, and Effective Cation Exchange Capacity (ECEC. Leaf samples were analyzed for N, P, K, Ca, Mg and Na. Data were compared with the corresponding soil and foliar critical nutrient values for each crop. Results indicated that the soils were texturally sandy clay loam and acidic. The soils varied in their nutrient contents, with soil P for the old cocoa, young coffee and cashew plantations far below critical values. The young cashew plot was low in N content but adequate for other plots. However, the soil ECEC increased with the increasing of calcium contents. Leaf N was below critical for all the crops. Leaf K was low for cocoa and coffee plants, leaf Ca was low for the young cashew plants, while leaf Mg was low for the young cocoa and old cashew. The high soil Mg/K ratio of 8.7- 22.3 as against the established value of 2.0 might have resulted in gross nutrient imbalance which must have affected the absorption and utilization of other nutrients. Hence, adequate soil N did not translate the same availability to the crops. The ECEC showed that the soil needs to be improved upon for sustainable productivity. Soil nutrient content variation across the plantations with age of establishment will necessitate the need for consistent routine soil nutrient assessment for proper and balanced soil nutrient supply to the crops, for healthy crop growth and optimum yield. Management practices of soil surface mulching using organic wastes and cover crops under

  12. Florística y fisonomía de un matorral xerófilo espinoso intervenido en Punta de Piedras, Municipio Miranda, Estado Zulia, Venezuela

    Directory of Open Access Journals (Sweden)

    Antonio Vera

    2009-06-01

    Full Text Available Se determinaron los aspectos florísticos y fisonómicos de un matorral xerófilo espinoso intervenido de Punta de Piedras, municipio Miranda, estado Zulia, Venezuela. Se realizaron dieciséis muestreos quincenales, entre noviembre 2005 y junio 2006, para la recolecta, identificación y conteo de las especies tanto en el periodo lluvioso como en el seco. Los muestreos se llevaron a cabo en 10 manchones de vegetación con un área promedio de 718 ± 706.24 m², en una formación graminiforme en la que se emplearon tres parcelas de 20 x 20 (400 m², dividiéndose cada una de éstas en cuatro subparcelas de 20 x 5 (100 m² y a su vez, dentro de ellas, se delimitaron 12 subparcelas de 1 x 1. (1 m², y también se realizaron recorridos para el reconocimiento de otras especies de la zona. El matorral xerófilo espinoso mostró evidencias de intervención antropogénica como quemas periódicas, deposición de desechos sólidos, caminerías para el tránsito de las personas y asentamientos poblacionales en las zonas circunvecinas; y presentó una vegetación semiárida de espinar costero característica y comparable a la señalada para otras regiones del país. Se identificaron 45 especies agrupadas en 22 familias, entre las cuales destacaron: las Poaceae (6, Mimosaceae (4, Boraginaceae (3, Cactaceae (3 Caesalpinaceae (3, Euphorbiaceae (3 y Fabaceae (3. La intervención antropogénica parece generar la aparición de manchones de vegetación arbustiva y arbórea y de una formación graminiforme o pastizal. En esta última, Aristida venesuelae, Aristida pittieri y Portulaca pilosa presentaron los mayores valores de abundancia y frecuencia relativa cuya sumatoria corresponde a 49.38% y 46.86%, respectivamente; mientras que en los manchones se destacaron dos estratos: uno herbáceo menor a 1 m, y otro estrato arbustivo-arbóreo de bajo porte (2.63 ± 1.37 m de altura media, conformado principalmente por Opuntia wentiana, Piptadenia flava y Jatropha

  13. Amidst ageing challenges, we can’t be left out in the smartphones-selfie bug: Narratives of the elderly in Edo State, Nigeria

    Directory of Open Access Journals (Sweden)

    Adediran Daniel Ikuomola

    2017-12-01

    Full Text Available Generally the growing trend of smartphones and selfies cannot be overemphasised in the discourse of social media and mass communication. Selfie is often highlighted as a domain controlled by the youthful population, relegating the agencies of the aged as active participants in the selfie bug. This article captures the agencies of the aged in the use of selfies as a medium of expression. The study employed qualitative research methodology in the data collection through in-depth interviews among a sample of forty-five (45 elderly persons in Edo State, Nigeria. Narratives reveal the ingenuities, nuances and manoeuvring strategies the elderly regularly employ in the use of selfies in their daily routine and social engagements. These narratives were nevertheless not devoid of the need to show-off their achievements and continuous existence and the influence of the younger generation of children and grandchildren, relatives and friends in the use of smartphones and selfies.

  14. Magnetic ground state of quasi-two-dimensional organic conductor, τ-(EDO-S,S-DMEDT-TTF)2(AuCl2)1+y

    International Nuclear Information System (INIS)

    Nakanishi, T; Yasuzuka, S; Yoshino, H; Fujiwara, H; Sugimoto, T; Nishio, Y; Kajita, K; Anyfantis, G A; Papavassiliou, G C; Murata, K

    2006-01-01

    To understand the interplay between transport and magnetic properties, quasi-two-dimensional (Q2D) organic conductor τ-(EDO-S,S-DMEDTTTF) 2 (AuCl 2 ) 1+y was studied by measurements of electric resistivity ( ρ a , ρ c ), magnetoresistance (MR), susceptibility (χ) and specific heat (C) in the temperature region between 1 K and 300 K. In spite of the fact that the drastic changes were observed in ρ a , ρ c , MR and χ at T C = 20 K, no anomaly was seen in C. The concentration of spins estimated from M-H curve is about 360 ppm, which is difficult to detect anomaly in C. These data suggest that the number of spins is very small in the ground state like spin-glass system

  15. Plasmodium falciparum malaria in pregnancy: prevalence of peripheral parasitaemia, anaemia and malaria care-seeking behaviour among pregnant women attending two antenatal clinics in Edo State, Nigeria.

    Science.gov (United States)

    Enato, E F O; Mens, P F; Okhamafe, A O; Okpere, E E; Pogoson, E; Schallig, H D F H

    2009-05-01

    This study evaluated malaria care-seeking behaviour, as well as the prevalence of parasitaemia and anaemia among pregnant women attending antenatal clinics of two tertiary healthcare facilities in Edo State, Nigeria. Malaria was highly prevalent in the study group (20% by microscopy and estimated 25% by PCR), but parasitaemia and incidence decreased with increasing number of pregnancies. Although the level of education of the study participants was relatively high, antimalarial control measures during pregnancy were found to be poorly utilised by the women and malaria care-seeking was often delayed. A minority of the interviewed pregnant women said they had received sulphadoxine/pyrimethamine-based intermittent preventive therapy (IPT) during current pregnancy. Moreover, the use of inferior antimalaria treatment (e.g. chloroquine) was frequent. The majority of the pregnant women, mainly primigravidae, were anaemic. Efforts to improve antimalaria healthcare must be intensified, targeting pregnant women, particularly the primigravidae and secundigravidae and the healthcare providers.

  16. Estudio comparativo de la composición química y actividad antibacteriana del aceite esencial de Ruta graveolens L. recolectada en los estados Mérida y Miranda, Venezuela.

    Directory of Open Access Journals (Sweden)

    Janne Rojas

    2011-12-01

    Full Text Available Essential oil from two R. graveolens samples collected from Mérida and Miranda states, Venezuela, were analyzed by GC/MS identifying as major components: 2-undecanone, 2-nonanonae and pregeijerene. On the other hand, the antibacterial activity assays showed the wide range of activity of the oils that inhibited the bacterial strains grow not only for the Gram positive (S. aureus and E. faecalis but the Gram negative (E. coli and K. pneumonie as well, displaying MIC values between 100 μg/mL and 200 μg/mL.

  17. Characterization of a Namban folding screen from the Edo period by X RF, Raman, FTIR and Sem-EDS: Comparison with a screen from the Momoyama period

    International Nuclear Information System (INIS)

    Pessanha, S.; Madeira, T.I.; Manso, M.; Carvalho, M.L.; LeGac, A.; Bardon, T.; Kazarian, S.G.; Silva, R.J.C.

    2011-01-01

    Full text: In 1543 Portuguese sailors arrived in southern Japan and foreign trade flourished there until they were banned and their missionaries expelled, in the early 1600s. The art that Japanese artists created after this contact has its own name: Namban. This work compares two Namban folding screens that depict the same scene, the arrival in a port which may be Nagasaki. One screen is signed by painter Kano Naizen (1570-1616), contemporaneous of this Namban trade, the other screen is attributed to the Edo period (1615-1868) and is what we could consider a second generation screen, a copy of scenes and characters that appear on the first screen but in increased scale and minor detail. The analysis of the screens was performed in situ using portable EDXRF spectrometry. The equipment used in this study consists on an X-ray generator ECLIPSE II from Amptek, with an Ag anode and an Amptek XR-100CR of Si-PIN thermoelectrically cooled detector. Micro-samples were collected and analysed with Raman spectrometry using the Xplora Confocal Raman microscope by Horiba and analyzed with micro-ATR-FTIR spectroscopy and spectroscopic imaging using a Hyperion FTIR microscope with a Ge crystal and combined with a FPA detector. The palette used by both artists seems very similar, opting to gold, malachite, azurite, vermillion, red lead, white oyster shell, and carbon black. Differences were found, namely the resort to mixtures of pigments in the later screen, namely vermillion with red lead in an orange shade of red, and also the mixture of vermillion and carbon black to obtain a brown color. It was also discovered what seems to be the mineral amazonite in the light blue shades of the screen belonging to the Edo Period. (author)

  18. Characterization of a Namban folding screen from the Edo period by X RF, Raman, FTIR and Sem-EDS: Comparison with a screen from the Momoyama period

    Energy Technology Data Exchange (ETDEWEB)

    Pessanha, S.; Madeira, T.I.; Manso, M.; Carvalho, M.L., E-mail: luisa@cii.fc.ul.p [Centro de Fisica Atomica da Universidade de Lisboa, Lisboa (Portugal); LeGac, A. [Departamento Conservacao e Restauro, Universidade Nova de Lisboa, Caparica (Portugal); Bardon, T.; Kazarian, S.G. [Department of Chemical Engineering, Imperial College London (United Kingdom); Silva, R.J.C. [CENIMAT/I3N, Departamento de Ciencia dos Materiais, FCT, Universidade Nova de Lisboa, Caparica (Portugal)

    2011-07-01

    Full text: In 1543 Portuguese sailors arrived in southern Japan and foreign trade flourished there until they were banned and their missionaries expelled, in the early 1600s. The art that Japanese artists created after this contact has its own name: Namban. This work compares two Namban folding screens that depict the same scene, the arrival in a port which may be Nagasaki. One screen is signed by painter Kano Naizen (1570-1616), contemporaneous of this Namban trade, the other screen is attributed to the Edo period (1615-1868) and is what we could consider a second generation screen, a copy of scenes and characters that appear on the first screen but in increased scale and minor detail. The analysis of the screens was performed in situ using portable EDXRF spectrometry. The equipment used in this study consists on an X-ray generator ECLIPSE II from Amptek, with an Ag anode and an Amptek XR-100CR of Si-PIN thermoelectrically cooled detector. Micro-samples were collected and analysed with Raman spectrometry using the Xplora Confocal Raman microscope by Horiba and analyzed with micro-ATR-FTIR spectroscopy and spectroscopic imaging using a Hyperion FTIR microscope with a Ge crystal and combined with a FPA detector. The palette used by both artists seems very similar, opting to gold, malachite, azurite, vermillion, red lead, white oyster shell, and carbon black. Differences were found, namely the resort to mixtures of pigments in the later screen, namely vermillion with red lead in an orange shade of red, and also the mixture of vermillion and carbon black to obtain a brown color. It was also discovered what seems to be the mineral amazonite in the light blue shades of the screen belonging to the Edo Period. (author)

  19. A cidade de Itajaí, o porto e a empresa G. Miranda Agencia Marítima Ltda.: a inter-relação entre eles e o desenvolvimento da região (1970-2000 = The city of Itajai, the port and company G. Miranda Maritime Agency Ltd.: interrelation between them and the development of the region (1970-2000

    Directory of Open Access Journals (Sweden)

    Oliveira, Geneci Guimarães de

    2014-01-01

    Full Text Available O artigo pretende trazer à discussão os fatores que impulsionaram o desenvolvimento da cidade portuária de Itajai, a instalação de um porto e o consequente aparecimento de empresas ligadas ao setor portuário, o caso da G. Miranda Agencia Marítima Ltda. O recorte temporal estabelecido vai de 1970, período que se intensifica o êxodo rural em que a cidade precisava ser pensada no seu todo, ou seja, através de um Plano Diretor que pudesse contemplar de maneira eficaz o seu desenvolvimento; a alavancagem da produção industrial e o incremento das importações/exportações, até o ano de 2000, com significativa ampliação e readequação dos usos da estrutura urbana, dos novos espaços para o armazenamento das cargas e da quase extinção das empresas de agenciamento marítimo. A pesquisa encontra-se na fase inicial da revisão bibliográfica sobre os processos de desenvolvimento urbano; dos estudos técnicos de armazenagem de cargas e da legislação pertinente. No breve levantamento das fontes já se percebe a necessidade de investigar os rastros deixados pelos atores envolvidos e as distintas percepções dos mesmos

  20. Análisis de vulnerabilidad ambiental de la cuenca alta del río San Pedro, estado Miranda, Venezuela

    Directory of Open Access Journals (Sweden)

    Haideé Coromoto Marín

    2017-12-01

    Full Text Available Se caracterizó la vulnerabilidad ambiental por inundación y desplazamiento en comunidades asentadas en la Cuenca alta del río San Pedro, municipio Guaicaipuro, estado Miranda; Venezuela usando SIG. El área de estudio se dividió en dos zonas, una ligeramente intervenida (A y otra fuertemente intervenida (B, para obtener los mapas temáticos usados como indicadores, los cuales se estandarizaron mediante la técnica de re-clasificación asignándoles valores numéricos en una escala del 1 al 5. Los resultados muestran que la vulnerabilidad por inundación en la subcuenca siguió la siguiente tendencia: clase media (3 33.75% > clase Baja (2 31.91% > clase muy Baja (1 26.86% > clase Alta (4 6.12% > clase muy alta (5 1.37%, no obstante las clases alta y muy alta se corresponde con comunidades cercanas al río, caracterizadas por la presencia de desarrollos urbanos, alta actividad agrícola, sugiriendo un alto riesgo por inundación. La distribución espacial de la vulnerabilidad por desplazamiento sugiere que predomina la clase media (3 y baja (2, las cuales representan el 50.58% y 36.25% respectivamente, mientras que el resto de las clase como alta (4, muy baja (1 y muy alta (5 mostraron porcentajes de 9.37, 3.29 y 0.41 respectivamente. Las clases de vulnerabilidad alta y muy alta están localizadas en el área de mayor intervención (Zona B, con un patrón muy irregular asociado a suelos con altas pendientes (>30% y manejo de suelo con cultivos pocos protectores como las hortalizas, favoreciendo procesos de degradación e incidiendo en la sustentabilidad de la zona. Los resultados obtenidos han servido para discriminar cuales comunidades son más vulnerables y establecer prioridades en cuanto a la intervención para minimizar los impactos ambientales.

  1. Computer Programming Education with Miranda

    NARCIS (Netherlands)

    Joosten, S.M.M.; van den Berg, Klaas

    During the past four years, an experiment has been carried out with an introductory course in computer programming, based on functional programming. This article describes the background of this approach, the aim of the computer programming course, the outline and subject matter of the course parts

  2. Macrófitas aquáticas de ilhas flutuantes (baceiros nas sub-regiões do Abobral e Miranda, Pantanal, MS, Brasil Aquatic macrophytes of floating mats (" baceiros" in the Abobral and Miranda Pantanal Wetlands, Mato Grosso do Sul State, Brazil

    Directory of Open Access Journals (Sweden)

    Marco Otávio Pivari

    2008-06-01

    Full Text Available A associação entre as formas biológicas flutuante e epífita, relacionadas a macrófitas aquáticas, constitui o que se chama genericamente de ilha flutuante. Esta denominação é aplicada ao estabelecimento de uma ou mais epífitas sobre indivíduos vivos de espécies flutuantes, como sinônimo de camalotal ou, ainda, para se referir à vegetação flutuante que se desenvolve sobre um solo orgânico em decomposição (histossolo. Realizou-se o levantamento das espécies presentes em cinco baceiros nas sub-regiões pantaneiras do Abobral e Miranda e o estabelecimento das similaridades florísticas entre estes, a fim de evidenciar aspectos da dinâmica sucessional de ilhas flutuantes. Foram encontradas 66 espécies de macrófitas aquáticas epífitas, distribuídas em 27 famílias, sendo Cyperaceae e Poaceae as mais representativas. O número de espécies por baceiro variou de 7 a 39, sendo os táxons comuns a todos esses Ludwigia leptocarpa (Nutt. H. Hara e Oxycaryum cubense (Poepp. & Kunth Palla, ao nível específico, e Asteraceae, Cyperaceae, Onagraceae, Poaceae e Polygonaceae, com relação às famílias. Outras formas biológicas, além da epífita, foram encontradas associadas aos baceiros, ou ainda, se mostraram adaptadas às condições do histossolo, podendo ser consideradas " epífitas casuais" . Baceiros em estágios sucessionais mais próximos apresentam maior similaridade florística e, no geral, quanto mais avançada a sucessão natural, maior a riqueza específica.The association between floating and epiphytic biological forms, regarding aquatic macrophytes, creates what are called floating mats. This concept refers to the establishment of one or more epiphytes on live individuals of floating species, as a synonym of " camalotal," or applied to floating vegetation that grows on organic soil in decomposition (histosol. A checklist of species was made of five floating mats in the Abobral and Miranda Pantanal Wetlands and

  3. Well known outstanding geoid and relief depressions as regular wave woven features on Eartg (Indian geoid minimum), Moon (SPA basin), Phobos (Stickney crater), and Miranda (an ovoid).

    Science.gov (United States)

    Kochemasov, Gennady G.

    2010-05-01

    by the sector highest elevation. Procellarum Ocean is filled with basalts and Ti-basalts. The SPA basin must be filled with even denser rocks. One expects here feldspar-free, pyroxene enriched rocks with some admixture of Fe metal and troilite. The spectral observations of Carle Pieters [4] confirm orthopyroxene enrichment and absence of feldspar. Enigmatic large and deep depression of crater Stickney on Phobos with an appropriate scale adjustment to much larger Earth and Moon occupies a similar structural position to the Indian geoid minimum and the SPA basin. Such situation cannot be random and proves a common origin of these remarkable tectonic features at so different celestial bodies. This conclusion is reinforced by taking for a comparison another small heavenly body- Uranus satellite Miranda. Imaged by Voyager 2 spacecraft in 1986 it shows two kinds of terrains (PIA01980 & others). Subsided provinces (ovoids) characterized by intensive curvilinear folding and faulting interrupt uplifted densely cratered old provinces. One of the deeply subsided ovoids with curvilinear folds pattern (compression under subsidence) perfectly fits into a sector boundary. References: [1] Kochemasov G. (1999) Theorems of wave planetary tectonics // Geophys. Res. Abstr., V.1, #3, 700. [2] Kochemasov G.G. (1998) The Moon: Earth-type sectoral tectonics, relief and relevant chemical features // The 3rd International Confernce on Exploration and Utilization of the Moon, Oct. 11-14, 1998, Moscow, Russia, Abstracts, p. 29. [3] Kochemasov G.G. (1998) Moon-Earth: similarity of sectoral organization // 32nd COSPAR Scientific Assembly, Nagoya, Japan, 12-19 July 1998, Abstracts, p. 77. [4] Pieters C. (1997) Annales Geophys., v. 15, pt. III, p. 792.

  4. LA PINTURA COMO RECURSO DIDÁCTICO PARA EL MAESTRO DE PRIMARIA EN EL ESTUDIO DEL ESPACIO GEOGRÁFICO: EL EJEMPLO DEL PAISAJE DEL VIÑEDO

    Directory of Open Access Journals (Sweden)

    Julio Fernández Portela

    2016-12-01

    Full Text Available Resumen: El tema del paisaje se encuentra dentro del currículo de Educación Infantil y de Educación Primaria, a través del cual se puede trabajar otro tipo de contenidos. Este trabajo presenta la pintura como una herramienta didáctica utilizada para el estudio de los temas de paisaje, y que mediante la observación de los cuadros los profesores pueden explicar otros elementos que conforman el espacio geográ co que permitan a los alumnos ver la utilidad del arte como una fuente que les proporciona información del medio que los rodea. Palabras clave: Recurso didáctico, pintura, viñedos, Castilla y León, paisaje. Abstract: The theme of the landscape is in the curriculum of Early Childhood Education and Primary Education, through which you can work other content. This paper presents painting as a didactic tool used to study the issues of landscape, and by observing the pictures teachers can explain other elements of the geographic space that allow students to see the usefulness of art as a source that provides information environment around them. 

  5. Estudio de procesos geomorfodinámicos en campos cultivados de viñedos sobre laderas en pendientes en el valle del Ruwer (Alemania

    Directory of Open Access Journals (Sweden)

    Jesús Rodrigo Comino

    2015-01-01

    Full Text Available El presente trabajo pretende examinar la respuesta erosiva del suelo en áreas cultivadas de viñe-dos sobre laderas en pendientes elevadas en el Valle del Ruwer (Alemania a través de diferentes técnicas. Los experimentos se desarrollan entre los meses de septiembre y diciembre durante di-ferentes épocas de manejo del suelo: antes, durante y después de la vendimia. En primer lugar, se realiza un análisis de la variación geométrica de tres rills para cuantificar su expansión lateral (de 7 a 13 cm y vertical (1 a 4 cm. El movimiento del suelo confirma una elevada variabilidad en los procesos hidro-geomorfológicos de la ladera. A continuación, a través del cálculo del coeficiente teórico de escorrentía a partir del número de curva y lluvias simuladas en diferentes épocas del año, se observan unas elevadas tasas de infiltración, aunque con resultados muy diferentes entre técnicas. Por último, con el cálculo de la RUSLE (Revised Universal Soil Loss Ecuation y el aná-lisis de las marcas botánicas en los tocones de las parras, se calcula el impacto negativo de la ero-sión con el manejo agrícola del ser humano sobre los suelos de los viñedos. Con ambos métodos, se han obtenido 11.28 t ha-1 y 3.4 t ha-1 año de pérdida de suelo, respectivamente.

  6. Envisioning the inner body during the Edo period in Japan: Inshoku yojo kagami (Rules of Dietary Life) and Boji yojo kagami (Rules of Sexual Life).

    Science.gov (United States)

    Shirasugi, Etsuo

    2007-03-01

    There are two ukiyoe, Japanese woodblock prints, that were produced around 1850 and give a good picture of the images of the insides of the human body that were widely accepted among the common people in the Edo period. The Inshoku yojo kagami (Rules of Dietary Life) shows a man drinking sake. The Boji yojo kagami (Rules of Sexual Life) shows a woman, apparently a courtesan. The purpose of the two ukiyoe was to educate viewers about the functions of the principal inner organs in the traditional East Asian concept of the body and to admonish them against excessive eating, drinking and sexual intercourse. The contrivance of the two ukiyoe lies in their fusion of two formats. One is the format of a see-through body displaying the internal organs. The other is that of explaining the functions of the various internal organs in the form of familiar scenes from the living space of cities and households. Miniature sketches can be seen in the prints of people at work, performing the tasks believed to be that of each organ. However, the scheme of the two ukiyoe was not an innovation of the author of the ukioye. Already in the kibyoshi (Yellow Cover booklets), the scheme of likening the interior of the body to a living space had been adopted. After entering the 18th century, Chinese medical knowledge and anatomical drawings became available. As sex manuals, Yellow Cover booklets, and ukiyoe publications, incorporated and disseminated the newly acquired medical knowledge and the medical concept of the body gradually became the common sense view among people in the street.

  7. Ajuste de modelo fenológico para predecir el comportamiento de Lobesia botrana (Lepidoptera: Tortricidae en un viñedo de Mendoza, Argentina

    Directory of Open Access Journals (Sweden)

    Carla Vanina DAGATTI

    2015-01-01

    Full Text Available La temperatura es la variable que más incide en el desarrollo de Lobesia botrana (Den & Schiff, cuya relación ha sido estudiada mediante modelos matemáticos, como el de Touzeau. En Mendoza, en 2010 se registró la aparición de L. botrana. El objetivo de este trabajo es ajustar el modelo de Touzeau para predecir el comportamiento de la polilla. El estudio se realizó en un viñedo cv. Malbec desde 2012. Se emplearon trampas de feromonas. La temperatura se registró con un sensor datalogger. Se calculó la integral térmica con la fórmula de Touzeau con un umbral de 10ºC desde el 1 de julio de cada año. Los resultados indicaron que el primer vuelo se desarrolló el 18 y el 20 de octubre con 204,05 ± 10,73 grados día, el segundo en la primera decena de diciembre con 728,34 ± 41,95 grados día, el tercero durante la última quincena de enero con 1329,08 ± 151,35 grados día y el cuarto a mediados de febrero de 2012 y 2013, respectivamente con 1721,84 ± 116,63 grados día. Estos resultados son útiles para predecir la aparición de la plaga y como herramienta para establecer un sistema de alarma para los productores.

  8. The effect of the tropical cloud (fog) forest on the spatial distribution of cesium-137 in soils in the Henri Pittier National Park (Edo, Aragua, Venezuela)

    International Nuclear Information System (INIS)

    LaBrecque, J.J.; Rosales, P.A.; Cordoves, P.R.

    2002-01-01

    Soils were collected at different elevations (m.a.s.l.) near the two roadways, that pass through the Henri Pittier National Park (Edo, Aragua, Venezuela) in order to determine the distribution of the concentrations of the 137 Cs fallout and its relation to the tropical cloud forest. Duplicate samples were taken at most elevations between 2-5 cm below the soil surface to confirm that the samples were representative of the area. In many cases, it was difficult or impossible to locate areas that were undisturbed by man or nature. The 137 Cs (Bq/kg) content was determined by conventional high resolution gamma ray spectroscopy employing a standard comparison method. The background of the 137 Cs fallout in soils, below the cloud (fog) baseline was calculated to be about 5 Bq/kg on both the south (land) side and north (ocean) side for both roadways. The concentrations of 137 Cs (Bq/kg) were between 2-3 times higher at the baseline of the cloud (fog) on both sides of the mountain range. The 137 Cs values at the highest elevations (1105 and 1625 m.a.s.l.) near the roadways were about 5-6 times higher than the determined background levels. Our estimates of the baseline of the cloud (fog) are in good agreement with other visual observations. It was concluded that the distribution of 137 Cs in soils in cloud forests can be employed to estimate the baseline and the concentrations of 137 Cs fallout can be related to the relative density of the cloud (fog) when it was deposited. (author)

  9. Baixa prevalência de discromatopsia, pela 4ª edição do teste pseudoisocromático HRR (Hardy, Rand e Rittler), da população indígena de etnia terena da aldeia lalima na região de Miranda: Mato Grosso do Sul

    OpenAIRE

    Piccinin,Marcos Rogério Mistro; Cunha,Juliana Ferrari; Almeida,Herbert Paulo de; Bach,Cleiton Cassio; Dossa,Andréa Cristina Grubits Gonçalves de Oliveira; Silva,Reinaldo Ferreira da; Pessoa,Valdir Filgueiras

    2007-01-01

    OBJETIVO: Avaliar a freqüência de discromatopsias através da 4ª edição do teste pseudoisocromático HRR (Hardy, Rand and Rittler) entre a população indígena masculina da aldeia Lalima, etnia Terena, na região de Miranda-MS. MÉTODOS: Foram realizadas viagens à aldeia Lalima em Miranda-MS, nos meses de janeiro e fevereiro de 2005. As viagens para realizar os exames só foram iniciadas após o projeto ter sido avaliado e aprovado pelos Comitê de Ética e Pesquisa da UFMS, Comitê Nacional de Ética e ...

  10. Corporate social responsibility in Japan from the Edo period to the Fukushima nuclear accident; La responsabilite sociale des entreprises au Japon de l'epoque d'Edo a la norme ISO 26 000 a l'accident nucleaire de Fukushima

    Energy Technology Data Exchange (ETDEWEB)

    Rolland-Piegue, E. [Ambassade de France au Japon (Japan)

    2011-05-15

    Behind an apparently universal adherence to corporate social responsibility, differences in approaches are lurking with roots in distinct traditions of thought. Japanese business values date back to merchants during the Edo period and to the pioneers of Japanese capitalism during the Meiji period. They have always emphasized the diversity of all the parties - and not just shareholders - who contribute to a company's prosperity and should share in the benefits. Imported from Europe in 2003, corporate social responsibility was quickly institutionalized by Japanese firms that want to comply with international standards. This concept, Japanese-style, barely touches on social questions, which are referred to traditional values; but focuses instead on environmental issues and consumer protection. Non governmental organizations are not very active in Japan, and the state refuses to take a leading role even though its pro-business policy supports corporate social responsibility and should help, for example, diffuse the new standard, Iso-26000. Since March 2011, a new phase, laden with uncertainty, has started. The most devastating earthquake since World War II and the crisis at the Fukushima Daiichi nuclear power station should lead the Japanese to raise fundamental questions about what they expect from firms and public authorities. (author)

  11. Complications and co-morbidities in radiographs of patients in traditional bone setters’ homes in Ogwa, Edo State, Nigeria: a community-based study

    International Nuclear Information System (INIS)

    Eze, Kenneth C.

    2012-01-01

    Background: Musculoskeletal injuries are common in developing countries, but access to high quality orthopedic care is not. Traditional bone setters (TBS) serve to fill the gap, but the nature and quality of their treatment are largely understudied. Traditional bone setting in Idunmunkpaghan clan of Ogwa community, Edo State, Nigeria, was founded by Odion Ekhimere between about 1680 and 1705. The TBS practice in this community is studied to find out the complications and co-morbidities associated with it. Methods: A prospective community-based study of the patients admitted in the traditional bone setters’ homes was done at Ogwa over a -2-year period by studying the admission and discharge radiographs of patients treated in the community and by interviewing the TBS and patients. Result: Ninety patients with radiographs of the lesion sites were followed up from admission to discharge at the TBS homes, comprising 53 males (53.89%) and 37 females (41.11%) with a male to female ratio of 1.4:1. Sixty five patients (72.2%) had fracture or dislocation. Forty four of the 65 patients (67.7%) with fracture/dislocation had complications including mal-union 31(70.4%), secondary osteoarthritis 8 (18.2%), non-reduction of dislocation 7 (11.9%), non-union 8 (18.2%), and others 12 (27.2%). Co-morbidities were identified in 15 patients (16.7%) and included severe osteoarthritis 7 (46.7%), diabetic foot ulcer 4 (26.7%), severe hypertension with cardiomegaly 4 (26.7%), metastatic carcinoma of the prostate 3 (20.0%), septic arthritis 2 (13.3%), pulmonary tuberculosis 1 (6.7%) and others 3 (20.0%). Conclusion: The practice of traditional bone setting is well established in Idunmunkpaghan clan in Ukpogo quarter of Ogwa. Education and training of the TBS is the key to reduction of complications and co-morbidities seen in their practices as they have high patronage and the patients have high regards for them and will continue to patronize them

  12. Complications and co-morbidities in radiographs of patients in traditional bone setters’ homes in Ogwa, Edo State, Nigeria: a community-based study

    Energy Technology Data Exchange (ETDEWEB)

    Eze, Kenneth C., E-mail: ezechallenge@yahoo.co.uk [Department of Radiology, Faculty of Medicine, College of Health Sciences, Nnamdi Azikiwe University, Nnewi Campus, Anambra State (Nigeria)

    2012-09-15

    Background: Musculoskeletal injuries are common in developing countries, but access to high quality orthopedic care is not. Traditional bone setters (TBS) serve to fill the gap, but the nature and quality of their treatment are largely understudied. Traditional bone setting in Idunmunkpaghan clan of Ogwa community, Edo State, Nigeria, was founded by Odion Ekhimere between about 1680 and 1705. The TBS practice in this community is studied to find out the complications and co-morbidities associated with it. Methods: A prospective community-based study of the patients admitted in the traditional bone setters’ homes was done at Ogwa over a -2-year period by studying the admission and discharge radiographs of patients treated in the community and by interviewing the TBS and patients. Result: Ninety patients with radiographs of the lesion sites were followed up from admission to discharge at the TBS homes, comprising 53 males (53.89%) and 37 females (41.11%) with a male to female ratio of 1.4:1. Sixty five patients (72.2%) had fracture or dislocation. Forty four of the 65 patients (67.7%) with fracture/dislocation had complications including mal-union 31(70.4%), secondary osteoarthritis 8 (18.2%), non-reduction of dislocation 7 (11.9%), non-union 8 (18.2%), and others 12 (27.2%). Co-morbidities were identified in 15 patients (16.7%) and included severe osteoarthritis 7 (46.7%), diabetic foot ulcer 4 (26.7%), severe hypertension with cardiomegaly 4 (26.7%), metastatic carcinoma of the prostate 3 (20.0%), septic arthritis 2 (13.3%), pulmonary tuberculosis 1 (6.7%) and others 3 (20.0%). Conclusion: The practice of traditional bone setting is well established in Idunmunkpaghan clan in Ukpogo quarter of Ogwa. Education and training of the TBS is the key to reduction of complications and co-morbidities seen in their practices as they have high patronage and the patients have high regards for them and will continue to patronize them.

  13. Assessment of water quality of rivers that serve as water sources for drinking and domestic functions in rural and pre-urban communities in Edo North, Nigeria.

    Science.gov (United States)

    Beshiru, Abeni; Okareh, Oladapo T; Chigor, Vincent N; Igbinosa, Etinosa O

    2018-06-09

    Surface waters are important to humans because they are a significant water supply source. They are, however, under serious environmental stress and are being threatened as a consequence of developmental activities. The present study describes the physicochemical properties and water quality indices of five different rivers used for drinking and other domestic activities in rural and pre-urban communities in Edo North, Nigeria. The physicochemical variable ranges include pH [wet season (6.47 ± 0.30-6.89 ± 0.11), dry season (6.61 ± 0.14-7.84 ± 0.24)], electrical conductivity (EC) [wet season (3.33 ± 0.57-12.33 ± 2.51 μS/cm), dry season (5.33 ± 0.57-21.33 ± 2.08 μS/cm)], water temperature [wet season (24.23 ± 0.98-25.40 ± 1.15 °C), dry season (26.20 ± 0.55-27.10 ± 0.75 °C)], TDS [wet season (417.00 ± 15.87-433.33 ± 18.50 mg/L), dry season (319.33 ± 16.50-372.66 ± 22.30 mg/L)], turbidity [wet season (1.01 ± 0.11-2.08 ± 0.99 NTU), dry season (3.11 ± 0.01-5.41 ± 0.24 NTU)], and DO [wet season (2.65 ± 0.37-3.99 ± 0.01 mg/L), dry season (2.12 ± 0.11-2.44 ± 0.01 mg/L)]. For the wet and dry seasons, the water quality indices were 120.225 and 585.015 for River Osolo, 119.849 and 445.751 for River Foreign, 200.474 and 587.833 for Ijoh River, 105.261 and 512.498 for Ole River, and 150.114 and 489.992 for Ole Extension River, respectively. The pH was negatively correlated with DO (r = -0.648), and EC was negatively correlated with DO (r = -0.635). Most of the evaluated parameters were within recommended water safety guidelines. However, the water quality index shows that the water quality was very poor and/or unsuitable for drinking and other domestic uses, especially during the dry season. It is suggested that river water be treated prior to its use for drinking and other domestic purposes.

  14. Effects Based Operations (EDO) Endstate

    National Research Council Canada - National Science Library

    James, Ron; Daniels, Troy

    2005-01-01

    .... An analysis of the combination of physical (e.g. petroleum, electric power) and behavioral (e.g. leadership) COGs at the operational level models was performed and the results were incorporated in the EndState Tool...

  15. Modalidades disciplinarias en el colegio de calidad de la ciudad de Medellín "Institución Educativa Francisco Miranda" en los grados séptimo y octavo. Una perspectiva psicoanalítica

    Directory of Open Access Journals (Sweden)

    Hernando Alberto Bernal Zuluaga

    2011-07-01

    Full Text Available Esta investigación abordó el problema de las modalidades disciplinarias en uno de los colegios de calidad en la ciudad de Medellín, la Institución Educativa Francisco Miranda, en los grados séptimo y octavo, colegio situado en la comuna 4 (Aranjuez y que atiende población de los estratos 1, 2 y 3. La pregunta de investigación fue la siguiente: ¿cómo se sanciona hoy en el Colegio de Calidad de la ciudad de Medellín “Institución Educativa Francisco Miranda” en los grados séptimo y octavo?, en un momento de la época actual en el que padres y profesores se preguntan la razón por la cual los castigos no tienen efecto. La metodología de la investigación fue cualitativa –paradigma histórico-hermenéutico–, con un enfoque específico o técnica de investigación del psicoanálisis: el paradigma indiciario, enfoque formalizado por el historiador Carlo Ginzburg. Los resultados dados por la investigación permitieron dilucidar cómo se sanciona hoy en el Colegio de Calidad de la ciudad de Medellín “Institución Educativa Francisco Miranda” en los grados séptimo y octavo; así mismo, se pudo dar cuenta de las dificultades que encuentran los maestros como representantes de la ley.

  16. Modalidades disciplinarias en el colegio de calidad de la ciudad de Medellín "Institución Educativa Francisco Miranda" en los grados séptimo y octavo. Una perspectiva psicoanalítica

    Directory of Open Access Journals (Sweden)

    Hernando Alberto Bernal Zuluaga

    2011-07-01

    Full Text Available Esta investigación abordó el problema de las modalidades disciplinarias en uno de los colegios de calidad en la ciudad de Medellín, la Institución Educativa Francisco Miranda, en los grados séptimo y octavo, colegio situado en la comuna 4 (Aranjuez y que atiende población de los estratos 1, 2 y 3. La pregunta de investigación fue la siguiente: ¿cómo se sanciona hoy en el Colegio de Calidad de la ciudad de Medellín “Institución Educativa Francisco Miranda” en los grados  séptimo  y octavo?, en un momento de la época actual en el que padres y profesores se preguntan la razón por la cual los castigos no tienen efecto. La metodología de la investigación fue cualitativa –paradigma histórico-hermenéutico–, con un enfoque específico o técnica de investigación del psicoanálisis: el paradigma indiciario, enfoque formalizado por el historiador Carlo Ginzburg. Los resultados dados por la investigación permitieron dilucidar cómo se sanciona hoy en el Colegio de Calidad de la ciudad de Medellín “Institución Educativa Francisco Miranda” en los grados séptimo y  octavo; así mismo, se pudo dar cuenta de las dificultades que encuentran los maestros como representantes de la ley. © Revista Colombiana de Ciencias Sociales.

  17. Baixa prevalência de discromatopsia, pela 4ª edição do teste pseudoisocromático HRR (Hardy, Rand e Rittler), da população indígena de etnia terena da aldeia lalima na região de Miranda: Mato Grosso do Sul Low prevalence of dyschromatopsia using the fourth edition of HRR (Hardy, Rand and Rittler) pseudoisochromatic plate test among the Indian population of Lalima village, Terena

    OpenAIRE

    Marcos Rogério Mistro Piccinin; Juliana Ferrari Cunha; Herbert Paulo de Almeida; Cleiton Cassio Bach; Andréa Cristina Grubits Gonçalves de Oliveira Dossa; Reinaldo Ferreira da Silva; Valdir Filgueiras Pessoa

    2007-01-01

    OBJETIVO: Avaliar a freqüência de discromatopsias através da 4ª edição do teste pseudoisocromático HRR (Hardy, Rand and Rittler) entre a população indígena masculina da aldeia Lalima, etnia Terena, na região de Miranda-MS. MÉTODOS: Foram realizadas viagens à aldeia Lalima em Miranda-MS, nos meses de janeiro e fevereiro de 2005. As viagens para realizar os exames só foram iniciadas após o projeto ter sido avaliado e aprovado pelos Comitê de Ética e Pesquisa da UFMS, Comitê Nacional de Ética e ...

  18. Presencia de Phomopsis viticola (Saccardo Saccardo, agente causal de excoriosis, en viñedos de Córdoba, Argentina Presence of Phomopsis viticola (Saccardo Saccardo, causal agent of excoriosis, in vineyards of Córdoba, Argentina

    Directory of Open Access Journals (Sweden)

    C.I. Cragnolini

    2009-12-01

    Full Text Available Desde 2001 se observan en viñedos de Córdoba, Argentina, hojas de Vitis vinifera y V. labrusca con manchas cloróticas y centro necrótico. Las plantas presentan nervaduras, pecíolos, raquis y entrenudos con puntos necróticos que al confluir agrietan el tejido cortical. Las bayas pueden marchitarse y desprenderse. En invierno los sarmientos toman color blanquecino con manchas negras, y en ellos y en órganos secos aparecen picnidios con cirros blanco-crema con conidios alfa y beta. El objetivo fue confirmar la presencia de Phomopsis viticola (excoriosis y cuantificar su incidencia. Se realizaron aislamientos a partir de pecíolos, brotes, zarcillos, bayas y sarmientos que produjeron micelio claro con picnidios y conidios alfa (7,5m±1,5 x 2,8m±2 y beta (19m±1 x 1,2m±0,5 o sólo alfa, típicos de P. viticola. La identificación fue confirmada mediante secuenciación molecular. En brotes de las variedades Malbec y Pinot noir inoculados con 3 10(4 conidios/mL, las hojas mostraron lesiones y picnidios 8 días después, y las bayas cirros amarillos a los 15-18 días. P. viticola (Sacc. Sacc. fue reaislado de los cirros y las colonias produjeron picnidios y conidios característicos 10-20 días después. Se detectó excoriosis en 80% de los viñedos evaluados, con mayor incidencia en viñedos añosos de las variedades Pinot noir e Isabella.Leaves with chlorotic spots and necrotic centers have been observed in Vitis vinifera and V. labrusca in vineyards of Córdoba, Argentina, since 2001. Plants exhibit veins, petioles, rachises, and internodes with necrotic spots that coalesce to form cracks in the cortical tissue. Grape berries can shrivel and fall off. Winter canes became whitish with black spots; pycnidia appear in canes and in dry organs, exuding whitish-cream cirri with alpha and beta conidia. The aim of this work was to confirm the presence of Phomopsis viticola (excoriosis and quantify its incidence. Isolates obtained from petioles

  19. El programa iconográfico del presbiterio y crucero de la catedral de Mondoñedo (1769-1773 y la reconstrucción de la “prueba perdida”

    Directory of Open Access Journals (Sweden)

    López Calderón, Carme

    2013-12-01

    Full Text Available In this article we deal with the sculptural and pictorial ensemble in the presbytery and transept of the Cathedral of Saint Mary of Mondoñedo, carried out by Francisco José Terán between 1769 and 1773. We propound its analysis from an iconographic point of view so as to, once subjects are identified, go into their symbolic values in depth. With this, our aim is to try to reconstruct the program —the “lost piece of evidence”— that justifies its choice. In doing so, we act according to the function given by E. Gombrich to the Iconology, that also demands to look for the concrete meaning that this illustrated story has within the context in which it appears. Of that way, handling visual and written sources of the period —standing out those referred to the frescoes by Lucas Jordan in the church of The Escorial, whose similarities with the Mondoñedo program are, at least, strinking— and considering the Counter-Reformation teachings about the prerogatives of the Deipara and the spiritual progress of the faithful, we offer an interpretation focused in the Marian exaltation, whose last target is to remind the people the mediation that, in honour of their Redemption, Virgin undertakes between them and God.En el presente artículo abordamos el conjunto escultórico-pictórico del presbiterio y crucero de la Catedral de Santa María de Mondoñedo, ejecutado por José Francisco Terán entre 1769 y 1773. Proponemos su análisis en términos iconográficos, para, una vez identificados los temas, ahondar en sus valores simbólicos de cara a intentar reconstruir el programa —la “prueba perdida”— que justifica su elección. Actuamos así conforme a la función dada por E. Gombrich a la Iconología, la cual asimismo exige buscar el significado concreto que dicha historia ilustrada posee dentro del contexto en que se gesta. De esta manera, consultando fuentes de época, visuales y escritas —destacando las referidas a los frescos de Lucas

  20. Estrategias de calidad en las prácticas pedagógicas de los docentes, en la educación pública de la ciudad de Medellín: el caso de la Institución Educativa Francisco Miranda

    OpenAIRE

    Buitrago Castaño, Margarita María

    2010-01-01

    Ubicación en Biblioteca USB Medellín (San Benito): CD-1636t.-- Grupo de Investigación en Epistemologías y Metodologías en la Educación y la Motricidad "EPIMEM".-- Linea de Investigación: Gestión y Currículo .-- Área: Pedagogía - Tema: Gestión educativa La investigación estrategias de calidad en las prácticas pedagógicas de los docentes, en la educación pública de la ciudad de Medellín: el caso de la Institución Educativa Francisco Miranda, estudia cómo los cambios que se presentan en la ed...

  1. Variação temporal e espacial de ovos e de larvas das espécies de interesse para a pesca na sub-bacia do rio Miranda, Pantanal, Estado do Mato Grosso do Sul, Brasil - DOI: 10.4025/actascibiolsci.v27i3.1314 Temporal and spatial variation of fish eggs and larvae of the main exploited species in the sub-basin of Miranda River, Pantanal wetland, State of Mato Grosso do Sul, Brazil - DOI: 10.4025/actascibiolsci.v27i3.1314

    Directory of Open Access Journals (Sweden)

    Keshyiu Nakatani

    2005-03-01

    Full Text Available Foi analisada a variação temporal de ovos e de larvas das principais espécies exploradas no Pantanal: Piaractus mesopotamicus; Prochilodus lineatus; Salminus maxillosus; Leporinus macrocephalus e Pseudoplatystoma spp., no rio Miranda. As coletas foram realizadas nos meses de outubro a março, quinzenalmente, de 1996 a 1999. O rio foi dividido em trecho superior, médio e inferior, com 15 pontos de coleta. Foram utilizadas rede de plâncton cônico-cilindrica, com fluxômetro, e as amostras fixadas em formol 4%. Para a identificação, utilizaram-se características morfológicas e merísticas, grau de flexão da notocorda e elementos da nadadeira caudal. No primeiro período, foram capturadas 5.979 larvas e 1.075 ovos; no segundo, 108.912 larvas e 1.836 ovos; no terceiro, 13.465 larvas e 1.855 ovos. A ANOVA, entre os anos e trechos do rio, foi significativa (F= 6.5, p >0,05 no trecho médio, indicando que a reprodução ocorre do trecho médio para o superior, nos meses de novembro a janeiroThe aim of this study was to analyze temporal variation of fish eggs and larvae of the main exploited species in Miranda river, Pantanal wetland (Piaractus mesopotamicus, Prochilodus lineatus, Salminus maxillosus, Leporinus macrocephalus, and Pseudoplatystoma spp., which were collected from October to March, biweekly, from 1996 to 1999. The river was divided into superior, medium and inferior sections, of 15 collection sites. Conical-cylindrical plankton net with a fluxometer and samples fixed in formol 4% were utilized. Morphological and meristic characteristics, notochord flexion degree and caudal fin elements were utilized for identification. A total of 5,979 larvae and 1,075 eggs were collected in the first period; 108,912 larvae and 1,836 eggs in the second; 13,465 larvae and 1,855 eggs in the third. Results showed that ANOVA, between the years and the river stretches, was significant (F = 6.5, p >0.05 in the medium section, which indicates that the

  2. Evaluation of a model to Simulate Net Radiation Over a Vineyar cv. Cabernet Sauvignon Evaluación de un Modelo para Simular el Flujo de Radiación Neta Sobre un Viñedo cv. Cabernet Sauvignon

    Directory of Open Access Journals (Sweden)

    Marcos Carrasco

    2008-06-01

    Full Text Available Net radiation (Rn is the main energy balance component controlling evaporation and transpiration processes. In this regard, this study evaluated two models to estimate Rno above a commercial vineyard (Vitis vinifera cv. Cabernet Sauvignon located in Pencahue Valley, Maule Region (35º22’ S; 71°47’ Wl; 75 m.a.s.l.. An automatic meteorological station (AMS was installed in the central part of the vineyard and used to measure Rn, solar radiation (Rsi, air temperature (Ta, canopy temperature (Tf and relative humidity (RH. On a 30 min interval, results indicated that model Rne1 (assuming Ta ≠ Tf and model Rne2 (assuming Ta = Tf were able to estimate Rn with a mean absolute error (MAE of less than 40 W m-2 and root mean square error (RMSE of less than 61 W m-2. On daily intervals, the two models estimated Rno with MAE and RMSE values of less than 1.68 and 1.75 MJ m-2 d-1, respectively. In global terms, the models presented errors below 9 and 11% on 30 min and daily intervals, respectively. Furthermore, this study indicated that the incorporation of canopy temperature did not improve the Rno estimation substantially, in spite of having a temperature gradient (dT = Tf - Ta between -3 and to 4ºC. These results suggest that an Rne2 model could be used to estimate Rno using Rsi, Ta and RH measurements.El flujo de radiación neta (Rn es el principal componente del balance de energía que determina los procesos de evaporación y transpiración. En este contexto, este estudio evaluó dos modelos para estimar Rno sobre un viñedo (Vitis vinifera L. cv. Cabernet Sauvignon comercial ubicado en el Valle de Pencahue, Región del Maule (35º22’ S; 71º47’ Oeste; 75 m.s.n.m.. Para esto, se ubicó una estación meteorológica automática (AME en la parte central del viñedo para medir Rn, radiación solar (Rsi, temperatura del aire (Ta, temperatura del dosel (Tf y humedad relativa (HR. En intervalos de tiempo de 30 min, los resultados indicaron que el

  3. Reguladores de la brotación, alternativos a la cianamida hidrogenada, para suplir la falta de horas de frío en viñedos tropicales del litoral ecuatoriano

    Directory of Open Access Journals (Sweden)

    Raquel Herranz

    2015-12-01

    Full Text Available La cianamida hidrogenada (CH es un eficaz estimulante de la brotación de las yemas habitualmente utilizado en viticultura tropical, pero manipular esta materia activa conlleva un alto riesgo por su elevada toxicidad. Según algunos estudios tratamientos alternativos podrían llegar a producir sobre las yemas efectos similar a la CH, compensado la falta de horas de frío en viñedos situados en zonas tropicales, como los ubicados en la costa sur ecuatoriana. De entre todos los tratamientos evaluados destacan los efectos producidos por la aplicación directa sobre las yemas de peróxido de hidrógeno al 5%. Este tratamiento consigue estimular la brotación de la práctica totalidad de las yemas, adelantando e incrementando el desarrollo vegetativo y duplicando el rendimiento de las cepas, sin mermar la calidad de los racimos producidos. Por tanto podemos afirmar que los tratamientos con peróxido de hidrógeno son una alternativa viable, más económica y sostenible, a las aplicaciones de CH en estas condiciones de cultivo   Abstract Hydrogen cyanamide (CH is an effective stimulant bud breaking usually used in tropical viticulture, but handling this active substance carries a high risk because of their high toxicity. According to some studies alternative treatments could potentially produce a similar effect on the buds to CH, offset the lack of chilling hours in vineyards located in areas without a sufficient period of chilling hours, such as those located on the southern coast of Ecuador. Among all treatments evaluated the effects include direct application to the buds of hydrogen peroxide 5%. This treatment gets stimulate bud breaking of almost all of the buds, advancing and increasing vegetative growth and doubling the performance of the strains, without compromising the quality of the grapes produced. Therefore we can say that the hydrogen peroxide treatments are a viable, economical and sustainable, alternative to CH applications in these

  4. art and culture administration in Edo State

    African Journals Online (AJOL)

    imitch

    its environment the social, political, economic, aesthetic and religious norms and ... essence of culture “as the development and refinement of the various aspects of ... the academia, had many editions of it published before going out of circulation. ... of the statue of “General Asoro” which was unveiled in Benin City on 11th.

  5. art and culture administration in Edo State

    African Journals Online (AJOL)

    imitch

    its environment the social, political, economic, aesthetic and religious norms and .... December, 2009, the Ministry of Arts, Culture and Tourism did organize a well ... and Social Welfare Departments and the mass media in the state so that the ...

  6. Edo Journal of Counselling: Editorial Policies

    African Journals Online (AJOL)

    Benue State, Nigeria Professor Adriana G. McEachern Florida Inter. University, Miami. USA. Professor Bryan Hiebert University of Calgary, Alberta. Canada Professor Beatrz Malik Universidad Nacional de Educación a Distancia (UNED) Madrid, Spain Professor Jim Athanasou University of Technology, Sydney. Australia.

  7. by men in Edo state, Nigeria

    African Journals Online (AJOL)

    E. (Eshiobo) Irekpita

    2017-05-03

    May 3, 2017 ... b Dept. of Surgery, Irrua Specialist Teaching Hospital, Irrua, Nigeria c Dept. of Medicine .... the hospital as the treatment facility, while, the others either did .... pros and cons of reporting and creating an appropriate environment.

  8. Psychological empowerment and development | Oladipo | Edo ...

    African Journals Online (AJOL)

    Using the archival method of investigation, this paper explores the subject of psychological empowerment (particularly in relation to youths) and national development. The specific objective of the paper is to explore and establish the importance of psychological empowerment of the masses and particularly the youths, ...

  9. HYDROLOGICAL ASSESSMENTS OF SOME RIVERS IN EDO ...

    African Journals Online (AJOL)

    Highest monthly hydropower yields were recorded in September for Ovia, Ikpoba and Edion Rivers and in August for Orlie River. On annual basis, Ovia River, recorded the highest power yield of 61.619MW (suggesting that Ovia river may be suitable for a Medium hydropower scheme, 10MW-100MW) with the highest ...

  10. Specimen Days: The Teaching Diaries of Miranda Field.

    Science.gov (United States)

    Field, Miranda

    2002-01-01

    Describes the author's experiences teaching Girl Scouts writing and poetry. Concludes that she learned many crucial lessons from her students including lessons on power relations in the classroom, on communication across cultural and even generational divides, and on the varieties of poetry that can be made by the varieties of imaginative…

  11. Decolorization of laundry effluent by filamentous fungi | Miranda ...

    African Journals Online (AJOL)

    After selecting, the best fungi were subjected to an experimental design and evaluation of the production of the ligninolytics enzymes. Fungi Phanerochaete chrysosporum CCT 1999, Lentinula edodes CCT 4519 and Curvularia lunata UFPEDA 885 reduced 100% the color of the effluent during growth under agitation while ...

  12. Baixa prevalência de discromatopsia, pela 4ª edição do teste pseudoisocromático HRR (Hardy, Rand e Rittler, da população indígena de etnia terena da aldeia lalima na região de Miranda: Mato Grosso do Sul Low prevalence of dyschromatopsia using the fourth edition of HRR (Hardy, Rand and Rittler pseudoisochromatic plate test among the Indian population of Lalima village, Terena

    Directory of Open Access Journals (Sweden)

    Marcos Rogério Mistro Piccinin

    2007-03-01

    Full Text Available OBJETIVO: Avaliar a freqüência de discromatopsias através da 4ª edição do teste pseudoisocromático HRR (Hardy, Rand and Rittler entre a população indígena masculina da aldeia Lalima, etnia Terena, na região de Miranda-MS. MÉTODOS: Foram realizadas viagens à aldeia Lalima em Miranda-MS, nos meses de janeiro e fevereiro de 2005. As viagens para realizar os exames só foram iniciadas após o projeto ter sido avaliado e aprovado pelos Comitê de Ética e Pesquisa da UFMS, Comitê Nacional de Ética e Pesquisa, Fundação Nacional do Índio e do cacique da aldeia Lalima. O teste HRR foi aplicado em 226 índios após terem sido submetidos a exame oftalmológico para detecção de anormalidades que pudessem comprometer a aplicabilidade do teste. O teste foi realizado sob luz natural, em dias ensolarados, sem incidência direta de sol. O teste foi aplicado e interpretado pelo mesmo examinador em todos os índios. RESULTADOS: Realizaram-se 226 exames (60,1% de uma população de 376 homens entre 10 e 45 anos de idade, que vivem na Aldeia Lalima. Não foi encontrado nenhum caso de discromatopsia na população examinada com o teste HRR. CONCLUSÃO: O resultado do presente estudo mostra a baixa prevalência de discromatopsia nesta população indígena de etnia Terena, uma vez que não se detectou nenhum caso de discromatopsia na população estudada, sendo a prevalência de discromatopsia entre homens caucasianos de 6 a 8%. A ausência de discromatopsia na população estudada, no entanto, deve ser mais bem avaliada tentando aumentar o tamanho da amostra, utilização de outros testes e, principalmente, por estudos genéticos para verificar os genes codificadores dos fotopigmentos para melhor compreensão das condições relacionadas à visão de cores dessa comunidade indígena.PURPOSE: to evaluate the frequency of dyschromatopsias among the 10 to 45-year-old male Indian population of Lalima village, Terena ethnicity, in Miranda-MS, using

  13. Components/factors of the Czech version of the Physical Self Perception Profile (PSPP-CZ among high school students [Komponenty/faktory české verze dotazníku tělesného sebepojetí (PSPP-CZ u středoškolských studentů

    Directory of Open Access Journals (Sweden)

    Vlastimil Kudláček

    2010-12-01

    have found that students from Czech high schools have a different structure of self perception then the original PSPP population from England (Fox, 1990. Our findings correspond with findings among Flemish adults (Van de Vliet et al., 2002; Ferreira & Fox, 2007 where components of sport and condition were also loaded into one factor. There are clear, subtle differences in the structure of physical self perception as related to cultural and language differences. Findings of internal reliability and content validity suggest that the three subscales questionnaire can be used in the Czech population as a valid and reliable instrument. CONCLUSIONS: In conclusion, we can recommend using the PSPP-CZ with three scales for use among young adults for the exploration of the role of physical self-perception as a determinant of physical activity/inactivity and a healthy lifestyle.[VÝCHODISKA: Tělesné sebepojetí bylo široce zkoumáno jako určující činitel pro cvičení stejně jako jeden z prvků majících vliv na duševní zdraví a blaho (Fox, 1997. Sebepojetí je všeobecně přijímáno jako významný prostředník mezi cvičením a sebeúctou (Fox, 2000; Sonstroem, 1997. Porozumění procesům seberozvoje nabylo na důležitosti, jelikož sebeúcta a sebepojetí jsou stále významnějšími komponenty vzdělávacích, klinických a komunitních programů péče o zdraví (Ferreira & Fox, 2008. Abychom mohli prozkoumat vztahy mezi různými úrovněmi tělesných aktivit a sebepojetí, musíme k měření tělesného sebepojetí mezi českými adolescenty využít standardizované nástroje. CÍLE: Účelem této studie bylo analyzovat strukturu přeloženého dotazníku PSPP-CZ mezi populací středoškolských studentů, a to hledáním komponentů PSPP-CZ za pomoci analýzy hlavních komponentů. Dotazník tělesného sebepojetí (Physical Self Perception Profi le, PSPP na české populaci nikdy nebyl použit. METODIKA: Studie se zúčastnili středo

  14. Psychological Techniques In Helping Rape Victims | Ayinde | Edo ...

    African Journals Online (AJOL)

    Counselling psychology is concerned with assisting people who have personal, social, educational and vocational problems to better understand themselves and solve their problems. Rape is seen as a problem that militates against the psychological well being of victims, because of the devastating aftermath of the incident ...

  15. invertebrate fauna of Ovia River, Edo State, Nigeria

    African Journals Online (AJOL)

    ogbe

    low species abundance in station II is an indication of the grazing effect of the herds of cattle, which resulted in the ... potential to influence the condition of our freshwater .... taxonomic groups using an American Optical ..... Journal of the North.

  16. hydrological assessments of some rivers in edo state, nigeria

    African Journals Online (AJOL)

    user

    friction of flowing water with the rocks and the sediment in the river beds. Harnessing the kinetic energy from ... reported that the amount of achievable hydropower at any given site is a function of turbine head and the .... the discharge coefficient of each land use pattern, using GIS [52,2, 53,54,55], Discharge estimates based.

  17. Geophysical Study of Lithologies Attributes At Isihor Village, Edo ...

    African Journals Online (AJOL)

    These attributes include depth, thickness of lithologies or rock types beneath the sea level or earth's surface. Geophysical prospect of lithologies in this studied area is vital for many economic and environmental reasons for examples a large portion of the world's fossil fuels such as oil, gas and coal are found in stratified ...

  18. Examination anxiety among secondary school students in Edo State ...

    African Journals Online (AJOL)

    ... encourage stakeholders in the learning process to promote good study habits, provide learning materials and facilities that will build self confidence in the students, thereby reducing anxiety over examination. Keywords: Examination Anxiety, Adolescents, Secondary School Students, Examination Phobia, Test Anxiety ...

  19. Job satisfaction of extension workers in Edo State Agricultural ...

    African Journals Online (AJOL)

    Agricultural extension can be said to be germane for any meaningful development in the agricultural sector. Extension personnel that are saddled with this responsibility need to be satisfied with their job in order to perform their duties effectively. Therefore this study examined the factors affecting job performance and level of ...

  20. Parasitic contamination of fruits and vegetables in Benin city, Edo ...

    African Journals Online (AJOL)

    Aim: The consumption of fresh fruits and vegetables helps in protecting the human body from diseases and also has a positive impact on body-weight regulation and related conditions, including diabetes and hypertension. This study was conducted to determine the parasitic contamination of fruits and vegetables in Benin ...

  1. Management of examinations: ethical issues. | Nweze | Edo Journal ...

    African Journals Online (AJOL)

    Talking about the ethical issues, we are all aware of the manner/way in which examination malpractice has eaten deep into the fabrics of our society. Some measures really have to be taken to normalize the examination system in our society. The challenges of examination management are numerous for example, having ...

  2. Duodenal Obstruction: Etiology, Morbidity and Mortality among Edo ...

    African Journals Online (AJOL)

    Duodenal obstruction in children is associated with poor outcome which has improved in developed but remained poor in developing countries. The objective of this study was to ascertain the etiology, morbidity, mortality and factors that contributed to poor outcome in a developing country. Retrospective analysis of pediatric ...

  3. Oguega Divination Poetry In Edo State, Nigeria Abstract Introduction

    African Journals Online (AJOL)

    Frederick Iraki

    Although Oguega terms are esoteric, one notices that the poetry which goes with the codified .... It is a normal thing to go through the door to access a room and an abnormal thing to use the window ... This is of course why such persons may be seen as poor historians. .... Encarta Encarta Microsoft Corporation1993-2008.

  4. Attitude of Nursing Mothers In Edo State Towards Exclusive | Alutu ...

    African Journals Online (AJOL)

    Secondly, practice of exclusive breast-feeding adversely affected by the nursing mothers\\' nature of work. The nurses and teachers were more favourably disposed to exclusive breast-feeding than the bankers. There is therefore need to provide an enabling environment for working mothers to cope with infant feeding and ...

  5. Youth contract of some sexually transmitted infections (STIs) In Edo ...

    African Journals Online (AJOL)

    Finally, the prevalence of Gonorrhea, herpes simplex, Chlamydia, trachomatis, genital warts, syphilis, staph aureus and HIV/AIDS at 6.5, 0.4, 0.8, 2.6, 1.9, 1.0 and 1.3 percent among youth was found. It was, therefore, asserted in this study that STIs can cause infertility, serious illness, disability and death if left untreated.

  6. Gender Issues in Human trafficking in Edo State, Nigeria

    African Journals Online (AJOL)

    Importantly, previous studies have utilized macro theoretical perspective in explaining the .... represent the territorial label in recent times as in Benin Division, Benin City, Benin. Kingdom. ..... and this was a psychological boost for the Benin.

  7. Dynamics of the zooplankton assemblage of Ojirami Reservoir, Edo ...

    African Journals Online (AJOL)

    Zooplankton form an important trophic link between phytoplankton and fish in ... with water temperature and water level; and positive with alkalinity, free CO2 and phosphate. The study revealed low pollution indicator species in the reservoir ...

  8. Parasitic infections in African pangolin ( Manis temminckii ) from Edo ...

    African Journals Online (AJOL)

    Amblyomma sp.). Oochoristica sp. (100%) and Amblyomma sp. (75%) were the most prevalent parasites. Both male and female pangolins recorded equal prevalence (100%) of infection, however, mean intensity of parasites was higher in males ...

  9. Geophysical Prospecting Of Clay Deposits in Abudu Area of Edo ...

    African Journals Online (AJOL)

    Its resistivities varied from about 1.0 ohm - m to 500 ohm-m. Area of probable clay formation and their thicknesses have been identified especially for future mining of industries foundation, operations and drilling. Journal of the Nigerian Association of Mathematical Physics, Volume 19 (November, 2011), pp 335 – 342 ...

  10. Prevalence and Prevention of Malaria in Pregnancy in Edo State ...

    African Journals Online (AJOL)

    Erah

    Prevention used against malaria in pregnancy is a sure safe guard against maternal morbidity/mortality and should be ... This acquired anti- malarial immunity ... her family by reducing malaria related ... complications arising during pregnancy,.

  11. Forest regeneration, dereservation and management in Edo State ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-12-29

    Dec 29, 2008 ... concluded that the role of the forests which cut across many areas of human endeavour seem not to be appreciated ... as an agroforestry system could be an effective and cost saving ... manpower, logistics, and patrol duties to prevent forest offences. ... The reversal of political direction in this matter is.

  12. Edo Journal of Counselling - Vol 3, No 1 (2010)

    African Journals Online (AJOL)

    Remedy to the inadequate representation of guidance and counselling in the national policy on education · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. E Egbochuku, I Alika, 16-27. http://dx.doi.org/10.4314/ejc.v3i1.52677 ...

  13. Tuberculous pyomyositis in a patient with diabetes Mellitus | Edo ...

    African Journals Online (AJOL)

    Pyomyositis is a pyogenic infection of the skeletal muscle which can cause significant morbidity and mortality if not properly treated. Diabetes mellitus (DM) is a well recognized risk factor for development of pyomyositis. The usual causative pathogen of pyomyositis in diabetes mellitus is Staphylococcus aureus. Tuberculous ...

  14. Optimum Plans For Oilpalm And Food Crop Combinations In Edo ...

    African Journals Online (AJOL)

    Intercropping food crops in oil palm plantations is a popular practice among oil ... are not guided by economic rationale for the choice of food crops and oil palm. ... linear programming model for oil palm/food crops enterprise combinations in ...

  15. Pornograghy in Postcolonial Nigeria: An Owan (Edo) Traditional ...

    African Journals Online (AJOL)

    Sexual morals vary across culture, religion and historical periods. This is evidenced in the various norms set by different societies, religions and ideological groups on what is perceived as permissible sexual behaviour. This paper reviews the phenomenon of pornography in postcolonial Nigeria. It seeks to evaluate the ...

  16. ¿Cómo fue que el viñedo adquirió importancia? Significados de las vides, calidades de las uvas, y cambio socio-técnico en la producción vinícola de Mendoza

    Directory of Open Access Journals (Sweden)

    Hernán Thomas

    2009-08-01

    over the past few decades. Limiting itself to the Mendoza region, this paper wants to analyze some of the changes observed in vineyards from a socio-technical perspective. Following the way that the definition of quality is (reconstructed, a relationship is sought between vines and wine and the use of certain technologies. The paper shows how the dynamics between social groups and artifacts create different conceptions of quality, which in turn lead to a different role of grapes in the wine making process. It also shows that the changes observed do not necessarily imply a ‘new way’ has taken over an ‘old way’. It rather seems that different social groups are relevant in different technological frames, displacing others.

    Según los diferentes actores implicados en el proceso de producción, el vino argentino ha vivido cambios radicales en las últimas décadas. Limitándose a la región de Mendoza, esta investigación intenta analizar algunos de los cambios observados en los viñedos desde una perspectiva socio-técnica. Siguiendo la forma como la definición de calidad es (reconstruida, se busca comprender la relación existente entre la interpretación de la vid y el uso de ciertas tecnologías. El artículo muestra cómo las dinámicas entre grupos sociales y artefactos crean significados diferentes de calidad, lo que a su vez otorga diferentes papeles a las uvas en el proceso de producción de vinos. También muestra que los cambios descriptos no necesariamente implican que una ‘nueva tradición’ haya reemplazado a una ‘vieja tradición’, sino que diferentes grupos sociales son relevantes en diferentes marcos tecnológicos, desplazando a otros.

  17. MIRANDA: The EO-sensor Performance Tool Powered by EOSTAR-PRO - poster (Abstract)

    NARCIS (Netherlands)

    Hammel, S.H.; Tsintikidis, D.; Adonidis, M.; Degache, M.A.C.; Lange, D.J.J. de; Eijk, A.M.J. van

    2007-01-01

    Over the last decades, considerable efforts have been made to assess the impact of theenvironment on EM and EO propagation. While encouraging progress has been made in the EM domain, few, if any, operational tools are available for the EO domain. As a consequence, no EO operational software,

  18. Accelerated pseudogenization on the neo-X chromosome in Drosophila miranda

    KAUST Repository

    Nozawa, Masafumi; Onizuka, Kanako; Fujimi, Mai; Ikeo, Kazuho; Gojobori, Takashi

    2016-01-01

    Y chromosomes often degenerate via the accumulation of pseudogenes and transposable elements. By contrast, little is known about X-chromosome degeneration. Here we compare the pseudogenization process between genes on the neo-sex chromosomes

  19. An Evaluation of "Miranda" Rights and Interrogation in Autism Spectrum Disorders

    Science.gov (United States)

    Salseda, Lindsay M.; Dixon, Dennis R.; Fass, Tracy; Miora, Deborah; Leark, Robert A.

    2011-01-01

    The primary deficits present in autism spectrum disorders (ASD) may lead to increased susceptibility to involvement in the criminal justice system. The same deficits may also cause individuals with ASD to be more vulnerable to interrogation techniques and other aspects of the legal system. Due to the increased level of vulnerability as well as…

  20. Mycobacterium tuberculosis population structure and molecular epidemiological analysis in Sucre municipality, Miranda state, Venezuela.

    Science.gov (United States)

    Patiño, Margareth A; Abadía, Edgar; Solalba Gómez; Maes, Mailis; Muñoz, Mariana; Gómez, Daniela; Guzmán, Patricia; Méndez, María Victoria; Ramirez, Carmen; Mercedes, España; de Waard, Jacobus; Takiff, Howard

    2014-12-01

    Sucre municipality is a large, densely populated marginal area in the eastern part of Caracas, Venezuela that consistently has more cases of tuberculosis than other municipalities in the country. To identify the neighborhoods in the municipality with the highest prevalence of tuberculosis, and determine whether the Mycobacterium tuberculosis strain distribution in this municipality is different from that previously found in the western part of Caracas and the rest of Venezuela, we collected data on all tuberculosis cases in the municipality diagnosed in 2005-6. We performed two separate molecular epidemiological studies, spoligotyping 44 strains in a first study, and spoligotyping 131 strains, followed by MIRU-VNTR 15 on 21 clustered isolates in the second. With spoligotyping, the most common patterns were Shared International Type SIT17 (21%); SIT42 (15%); SIT93 (11%); SIT20 (7%); SIT53 (6%), a distribution similar to other parts of Venezuela, except that SIT42 and SIT20 were more common. MIRU-VNTR 15 showed that six of seven SIT17 strains examined belonged to a large cluster previously found circulating in Venezuela, but all of the SIT42 strains were related to a cluster centered in the neighborhoods of Unión and Maca, with a MIRU-VNTR pattern not previously seen in Venezuela. It appears that a large percentage of the tuberculosis in the Sucre municipality is caused by the active transmission of two strain families centered within distinct neighborhoods, one reflecting communication with the rest of the country, and the other suggesting the insular, isolated nature of some sectors.

  1. Miranda en la miseria. Acción cine y televisión.

    OpenAIRE

    Eguren, Daniel

    2006-01-01

    : Editorial: El emblemático número tres. Por: Ruiz Calderón, Humberto Especial Jóvenes, alcohol y ¿salud?. Venezuela, penoso liderazgo: consumo de licor y muertes en percances viales. Por: González, Silvia Lidia ¡Cuidado! ebrio al volante. Artículo Bebiendo el futuro. Por: Morales, Nelson Guía Web Sitios sobre alcoholismo en Internet. Historias El rostro más especial de Venezuela. Jacqueline Saburido. Por: González, Silvia Lidia Hora libre...

  2. Notes on the distribution of the genus Pseudopaludicola Miranda-Ribeiro, 1926 (Anura: Leptodactylidae) in Paraguay

    OpenAIRE

    Lavilla, Esteban; Caballero-Gini, Andrea; Bueno-Villafañe, Diego; Cardozo, Darío

    2016-01-01

    Four species of Pseudopaludicola, Pseudopalud­icola boliviana, P. falcipes, P. mystacalis and P. ternetzi, are usually cited for Paraguay. However, after analyzing 407 specimens assigned to this genus in herpetological collections of the country, we conclude that there are no specimens of P. falcipes in Paraguayan collections or vouchers cited in the literature, and almost all individuals referred to P. ternetzi are most probably P. ameghini. At the same time, a recently described species, P....

  3. Corporación Miranda, en Morón, Venezuela

    Directory of Open Access Journals (Sweden)

    Bornhorst, Dirk

    1969-10-01

    Full Text Available This corporation manufacturers parts and accessories for the motor industry. The factory consists of three naves, a building with the bar and entrance control, and the pressing tools building. All the buildings were designed on a 5 x 5 m module, and allowance was made for possible extensions. Naves 1, 2 and 3 have hyperbolic paraboloid roof elements, of 10 x 10 m; the bar is covered with a 5 x 5 m inverted paraboloid. The pressing tools building has a metalic structure, and is separated from the other buildings to protect them from the vibrations produced by the pressing operations. Both the chosen site, the type of construction and other details have been carefully studied, and the overall result is correspondingly successful.Dedicada a la producción de piezas y accesorios para la industria automotriz, consta de: tres naves, el cuerpo de bar-control de entrada y el edificio-prensa. Todos los edificios fueron diseñados y modulados partiendo de un módulo de 5 X 5 m, previendo la posibilidad de futuras ampliaciones de cada unidad. Las naves 1, 2 y 3 han sido construidas a base de paraboloides hiperbólicos de 10 X 10 m ; el bar, con paraboloides invertidos de 5 X 5 m; y el edificio-prensa, a base de estructura metálica, y alejado de los demás, a fin de evitar las molestias que producirían las fuertes vibraciones causadas por la prensa. Tanto el emplazamiento elegido como la construcción y demás detalles han sido estudiados cuidadosamente, deduciéndose de ello el éxito plástico y el buen tratamiento obtenidos.

  4. High Lassa Fever activity in Northern part of Edo State, Nigeria: re ...

    African Journals Online (AJOL)

    for the control of lassa fever in Nigeria. [Afr J Health Sci. 2010 ... by the Centre for Disease Control (CDC), Atlanta,. USA, in 1969 ... malaria, typhoid, yellow fever, upper respiratory tract infection and other ..... Health Policy Plan. 2006; 21: 411.

  5. Edo Journal of Counselling - Vol 4, No 1-2 (2011)

    African Journals Online (AJOL)

    The Mediating Impact of Personality and Socio-Economic Status in the Treatment of Stress in Adolescents · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT ... Fostering Adolescents' Interpersonal Behaviour: An Empirical Assessment of Enhanced Thinking Skills and Social Skills Training · EMAIL FREE FULL TEXT ...

  6. Jurisprudenţa CtEDO în cazul regimurilor separatiste

    Directory of Open Access Journals (Sweden)

    Mitrofan Livia

    2015-12-01

    Full Text Available The territorial separatism, we refer below, may be saw as an illegitimate movement, as well legitimate in some cases. Separatist movement will always be illegitimate for the state on which territory it is happening in contradiction with the state’s official legislation. The issue consists in the state power’s legality and the compliance of its policy with law and morality principles. Thus, the separatism may, morally, be legitimate and commiserate poor nations dominated by strong nations, and to justify itself as an adequate reaction to the state’s actions through the realization of the historical right to self determination.

  7. Rozvoj kultury v malé obci Středočeského kraje

    Czech Academy of Sciences Publication Activity Database

    Vojtíšková, Kateřina

    2013-01-01

    Roč. 5, č. 2 (2013), s. 143-160 E-ISSN 1803-8220 R&D Projects: GA MK DF11P01OVV032 Keywords : local culture * regional development * citizen participation Subject RIV: AE - Management ; Administration http://acpo.vedeckecasopisy.cz/publicFiles/00462.pdf

  8. Physio-Chemical Analysis of Industrial Effluents in parts of Edo ...

    African Journals Online (AJOL)

    Journal of Applied Sciences and Environmental Management. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 18, No 2 (2014) >. Log in or Register to get access to full text downloads.

  9. study of the nature of urban flood in benin city, edo state; nigeria

    African Journals Online (AJOL)

    DJFLEX

    In consonance with dominance of the clay soil in the study area, bulk density is high .... Table1: Mean Monthly/Annual Rainfall of Benin City Region ( 1997 - 2007) in Millimeters ..... There is good network of drainage network ... In the case of the Uselu-Ugbowo road (an ... poor integrations of landuse development control with.

  10. Study of the nature of urban flood in Benin City, Edo State; Nigeria ...

    African Journals Online (AJOL)

    In consonance with dominance of the clay soil in the study area, bulk density is high. It is therefore concluded that the soil condition is a major determinant of flooding in Benin City. The flooding problems has resulted in traffic congestion and lost of man-hours giving rise to lopsided concentration of vehicular traffic.

  11. Evaluation of the glycemic indices of three commonly eaten mixed meals in Okada, Edo State.

    Science.gov (United States)

    Omage, Kingsley; Omage, Sylvia O

    2018-01-01

    People do not generally eat single or individual meals; rather they eat mixed meals, consisting of two or more individual meals. These mixed meals usually have glycemic indices which differ from that of the individual food type. This study was aimed at evaluating the glycemic indices of three commonly consumed mixed meals eaten in Okada; rice and beans (test food 1), rice and plantain (test food 2), beans and plantain (test food 3). Two hundred and forty healthy subjects aged between 18 and 30 participated in this study. They were randomized into three groups of eighty persons each, and fed with the standard food (50 g glucose) on day one and one of the test foods on day two, after an overnight fast. Blood samples were taken at 0, 30, 60, 90, and 120 min after the food had been eaten. The results showed that the Glycemic Index (GI) values for the test foods were high: 86.60 (test food 1), 89.74 (test food 2), 86.93(test food 3). The incremental increase in blood glucose was monitored and calculated for each food and when compared with that of the standard food (glucose), there was significant differences ( p   .05). The results from this study indicated that the GI of the mixed meals was affected by the constituent nutrient and the response is also affected by the proportion of each nutrient. Our findings show that the selected test foods (mixed meals) consumed in Okada have high GI values.

  12. Information and Communication Technologies in Enhancing Learning Ability in Secondary Schools in Edo State, Nigeria

    Science.gov (United States)

    Osagie, Roseline O.

    2012-01-01

    The dismal results of 2011, 2010, 2009, and previous years WAEC and NECO Senior School Certificate Examinations (SSCE) show the pitiable state of education in secondary schools in Nigeria. The youths of today live in a digital age. Web technologies and sites have become an integral part of the youth culture. Today's youths use the web tools to…

  13. Confucian Learning and Literacy in Japan’s Schools of the Edo Period

    Directory of Open Access Journals (Sweden)

    Kristina HMELJAK SANGAWA

    2017-06-01

    Full Text Available With the political stability, economic growth and cultural revitalisation of Japan after its unification by Tokugawa Ieyasu, the educational infrastructure also grew to meet new literacy demands. Governmental schools endowed by the shogunate (Shōheikō and by the domains (hankō, which catered to the upper military class of the samurai, focused on classical Chinese studies, particularly the Neo-Confucian canon taught in kanbun, a style of classical Chinese. Given the prestige of Neo-Confucian Chinese learning and of the kanbun writing style, these were taught also in temple schools (terakoya and private academies (juku that were open to the lower classes, thus contributing to the spread of this particular type of literacy. However, Chinese learning in these schools often involved memorising rather than reading, both because of educational traditions and socio-ideological factors, and also because of the sheer difficulty of reading kanbun, a de facto foreign language. The present article investigates the contrasting implications of Neo-Confucian learning and of the kanbun writing style for the development of education and literacy in Japanese society: while the prestige of Chinese learning contributed to the demand for and development of educational facilities, its complexity also acted as an obstacle to the development of widespread functional literacy.

  14. Algunas consideraciones acerca de la superficie foliar del viñedo

    OpenAIRE

    Lissarrague Garcia-Gutierrez, Jose Ramon

    2011-01-01

    Las hojas representan el centro básico de la actividad de la vid, en ellas se realizan múltiples funciones que van desde las funciones fisiológicas más conocidas entre las que destaca la fotosíntesis, a través de la cual las hojas captan de la atmosfera la energía luminosa, que trasforman en energía química para trasformar el anhídrido carbónico (CO2) atmosférico en hidratos de carbono, en azúcares, que son el primer eslabón de todas las cadenas metabólicas de la planta, azúcares que la vid u...

  15. The English and the Control of Christianity in the Early Edo Period

    OpenAIRE

    SCREECH, Timon

    2012-01-01

    The history of Japan's de-Christianization in the early seventeenth century has often been told, but is here re-examined using new data, much of it previously unknown. The turn against Catholicism is variously attributed to fear of invasion or cultural difference, but most scholars agree the Dutch played little role, seldom engaging with theological issues. Neglected has been the activities of the English, whose East India Company was in Japan 1613-1626. Investigation of its records reveal...

  16. Feeding practices in late infancy in Benin City, Edo State, Nigeria

    African Journals Online (AJOL)

    2015-05-13

    May 13, 2015 ... mum feeding in early infant feed- ing same ... basis of equal distribution of 68,748 women of child bearing age ... used by the Expanded Programme on Immunization. (EPI).14 All ..... Mothers Attitudes and Practices;. December ...

  17. Středočeská integrovná doprava

    OpenAIRE

    Faltýnek, Jan

    2012-01-01

    The objective of this Bachelor's Thesis is to describe integrated transport systém in the Central Bohemia Region, Kladno district. Special attention will be given to the Central Bohemian integrated transport systém. The thesis is divided into theoretical and practical part. In the theoretical part are explained basic terms and principles of integrated transport systems and public transport. The practical part focuses on area of Kladno district the and local dominant transport company CSAD MHD...

  18. Evaluation of the glycemic indices of three commonly eaten mixed meals in Okada, Edo State

    OpenAIRE

    Omage, Kingsley; Omage, Sylvia O.

    2017-01-01

    Abstract People do not generally eat single or individual meals; rather they eat mixed meals, consisting of two or more individual meals. These mixed meals usually have glycemic indices which differ from that of the individual food type. This study was aimed at evaluating the glycemic indices of three commonly consumed mixed meals eaten in Okada; rice and beans (test food 1), rice and plantain (test food 2), beans and plantain (test food 3). Two hundred and forty healthy subjects aged between...

  19. Fluoride Levels of Major Sources of Drinking Water in Edo State of ...

    African Journals Online (AJOL)

    ... also strengthens the enamel thereby making the teeth generally more resistant to dental caries. The incidence of dental caries has increased in Nigeria today due to dietary changes and so it becomes important that means of enhancing resistance to tooth decay are put in place to check this down ward trend in oral health.

  20. Regionální gastronomie ve Středočeském kraji

    OpenAIRE

    Nekvasilová, Šárka

    2011-01-01

    The main aim of this thesis is to examine the implementation of the project Czech Specials in practice and analyze offer of regional specialities in the Central Bohemian region through the comparison of the product of certified and non-certified restaurants. The theoretical part deals with the importance of restaurant services, gastronomy, gastronomic tourism, quality, and marketing. The content of the work is also characteristic of the region of Central Bohemia, the historical development of...

  1. Edo N'ekue Phenomenon: A Study in Pre-colonial Benin Imperialism ...

    African Journals Online (AJOL)

    Most societies in pre-colonial times experienced one form of relationship or the other with their neighbours. More often than not, these relationships came in form of commercial, cultural and political relations. Characteristic of these relations were intermarriages, linguistic borrowings and other interactions dictated by the ...

  2. Larval morphology of Hoplias lacerdae Miranda Ribeiro, 1908 (Characiformes, Erythrinidae, from hatching to metamorphosis, related to exogenous food capture ability

    Directory of Open Access Journals (Sweden)

    Cláudia Maria Reis Raposo Maciel

    2009-09-01

    Full Text Available For the accomplishment of this work, 510 specimens of Hoplias lacerdae were used from one to 30 days after hatching, with the objective of studying the mesoscopic morphological characteristics that enable this species, in the initial phases of its development, to present adaptations for movement and the capture of exogenous food. The yolk sac larvae at 11 days after hatching have the potentiality to capture exogenous food, i.e. prey, even before the total yolk absorption which happens at 12 days, presenting in this phase: an open mouth at one day after hatching, displaying the terminal position at four days; notochord flexion, that takes place at seven days and provides greater efficiency of movement; pectoral fins, also developed at seven days, which facilitate its balance and direction in the water column; formation of the dorsal and anal fins at eight days and the pelvic ones, at 11 days.

  3. NCBI nr-aa BLAST: CBRC-CBRE-01-1302 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-1302 gb|ABJ74629.1| stan [Drosophila miranda] gb|ABJ74630.1| stan [Drosophila miranda...] gb|ABJ74631.1| stan [Drosophila miranda] gb|ABJ74632.1| stan [Drosophila miranda] gb|ABJ746...33.1| stan [Drosophila miranda] gb|ABJ74634.1| stan [Drosophila miranda] gb|ABJ74635.1| stan [Drosophila miranda...] gb|ABJ74637.1| stan [Drosophila miranda] gb|ABJ74638.1| stan [Drosophila miranda...] gb|ABJ74641.1| stan [Drosophila miranda] gb|ABJ74642.1| stan [Drosophila miranda] gb|ABJ74643.1| stan [Drosophila miranda

  4. Relationship between Broken Homes and Academic Achievement of Secondary School Students in Oredo Local Government Area of Edo State, Nigeria

    Science.gov (United States)

    Alika, Henrietta Ijeoma; Edosa, Ogboro Samson

    2012-01-01

    The study investigated the relationship between broken homes and academic achievement of students. Three research hypotheses were formulated to guide the study. The study was correlational because the study sought to establish the extent of relationship between broken homes and academic achievement. The statistical method used in analyzing the…

  5. Dimensions of Cognitive Dissonance and the Level of Job Satisfaction among Counsellors in Delta and Edo States, Nigeria

    Science.gov (United States)

    Oduh, William Akporobaroh

    2016-01-01

    This study examined the dimensions of cognitive dissonance and the extent to which cognitive dissonance could influence the level of job satisfaction of guidance counsellors. The study was guided by three research questions and one null hypothesis. The design of the study was correlational survey. The population of the study was 158 practising…

  6. Tvorba cykloturistického zájezdu ve Středočeském kraji

    OpenAIRE

    Weissová, Zuzana

    2009-01-01

    The aim of the thesis was to prepare a bike tour in the Central Bohemia region. The first chapter is focused on the basic terms in the field of cycling tourism and it also describes the situation of the cycling infrastructure in the Czech Republic. The second chapter is devoted to theoretic description of inclusive tour preparation. The aplied part of the thesis is represented by the third chapter, which is devoted to the own bike tour. It contents general information about the bike tour, the...

  7. Human immunodeficiency virus (HIV) seropositivity and hepatitis B surface antigenemia (HBSAG) among blood donors in Benin city, Edo state, Nigeria.

    Science.gov (United States)

    Umolu, Patience Idia; Okoror, Lawrence Ehis; Orhue, Philip

    2005-03-01

    Human Immunodeficiency Virus and Hepatitis B virus are blood borne pathogens that can be transmitted through blood transfusion and could pose a huge problem in areas where mechanisms of ensuring blood safety are suspect. This study became necessary in a population where most of the blood for transfusion is from commercial blood donors. A total of 130 donors comprising 120 commercial donors and 10 voluntary donors were tested for antibodies to human immunodeficiency virus and hepatitis B surface antigen in Benin city using Immunocomb HIV - 1 and 2 Biospot kit and Quimica Clinica Aplicada direct latex agglutination method respectively. Thirteen (10%) samples were HIV seropositive and 7(5.8%) were HBsAg positive. The age bracket 18 - 25years had the highest numbers of donors and also had the highest number of HBsAg positive cases (7.8%) while the age group 29 - 38years had highest number of HIV seropositive cases. High prevalence of HIV antibodies and Hepatitis B surface antigen was found among commercial blood donors. Appropriate and compulsory screening of blood donors using sensitive methods, must be ensured to prevent post transfusion hepatitis and HIV.

  8. Jurisprudența CtEDO în cazuri de susținere a regimurilor separatist

    Directory of Open Access Journals (Sweden)

    Şonţu Felicia

    2015-07-01

    Full Text Available In article below are elucidated the problems regarding the implementation of CEDO provisions on the separatist regimes territory, determination of the state that has the jurisdiction on the territory controlled by a separatist regime and regarding the extent of its international liability, in case it is part of the Convention. Th e article reveals ECHR vision regarding the acts legitimacy of separatist regimes and analyze the requests addressed to the ECHR and the perspective of their solving. In article is approached the possibility that, de facto, a separatist regime is undergoes to the Convention authority, being non-equivalent with its recognition as state with international statute but an understanding which means that CoE states member can exercise the legitimate political authority, in case the separatist regime acts incompatible with the human rights guaranteed by the Convention.

  9. Between copyright and privacy : The experience of ethnographic research ethics in the 20th century Lithuania / Irena Regina Merkienė ; tõlk. Miranda Navickienė

    Index Scriptorium Estoniae

    Merkienė, Irena Regina

    2002-01-01

    Eetilistest probleemidest etnograafilise informatsiooni koguja ja informandi vahel, autoriõigusest ja moraalsetest tõekspidamistest. Ettekanne konverentsilt - Eesti Rahva Muuseum. Konverents 42 : (2001 : Tartu)

  10. Un programa iconológico perdido, recuperado : pinturas de la iglesia nueva de Guadalupe, de Juan García de Miranda

    Directory of Open Access Journals (Sweden)

    María Teresa Jiménez Priego

    1992-01-01

    Full Text Available La iglesia nueva de Guadalupe constituyó uno de ios conjuntos más reveladores, desde el punto de vista artístico, programático y significativo, de la influencia y ejercicio del patrocinio de un mecenas. Este conjunto es creado bajo los auspicios económicos e intelectuales de don Pedro Ñuño Manuel Florentín Colón y Portugal, Duque de Veragua, Almirante y Adelantado de las Indias y virrey de Navarra, Sicilia y Cerdeña, además de ser ministro del monarca Felipe V.

  11. Early Detection of Cervical Intraepitelial Neoplasia in a Heterogeneos Group of Colombian Women Using Electrical Impedance Spectroscopy and the Miranda-López Algorithm

    International Nuclear Information System (INIS)

    Miranda, David A; Corzo, Sandra P; González-Correa, Carlos-A

    2012-01-01

    Electrical Impedance Spectroscopy (EIS) allows the study of the electrical properties of materials and structures such as biological tissues. EIS can be used as a diagnostic tool for the identification of pathological conditions such as cervical cancer. We used EIS in combination with genetic algorithms to characterize cervical epithelial squamous tissue in a heterogeneous sample of 56 Colombian women. All volunteers had a cytology taken for Papanicolau test and biopsy taken for histopathological analysis from those with a positive result (9 subjects). ROC analysis of the results suggest a sensitivity and specificity in the order of 0.73 and 0.86, respectively.

  12. Analysis of the socio political and environmental conflict about the use of La laguna park public spaces in Nueva Casarapa housing development; Miranda, Venezuela

    International Nuclear Information System (INIS)

    Zerpa, Mildred de

    2013-01-01

    Nueva Casarapa is an integral urban complex conceived under the concept of city. This complex has open spaces, shopping malls, green and public spaces, that are under the care of the owners, and a central natural park known as La Laguna. In 2009, starts a controversy that could become in a political environmental conflict with implications on the Municipio Plaza's government, because of the resolution of using the green areas of the park for a low price grocery market. This resolution was taken unilaterally by the Mayors' Office, not consulting the actors living in the complex. Besides the conflict for the use of this public space located inside of a private urban complex, there are discussions about which should be the institution to manage the resources obtained for the rent of the meeting spaces and who should be responsible of the maintenance staff. In function of this, it is possible to observe the rising of some conflicts between the different organizations and the users of the park that could lead to its damage.

  13. The male reproductive strategy of a deep-sea squid : sperm allocation, continuous production, and long-term storage of spermatophores in Histioteuthis miranda

    NARCIS (Netherlands)

    Hoving, Hendrik Jan T.; Lipinski, Marek R.; Dam, Lammertjan

    2010-01-01

    Squid are semelparous organisms. Much of what we know about squid reproduction relates to females, because few studies have addressed males and, although males are similarly challenged by semelparity, it remains virtually unknown what tactics squid have evolved to allocate sperm to spermatophores.

  14. Late Holocene vegetation dynamics and lake geochemistry at Laguna Miranda, XI Region, Chile Dinámica vegetaciónal y geoquímica lacustre del Holoceno tardío en Laguna Miranda, XI Región, Chile

    Directory of Open Access Journals (Sweden)

    S. G. HABERLE

    2000-12-01

    Full Text Available Palynological and geochemical analysis of late Holocene lake sediments and dendrochronological analysis of Pilgerodendron in a volcanically active region of southern Chile reveal the long-term impact of a series of tephra fall events and tectonic activity on lake sedimentation and local vegetation. An upper 0,75 m core overlaps with a 4,35 m long Livingstone piston core to give a 4,60 m long sediment record, extending back to 4800 yr BP. Geochemical data shows the shift from allogenic dominance to authigenic and biogenic dominance as waterlogged soils developed within the catchment. This is presumed to have occurred under the influence of continued addition of nutrients to the catchment from tephra deposition and the associated high sedimentation rates. The palynological record from this site is dominated by Nothofagus dombeyi-type and Filicales. The most prominent changes in the pollen record, however, are the gradual decline in Podocarpus nubigena pollen throughout the last 4800 yr; the appearance and increase of Gramineae pollen during the past 2100 yr; and the rapid increase in the pollen of Pilgerodendron uviferum within the past 300-400 yr. Pilgerodendron tree-ring analysis and the pollen results over the last 400 years show that the most recent expansion of Pilgerodendron at the northern and eastern margins of this site is a response to either, periodic tectonic induced watertable changes, or is part of a long-term trend in gymnosperm growth around a shallowing lake margin. The decline of shade-intolerant trees such as Weinmannia and Podocarpus within a Nothofagus-rich forest community towards an increased presence of Pilgerodendron and Gramineae (likely Chusquea bamboo, that began over 2100 yr BP, may have been due as much to autogenic processes such as a change in the disturbance regime resulting in the development of waterlogged soils, rather than to an episode of climate change. It is important to recognise the potential effects of autogenic processes that may result from disturbance such as volcanic/tectonic activity in reconstructing past vegetation dynamics from pollen recordsAnálisis palinológicos y geoquímicos de sedimentos lacustres del holoceno tardío y análisis dendrocronológicos de Pilgerodendron uviferum en una zona volcánica activa del sur de Chile revelan el impacto a largo plazo de diversas caidas de tefra y actividad tectónica en la sedimentación lacustre y la vegetación de la zona. Una sección sedimentaria superior de 0,75 m traslapa una columna de pistón Livingstone de 4,35 m de largo para dar un registro de sedimentación de 4,60 m de longitud extendiéndose 4800 años AP. Datos geoquímicos muestran el cambio de dominancia alogénica a dominancia autígena y biogénica según se formaban los terrenos anegadizos dentro de la cuenca. Se presume que esto pudo producirse bajo la influencia de la llegada constante de nutrientes a la cuenca del lago procedentes del depósito de materias volcánicas conjuntamente con una alta sedimentación. El registro palinológico de este lugar está dominado por el tipo Nothofagus dombeyi y Filicales. Los cambios más notables que registra el polen son, no obstante, la declinación gradual del polen Podocarpus nubigena durante los últimos 4800 años; la aparición y aumento del polen Geamineae durante los pasados 2100 años; y el rápido aumento del polen Pilgerodendron uviferum en los últimos 300 a 400 años. El análisis de los anillos de leño de Pilgerodendron y los resultados que da el polen en los últimos 400 años muestran que la expansión más reciente de Pilgerodendron en las márgenes norte y este del lugar es una respuesta, bien a cambios periódicos de la capa freática por interacción tectónica, o es parte de un lento proceso de desarrollo de gimnospermas en las márgenes poco profundas del lago. La disminución de Weinmannia y Podocarpus, hace alrededor de 2100 años AP, se podría deber a procesos autogénicos resultando en el desarrollo de terrenos anegadizos, o a cambios en el régimen de perturbación, más bien que a un episodio de enfriamiento climático. En la reconstrucción de la dinámica de vegetaciones pasadas y partiendo de los registros del polen, es importante reconocer los efectos potenciales de los procesos autogénicos que pueden derivarse de perturbaciones tales como actividad volcánico/tectónica

  15. Čtyři náměty pro středoškolské semináře matematiky

    OpenAIRE

    Nečasová, Marie

    2009-01-01

    The diploma thesis describes four less known mathematical topics, which could be part of mathematical seminars at the secondary schools or mathematical camps, 1 Hippocrates lunes, Golden section, tangram and Columbus egg. Each topic is elaborated into a didactic material, which should function as a source of information for teachers. Two of the topics were trialled with secondary school students, which is dealt with in one of the chapters. The main part of the thesis focuses on the preparatio...

  16. Detection of Fracture Patterns Within the Southern Portion of a Residential Complex (Tepozanes), Los Reyes-La Paz County (Edo. de Mexico)

    Science.gov (United States)

    Chavez, R. E.; Arango, C.; Tejero, A.; Cifuentes, G.; Hernandez, E.

    2008-12-01

    Most of the urban zone within the Valley of Mexico is built on top of the sediments of the ancient lakes of Chalco, Xochimilco, Mexico, Texcoco, Xaltocan and Zumpango. The sediments that cover this great valley are mainly composed by highly saturated clay-sandy materials; which offer a weak resistance to the constructions built on top. In addition, the increasing need of water supply for the population living in the valley (~22 million inhabitants) has weakened the main groundwater aquifers. This has lead to a differentiated subsidence and collapse of buildings, habitation units and roads. These effects put in a serious risk the inhabitants and the infrastructure of the city. As an example, we present a case of an area located in a densely populated zone, within a low-income residential complex denominated Tepozanes. This is located in the Los Reyes-La Paz County (Mexico State), towards the southeastern portion of the Valley of Mexico. The area is geologically limited by the Chimalhuacan Hill to the N, by the Santa Catarina volcanic range to the S. The previously mentioned effects are evident in the constructions of some buildings, where an exposed fracture is found in the NE-SW direction. This feature is affecting the structure of one of them in the residential complex, where the fracture runs underneath. A geophysical study was proposed to characterize the subsoil and to define the fracturing patterns in the zone. The electrical resistivity tomography (ETR) method employing the capacitive and galvanic modes was used to define the fracturing patters and the position at depth of the saturated layers, which might affect the Residential buildings. As a complement, GPR (Ground Penetrating Radar) profiles were carried out on the same profiles to correlate the information obtained from the ETR capacitive method which has a better resolution in the shallower zone. The computed results show that the buildings foundations were set on top of a high resistivity layer (~1000 Ohm-m), with variable thickness (5 m to 20 m). This layer depicts important discontinuities that can be associated to fractures. Low resistivity sediments lie on top of the resistive horizon. This feature corresponds to saturated sediments (clays and sands) that due to the water flow tend to form areas with low mechanical resistance and vey high compressibility, producing subsidence, following the fracture pattern in the resistive layer. The GPR study defined the presence of small fractures to depths ranging between 1 m and 3 m, which can be correlated with the information provided by the capacitive method. A subsidence map was produced for the studied zone. The fracture pattern is found in the SW-NE direction, affecting the residential complex at the surrounding. Three exploratory wells were drilled within the studied area. The stratigraphy obtained correlated well with the electrical models.

  17. Peer education: The effects on knowledge of pregnancy related malaria and preventive practices in women of reproductive age in Edo State, Nigeria

    Directory of Open Access Journals (Sweden)

    Al Atabbi Hind

    2011-08-01

    Full Text Available Abstract Background There is limited uptake of measures to prevent malaria by pregnant women in Nigeria which is often related to the lack of knowledge on Malaria in Pregnancy (MIP and its effects on mother and foetus. This study, explored peer to peer education as a tool in raising knowledge of MIP among women of child bearing age. Methods 1105 women of child bearing age were interviewed in their households using a structured questionnaire about their knowledge of malaria in general, MIP and use of preventive measures. Thereafter, a peer education campaign was launched to raise the level of knowledge in the community. The interviews were repeated after the campaign and the responses between the pre- and post-intervention were compared. Results In the pre-assessment women on average answered 64.8% of the question on malaria and its possibility to prevent malaria correctly. The peer education campaign had a significant impact in raising the level of knowledge among the women; after the campaign the respondents answered on average 73.8% of the questions correctly. Stratified analysis on pre and post assessment scores for malaria in general (68.8 & 72.9% and MIP (61.7 & 76.3% showed also significant increase. Uptake of bed nets was reported to be low: 11.6% Conclusion Peer education led to a significant increase in knowledge of malaria and its prevention but we could not asses its influence on the use of preventive measures.

  18. Kriminalita dětí a mládeže ve Středočeském kraji

    OpenAIRE

    Hykšová, Jana

    2013-01-01

    This bachelor thesis deals with some knowledge of child delinquency and crime statistics to determine the fair youth in the Central Region. Mention where is the beginning of child delinquency. I used the statistics of the Police of the Czech Republic, where the actual number of children and juvenile delinquents. Analyzing juvenile delinquency and children in 2000 - 2012 and describes current developments. Suggesting effective forms of assistance to children from single-parent families, as wel...

  19. COMPETITIVIDAD DE LA HIGUERILLA (Ricinus communis) PARA BIOCOMBUSTIBLE EN RELACIÓN A LOS CULTIVOS ACTUALES EN EL EDO. DE OAXACA, MÉXICO

    OpenAIRE

    Rodriguez Hernandez, Rafael; Zamarripa Colmenero, Alfredo

    2013-01-01

    Before the current problem of global warming by high emissions of CO to the atmosphere, as 2 well as the scarcity and cost of fossil energy such as oil, coal and gas, has become important search and use of alternate sources of fuel. The main plant species that can provide biofuels are cane sugar, sorghum, corn, among others for ethanol; soybean, sunflower and groundnut, among others for biodiesel; However the use of food grains has caused higher prices of food, so it is required to seek alter...

  20. ¿Es posible mejorar la eficiencia en el uso del agua de un viñedo mediante un acolchado orgánico del suelo?

    OpenAIRE

    López Urrea, R.; Montoro, A; Martínez, L.; Mañas, F.; Sánchez, J.M.; Intrigliolo, D.S

    2016-01-01

    El objetivo de este trabajo fue evaluar el efecto que un acolchado orgánico del suelo (restos de poda) puede tener sobre la evapotranspiración del cultivo (ETc) de la vid con el fin de mejorar la eficiencia en el uso del agua. El estudio se realizó durante la campaña de 2015 en la finca “Las Tiesas”, Albacete (España). Las medidas se llevaron a cabo en un lisímetro monolítico de pesada ubicado en el centro de una parcela de vid (Vitis vinífera L., cv. Tempranillo) de 1 ha de su...

  1. Bezdomovství v Praze a ve větších městech Středočeského kraje

    Czech Academy of Sciences Publication Activity Database

    Mikeszová, Martina

    2010-01-01

    Roč. 8, č. 5 (2010), s. 3-5 ISSN 1214-1720 R&D Projects: GA MMR WD-05-07-3 Institutional research plan: CEZ:AV0Z70280505 Keywords : housing * regions * homelessness Subject RIV: AO - Sociology, Demography http://www.socioweb.cz/upl/editorial/download/179_soc.web._05-2010%20final!.pdf

  2. Chemie potravin a výživa ve středoškolské výuce chemie

    OpenAIRE

    Třeštíková, Tereza

    2017-01-01

    This PhD thesis deals with a topic of food chemistry and nutrition in secondary school education in chemistry lessons. The theoretical part summarizes significance and evaluation of textbooks and furthermore it focuses on modern approaches in chemistry lessons with the main focus on interactive boards. The methodological part deals with the analysis of framework educational programs, textbook analysis, questionaire surveys and creation of teaching materials. The practical part of this thesis ...

  3. Tabák, alkohol a nelegální drogy mezi středoškoláky

    Czech Academy of Sciences Publication Activity Database

    Miovský, Michal; Urbánek, Tomáš

    2002-01-01

    Roč. 46, č. 2 (2002), s. 165-177 ISSN 0009-062X Institutional research plan: CEZ:AV0Z7025918 Keywords : school studies * drug use * tobacco Subject RIV: AN - Psychology Impact factor: 0.190, year: 2002

  4. EL CULTIVO DEL VIÑEDO COMO RECURSO TURÍSTICO CULTURAL: EL CASO DE LA GERIA (LANZAROTE. ISLAS CANARIAS, ESPAÑA

    Directory of Open Access Journals (Sweden)

    Alejandro González Morales

    2015-01-01

    Full Text Available La agricultura es un sector económico importante pero actualmente en regresión. El paisaje agrícola constituye un patrimonio que puede ser puesto en valor como recurso turístico, de manera que ambas actividades, agricultura y turismo, se verían mutuamente beneficiadas de esa relación. El presente trabajo aborda la evolución y situación actual del sector vitivinícola, su producción y sistemas de cultivo, distribución espacial y expectativas de futuro. Asimismo, se pone en relación el paisaje vitivinícola con la actividad turística y el uso que del primero se está llevando a cabo, y aún puede potenciarse, como atractivo en rutas y actividades de ocio para los visitantes de Lanzarote.

  5. Peer education: the effects on knowledge of pregnancy related malaria and preventive practices in women of reproductive age in Edo State, Nigeria

    NARCIS (Netherlands)

    Mens, Petra F.; Scheelbeek, Pauline Fd; Al Atabbi, Hind; Enato, Ehijie Fo

    2011-01-01

    There is limited uptake of measures to prevent malaria by pregnant women in Nigeria which is often related to the lack of knowledge on Malaria in Pregnancy (MIP) and its effects on mother and foetus. This study, explored peer to peer education as a tool in raising knowledge of MIP among women of

  6. Peer education: The effects on knowledge of pregnancy related malaria and preventive practices in women of reproductive age in Edo State, Nigeria

    NARCIS (Netherlands)

    Mens, P.F.; Scheelbeek, P.F.D.; Al Atabbi, H.; Enato, E.F.O.

    2011-01-01

    Background: There is limited uptake of measures to prevent malaria by pregnant women in Nigeria which is often related to the lack of knowledge on Malaria in Pregnancy (MIP) and its effects on mother and foetus. This study, explored peer to peer education as a tool in raising knowledge of MIP among

  7. 92 INSULIN RESISTANCE: CAUSES AND METABOLIC ...

    African Journals Online (AJOL)

    drclement

    2009-12-01

    Dec 1, 2009 ... Edo State Institute of Technology and Management. Usen, Edo State ... type 2 diabetes mellitus. The cause of the vast ... Insulin (molecular mass 6000D) consists of 51 amino acids .... Experimental Biology and. Medicine 2004 ...

  8. WEST AFRICAN JOURNAL OF MEDICINE

    African Journals Online (AJOL)

    user1

    Departments of *Medicine, University of Benin Teaching Hospital, Benin City, Edo State, †Medicine, College of Health Sciences,. Benue State University, Makurdi, Benue State, Nigeria. *Correspondence: Dr Andrew Edo, PO BOX 10458, Ugbowo, Benin City, Edo State. E-mail: osayumen@yahoo.com. Tel No.

  9. Análisis prospectivo del conflicto político ambiental, sobre el uso del espacio público Parque La Laguna, localizado en la Urbanización Nueva Casarapa, Estado Miranda.Venezuela

    Directory of Open Access Journals (Sweden)

    Mildred Zerpa

    2013-06-01

    Full Text Available Nueva Casarapa, es un complejo urbanístico integral concebido bajo el concepto de ciudad. Posee espacios abiertos, centros comerciales, espacios verdes y públicos cuidados por los propios habitantes y un parque central conocido como La Laguna. En 2009 comenzó una polémica que podría convertirse en conflicto socio natural con implicaciones en la gestión integral de riesgo del Municipio Plaza, por la incertidumbre acerca de cuál grupo es el más indicado para administrar y gestionar el parque La Laguna.

  10. Reseña de Libro: Relatos, Himnos y Camiseta. Clubes deportivos y vida barrial en Quinta Normal. Miranda, D., Jofré, N., Araneda, G. Y González, R. (2014. Editorial Victorino Laines: Santiago, Chile.

    Directory of Open Access Journals (Sweden)

    Carlos Vergara Constela

    2015-07-01

    Full Text Available RELATOS, HIMNOS Y CAMISETAS es una obra que, como señala en su contratapa, pretende “dar cuenta de la historia local. O en mejores términos, al menos, para nosotros, contar los mecanismos de sociabilidad popular en torno a instituciones básicas para entender al barrio y a la ciudad: los clubes deportivos”. Para esto, el libro comienza con un capítulo introductorio donde se explica cómo ha sido el proceso de poblamiento de la comuna de Quinta Normal, tomando en cuenta los orígenes sociales de sus primeros pobladores, las características de un paisaje metropolitano periférico, compuesto por matices urbanos y rurales, así como justificaciones de corte teórico que dan cuenta de la relevancia que posee el estudio de los clubes deportivos para entender las tramas sociales y culturales que permiten comprender la articulación de identidades barriales, durante el siglo veinte. Los clubes de barrio han sido siempre espacios de encuentro y socialización. Donde se transmiten y difunden valores, tradiciones y costumbres de generación en generación; ya que dichos espacios permiten la interacción entre niños, jóvenes y adultos. En este sentido, el club de barrio funciona como un espacio nodal en la construcción de identidades colectivas (p.32. El presente estudio entrega una reconstrucción de las historias de siete clubes deportivos de la comuna de Quinta Normal: Asociación de Ciclismo de Quinta Normal, Círculo Atlético Royal, Club de Deportes Población El Polígono, Club Deportivo Victorino Laynez, Club Deportivo, Social y Cultural Población Simón Bolivar, Club Deportivo México y Sus Canciones y Club Deportivo Juan García, donde aparecen elementos pertenecientes a las formas que adquirían las culturas populares, urbanas y deportivas: todas entremezcladas, todas posibilitando comprender las historias de Quinta Normal.Cada capítulo del libro, destinado al estudio de cada uno de los clubes nombrados, privilegia la inmersión en los símbolos, espacios y anécdotas que articulan el nosotros colectivo. Como señala Bernardo Guerrero en uno de los prólogos del libro, el texto posee sutiles guiños a Georg Simmel, puesto que se da preponderancia a los tránsitos, ritualidades y el acontecer, antes que las estructuras sociales más rígidas. A propósito de Simmel, resulta indispensable poder imaginar a Quinta Normal en su primera fase de poblamiento durante la década de mil novecientos treinta (1930. Esta comuna, hoy inserta en medio del espacio metropolitano, constituía la periferia occidente de la capital chilena, por lo tanto era un espacio urbano que colindaba con amplios e “interminables” espacios rurales. Sobre lo anterior, el relato del libro deja entrever que en la fase primaria del poblamiento de Quinta Normal, predominaba un ritmo de vida que fluía de manera más tranquila y más homogénea, lo que se diferencia de la actual vida metropolitana de inicios de siglo XXI. En esa Quinta Normal, la vida social descansaba mucho más en relaciones emocionales profundas y con un mayor conocimiento de las individualidades, que los tránsitos, desplazamientos y rigores pertenecientes a la multitud metropolitana de la cual hoy en día es parte.Luego de esta introducción, donde fueron expuestos de manera breve los contenidos de la obra, quisiera resaltar, por lo menos dos campos de producción intelectual, en las que Relatos, Himnos y Camisetas, realiza un aporte sustantivo: los estudios sociales del deporte y los estudios urbanos.

  11. Desenvolvimento morfológico das larvas de Hoplias lacerdae Miranda Ribeiro, 1908 (Characiformes, Erythrinidae, da eclosão até a metamorfose, relacionado com a capacidade de capturar alimento exógeno

    Directory of Open Access Journals (Sweden)

    Cláudia Maria Reis Raposo Maciel

    2009-06-01

    Full Text Available http://dx.doi.org/10.5007/2175-7925.2009v22n3p103 Para a realização deste trabalho foram utilizados 510 exemplares de Hoplias lacerdae, com um a 30 dias após a eclosão, com o objetivo de estudar as características morfológicas, mesoscópicas, que capacitam essa espécie, nas fases iniciais do seu desenvolvimento, a apresentarem estruturas adaptadas para se locomoverem e capturarem alimento exógeno. As larvas vitelínicas com 11 dias após a eclosão têm potencialidade para capturar alimento exógeno, ou seja, presas, mesmo antes da absorção total do vitelo, o que acontece com 12 dias. Nesta fase apresentam: boca aberta com um dia após a eclosão e posição terminal aos quatro dias; aos sete dias demonstram flexão da notocorda, proporcionando maior eficiência locomotora, bem como apresenta neste período nadadeiras peitorais desenvolvidas, as quais facilitam o equilíbrio e direcionamento na coluna d’água; e aos oito dias visualizou-se a formação das nadadeiras dorsal e anal, porém as nadadeiras pélvicas foram visualizadas aos 11 dias.

  12. COMPARACIÓN DEL NIVEL DE CONOCIMIENTO Y LA APLICACIÓN DE ESTRATEGIAS DE RESOLUCIÓN DE CONFLICTOS ENTRE LOS DOCENTES DEL SECTOR PÚBLICO Y DEL SECTOR PRIVADO DEL ESTADO MIRANDA

    OpenAIRE

    Natalia Castañón; Elena Cristina Hernández; Valeria Stefania Mastrangelo

    2015-01-01

    At present, the violence has been seeping into all aspects of daily life, leaving impact in the field of emotional and social child, which directly affect their development and progress in school. It is then when it comes to the fore the decisive role of teachers in the prevention, control and management of violent situations in the school, which is projected toward the establishment of a culture of peace, so that schools could be environments in which harmony and peaceful coexistence.

  13. Population and feeding structure of Steindachnerina notonota Miranda-Ribeiro, 1937 (Actinopterygii, Characiformes, Curimatidae in Taperoá II dam, semi-arid region of Paraíba, Brazil Estrutura populacional e alimentar de Steindachnerina notonota Miranda Ribeiro, 1937 (Actinopterygii, Characiformes, Curimatidae no Açude Taperoá II, na região do semi-árido da Paraíba, Brasil

    Directory of Open Access Journals (Sweden)

    Ana Karla Araujo Montenegro

    2011-09-01

    Full Text Available AIM: The present study investigated population structure, weight-length relationships, sex ratio and associations between feeding activity and reproductive period, diet and alimentary regime of Steindachnerina notonota at Taperoá II dam, semi-arid region of Paraíba State. METHODS: The region has the lowest pluviometric rates of Brazil. Fishes were collected during six sampling periods (October and December/2005, and March, June, August and October of 2006 encompassing two dry periods, and one rainy period. Cast, seine and gill nets were used to collect the individuals. RESULTS: Throughout the study period 120 individuals were collected, with total length ranging between 2.2 and 10.7 cm and weight between 0.31 and 43.1 g. A recruitment period, identified due to a higher abundance of small individuals in the population, was observed in the beginning of the rainy period of 2006, lasting until the beginning of the dry season. S. notonota showed a negative allometric growth type, i.e., individuals 'elongate' during their development. A significantly higher proportion of females were observed throughout the study period. The relationship between feeding and reproductive activities were not significant, given that individuals showed high feeding rates regardless of the intensity of their reproductive activities. Although the diet of S. notonota comprised several items such as plant debris, eggs, organic matter, phytoplankton, zooplankton, Nematoda, Ostracada, Conchostraca, among others, the most important feeding item was detritus, suggesting a predominant detritivirous feeding habit. CONCLUSIONS: Biological aspects of S. notonota observed in the present study suggest that this species has potential to attain great population sizes, as consequence of both diet and feeding dynamics, as well as its reproductive characteristics and growth type.OBJETIVO: O presente estudo investigou a estrutura da população, a relação peso-comprimento, a razão sexual, as associações entre atividade alimentar e período de reprodução, dieta e regime alimentar de Steindachnerina notonota, no açude Taperoá II, semi-árido paraibano. MÉTODOS: A região tem os menores índices pluviométricos do Brasil. Os peixes foram coletados em seis amostragens (Outubro e Dezembro de 2005, e Março, Junho, Agosto e Outubro de 2006, compreendendo 2 períodos de estiagem e 1 chuvoso. Para a captura dos exemplares, utilizou-se tarrafa, redes de espera e de arrasto. RESULTADOS: Ao longo do estudo capturou-se um total de 120 indivíduos, que mediram entre 2,2 e 10,7 cm de comprimento total e pesaram de 0,31 a 43,1 g. Evidenciou‑se intenso recrutamento durante todo o período estudado, demonstrado pela maior abundância de indivíduos em estádios gonadais “em maturação” (2 e “maduros (3”. S. notonota apresentou um crescimento do tipo alométrico negativo (quando os indivíduos se tornam mais “alongados” durante o seu desenvolvimento, com uma proporção sexual significativamente maior de fêmeas ao longo do período estudado. Observou-se que a relação entre a atividade alimentar e a atividade reprodutiva não foi significativa, tendo em vista que os indivíduos apresentaram alta atividade alimentar independente da intensidade da atividade reprodutiva. Embora a dieta alimentar de S. notonota tenha sido composta por diversos itens, a exemplo de restos vegetais, ovos, matéria orgânica, fitoplâncton, zooplâncton, Nematoda, Ostracoda, Conchostraca, dentre outros, o item de maior importância alimentar foi detritos, indicando um regime alimentar predominantemente detritívoro. CONCLUSÕES: Os aspectos da biologia de S. notonota observados no presente estudo, remetem a uma espécie com potencial para atingir grandes tamanhos populacionais, tanto pela sua dieta e dinâmica alimentar, quanto pelas suas características reprodutivas, e tipo de crescimento.

  14. Soil properties influencing phytoparasitic nematode population on Chilean vineyards Propiedades del suelo que influyen en la población de nematodos fitoparásitos en viñedos de Chile

    Directory of Open Access Journals (Sweden)

    Mario Fajardo P

    2011-06-01

    Full Text Available Lifecycle of phytoparasitic nematode takes place in the rhizosphere, therefore their breeding, parasitism and mobility dynamics are inevitably influenced by the soil-root interaction, A study was performed to evaluate the influence of Vitis rootstocks to some plant parasitic nematodes under different soil conditions. Nematode populations were assessed in Vitis vinifera L. var ‘Chardonnay’ plants grafted on two rootstocks (K5BB, SO4 and ungrafted ‘Chardonnay’ as a control in three diferent alluvial soils in the central zone of Chile. Soils were two Inceptisols of the Casablanca Valley (Valparaíso Region, the first one without soil structure and with a densification zone in depth (S1 and the second one with sandy textural class (S3. A third soil was a Mollisol (S2 more structured than the others, situated on a locality of Melipilla (Metropolitan Region. The soils were characterized physically and morphologically and nematode genera were identified and counted using a dissecting microscope. ‘Chardonnay’ presented the highest population of Meloidogyne spp. on the three soil conditions but only significant in S2 soil. The population of Xiphinema spp. and Mesocriconema xenoplax were not representative enough to relate them with either soil or the different rootstocks. The amount of Meloidogyne spp. was inversely related with the sand content but positively related with the more structured soil. The stepwise regressions resulted useful when relating nematode populations with multiple soil factors.El ciclo de vida de los nematodos fitoparásitos ocurre en la rizósfera, por lo tanto, sus dinámicas de alimentación, parasitismo y movilidad están inevitablemente influenciadas por la interacción suelo-raíz. Se llevó a cabo un estudio para evaluar la respuesta de diferentes portainjertos de Vitis frente a algunas poblaciones de nematodos fitoparásitos en diferentes tipos de suelos. Se determinaron las poblaciones de nematodos fitoparásitos en plantas de Vitis vinifera L. var ‘Chardonnay’ sobre dos portainjertos (K5BB, SO4 y ‘Chardonnay’ sin injertar como testigo, en tres diferentes suelos aluviales de la zona central de Chile. Los suelos fueron dos Inceptisoles del Valle de Casablanca (Región de Valparaíso, uno sin estructura, con una zona de densificación en profundidad (S1, y otro de textura predominante arenosa (S3; un tercer suelo correspondió a un Mollisol mejor estructurado (S2, en la Comuna de Melipilla (Región Metropolitana. Los suelos fueron caracterizados física y morfológicamente y los géneros de nematodos fueron identificados y contabilizados bajo lupa estereoscópica. ‘Chardonnay’ tuvo las mayores poblaciones de Meloidogyne spp. aunque sólo significativas en el suelo S2. Las poblaciones de Xiphinema spp. y Mesocriconema xenoplax no fueron suficientemente representativas como para asociarlas a diferencias de suelo o uso de portainjerto. Meloidogyne spp. se relacionó inversamente con el contenido de arena, sin embargo, positivamente con la mayor estructuración del suelo. Las regresiones Stepwise fueron útiles al relacionar las poblaciones de nematodos con múltiples factores edáficos.

  15. Caracterización funcional de la comunidad bacteriana cultivable aislada del suelo de la zona de descarga de la fosa petrolera Bare-9. San Tomé. Edo. Anzoátegui

    OpenAIRE

    Barrios, Arturo

    2011-01-01

    Mediante el presente estudio enmarcado dentro del proyecto Misión Ciencia “Desarrollo y Validación de Nuevas Tecnologías para el Saneamiento Ambiental de Pasivos Generados por la Actividad Petrolera”, dentro del subprefecto “Caracterización del Medio Físico Natural en Áreas Impactadas con Hidrocarburos” se pretende caracterizar funcionalmente la comunidad bacteriana del suelo de la zona de descarga de la fosa petrolera (Bare-9) y así determinar la estructura funcional de la comunidad y grupos...

  16. Alteration geochemistry of the volcanic-hosted Dedeninyurdu, Yergen and Fındıklıyar Fe-Cu mineralization at Gökçedoǧan, Çorum-Kargi region, Turkey

    Science.gov (United States)

    Gumus, Lokman; Öztürk, Sercan; Yalçın, Cihan; Abdelnasser, Amr; Hanilçi, Nurullah; Kumral, Mustafa

    2016-04-01

    This study is to determine the mass/volume gain and loss of the major and trace elements during the alteration processes on Dedeninyurdu, Yergen and Fındıklıyar Fe-Cu mineralizations of the area. Fe-Cu mineralization occurred in the spilitic volcanic a rock of Saraycık Formation is associated with the different types of alteration zones which are pyritization, silicification and sericitization. The study area comprises Bekirli Formation, Saraycık Formation, Beşpınar Formation, and Ilgaz Formation. Saraycık formation consists of spilitic volcanic rocks with pelagic limestone, siltstone and chert. The ore mineralogical data show that the pyrite, chalcopyrite, covellite, hematite, malachite and goethite formed during three phases of mineralization. As well as the geologic and petrographic studies reveal three alteration zones with definite mineral assemblages; phyllic alteration (quartz + sericite + pyrite) that represents the main alteration and mineralized zone; propylitic alteration; and carbonatized sericitic alteration zone. The boundaries between these zones are gradual. Mass balance calculations suggested that the phyllic alteration zone represented by gain in Si, Fe, K, S, and LOI and loss in Mg, Ca, and Na refers to silicification, sericitization and pyritization as well as replacement of Fe-Mg silicate and plagioclase. While, in the propylitic alteration zone, enrichment of Si, Fe, Mg, LOI and S occurred with depletions of Ca, Na, and K reflecting chloritization alteration type. On the other hand, carbonatized sericitic alteration zone shows local gain in Si, CaO and K reflects the occurrence of calc-silicate alteration. All alteration zones contain a large proportion of sulfide minerals (gain in S) with increase in loss on ignition (LOI). Keywords: Alteration geochemistry; Mass balance calculation, Fe-Cu mineralization; phyllic alteration, propylitic alteration.

  17. Caracterización toxinológica del veneno de Bothrops Atrox de Puerto Ayacucho, Edo. Amazonas (Venezuela) y su neutralización por un antiveneno venezolano

    OpenAIRE

    Duque Zerpa, Carmen Teresa; Fernández, Irma; Vargas, Alba M.; López, Juan Carlos; Scannone, Héctor

    2014-01-01

    Bothrops atrox es reconocida por la Organización Mundial de la Salud (OMS) como una de las serpientes suramericanas, que comúnmente causa incapacidad física o muerte. En Venezuela, esta especie se localiza en los estados Amazonas, Bolívar y Delta Amacuro siendo responsable de un cuadro fisiopatológico caracterizado por edema, hemorragia, necrosis, incoagulabilidad sanguínea y hemólisis. Para el tratamiento del envenenamiento por esta especie, en Venezuela se produce un ...

  18. Emerging quinolones resistant transfer genes among gram-negative bacteria, isolated from faeces of HIV/AIDS patients attending some Clinics and Hospitals in the City of Benin, Edo State, Nigeria

    Directory of Open Access Journals (Sweden)

    Enabulele IO

    2006-12-01

    Full Text Available A survey of 1431 gram-negative bacilli from June 2001 to September 2005 were obtained from the faeces of 920 HIV/AIDS patients attending some Clinics and Hospitals in Benin City, Nigeria, were screened for quinolones resistance gene. The HIV/AIDS patients CD4 cells range was ≤14/mm3 ≥800/mm3 of blood. Out of the 1431 isolates, 343 (23.9% were resistance to quinolones with a MIC ≥4μg/ml for norfloxacin, ciprofloxacin and pefloxacin while a MIC of ≥32 µg/ml for nalidixic acid. The screened isolates include Pseudomonas aeruginosa 64(18.7%, E coli 92(26.8%, Klebsiella pneumoniae 53(15.4%, Salmonella typhi 39(11.4%, Shigella dysenteriae 36(10.5%, Proteus mirabilis 34(9.9% and Serratia marcescens 25(7.3%. The average resistance of the isolates to the various quinolones ranged from 42.7% to 66.7%. Klebsiella were the most resistant isolates with a mean resistance of 66.7% while Proteus were the less resistant isolates with a mean resistance of 42.7%. Most isolates were resistant to Nalidixic acid followed by norfloxacin while the less resistant were to the pefloxacin. The frequency of qnr genes transfer to EJRifr as recipient ranged from 2 x 10-2 to 6 x 10-6 with an average of 2 plasmids per cell. The molecular weight of the plasmids ranged from <2.9kbp to <5.5 kbp. This indicated that plasmids allowed the movement of genetic materials including qnr resistant genes between bacteria species and genera in Benin City, Nigeria.

  19. The perception, beliefs and practices toward genitourinary schistosomiasis by inhabitants of selected endemic areas (Edo/Delta States in south-eastern Nigeria Percepção, crenças e práticas sobre a esquistossomose genito-urinária de habitantes de áreas endêmicas selecionadas (Edo/Estados Delta no sudeste da Nigéria

    Directory of Open Access Journals (Sweden)

    Nnamdi Callistus D. Ukwandu

    2004-08-01

    Full Text Available Well-structured questionnaire on the perception, impression and response to genitourinary bilharziasis (Genitourinary schistosomiasis was administered and explained in local languages: 'Igbo' 'Esan' 'Ezon' Itshekiri and Bini to 33815 inhabitants of selected endemic areas in south-eastern Nigeria from January, 1999 to December, 2001. Out of this number, 3815 (11.3% were properly filled and returned. About 42.0% of the inhabitants admitted knowledge of the disease, while 14 (0.4% knew about the aetiologic agent. About 181 (5.0% who responded, admitted procuring treatment, while 100 (5.0% declined to seek treatment of any sort. The relationships between water-bodies and human activities, and infection were well discussed. Amongst those who admitted knowledge of the disease but no knowledge of its etiologic agent, declined seeking treatment of any kind, but believe the disease is a natural phenomenon in ones developmental stage and therefore of no morbidity and mortality. Laboratory analysis of urine, faeces, semen and HVS was employed to assess questionnaire responses, and in some cases, physical examination was utilized to augment laboratory analysis in confirming urinal diagnosis. Haematuria was only directly related to egg count in the early part of life. Females were significantly haematuric and excreted more ova than males (p Um questionário bem estruturado sobre a percepção e práticas e crenças sobre a esquistossomose genito-urinária foi administrado e explicado em dialetos locais: "Igbo" "Esan" "Ezon" Itshekiri e Bini a 33815 habitantes de áreas endêmicas selecionadas no sudeste da Nigéria, de janeiro de 1999 a dezembro de 2001. Deste total, 3815 (11,3% foram preenchidos adequadamente e devolvidos. Cerca de 42,0% dos habitantes admitiram conhecer a doença, enquanto 14 (0,4% conheciam o agente etiológico. Cerca de 181 (5,0% dos que responderam admitiram ter procurado tratamento, enquanto 100 (5,0% não procuraram tratamento de qualquer tipo. A relação entre as coleções de águas e atividades humanas e infecção foram discutidas. Entre os que admitiram conhecer a doença mas não o seu agente etiológico não procuraram nenhum tratamento, mas acreditam que a doença é um fenômeno natural nos estágios de desenvolvimento e portanto não apresentam morbidade e mortalidade. A análise laboratorial da urina, fezes, semen e HVS foi empregada para as respostas dos questionários e em alguns casos o exame físico foi utilizado para aumentar a análise laboratorial e confirmar o diagnóstico urinário. Hematúria foi diretamente relacionada a contagem de ovos na primeira parte da vida. As mulheres foram significativamente mais hematúricas e excretaram mais ovos que os homens (p < 0,05. Dor de cabeça (43,0% e febre (31,0% foram os maiores sinais clínicos enquanto dores sexuais (22,0% foram os menores.

  20. Gene : CBRC-PTRO-14-0016 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available icted protein [Nematostella vectensis] gb|EDO44122.1| predicted protein [Nematostella vectensis] 5e-22 27% MHIPYTYIPYICISH...IYVYPYTYIPHICIYRPYTYIPYICIAHIHISHIHISHIYMFIPYTYIPYPYIPCTCISHIRISHVHVYPISVYPMYMYIPYPYIPCTCISHIR...ISHVHVYPVSVYPMYMYIPYPYIPCTCISHIRISHVHVYPVSVYPMYMYILYPYIPCTCISRIRISHVYVYPIYVYPMYMYNPYTYIPYISCVCIYKYPVCIYIYPVCIYIYISCVCVCVYIYIHTHTYSSVFLFLFYFIF ...

  1. Static Analysis of Functional Programs

    NARCIS (Netherlands)

    van den Berg, Klaas; van den Broek, P.M.

    1994-01-01

    In this paper, the static analysis of programs in the functional programming language Miranda is described based on two graph models. A new control-flow graph model of Miranda definitions is presented, and a model with four classes of caligraphs. Standard software metrics are applicable to these

  2. liquid soap production with blends of rubber seed oil (rso)

    African Journals Online (AJOL)

    Department of Chemical Engineering, Edo State Institute of Technology and Management, Usen,. P.M.B 1104, Benin City, Edo State. ... The basic processes for making soap have re- mained unchanged for the past 200 years. How- ... palm kernel oil for good quality liquid soap using locally produced caustic potash from ...

  3. ISLAM IN THE NON-MUSLIM AREAS OF NORTHERN NIGERIA, c

    African Journals Online (AJOL)

    QUADRI Y A

    sculptures, drawings, paintings, animations, sounds, film, video and video games and most predominantly in this modern era, the internet, to portray its sexual themes. Who are the Owan People? The Owan are people of Edo extraction currently scattered around the Owan River in the Northern fringe of Edo State. 19 . They ...

  4. Nature of ergastic substances in some Poaceae seeds

    African Journals Online (AJOL)

    ajl yemi

    2011-08-29

    Aug 29, 2011 ... 1Department of Botany, University of Benin, PMB 1154, Benin City, Edo State, Nigeria. 2Department of Botany, Ambrose Alli University, PMB. 14, Ekpoma, Edo State, Nigeria. Accepted 6 May, 2011 ... grasses) contribute more food seeds than any other plant family; it contributes about 50% per capita energy ...

  5. Entropy-Based Economic Denial of Sustainability Detection

    Directory of Open Access Journals (Sweden)

    Marco Antonio Sotelo Monge

    2017-11-01

    Full Text Available In recent years, an important increase in the amount and impact of Distributed Denial of Service (DDoS threats has been reported by the different information security organizations. They typically target the depletion of the computational resources of the victims, hence drastically harming their operational capabilities. Inspired by these methods, Economic Denial of Sustainability (EDoS attacks pose a similar motivation, but adapted to Cloud computing environments, where the denial is achieved by damaging the economy of both suppliers and customers. Therefore, the most common EDoS approach is making the offered services unsustainable by exploiting their auto-scaling algorithms. In order to contribute to their mitigation, this paper introduces a novel EDoS detection method based on the study of entropy variations related with metrics taken into account when deciding auto-scaling actuations. Through the prediction and definition of adaptive thresholds, unexpected behaviors capable of fraudulently demand new resource hiring are distinguished. With the purpose of demonstrate the effectiveness of the proposal, an experimental scenario adapted to the singularities of the EDoS threats and the assumptions driven by their original definition is described in depth. The preliminary results proved high accuracy.

  6. Impact of Contract Bundling and Consolidation on Defense Acquisition System and Defense Industrial Base: The Case of the U.S. Department of the Navy

    Science.gov (United States)

    2012-04-27

    or 39% of the value of such contracts. Next, a group of nine firms—EDO Communications and Countermeasures Systems, Lockheed Martin, Sociedad ...49,437,854.00 5.94% SOCIEDAD ESPAIOLA DE MONTAJES INDUSTRIALES SA $60,000,000.00 7.21% LOCKHEED MARTIN CORPORATION $79,342,491.00 9.54% EDO

  7. Cocoa Farmers Attitude towards Utilisation of Integrated Pest ...

    African Journals Online (AJOL)

    The study examined cocoa farmers' attitude towards the utilization of integrated pest management (IPM) in Edo and Ogun States of Nigeria. In Edo State, 60 respondents were randomly selected out of 100 trained cocoa farmers. Random selection of 60 respondents from registered cocoa farmers that were not trained in IPM ...

  8. Soil Characteristics, Microbial Compostion of Plot, Leaf Count and ...

    African Journals Online (AJOL)

    Soil Characteristics, Microbial Compostion of Plot, Leaf Count and Sprout Studies of Cocoyam ( Colocasia [Schott] and Xanthosoma [Schott], Araceae) Collected in Edo State, ... Science, Technology and Arts Research Journal ... Government Areas (LGA) in Edo state and describe them based on leaf count and sprout

  9. The influence of family factors on delinquent adolescents in ...

    African Journals Online (AJOL)

    This study was carried out with the aim of finding out the influence of family factors on delinquent adolescents in secondary schools in Edo South Senatorial District of Edo State. This study ascertained the extents to which family factors such as parent child rearing style, family type and parent socio economic background ...

  10. Civic Action Projects Report, 1 January 1965-31 December 1965. Volume 2.

    Science.gov (United States)

    1966-06-22

    country PIO. .~. 439 EL SALVADOF b. A copy of the pamphlet " Lecturas Seleccionadas Sobre el Desarollo de la Comunidad" fron. the U. S. Army School of...PiOJECT Ponton La Vega A-I Juan Lopez Moca A-2 Las Uvas Villa Tapia A-3 Buena Vista Jarabocoa A-4 Los Rios Neyba A-5 Juan Herrera San Juan de la ...Maguana A-6 Hatillo San Cristobal A-7 Licey La Vega A-8 Canoa Barahona AF-I Fundacion Bani N-i Comatillo Bayaguana A- 9 Santa Maria San Cristobal G-I 4

  11. Solar System constraints on a cosmologically viable f(R) theory

    Energy Technology Data Exchange (ETDEWEB)

    Bisabr, Yousef, E-mail: y-bisabr@srttu.ed [Department of Physics, Shahid Rajaee Teacher Training University, Lavizan, Tehran 16788 (Iran, Islamic Republic of)

    2010-01-18

    Recently, a model f(R) theory is proposed (Miranda et al. (2009)) which is cosmologically viable and distinguishable from LAMBDACDM. We use chameleon mechanism to investigate viability of the model in terms of Solar System experiments.

  12. Solar System constraints on a cosmologically viable f(R) theory

    International Nuclear Information System (INIS)

    Bisabr, Yousef

    2010-01-01

    Recently, a model f(R) theory is proposed (Miranda et al. (2009)) which is cosmologically viable and distinguishable from ΛCDM. We use chameleon mechanism to investigate viability of the model in terms of Solar System experiments.

  13. 76 FR 52961 - Agency Information Collection Activities: Form N-300; Revision of an Existing Information...

    Science.gov (United States)

    2011-08-24

    ... documentary requirements for those seeking to work in certain occupations or professions, or to obtain various... 18, 2011. Liana Miranda-Valido, Management and Program Analyst, Regulatory Products Division, Office...

  14. Sõrmuste emandad

    Index Scriptorium Estoniae

    2002-01-01

    Naisnäitlejad Liv Tyler, Miranda Otto ja Cate Blanchett Peter Jacksoni lavastatud filmides J.R.R. Tolkieni triloogia "Sõrmuste isand" alusel - "Sõrmuse vennaskond", "The Lord of the Rings : The Fellowship of the Ring"

  15. Carmen Miranda’s white dress: ethnicity, syncretism and subaltern sexualities in springtime in the rockies Carmen Miranda’s white dress: ethnicity, syncretism and subaltern sexualities in springtime in the rockies

    Directory of Open Access Journals (Sweden)

    José Gatti

    2008-04-01

    Full Text Available This essay calls for a reassessment of Carmen Miranda's work in Hollywood. Her singing and dancing can reveal unexpected ethnic and cultural alignments. The focus here is on the costumes she designed for Springtime in the Rockies, a Fox musical in which Brazilian as well as Native American cultural references are made explicit in Miranda's performance. This essay calls for a reassessment of Carmen Miranda's work in Hollywood. Her singing and dancing can reveal unexpected ethnic and cultural alignments. The focus here is on the costumes she designed for Springtime in the Rockies, a Fox musical in which Brazilian as well as Native American cultural references are made explicit in Miranda's performance.

  16. Awareness of high blood pressure status, treatment and control in a ...

    African Journals Online (AJOL)

    west LGA of Edo State to assess the level of awareness of high blood pressure status, treatment and control. Cluster sampling method was used to select participants and data collection was by researcher administered questionnaire. Blood ...

  17. Socio-Economic Characteristics of Registered Cocoa Farmers in ...

    African Journals Online (AJOL)

    PROF HORSFALL

    ABSTRACT: This study examined the socio-economic characteristics of registered cocoa farmers in Edo State; ... Key words: socio-economics, characteristics, registered cocoa farmers. ... international exchange market in two world currencies ...

  18. PERCEPTION OF HOST COMMUNITIES TOWARD THE ...

    African Journals Online (AJOL)

    DORCAS

    Department of Forestry and Wildlife, University of Benin, Benin city, Edo state, Nigeria. Corresponding ... park laws relating to wildlife conservation in Okomu National Park. The Park ..... Parks. Federal. Government Press, Lagos, Nigeria.

  19. Population dynamics of Rodents and Insectivores in lowland tropical ...

    African Journals Online (AJOL)

    ADOWIE PERE

    2018-03-19

    Mar 19, 2018 ... ecosystem of Okomu National Park, Edo State, Nigeria. OMOGBEME, MI; OKE, CO. Department of Animal and Environmental Biology, University of Benin, P.M.B 1154, Benin City, Nigeria. ..... University Press ... IUCN (2017).

  20. [Research on Japanese monograph of comprehensive dietetic materia medica, the Pao chu bei yong wo ming ben cao (Japanese Materia Medica Prepared for Kitchen)].

    Science.gov (United States)

    Zhou, M; Ye, J

    2017-11-28

    Japanese physicians of Edo Period (1603-1867) wrote many dietetic books, by combining the knowledge system (content and compiling style) and thoughts of diet therapy from China with local condition in Japan. Among them, the Pao chu bei yong wo ming ben cao ( Japanese Materia Medica Prepared for Kitchen ), written by Mukai Genshou, a physician in the early Edo, is the earliest comprehensive work of dietetic materia medica. In this book, the choice and usage of Japanese dietetic materia medica reveals obvious Japanese local color, including the name, morphology, cultivation, collection, identification, nature and flavor, and indication etc., reflecting the sprouting idea of edible herbal plant at the beginning of Edo period and the characteristic of absorbing Chinese diet thoughts by Japanese physician. This is the important first-hand historical material to understand the development of Japanese dietetic herbalism in early Edo and its dietotherapy culture.

  1. Download this PDF file

    African Journals Online (AJOL)

    2016-01-31

    Jan 31, 2016 ... Chemical Society; and IRMS Informatics India (J-Gate) ... Health Care, Ambrose Alli University, Edo State. ... Bridging the gaps of inequality in health care service delivery ... rich and poor, men and women, urban and rural.

  2. Climate Change Adaptation Needs of Male and Female Oil Palm ...

    African Journals Online (AJOL)

    User

    2008 and Ayodele, 2010) and also results in an increase in demand for palm oil. The demand .... climate change adaptation practice needs of oil palm entrepreneurs in Edo State, .... female respondents had one form of education or the other.

  3. Prevalence of urinary schistosomiasis in Nigeria, 1994–2015 ...

    African Journals Online (AJOL)

    A. Abdulkadir

    2017-03-14

    Mar 14, 2017 ... Introduction: The Global significance of schistosomiasis started waning ... prevalence of schistosomiasis in Nigeria, and its six geo-political zones. ...... schistosomiasis in a rural community in Edo state, Nigeria: eosinophil-.

  4. Download this PDF file

    African Journals Online (AJOL)

    User

    because they cannot appreciate the extra protection afforded by ITN. ... To determine the factors affecting utilization of ITN by pregnant women in Etsako West LGA, Edo. State. A descriptive cross-sectional study design was employed. Using a ...

  5. chemical and mineralogical characterization of lateritic iron ore

    African Journals Online (AJOL)

    DJFLEX

    2010-04-22

    Apr 22, 2010 ... The laterite iron ore deposit at Auchi, Edo State, Nigeria was studied chemically and mineralogically. The results of the chemical ... SAMPLE PREPARATION. The samples .... 2µm) and were subjected to X-ray diffraction using.

  6. Haematopoietic stem cell transplantation: activities (2014 report) in a ...

    African Journals Online (AJOL)

    PROMOTING ACCESS TO AFRICAN RESEARCH ... Introduction: Hematopoietic Stem Cell transplantation (HSCT) is the only curative therapy for ... Activities: The stem cell transplant centre at the University of Benin Teaching Hospital Edo ...

  7. year surveillance of wound infections at a rural tertiary hospital in ...

    African Journals Online (AJOL)

    EB

    Conclusions: Staphylococcus aureus was the most predominant etiologic agent of wound infection among in and out patients. ... methicillin – resistant Staphylococus aureus (MRSA) and ... Northeast local government area of Edo State,.

  8. Relationship Between Body Weight and Growth Traits of Crossbred ...

    African Journals Online (AJOL)

    SH

    Pearson's correlation coefficient between body weight and other measured traits. .... management system where routine and ..... 13th Annual Conference of Animal ... and Genetic variation among local chickens in Edo State of Nigeria. Ed.

  9. Download this PDF file

    African Journals Online (AJOL)

    PROF. MADUKWE

    Participation of Women in the Third National Fadama Development Programme in. Edo State ... The project targets the rural poor [farmers, .... Divorced. Widowed. 10.7. 61.3. 07.3. 20.7. Educational attainment. No formal education primary.

  10. The attitudes of clergy in Benin City, Nigeria towards persons with ...

    African Journals Online (AJOL)

    Department of Clinical Services, Federal Psychiatric Hospital, Benin City, Edo State, Nigeria ... Their attitudes concerning mental illnesses would influence community mental health ... distributed to ministers at convenient group meetings, e.g..

  11. Browse Title Index

    African Journals Online (AJOL)

    Items 601 - 650 of 1463 ... Vol 4, No 1 (2004), Gender inequality and domestic violence: ... in contraceptive use among educated women in Edo state, Nigeria, Abstract PDF ... women: a cross-sectional study from coastal South India, Abstract PDF.

  12. International Journal of Pedagogy, Policy and ICT in Education - Vol ...

    African Journals Online (AJOL)

    Prevalence of conduct disorder among adolescents in a senior secondary school in Benin City, Edo State, Nigeria · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. EE Omotunde, O Philomena, 15-28 ...

  13. Journal of Agriculture and Social Research (JASR) Vol. 16, No. 1 ...

    African Journals Online (AJOL)

    Ekunwe

    The study examined the profitability of snail marketing in Benin metropolis, Edo state, Nigeria. Random ... Agricultural marketing can be defined as the performance of all business activities included in the flow of ..... Principles and Applications.

  14. design and implementation of a microcontroller-based adjustable ...

    African Journals Online (AJOL)

    HOD

    1, DEPARTMENT OF COMPUTER ENGINEERING, UNIVERSITY OF BENIN, BENIN CITY, EDO STATE, NIGERIA ... ICs, to design a user friendly charger circuit that manually adjusts the voltage .... the multivibrator integrated circuit does it.

  15. EJOTMAS 13

    African Journals Online (AJOL)

    AUNTY TEE

    EJOTMAS: EKPOMA JOURNAL OF THEATRE AND MEDIA ARTS. 169 ... social, political and economic significance during the struggle for independence ..... was again appointed a Commissioner for Arts, Culture, and Tourism in. Edo State ...

  16. Browse Title Index

    African Journals Online (AJOL)

    2013), Market Sanitation: A Case Study of Oregbeni Market Benin - City Edo ... Pathophysiology and Evidence Based Intervention Strategy, Abstract PDF ... Hormones on Gamma Immunoglobulin Density (Ig-Gp) and Apgar ...

  17. Nature of ergastic substances in some Poaceae seeds

    African Journals Online (AJOL)

    ajl yemi

    2011-08-29

    Aug 29, 2011 ... 1Department of Botany, University of Benin, PMB 1154, Benin City, Edo State, Nigeria. ... Since seed is the storage organs of ergastic materials such as .... Ultrastructure and Development of Silica Bodies in Monocotyledons.

  18. African Journal of Urology - Vol 23, No 2 (2017)

    African Journals Online (AJOL)

    Management of the exstrophy-epispadias complex in adolescents and adults · EMAIL ... An unusual presentation of advanced prostate cancer in a 56-year old ... psychosocial impediments to self reporting of erectile dysfunction by men in Edo ...

  19. Attention Deficit Hyperactivity Disorder Intervention: Strategies ...

    African Journals Online (AJOL)

    Edo Journal of Counselling. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 2, No 2 (2009) >. Log in or Register to get access to full text downloads.

  20. IGBO POLITICAL ORGANIZATION AND IMPUNITY Ifeyinwa ...

    African Journals Online (AJOL)

    JONATHAN

    2016-07-01

    Jul 1, 2016 ... The focus of this paper is on the Democratic village Republican ... some other communities such as Yoruba, Hausa, Edo etc, but they have their own style of ... and in a democratic manner that abhors autocratic leadership.

  1. Counsellor (The) - Vol 33, No 1 (2014)

    African Journals Online (AJOL)

    Open Access DOWNLOAD FULL TEXT ... Communication in marital homes and work performance among Secondary School ... Predictive value of parenting styles on the academic achievement of adolescent students in Edo State, Nigeria.

  2. Journal of Agriculture and Social Research (JASR) Vol. 11, No. 1 ...

    African Journals Online (AJOL)

    C.P. Kalu

    The study examined the economic potential of taungya system in Edo state, using of data ... potential of taungya so as to convert all the possible potentials to reality. ..... issues of university of Britain Colombia Press, Vancouver, 497-504.

  3. Fruits and Seeds Production of Irvingia Gabonensis (O' Rorke) and ...

    African Journals Online (AJOL)

    Fruits and Seeds Production of Irvingia Gabonensis (O' Rorke) and Its Economic Importance in Edo Central, Nigeria. ... Journal of Agriculture and Social Research (JASR). Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current ...

  4. Fruits and Seeds Production of Irvingia Gabonensis (O' Rorke) and ...

    African Journals Online (AJOL)

    Fruits and Seeds Production of Irvingia Gabonensis (O' Rorke) and Its Economic Importance in Edo ... Journal of Agriculture and Social Research (JASR) ... Irvingia gabonensis is one of the most important indigenous fruit trees cultivated and ...

  5. monosymptomatic childhood nocturnal enuresis in Benin City, Nigeria

    African Journals Online (AJOL)

    Only children with a history of bed-wetting since birth were recruited. ... The parents of children in public primary and secondary schools in Egor local government area, Edo State, were interviewed ..... fertility control in a developing country.

  6. pitting corrosion susceptibility pitting corrosion susceptibility of aisi

    African Journals Online (AJOL)

    eobe

    2DEPARTMENT OF MECHANICAL ENGINEERING, UNIVERSITY OF BENIN, BENIN- CITY, EDO STATE, NIGERIA. E-mail addresses: ... fluids and aggressive chemicals. Pitting corrosion ... the kitchen, food manufacturing and dispensing and.

  7. Evaluation of the Influence of Salt Treatment on the Structure of ...

    African Journals Online (AJOL)

    MICHAEL HORSFALL

    Department of Chemical Engineering, University of Benin, Edo State, Nigeria. ABSTRACT: This paper ... activated carbon obtained by chemical activation exhibits a larger surface ..... A master thesis from Faculty of. Engineering, Zonguldak ...

  8. Determination of water quality index and portability of Iguedo stream ...

    African Journals Online (AJOL)

    Determination of water quality index and portability of Iguedo stream in Edo ... has been found functional in assessing the water quality of this stream based on the ... Key words: Water quality index, physicochemical parameters, Iguedo Stream.

  9. Author Details

    African Journals Online (AJOL)

    Diabetic Patients Attending the University Teaching Hospital, Ado Ekiti, Nigeria Abstract · Vol 5, No 3 (2009) - Articles Plasma Zinc Levels of Pregnant Women Visiting Irrua Specialist Teaching Hospital, Irrua, Edo State, Nigeria Abstract · Vol 5, No ...

  10. DECEMBER JMBR 13 - 2 correction.cdr

    African Journals Online (AJOL)

    Fine Print

    pregnant women attending antenatal clinic in Etsako East LGA, Edo State. Methodology: A descriptive ... by being a leading cause of anaemia in. 2 pregnancy. Plasmodium ... For the prevention and control of malaria during pregnancy in ...

  11. JMBR VOLUME 14 Number 2.cdr

    African Journals Online (AJOL)

    FINEPRINT

    Farmers are exposed to certain occupational hazards which predispose ... sectional survey carried out among farmers in an agricultural industry in Edo ... general health services for farm workers. ..... industrial workers in cement, coal, steel.

  12. Dynamics of satellites, asteroids, and rings

    International Nuclear Information System (INIS)

    Dermott, S.F.

    1987-01-01

    Work is reported on: (1) the shapes and the internal structures of satellites; (2) the tidal heating of Miranda; (3) the dynamics of arc-like rings; and (4) the structure of the zodiacal cloud that was revealed by the Infrared Astronomy Satellite. Significant progress was made in determining the shape and internal structure of Mimas and in understanding the dynamical evolution of Miranda's orbit

  13. 川の手, 山の手, 海の手 : 日本の近代化を東京に読む

    OpenAIRE

    服部, 銈二郎

    1985-01-01

    The rapid modernization of Japan during the Edo, Meiji, Taisho and Showa Periods has made the modern Japan one of the top-level countries in material terms at least. The traditional culture of Japan of the Edo Period was transformed through the Western civilization introduced with the Meiji Restoration. The life style of the Japanese as well as Japan's politics, economy and culture was rapidly westernized. Both the government and the common people of Japan considered that their urgent objecti...

  14. Karbonátová hydrotermální žilná mineralizace v granitoidních horninách středočeského plutonu na ložisku zlata Mokrsko-západ

    Czech Academy of Sciences Publication Activity Database

    Dobeš, P.; Žáček, V.; Jačková, I.; Čejková, B.; Lněničková, Z.; Filip, Jiří; Veselovský, F.; Drahota, J.

    2015-01-01

    Roč. 2014, č. 1 (2015), s. 165-169 ISSN 0514-8057 Institutional support: RVO:67985831 Keywords : Bohemian Massif * Central Bohemian Pluton * fracture filing * fluid inclusions * stable isotopes * trace elements and REE * AFT analysis Subject RIV: DB - Geology ; Mineralogy http://www.geology.cz/img/zpravyvyzkum/fulltext/24_Dobes_151115.pdf

  15. Paleontologický význam dutin ve fosilních dřevech permokarbonského stáří středočeských a západočeských kamenouhelných pánví

    Czech Academy of Sciences Publication Activity Database

    Mikuláš, Radek; Zasadil, B.

    2008-01-01

    Roč. 2007, - (2008), s. 124-127 ISSN 0514-8057 Institutional research plan: CEZ:AV0Z30130516 Keywords : Carboniferous * Permian * wood boerings * fungi * insects * weathering Subject RIV: DB - Geology ; Mineralogy http://www.geology.cz/zpravy/obsah/2007/2007-34.pdf

  16. Kvalitativní analýza potřeb klientů využívajících nízkoprahové služby ve Středočeském kraji

    Czech Academy of Sciences Publication Activity Database

    Gabrhelík, Roman; Charvát, M.; Miovský, Michal

    2005-01-01

    Roč. 5, č. 1 (2005), s. 22-33 ISSN 1213-3841 Institutional research plan: CEZ:AV0Z70250504 Keywords : Needs analysis * qualitative methodology * Rapid Assessment and Response * injection drug user Subject RIV: AN - Psychology

  17. Protilátky k virům přenosným komáry u středočeské populace z oblasti zasažené povodní v roce 2002

    Czech Academy of Sciences Publication Activity Database

    Hubálek, Zdeněk; Zeman, P.; Halouzka, Jiří; Juřicová, Zina; Šťovíčková, E.; Bálková, H.; Šikutová, Silvie; Rudolf, Ivo

    2004-01-01

    Roč. 53, č. 3 (2004), s. 112-120 ISSN 1210-7913 R&D Projects: GA ČR GA310/03/Z033; GA ČR GA206/03/0726 Institutional research plan: CEZ:AV0Z6093917 Keywords : mosquito es * flood Subject RIV: FN - Epidemiology, Contagious Diseases ; Clinical Immunology http://www.clsjep.cz/Ukazclanek2.asp?clanek=19563&jazyk=&cislo=1207

  18. K hospodaření a kultuře bydlení na středočeském statku v raném novověku: příklad z Trněného Újezdu (okr. Kladno)

    Czech Academy of Sciences Publication Activity Database

    Šulc, J.; Kypta, J.; Ježek, Martin

    2009-01-01

    Roč. 61, č. 4 (2009), s. 697-714 ISSN 0323-1267 Institutional research plan: CEZ:AV0Z80020508 Keywords : Central Bohemia * Late Middle Ages * Early Modern period * village * social structure * stove tiles * stoves Subject RIV: AC - Archeology, Anthropology, Ethnology

  19. Narativy křížových výprav v českých středoškolských učebnicích dějepisu 20. století

    OpenAIRE

    Kroupová, Pavlína

    2014-01-01

    This thesis deals with different narratives of the crusades found in czech high school history textbooks published during the 20th century. The paper shows various narrative strategies, use of languages and figures of speech that allow for many different points of view and a wide range of explanations of the same historical material. The paper is grounded in the historical narrativism paradigm and organized as follows: the first chapter introduces the theoretical background of narrativism, th...

  20. Production of sugarcane and tropical grasses as a renewable energy source. Third quarterly report, December 1, 1980-February 28, 1981

    Energy Technology Data Exchange (ETDEWEB)

    Alexander, A.G.

    1981-01-01

    Research continued on tropical grasses from Saccharum and related genera as sources of intensively-propagated fiber and fermentable solids. Greenhouse-level screening for short- and intermediate-rotation grasses included further trials with legume species as potential nitrogen sources for the tropical grasses. Yields from four indigenous legumes were appreciably higher when planted in spring (May) than when planted in autumn (November). Initial data were recorded from second generation energy cane studies established during 1980. Controlled variables include varieties, harvest interval, and nitrogen input. Yield data at 6 months indicate high but essentially equal growth rates among all varieties and N-variables. This is attributed to the use of a land rotavator during seedbed preparation - the first such application of this implement on Lajas Valley soils. Total green weights were in the order of 50 to 60 tons/acre, and millable stem weights ranged from 33 to 37 tons/acre, at the 6-months harvest. Dry matter yields ranged from 8 to 11 tons/acre. Juice quality values indicated a minimal sugar content at this stage of maturity. Fiber values ranged from 7 to 14%. Field-scale studies were continued at the Hatillo demonstration site on the humid north coast and in the semi-arid Lajas Valley. For the 6-months harvest at Hatillo, total green weights for all treatments averaged 38.4 tons/acre. Variety US 67-22-2 produced 50.2 tons/acre. Millable cane yields averaged 25.3 tons/acre for all treatments and 34.7 tons/acre for variety US 67-22.2.

  1. Less invasive causal treatment of ejaculatory duct obstruction by balloon dilation: a case report, literature review and suggestion of a CT- or MRI-guided intervention

    Directory of Open Access Journals (Sweden)

    Ole Kayser

    2012-03-01

    Full Text Available Uni- or bilateral ejaculatory duct obstruction (EDO is a rare but correctable cause of infertility, chronic pelvic pain and postejaculatory pain. EDO is a congenital or acquired condition, it is the underlying cause of infertility in approximately 5% of infertile men. If acquired, the etiology often remains unresolved, but prostatitis or urethritis with post-inflammatory adhesion of the duct walls seems to be a common underlying pathomechanism. Although a certain constellation of physicochemical semen parameters may lead to correct diagnosis, EDO often resembles a diagnosis by exclusion. Imaging of acquired EDO remains a challenge and the established surgical therapy, transurethral resection of the ejaculatory ducts (TURED, leads to a low rate of natural conception and a high rate of complications such as reflux of urine and epididymitis. We present a case of a male with suspected EDO who underwent a combined approach to both, semi-invasive diagnosis and therapy by transrectal puncture of the seminal vesicles and antegrade balloon-dilation of the ejaculatory ducts. Possibilities and pitfalls of this procedure are described and the literature is reviewed. Furthermore, we suggest a CT- or MRI-guided, percutaneous intervention for treatment of ejaculatory duct obstruction by balloon dilation and demonstrate initial steps of this procedure with a body donor. We call this new procedure PTED (percutaneous transgluteal ejaculatory ductoplasty.

  2. Herbological studies of Coptidis rhizoma (Part 2): on the old Japanese name of Coptis japonica makino.

    Science.gov (United States)

    Kawamoto, M; Mikage, M

    1999-01-01

    The rhizome of Coptis plant of the family ranunculaceae has been used in traditional Chinese medicine as a crude drug (Huanglian in present Chinese). In Japan, the rhizome of Coptis japonica Makino (the botanical name of which is "Ohren" in modern Japanese) has been utilized as a crude drug since the Nara era. The Japanese name in those days was "Kakumakusa based on descriptions in old books written in the Heian era. It changed to "Kakumikusa" early in the Edo era, and then changed again to Kakumakusa later in the Edo era. Through this herbological study, it was conjectured as follows: The resemblance between Chinese characters (or MA) and (or MI) in cursive style caused mis-copying of the character. After the "Honzo-wamyo, written in the Heian era, was revised in the late Edo era, and on which the name was accurately written as Kakumakusa, the mistake was corrected.

  3. Tres nuevas especies de Sterculia L. (Sterculiaceae) de Venezuela

    OpenAIRE

    MONDRAGÓN, Alcides

    2005-01-01

    Como resultado del estudio taxonómico del género Sterculia L. (Sterculiaceae) en Venezuela, se describen tres nuevas especies: Sterculia abbreviata, procedente de los estados Amazonas, Aragua, Delta Amacuro, Mérida y Miranda; S. amazonica, a lo largo del Río Ocamo del estado Amazonas, y estado Bolívar; S. steyermarkii, en bosques siempreverdes en las costas del estado Miranda y en el estado Mérida. As a result of a taxonomical study of the genus Sterculia L. (Sterculiaceae) in Venezuela, t...

  4. Extensional and compressional instabilities in icy satellite lithospheres

    International Nuclear Information System (INIS)

    Herrick, D.L.; Stevenson, D.J.

    1990-01-01

    The plausibility of invoking a lithospheric instability mechanism to account for the grooved terrains on Ganymede, Encedalus, and Miranda is presently evaluated in light of the combination of a simple mechanical model of planetary lithospheres and asthenospheres with recent experimental data for the brittle and ductile deformation of ice. For Ganymede, high surface gravity and warm temperatures render the achievement of an instability sufficiently great for the observed topographic relief virtually impossible; an instability of sufficient strength, however, may be able to develop on such smaller, colder bodies as Encedalus and Miranda. 15 refs

  5. Análisis por espectroscopia infrarroja de algunas arcillas colombianas

    Directory of Open Access Journals (Sweden)

    Yolanda O. de Bravo

    2009-06-01

    Full Text Available Se estudiaron once muestras procedentes de distintos puntos del yacimiento Mondoñedo (Mosquera, Cundinamarca. A la fracción arcillosa menor de 2 micras, separadas, según el método de Jackson, se les tomó para su caracterización, los correspondientes espectros IR. Las muestras analizadas contienen como mineral predominante caolinita y en menor proporción cuarzo. Es de anotar la presencia de hidróxidos de hierro y de aluminio. La similitud en la composición mineralógica de las muestras permite inferir la homogenidad del yacimiento de Mondoñedo.

  6. UNIVERSIDAD NACIONAL EXPERIMENTAL “RAFAEL MARÍA BARALT”: IMAGEN CORPORATIVA EXTERNA

    Directory of Open Access Journals (Sweden)

    Julio Rafael Pire Morales

    2014-04-01

    Full Text Available El estudio tuvo como propósito describir la Universidad Nacional Experimental “Rafael María Baralt” desde su imagen corporativa externa en el municipio Miranda estado Zulia. El estudio fue de carácter descriptivo, con diseño no experimental transversal cuya población estuvo conformada por 2 grupos 18 sujetos denominados comerciantes del sector productivo y 384 jefes de las familias que habitan el 13 sectores de la Parroquia Altagracia, municipio Miranda a quienes se les aplicó un instrumento cuestionario de doble versión tipo Likert, cuya confiabilidad se alcanzó con la realización de una prueba piloto a 20 sujetos obteniendo un alfa cronbach de 0,8494. El análisis de los resultados se llevó a cabo con una estadística descriptiva a través de frecuencia absoluta y relativa tal como se observa en el siguiente apartado. Como conclusiones se resaltó. Los públicos responden tener una actitud positiva cuando opinan que la UNERMB ha contribuido en el desarrollo del Municipio Miranda y mejorado la calidad de vida de sus habitantes, al tiempo que la comunidad se siente orgullosa de contar con esta institución en el municipio Miranda.

  7. Diversity Research Literature on the Rise? A Review of School Psychology Journals from 2000 to 2003

    Science.gov (United States)

    Brown, Stephanie L.; Shriberg, David; Wang, Aimin

    2007-01-01

    School psychologists in the United States are not nearly as diverse demographically as the students they serve (T.K. Fagan & P.S. Wise, 2000). A.H. Miranda and P.B. Gutter (2002) investigated the number of diversity-related articles in four leading school psychology journals from 1990 to 1999 and found that there was an increase in the…

  8. Geographical Distribution of Publications in the African Journal of ...

    African Journals Online (AJOL)

    Erah

    been pointed out by Kremer JAM, simple counts of the number of publications are only crude estimates of research productivity of a country/region. However, there is no superior practical way of assessing research productivity besides simple article counts. References. 1. Saravia NG, Miranda JF. Plumbing the brain drain.

  9. Reforma financování vědy k dopracování

    Czech Academy of Sciences Publication Activity Database

    Jurajda, Štěpán; Münich, Daniel

    -, č. 3 (2008), s. 20-21 ISSN 1210-9525 Institutional research plan: CEZ:AV0Z70850503 Keywords : science funding reform * Czech Republic Subject RIV: AH - Economics http://abicko.avcr.cz/miranda2/export/ sites /abicko.avcr.cz/cs/2008/3/pdf/AB3_08_web.pdf

  10. Teater. Muusika. Nyyd / Anneli Remme

    Index Scriptorium Estoniae

    Remme, Anneli, 1968-

    2005-01-01

    ERSO ja NYYD Ensemble'i ühiskontserdil esitatud Brett Deani "Kontserdist vioolale ja orkestrile" ja teosest "Game Over", Küberstuudio etendusest "Lend-ajad", hispaania laulja Fatima Miranda kontsertetendusest "Diapassion", Michel van der Aa kammerooperist "One" rahvusvahelise uue muusika festivali "NYYD 2005" raames

  11. LETOS -- A Lightweight Execution Tool for Operational Semantics

    NARCIS (Netherlands)

    Hartel, Pieter H.

    A lightweight tool is proposed to aid in the development of operational semantics. To use LETOS an operational semantics must be expressed in its meta-language, which itself is a superset of Miranda. The LETOS compiler is smaller than comparable tools, yet LETOS is powerful enough to support

  12. Syntactic Complexity Metrics and the Readability of Programs in a Functional Computer Language

    NARCIS (Netherlands)

    van den Berg, Klaas; Engel, F.L.; Bouwhuis, D.G.; Bosser, T.; d'Ydewalle, G.

    This article reports on the defintion and the measutement of the software complexity metrics of Halstead and McCabe for programs written in the functional programming language Miranda. An automated measurement of these metrics is described. In a case study, the correlation is established between the

  13. Exchange rate dynamics and its effect on macroeconomic volatility in selected CEE countries

    Czech Academy of Sciences Publication Activity Database

    Audzei, Volha; Brázdik, F.

    2017-01-01

    Roč. 15, č. 1 (2017), s. 15-19 ISSN 1803-7089 Institutional support: Progres-Q24 Keywords : exchange rate dynamics * macroeconomic volatility Subject RIV: AH - Economic s http://www.cnb.cz/miranda2/export/sites/www.cnb.cz/en/research/research_publications/erb/download/ERB_No1_2017.pdf

  14. Možnosti aplikace alkalicky aktivovaných systémů ve stavebnictví

    Czech Academy of Sciences Publication Activity Database

    Boháčová, J.; Staněk, S.; Vavro, Martin

    2012-01-01

    Roč. 12, č. 2 (2012), s. 49-58 ISSN 1213-1962 Institutional support: RVO:68145535 Keywords : alkali activated system * geopolymer * binder Subject RIV: JN - Civil Engineering http://www.fast.vsb.cz/miranda2/export/sites-root/fast/cs/okruhy/veda-a-vyzkum/odborna-cinnost-fakulty/sbornik-vedeckych-praci/archiv-vydanych-sborniku/sbornik-vsb-fast-2012-2.pdf.

  15. Who borrows and who may not repay?

    Czech Academy of Sciences Publication Activity Database

    Bičáková, Alena; Prelcová, Zuzana; Pašaličová, R.

    2011-01-01

    Roč. 9, č. 2 (2011), s. 10-13 ISSN 1803-7089 Institutional research plan: CEZ:MSM0021620846 Keywords : household credit * debt burden * repayment Subject RIV: AH - Economics http://www.cnb.cz/miranda2/export/sites/www.cnb.cz/en/research/research_publications/erb/download/ERB_No2_2011.pdf

  16. Margins of trade: Czech firms before, during and after the crisis

    Czech Academy of Sciences Publication Activity Database

    Galuščák, K.; Sutóris, Ivan

    2017-01-01

    Roč. 15, č. 1 (2017), s. 2-5 ISSN 1803-7089 Institutional support: Progres-Q24 Keywords : Czech firms * crisis Subject RIV: AH - Economics http://www.cnb.cz/miranda2/export/sites/www.cnb.cz/en/research/research_publications/erb/download/ERB_No1_2017.pdf

  17. AFRREV STECH, Vol. 3(2) May, 2014

    African Journals Online (AJOL)

    Toshiba

    2014-05-07

    May 7, 2014 ... An International Journal of Science and Technology. Bahir Dar, Ethiopia ... and demonstration method on the teaching of agricultural science. One research ... secondary school students from 6 schools in Bende Local Government. Area formed the .... far above grade level (Miranda and Landmann, 2011).

  18. The Leucocytozoidae of South African birds. The Muscicapidae ...

    African Journals Online (AJOL)

    1991-12-05

    Dec 5, 1991 ... L. francai, L. giovanno/ia en L. mirandae word sinonieme van L. dubreuili verklaar. ... (1991), in a review of the leucocytozoids of the Phasianidae, again on analysis of the available ..... Russ.J. Trop.Med. 5: 654-664, 674-675.

  19. Zoogeographic and Taxonomic status of the South American snake Tachymenis surinamensis (Colubridae)

    NARCIS (Netherlands)

    Myers, C.W.

    1974-01-01

    Introduction Tachymenis is a characteristic genus of colubrid snakes inhabiting extreme western South America, from coastal Peru and Chile east to Bolivia (Walker, 1945; Peters & Orejas-Miranda, 1970). An extralimital species in Brazil, Tachymenis brasiliensis Gomes, was referred to its own genus

  20. Sídliště kultury s moravskou malovanou keramikou u Slavíkovic a jeho postavení v kontextu západní periferie lengyelské oikumeny na Moravě

    Czech Academy of Sciences Publication Activity Database

    Bartík, J.; Vokáč, M.; Kuča, M.; Čerevková, A.; Prokeš, L.; Nývltová Fišáková, Miriam

    2016-01-01

    Roč. 57, č. 1 (2016), s. 59-85 ISSN 1211-7250 Institutional support: RVO:68081758 Keywords : Southwestern Moravia * Lengyel Culture * periphery * radiocarbon dating * paleoenvironment Subject RIV: AC - Archeology, Anthropology, Ethnology http://arub.avcr.cz/miranda2/export/sitesavcr/arub/prehled-vyzkumu/prehled-vydanych-cisel/files/PV-57-1_bartik.pdf

  1. Examining the Effects of School-Provided E-Readers on Middle School Students' Reading Ability

    Science.gov (United States)

    Brown, H. Quincy

    2016-01-01

    Nationwide, the increasing popularity of e-books is undeniable; sales of e-books increased an astounding 4,456% over a 5-year period. Researchers, Miranda, Johnson, and Rossi-Williams, determined that e-readers have a positive impact on students' desire to read. This study attempted to determine if the use of institution issued e-readers would…

  2. Do financial variables help predict the macroeconomic environment?

    Czech Academy of Sciences Publication Activity Database

    Havránek, T.; Horváth, R.; Matějů, Jakub

    2011-01-01

    Roč. 9, č. 2 (2011), s. 14-17 ISSN 1803-7089 Institutional research plan: CEZ:MSM0021620846 Keywords : macroeconomic environment * monetary restriction * financial system Subject RIV: AH - Economics http://www.cnb.cz/miranda2/export/sites/www.cnb.cz/en/research/research_publications/erb/download/ERB_No2_2011.pdf

  3. The Federal Role in Meeting the Education Needs of Chicanos and Puerto Ricans with Special Emphasis on Higher Education. Final Report.

    Science.gov (United States)

    Miranda (L.) and Associates, Bethesda, MD.

    Federal efforts to meet higher educational needs of Chicanos and Puerto Ricans are analyzed in this report. As part of a study conducted by L. Miranda and Associates, 15 Federal agencies were surveyed to determine their programs and their financial commitment to Hispanic postsecondary education, and the participation of Hispanics in each agency's…

  4. A comparison of neutron resonance absorption in thermal reactor lattices in the AUS neutronics code system with Monte Carlo calculations

    International Nuclear Information System (INIS)

    Robinson, G.S.

    1985-08-01

    The calculation of resonance shielding by the subgroup method, as incorporated in the MIRANDA module of the AUS neutronics code system, is compared with Monte Carlo calculatons for a number of thermal reactor lattices. For the large range of single rod and rod cluster lattices considered, AUS results for resonance absorption were high by up to two per cent

  5. Effect of lactic acid bacteria on the textural properties of an edible ...

    African Journals Online (AJOL)

    Rodrigo

    2013-05-08

    May 8, 2013 ... Dominguez-Lopez1, Leobardo Manuel Gómez-Oliván2 and Abdel-Fattah Z.M. Salem4,5*. 1Facultad de ..... Furthermore, Alvarez (2012) observed that a film with .... Ribeiro C, Antonio A, Vicente JA, Teixeira, Miranda C (2007).

  6. Přerov (k.ú. Předmostí, okr. Přerov). Přerov - Předmostí Ib - Hřbitov. Gravettien. Předstihový výzkum

    Czech Academy of Sciences Publication Activity Database

    Svoboda, Jiří; Novák, Martin; Schenk, Z.; Mikulík, J.; Sázelová, Sandra

    2010-01-01

    Roč. 51, 1/2 (2010), s. 294-295 ISSN 1211-7250 Institutional research plan: CEZ:AV0Z80010507 Keywords : Předmostí * Pleistocene * stratigraphy Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Archaeology http://arub.avcr.cz/miranda2/export/sitesavcr/arub/prehled-vyzkumu/prehled-vydanych-cisel/files/PV51_paleolit.pdf

  7. Dolní Věstonice (okr. Břeclav). Lokality II a III. Dozor nad stavebními pracemi, laboratorní výzkum

    Czech Academy of Sciences Publication Activity Database

    Svoboda, Jiří; Havlíček, P.; Novák, Martin; Sázelová, Sandra

    2017-01-01

    Roč. 58, č. 1 (2017), s. 142-143 ISSN 1211-7250 Institutional support: RVO:68081758 Keywords : Dolní Věstonice * Paleolithic * Gravettian Subject RIV: AC - Archeology, Anthropology, Ethnology http://prehled-vyzkumu.arub.avcr.cz/miranda2/ export /sitesavcr/arub-prehled-vyzkumu/prehled-cisel-a-clanku/prehled-vydanych-cisel/files/PV-58-1-paleolit.pdf

  8. Primárně zpracovatelská dílna na amfibolitové metabazity u Želešic

    Czech Academy of Sciences Publication Activity Database

    Bartík, J.; Krmíček, Lukáš; Rychtaříková, Tereza; Škrdla, Petr

    2015-01-01

    Roč. 56, č. 1 (2015), s. 31-57 ISSN 1211-7250 Institutional support: RVO:67985831 ; RVO:68081758 Keywords : Moravia * Brno Batholith * Neolithic * primary workshop * stone industry * metabasic rock Subject RIV: AC - Archeology, Anthropology, Ethnology http://arub.avcr.cz/miranda2/ export /sitesavcr/arub/prehled-vyzkumu/prehled-vydanych-cisel/files/PV56_1_studie_2.pdf

  9. Dvě koncentrace epigravettských artefaktů v Mohelně-Plevovcích

    Czech Academy of Sciences Publication Activity Database

    Škrdla, Petr; Bartík, J.; Rychtaříková, Tereza

    2015-01-01

    Roč. 56, č. 1 (2015), s. 9-29 ISSN 1211-7250 Institutional support: RVO:68081758 Keywords : Moravia * Mohelno * Late Upper Paleolithic * Epigravettian * backed rectangles Subject RIV: AC - Archeology, Anthropology, Ethnology http://arub.avcr.cz/miranda2/ export /sitesavcr/arub/prehled-vyzkumu/prehled-vydanych-cisel/files/PV56_1_studie_1.pdf

  10. Examining Diversity Research Literature in School Psychology from 2004 to 2010

    Science.gov (United States)

    Grunewald, Stephanie; Shriberg, David; Wheeler, Anitra S.; Miranda, Antoinette Halsell; O'Bryon, Elisabeth C.; Rogers, Margaret R.

    2014-01-01

    One indicator of school psychology's capacity to provide culturally responsive practice is the percentage of articles in leading school psychology journals that have a "significant diversity focus." To date, there have been three published empirical studies (Brown, Shriberg, & Wang; Miranda & Gutte; Rogers Wiese) that have…

  11. Vyhodnocení osteologických pozůstatků z výzkumu parcel domů Dominikánská 11–19 a Kobližná 3 v Brně. K otázce organizace zásobování měst masem ve vrcholném středověku

    Czech Academy of Sciences Publication Activity Database

    Nývltová Fišáková, Miriam; Procházka, Rudolf; Sůvová, Z.

    2016-01-01

    Roč. 57, č. 2 (2016), s. 95-175 ISSN 1211-7250 Institutional support: RVO:68081758 Keywords : Osteological findings * mediaeval city * High Middle Ages Subject RIV: AC - Archeology, Anthropology, Ethnology http://prehled-vyzkumu.arub.avcr.cz/miranda2/export/sitesavcr/arub-prehled-vyzkumu/prehled-cisel-a-clanku/prehled-vydanych-cisel/files/PV-57_2_studie-3.pdf

  12. Welcome to the Fun House: When Is a Children's Room Not a Children's Room? When It's The Trove

    Science.gov (United States)

    Kenney, Brian

    2006-01-01

    In this article, the author talks about The Trove, a children's space--library doesn't quite cut it--located in the White Plains Public Library, New York. Sandra Miranda, the library's director, came up with the idea for The Trove, although it took the work of many--from her staff to the architects to theatrical designers and fabrications--to…

  13. Raha varjatud hind / Peter Singer

    Index Scriptorium Estoniae

    Singer, Peter

    2008-01-01

    Kathleen Vohs, Nicole Mead ja Miranda Goode leidsid eksperimentide kaudu viisi, kuidas panna inimesed mõtlema rahast, ilma et neil seda otseselt teha kästaks. Rahast mõtlema suunatud katsealuste grupi käitumine erines suuresti teise grupi käitumisest

  14. Lagos Historical Review - Vol 13 (2013)

    African Journals Online (AJOL)

    Human Trafficking in Edo State (Nigeria): A Socio- Economic Study · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AA Lawal, 17-30. http://dx.doi.org/10.4314/lhr.v13i1.2 ...

  15. Features and perceptions of menopausal women in Benin City ...

    African Journals Online (AJOL)

    Methods: A descriptive cross-sectional study of 533 randomly selected Nigerian women in Benin City, Edo State who had experienced at least 24 continuous months of amenorrhea using a structured questionnaire. Results: The ages of the women studied ranged between 47 and 78 years; mean 57.4 ± 6.3 years. The mean ...

  16. Test anxiety, attitude to schooling, parental influence, and peer ...

    African Journals Online (AJOL)

    This study investigated test anxiety, attitude to schooling, parental influence, and peer pressure as predictors of cheating tendencies in examination among secondary school students in Edo State, Nigeria. Ex-post facto research design was adopted for the study. Using stratified random sampling technique, 1200 senior ...

  17. Spatio-Temporal Variation in Water Quality of Orle River Basin, S.W. ...

    African Journals Online (AJOL)

    Spatio-Temporal Variation in Water Quality of Orle River Basin, S.W. Nigeria. ... Abstract. The water quality of small streams in Auchi area of Edo State, S.W. Nigeria was investigated with a view to ... and ecosystems. The study was carried out

  18. Influence of job frustration, narcissism and demographic variables ...

    African Journals Online (AJOL)

    The study examines the hypothesised relationship among job frustration, narcissism, demographic variables and professional ethical behaviour among Nigerian Police officers. One hundred policemen drawn from four police divisions of Benin Area Command of Edo State participated in the study. There were 18 females ...

  19. Comparative Demand Analysis for Rice in Three States of South ...

    African Journals Online (AJOL)

    Dauda Omoba

    2013-01-01

    Jan 1, 2013 ... The contribution of the effect of the price of rice on the budget share of rice in the study ...... it is a luxury in rural areas of Delta state. This may imply that ... between brands of rice in rural Lagos and urban. Edo was the highest ...

  20. Effects of Plant Density and NPK Application on the Growth and ...

    African Journals Online (AJOL)

    Studies were conducted at Evboneka, Edo State, Nigeria in a forest zone to examine the effect of increasing plant population and NPK application on the growth and tuber yield of Dioscorea rotundata (Poir) cv “Obiaoturugo”. This study involved three trials. The first was conducted in 2010 involving five plant densities (10000 ...

  1. Farmers\\' Characteristics And Adoption Of Recommended Practices ...

    African Journals Online (AJOL)

    The study focused on farmers under the fadama project scheme in Edo State, Nigeria with emphasis on the relationship between farmers\\' characteristics and adoption of recommended technologies. Analyses of data obtained from a random sample of 80 respondents reveals that fadama farming was dominated by females ...

  2. Nigerian Journal of General Practice - Vol 11, No 1 (2013)

    African Journals Online (AJOL)

    Prevalence and pattern of Dyslipidaemia among adult hypertensives in the general pratice clinic of University of Benin Teaching Hospital, Benin City Edo State Nigeria · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. DD Uyagu, O Ebomwonyi, PO Dienye ...

  3. Parenting Styles as Predicators of Anxiety and Depression of In-School Adolescents in Nigeria

    Science.gov (United States)

    Adubale, Andrew A.

    2017-01-01

    The study investigates parenting styles as predictors of anxiety and depression in secondary school students in Edo State, Nigeria. It employed a correlation research design. Two hundred and forty students constituted the sample for the study. Parenting Style Scale questionnaire was used to collect data for the study. Linear regression was used to…

  4. l-moments approach for floo moments approach for floo okhuwan

    African Journals Online (AJOL)

    User

    Generalized Logistic distribution (GLO) and G distribution ... nnual maximum stream flow series for 20 years (1989-2008). e the best ... eter distribution models namely: Generalized Extreme Value distribu namely: .... Figure 1: Map of Edo state Nigeria showing location of study River in the Benin Owena River Basin. Table 2: ...

  5. Knowledge and Attitude of Public Secondary School Teachers ...

    African Journals Online (AJOL)

    The study investigated knowledge and attitude of public secondary school teachers towards continuous assessment (CA) practices in Edo Central Senatorial District, Nigeria. The study was undertaken to determine the influence of gender, age, years of experience and area of educational specialization on teachers' attitude ...

  6. Gender and environmental influence on laterality functions among ...

    African Journals Online (AJOL)

    Background: A semi‑structured questionnaire was designed to ascertain laterality functions in randomly sampled population of 400 preclinical students of the University of Benin, Benin City, Edo State, Nigeria. Methodology: Frequency in use of limbs in physical activities categorized as: Always if (>80%), usually if ...

  7. Author Details

    African Journals Online (AJOL)

    Experience from Benin, Edo State. Abstract PDF · Vol 39, No 2 (2012) - Articles Accuracy of mother's touch in assessing the presence of fever in children. Abstract PDF · Vol 39, No 2 (2012) - Articles Morbidity and mortality of childhood illnesses at the emergency paediatric unit of the University of Benin Teaching Hospital, ...

  8. Physicochemical, heavy metal and mineral elements assessment of ...

    African Journals Online (AJOL)

    The Benin-Agbor road is a major road linking Edo State and the Eastern states of Nigeria, characterized by daily vehicular movements. The inhabitants of the area depend on the river waters mainly for their domestic purposes. It was against the above background that this research was conducted in order to assess the ...

  9. Study habit skills as correlate of academic performance of ...

    African Journals Online (AJOL)

    Study habit is one of the major factors that could influence students' academic attainment. Thus, this study examined study habit skills as correlate of academic performance of undergraduates in Edo state, Nigeria. It employed a correlation research design, using multistage sampling technique. Two hundred and forty eight ...

  10. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 55 ... Vol 33, No 1 (2014), Coping strategies for marital stress as reported by ... On Managing Adolescents' Aggressiveness Among Senior Secondary ... of the gifted Students in the Inclusive classroom among secondary ... in the classroom among Secondary School teachers in benin - City, Edo State, Abstract.

  11. impact of quality improvement in primary schools (quips) programme ...

    African Journals Online (AJOL)

    Elizabeth

    teachers in the school as well as the assistance that the programme has given to ... Edo Journal of Counselling. Vol. 2, No .... and compulsory at least at the elementary level. ... in order to get the opinions of the members of the Parent Teachers.

  12. THE PERFORMANCE PRACTICE IN AYELE MUSIC AND DANCE ...

    African Journals Online (AJOL)

    ABSTRACT. This paper focuses on Ayele music and dance of the Unuwazi village in Uromi, Esan North East Local Government Area of Edo State. It examines the term Ayele, its tradition of origin, its musical instruments, context of performance and performance practices. So as to be able to elicit data from the field, ...

  13. Attitude o f librarians towards the use of Information and ...

    African Journals Online (AJOL)

    Attitude o f librarians towards the use of Information and Communication Technology in some selected Nigerian Universities in Edo and Delta State , Nigeria. ... Furthermore, knowledge of IC T and training of librarians influence positive attitude towards ICT. Based on the findings, it is recommended that all librarians who do ...

  14. An Empirical Investigation of Some Social and Economic ...

    African Journals Online (AJOL)

    This study explored the level of some socio-economic remittances from relatives to the elderly in Edo Central. It focused on the range of income/financial assistance; revealed the regularity of assistance with food, clothing, laundry and medicine. A total of 514 respondents, 65 years and above, selected by systematic random ...

  15. The Relationship Between Library Development and Students ...

    African Journals Online (AJOL)

    The study examined the level of development of school libraries in privately owned secondary schools in five local government areas of Edo State and the influence of the school libraries on students' academic performances. Random sampling was used to select 48 out of a total of the 83 private schools in the study area.

  16. Economic analysis of the marketing of plantain: a case study of ...

    African Journals Online (AJOL)

    This study concentrated on economic analysis of the marketing of plantain in Uhunmwode and Ovia North East Local Government Areas of Edo State. Six markets, made up of three from each local governmnet were selected because of their high population of plantain marketers and their approximate equal sizes.

  17. Strategic Implications of Emerging Threats to West African Countries

    Science.gov (United States)

    2012-03-14

    foresters are smaller and as their name suggests seek refuge in the forests (the Ibo, the Edo, the Yoruba , the Nupe, the Ashanti, the Fon, the Kru, the...secession of the southeastern provinces of Nigeria as the self-proclaimed Republic of Biafra. The conflict stemmed from economic, ethnic, cultural and

  18. International Journal of Basic, Applied and Innovative Research ...

    African Journals Online (AJOL)

    Prevalence and association of asymptomatic prostatitis with urinary tract infection among apparently healthy men in Ekpoma, Edo, Nigeria · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AA Turay, AI Obadan, GRA Okagun, MA Okadua, AEJ Okwori, 72-79 ...

  19. ETHNOBOTANICAL STUDIES OF WEST AFRICAN OKRA ...

    African Journals Online (AJOL)

    Administrator

    18-87 years old. Of this number, 259 (48%) ... Traditional uses of the crop include food (100%) and non- ... inter-relationship studies between people and plants in the ..... of economic plants sold in the market of Benin City (Edo State). Nigeria.

  20. Ultraviolet spectroscopic evaluation of bioactive saponin fraction ...

    African Journals Online (AJOL)

    This study was to evaluate and characterize the saponin principles, using chromatographic and ..... triterpenoids, reducing sugars, amino acids, flavonoids, ..... blood glucose levels of diabetic rats. Int. J. Biol. Chem. ... homeostatic plants in Edo and Delta. States of ... mellitus: Systematic review and meta- analysis. BMJ,.

  1. Attitudinal and motivational factors influencing job performance of ...

    African Journals Online (AJOL)

    The study investigated the attitudinal and motivational factors influencing job performance of female extension agents in Edo State, Nigeria. A random sample of 35 female extension agents was selected for the study. Findings reveal that the majority of the respondents (57.1%) were in the age group of 31 – 40 years and ...

  2. Self-esteem, gender, family-communication-style and parental ...

    African Journals Online (AJOL)

    This study examined the role of self-esteem, gender, family communication style, and parental neglect on aggressive tendencies among secondary school adolescents' in Esan West Local Government Area of Edo State. A total of two hundred and forty (240) secondary school adolescents drawn from 9 private and 3 public ...

  3. Prevalence of obesity in nigerians with type 2 diabetes mellitus seen ...

    African Journals Online (AJOL)

    Background: Obesity increases the cardiovascular disease burden in type 2 diabetes mellitus (DM). There are few reports on obesity in type 2 DM patients in Edo State, Midwestern Nigeria. Objective: To determine the prevalence of obesity in Nigerians with type 2 DM seen in a secondary medical center. Methods: This was ...

  4. Effects of counselling techniques in rehabilitating emotional ...

    African Journals Online (AJOL)

    This study investigated the effectiveness of Rational Emotive therapy (RET) and Systematic Desensitization (SD) in promoting emotional adjustment among adolescents in Edo state. Quasi Experimental design was used for the study. A total number of eighty four (84) students were randomly selected for the study and three ...

  5. Assessment of water quality of Ogbese River in Ovia North-East ...

    African Journals Online (AJOL)

    The pollution of Ogbese River in Ovia North-East L.G.A. of Edo State, Nigeria was studied. Parameters like pH, temperature, electrical conductivity, colour, odour, chlorides, nitrates, phosphates and heavy metal ions such as lead, chromium, zinc etc, were analyzed. Also various techniques such as titrimetric methods, atomic ...

  6. Ethno veterinary practices of small ruminant livestock farmers in ...

    African Journals Online (AJOL)

    Data were collected from a total of 400 ruminant livestock farmers selected from Oyo, Ogun, Lagos, Ondo and Edo States of Nigeria using Multi-stage sampling technique. The data collected include the specific attributes of small ruminant livestock farmers in the area, ethno-veterinary practices of farmers in the treatment of ...

  7. Phytochemical screening and antimicrobial evaluation of the ...

    African Journals Online (AJOL)

    Piper umbellatum is widely distributed tropical plant species. The plant has been reported to possess an array activity including anti-inflammatory, antioxidant, antifungal, analgesic and skin protection. It is consumed as a vegetable and used ethnomedicinally in the treatment of stomach pain in Edo state, Nigeria.

  8. Assessing the knowledge of asthma among community pharmacists ...

    African Journals Online (AJOL)

    Purpose: To assess the knowledge of community pharmacists about asthma and its management. Methods: Seventy-six registered community pharmacists in. Edo State completed a structured questionnaire consisting of open and close ended questions which addressed issues relating to their knowledge of asthma

  9. Pre-colonial economy of Igala society | Achoba | Nigerian Journal of ...

    African Journals Online (AJOL)

    Throughout the vicissitude of history, man has always moved from one place to another in search for better economic activities. Hence, Igala people developed long distance trade with their neighbours such as the Yoruba, Igbo, Nupe, Tiv, Idoma, Edo and others around them. This type of economy brought a considerable ...

  10. Assessment of training needs of extension staff of agricultural ...

    African Journals Online (AJOL)

    The study identified strong training needs for Edo State extension agents on communication skills (X= 4.60), planning demonstration (X=4.60), evaluation of trials (X= 4.57) and farmers training (X=4.56). The correlation analysis showed that education had significant relationship many areas of the respondents' training ...

  11. Browse Title Index

    African Journals Online (AJOL)

    Items 401 - 450 of 917 ... Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives ... Vol 17, No 4 (2017), Factors associated with anaemia status and ... breastfeeding practices in Edo state, Nigeria, Abstract PDF ... Vol 8, No 3 (2008), Factors likely to enhance mycotoxin introduction into the human ...

  12. Author Details

    African Journals Online (AJOL)

    Adubale, AA. Vol 33, No 1 (2014) - Articles Predictive value of parenting styles on the academic achievement of adolescent students in Edo State, Nigeria. Abstract. ISSN: 0189-0263. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners ...

  13. Biochemical assessement of liver enzymes in immunocompromised ...

    African Journals Online (AJOL)

    Aim: This study aims at the estimation of serum alkaline phosphatase (ALP), alanine aminotransferase (ALT), Aspartate aminotransferase (AST), and glutmyltransferase GGT (Liver enzymes) in Human immunodeficiency virus(HIV) and/or Acquired immune deficiency syndrome(AIDS) patients in parts of Edo State, Nigeria.

  14. Ethnobotanical studies of west african okra [ Abelmoschus caillei (a ...

    African Journals Online (AJOL)

    It is produced in traditional agriculture especially when other vegetables are not in season and an important cash crop in the local economy. This study is aimed at generating information and documenting the ethnobotany of A. caillei via the indigenous knowledge among tribes of Delta, Edo and Ondo States of Nigeria).

  15. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 1215 ... Journal Home > Advanced Search > Browse Title Index. Log in or ... Vol 12, No 1 (2018), Analysis of the effects of frequent strikes on academic performance of students in universities in Nigeria: Edo State as a focal point, Abstract PDF ... Vol 6, No 1 (2012), Appraisal as a Determinant for Adequate ...

  16. Original Researc Original Research

    African Journals Online (AJOL)

    RAGHAVENDRA

    2009-09-17

    Sep 17, 2009 ... agriculture systems in Edo state, Nigeria and char ... were inferred as different varieties of the species of th ... tate, Nigeria and characterize them using molecular marker ... Article Information ... The development of Polymerase Chain Reaction (PCR) ... Quarters, University of Benin Teaching Hospital.

  17. assessment of the activity of glucose-6-phosphate dehydrogenase

    African Journals Online (AJOL)

    Uwaifoh

    2012-10-31

    Oct 31, 2012 ... Chemical Pathology, Irrua Specialist Teaching Hospital, Irrua, Edo ... in type 2 diabetes mellitus patients and control subjects using enzymatic ... inappropriate antioxidation process. ... without a previous diagnosis of diabetes develop a ... variants. It confers protection against malaria, which accounts for its ...

  18. A Comparative Analysis of Profitability of Broiler Production Systems ...

    African Journals Online (AJOL)

    This study investigated the cost implications of raising broilers under the battery cage and deep litter system of poultry production. The data used in the study were obtained from a cross-sectional survey of broiler farmers in Edo State from October– December, 2013. A multi-stage sampling process was used to select the 211 ...

  19. Annals of Biomedical Sciences - Vol 17, No 1 (2018)

    African Journals Online (AJOL)

    Assessment of career specialty preferences among medical students at the University of Benin, Benin city, Edo state · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. O.E. Obarisiagbon, G. Owoeye, J.C. Chukwu, V. Onwuchekwa ...

  20. Human serum protein and C-reactive protein levels among HIV ...

    African Journals Online (AJOL)

    Human serum protein and C-reactive protein levels were determined among HIV patients visiting St Camillus Hospital, Uromi, Edo State, Nigeria, between January to March, 2013. Fifty (50) HIV patients (20 males; 30 females) and 50 control subjects (24 males; 26 females) were enrolled for this study. The clinical status of ...

  1. High Prevalence of Vitamin A Deficiency in School Age Children in ...

    African Journals Online (AJOL)

    One hundred and fifty two children aged 6 to 12 years were randomly selected from10 out of 33 public primary schools in a Local Government Area of Edo State, Nigeria, to assess their plasma Vitamin A levels. Bessey's spectrophotometric method of ultraviolet destruction of vitamin A was used for determination of their ...

  2. Parents' occupation as correlate of students' career aspiration in ...

    African Journals Online (AJOL)

    This study investigated the relationship between parents' occupation and students' career aspiration in public secondary schools in Esan West Local Government Area of Edo State. The correlational research design was adopted for the study. A sample of 320 students was drawn for by simple random sampling technique ...

  3. Seroprevalence of Hepatitis C Virus in People Exposed to ...

    African Journals Online (AJOL)

    This study was therefore undertaken to determine the seroprevalence of hepatitis C virus (HCV) infection in people who had been exposed to traditional surgical practices in Edo State, Nigeria. Sera from the subjects were tested for HCV antibodies using Clinotech Diagnostic test device supplied by Clinotech Diagnostic and ...

  4. Case Report of A Baby with Suspected Vacterl Constellation ...

    African Journals Online (AJOL)

    A term, normal birth weight, appropriate for gestational age, male infant born in a private hospital in Delta State and referred to University of Benin Teaching Hospital, Benin City, Edo State on account of his abdominal and limb defects. The baby had multiple birth defects consistent with a diagnosis of VACTERL association.

  5. Download this PDF file

    African Journals Online (AJOL)

    UNIBEN

    Background: Emergency contraception (EC) refers to the use of drugs or a device as an emergency measure ... Methods: A descriptive cross-sectional study was carried out on 400 male students of the. University of ... University of Benin, Benin City, Edo State, Nigeria. E-mail: ..... pill,. IUD. 2013.www.nhs.uk/conditions/contra.

  6. Annals of Biomedical Sciences

    African Journals Online (AJOL)

    Awareness of health risks associated with body piercing and tattooing among tertiary students in Auchi, Edo state, Nigeria · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. T.A. Ehwarieme, F.O. Amieghemie ...

  7. Awareness of health risks associated with body piercing and ...

    African Journals Online (AJOL)

    Recently, there has been a widespread practice of tattooing and body piercing among youths despite the increased number of potential complications associated to the practice. This study aims to assess the awareness of health risk associated with body piercing and tattooing in Federal Polytechnic Auchi, Edo state.

  8. Factors Militating Against Effective Implementation of the 6-3-3-4 ...

    African Journals Online (AJOL)

    Nneka Umera-Okeke

    4 education policy in Nigeria, using Esan North East Local Government Area of Edo. State as a case study. ... Human Rights (1948), the International Covenant on Economic, Social and Cultural .... The following research questions were formulated to guide this study: (a) Does ... The role of technical education in South.

  9. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Author Affiliations. Carlos F Linares1 Freddy Ocanto1 Pablo Bretto1 Maricela Monsalve1. Unidad de Síntesis de Materiales y Metales de Transición, Facultad de Ciencias y Tecnología, Departamento de Química, Universidad de Carabobo, Valencia, Edo. Carabobo, Apartado Postal 3336, Venezuela ...

  10. 36 Dry Season Phytoplankton Composition Of Ibiekuma Dam ...

    African Journals Online (AJOL)

    `123456789jkl''''#

    freshwater algae of Edo State. To benefit from ... Algae. (phytoplankton) are the source of oxygen in aquatic systems and are the main ... be used in determining water pollution level. A dam is a ... taken in situ, using a mercury in bulb glass.

  11. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 319 ... Vol 24, No 3 (2017), Effect of age and gender on lipid profile in healthy rural population of Edo State, Nigeria, Abstract. J.O. Idemudia, H.F. Idogun ... Vol 18, No 2 (2011), Effects of Oral Administrationof Nicotine on Blood Glucose, Electrolytes and Lipid Profile in Albino Rats, Abstract. IP Oyeyipo, Y Raj, ...

  12. Errata: Reasons For Tooth Extraction Among Nigerian Children ...

    African Journals Online (AJOL)

    Dental caries was the predominant reason for exodontia in Nigeria children attending a general dental practice in Uselu, Edo State. Extensive prevention programmes targeted at children with high caries risk in schools and the communities is a necessity. Key words: exodontia, reasons, children, general dental practice ...

  13. The Concept of Illness and Musical Intervention Among Members of ...

    African Journals Online (AJOL)

    The healing effect of music on man is very significant in most parts of the world. However, not much has been done by African researchers to study music and the ailments it heals especially among the peoples of Nigeria. This work examines the therapeutic effect of music in Iyayi society of Esan community, Edo state of ...

  14. A contrastive study of two varieties of Onicha and the Central Igbo ...

    African Journals Online (AJOL)

    Igbo is also a minority language of the people of Delta, Rivers, and Edo states in the present south-south geopolitical zone. It is fraught with numerous dialects which can be arranged in clusters. Some Igbo linguists recognize merely two major dialect areas, namely Onicha (Onitsha) and Owere (Owerri) on which this study is ...

  15. Download this PDF file

    African Journals Online (AJOL)

    FIRST LADY

    Determinants of Rural Development in Edo State, Nigeria: An Overview (Pp ... half of this population is without proper-formal education (World Bank. 2005). Data for this ..... forestry, tourism) based on rural resources. The identification ... Olayide, B. (2002) Sustainable Settlement Development Constraints and. Strategies.

  16. A survey of the parasites of the African white-bellied pangolin ...

    African Journals Online (AJOL)

    Phataginus tricuspis) in Edo State, Nigeria. They were purchased at Ekiuwa Market in Benin City, where they are sold and people consume the meat as a good source of protein and the animal can also be used for medicinal purposes. Four (4) ...

  17. Health Workers' Knowledge of Preventing Mother-To-Child ...

    African Journals Online (AJOL)

    Health Workers' Knowledge of Preventing Mother-To-Child Transmission of HIV in Benin City, Edo State, Nigeria. ... The proportion of health workers with poor, fair, and good knowledge of the national guidelines on PMTCT was 8.5%, 30.4% and 61.1% respectively. Knowledge of the national guidelines was significantly ...

  18. JMBR Journal - dec 2012 - gan...

    African Journals Online (AJOL)

    Mrs Musa

    Benin City, Edo State, Nigeria. It provides specialist medical services, including ophthalmic services. ... Benin Teaching Hospital, Benin City, Nigeria - A Preliminary Report.....45 about where to get eye care services, patient For the .... rate, and with good surgical outcome will. 1. Patel D, Baker H, Murdoch I. Barriers to uptake.

  19. A Study of the Constraint to Formulation and Implementation of ...

    African Journals Online (AJOL)

    In recent years, Benin metropolis has been faced with solid waste management problems. Solid wastes generated from household and commercial activities are dump indiscriminately in the metropolis. The Edo state government has made effort in policy formulation and funding in line with the national policy on the ...

  20. Vocational interest, counselling, socioeconomic status and age as ...

    African Journals Online (AJOL)

    The aim of the study was to investigate the relationship between vocational interest, counselling, socio-economic status and age on re-entry of girls into school in Edo State. One research hypothesis was formulated to guide the study. The design was correlational. Five research instruments were used: they are the Modified ...

  1. Letters and Viewpoints Studies on the Effect of Laundry Effluent on ...

    African Journals Online (AJOL)

    topsoil, laundry effluent, soil physiochemical properties, pH, available phosphorus, exchangeable sodium, potassium, exchangeable sodium percentage, percentage base saturation, soil buffering capacity, cation exchange capacity, Edo, Nigeria Résume Des résidus issus des blanchisseries ont toujours prouvé leur effet ...

  2. 1448-IJBCS-Article-Orjiekwe Chike

    African Journals Online (AJOL)

    hp

    The pollution of Ogbese River in Ovia North-East L.G.A. of Edo State, Nigeria was studied. Parameters like pH ... Keywords: Water pollution, environment, water analysis. INTRODUCTION ..... metal pollution in streams in Zhozhon city in China.

  3. Women's land rights and the challenge of patriachy: lessons from ...

    African Journals Online (AJOL)

    Women's land rights and the challenge of patriachy: lessons from ozalla community, edo state, Nigeria. ... production output and ensuring higher incomes. KEYWORDS: Cultural practices, customary, economic life, food crisis, food production, gender equity, land rights, patriarchy, rural agriculture, rural areas, social justice ...

  4. Attitude and Motivation as Predictors of Academic Achievement of Students in Clothing and Textiles

    Science.gov (United States)

    Uwameiye, B. E.; Osho, L. E.

    2011-01-01

    This study investigated attitude and motivation as predictors of academic achievement of students in clothing and textiles. Three colleges of education in Edo and Delta States were randomly selected for use in this study. From each school, 40 students were selected from Year III using simple random technique yielding a total of 240 students. The…

  5. Perinatal mortality in a rural community | Ewah | East African Medical ...

    African Journals Online (AJOL)

    Objective: To determine the peri-natal mortality rate (PMR), still birth rate (SBR) and early neonatal death rate (ENDR) in Igueben Local Government Area (LGA) of Edo State. Design: A descriptive cross-sectional study. Setting: Igueben LGA is a rural governmental unit in mid-western Nigeria. Subjects: All women of ...

  6. Relationship between relative humidity and the dew point ...

    African Journals Online (AJOL)

    This research was aimed at determining the relationship between relative humidity and the dew point temperature in Benin City, Edo State, Nigeria. The dew point temperature was approximated from the measured air temperature and relative humidity with the aid of a currently self-designed weather monitoring system.

  7. Author Details

    African Journals Online (AJOL)

    Omotunde, EE. Vol 4, No 1 (2014) - Articles Prevalence of conduct disorder among adolescents in a senior secondary school in Benin City, Edo State, Nigeria Abstract. ISSN: 2026-6081. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's ...

  8. Prevalence of conduct disorder among adolescents in a senior ...

    African Journals Online (AJOL)

    The study investigated the prevalence of conduct disorder among adolescents in a senior secondary school in Benin City. This was a survey study. The population was made up of 1,540 students in one of the mixed schools that was randomly selected from the senior secondary schools in Benin City, Edo State Nigeria.

  9. Population dynamics of Rodents and Insectivores in lowland tropical ...

    African Journals Online (AJOL)

    The community structure of rodents and insectivores in the lowland tropical rainforest of Okomu National Park, Edo State, Nigeria was assessed using a combination of live-trapping and sighting techniques during the dry and wet seasons. Seventeen species (14 species of rodent, 3 species of insectivores) were captured, ...

  10. Preliminary experiment research of explosively driven opening switch

    International Nuclear Information System (INIS)

    Li Xiaolin; Chen Dongqun; Li Da; Cao Shengguang; Chen Yingcong

    2010-01-01

    In pulse power technology field, many loads require high current pulse with fast risetime, but sometimes, the common high current pulse powers don't satisfy request, thus there need pulse erection switches of sorts to shorten pulse risetime. Explosively driven opening switch (EDOS) is a good choice, it has simple structure and excellent performance, the primary parameters of EDOS are opening time, opening resistance, opening current and dissipation energy, which determine its performance and range for applications. For this, two kinds of EDOS are designed and manufactured, in the later experiments, the power supply is a 200 μF capacitor and the conductor is 0.03 mm copper foil, the results indicate that the two kinds of EDOS have good performance, the opening time is about 1-3 μs, the opening resistance is about 1-2 Ω, the opening current is about 24-31 kA and the average dissipation energy is about 0.125-0.34 kJ per groove, the capability of conduction current is adjusted by the thickness of conductor along with different opening current. (authors)

  11. Maize cob losses and their effects on the poverty status of maize

    African Journals Online (AJOL)

    This study analysed fresh maize cob losses and its effect on the poverty status of maize farmers in Edo State,. Nigeria. The specific .... is the poverty gap for ... Total cost. 162,367.48. 100.00. Returns. Total expected yield (N). 327,966.63. _.

  12. Helminth parasites of Silurana tropicalis from the Okomu National ...

    African Journals Online (AJOL)

    Silurana tropicalis, the edible clawed-frog, collected from the Okomu National Park, Edo State, Nigeria, was examined for helminth parasitic infections. From 142 specimens collected, ten endo-helminth parasites spread across four classes were recovered. These included Cestoda: Cephalochlamys compactus and the cyst ...

  13. Author Details

    African Journals Online (AJOL)

    Enabulele, EE. Vol 33, No 1 (2012) - Articles Helminth Community of Tree frogs at the Okomu National Park, Edo State, Nigeria Abstract · Vol 33, No 1 (2012) - Articles Ecto and Gastrointestinal Parasites of Captured Wild Pigeons in Benin City, Nigeria Abstract. ISSN: 1117-4145. AJOL African Journals Online. HOW TO USE ...

  14. Bacterial Isolates from Blood Samples of Patients in University of ...

    African Journals Online (AJOL)

    Bacterial Isolates from Blood Samples of Patients in University of Benin Teaching Hospital Benin City, Edo State, Nigeria. ... The thioglychollate broth was sub cultured onto blood agar plate for anaerobic incubation, while the brain heart infusion broth was sub cultured onto chocolate, blood agar and McConkey agar for ...

  15. Supracondylar and infratubercular processes observed in the ...

    African Journals Online (AJOL)

    SERVER

    2007-11-05

    Nov 5, 2007 ... 1Department of Anatomy, School of Basic Medical Sciences, Igbinedion University, Okada, P.M.B. 0006, Benin City,. Edo State. Nigeria. 2Department ... reliance on computer imaging in diagnostic medicine. (Harry et al., 1997). ... origins, because the proximal epiphyses are absent. The proximal epiphysis ...

  16. EJOTMAS: Ekpoma Journal of Theatre and Media Arts: Submissions

    African Journals Online (AJOL)

    The contributor must be consistent in the use of either the MLA or APA style. Footnotes to the text should be avoided. All articles, correspondence and enquiries should be sent to: The Editor. EJOTMAS: Ekpoma Journal of Theatre and Media Arts. Department of Theatre and Media Arts,. Ambrose Alli University, Ekpoma, Edo ...

  17. Author Details

    African Journals Online (AJOL)

    Ofevwe, GE. Vol 22, No 1-2 (2010) - Articles Evaluation of the performance of primary schools in Oredo Local Government Area of Edo State in the school health programme. Abstract PDF. ISSN: 0794-7410. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More ...

  18. Trichomonas vaginalis infection among adolescent girls in some ...

    African Journals Online (AJOL)

    Trichomonasvaginalisis the most common non-viral sexually transmitted disease (STD) and one of the neglected parasitic infections. This study aimed to determine the prevalence of T. vaginalisinfection among adolescent girls in some secondary schools in Edo State, Nigeria. A total of 272 girls were recruited in this study.

  19. Nigerian Journal of Horticultural Science - Vol 6, No 1 (2002)

    African Journals Online (AJOL)

    The Economic Potentials of Pineapple Marketing in Edo State, Nigeria. EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. G.O. Alufohal, 20-24. http://dx.doi.org/10.4314/njhs.v6i1.3340 ...

  20. The Influence of Gender on Junior Secondary School Students ...

    African Journals Online (AJOL)

    This paper is on the influence of gender on junior secondary school student's attitude towards mathematics in Ovia North East local government area of Edo state. The descriptive survey design was employed for the study. The population of the study comprised of all the JSS3 students, a total of Three Thousand Six Hundred ...

  1. Serological markers of hepatitis B infection in infants presenting for ...

    African Journals Online (AJOL)

    owner

    2012-12-29

    Dec 29, 2012 ... birth. Key words: Serological markers, hepatitis B. first infant immuniza- tion. Introduction. Universal infant immunization has been recommended since 1992 by the World ... to the inhabitants of Benin City, the capital of Edo state,. Nigeria. .... Of the 13(52%) that were done at home 5(38.5%) were carried out ...

  2. Effect of Consuming Rooftop Harvested Rainwater from Esan ...

    African Journals Online (AJOL)

    MICHAEL HORSFALL

    ABSTRACT: This study assessed the effects of some local sources of drinking water in. Okiagbem, Uromi and Ubiaja communities of Esan Edo State Nigeria on the biochemical, ... International reviews have shown that .... failure multiple myeloma, nutritional deficiencies etc. ..... Caffeine effects on short-term performance.

  3. Nature of ergastic substances in some Poaceae seeds

    African Journals Online (AJOL)

    ajl yemi

    2011-08-29

    Aug 29, 2011 ... 2Department of Botany, Ambrose Alli University, PMB. 14, Ekpoma, Edo State, Nigeria. Accepted 6 May, 2011. Seeds of 48 species of Poaceae were examined for the presence of alkaloid, protein, fats and oil, inulin, starch and tannins. All taxa investigated indicated the presence of starch, fats and oils and ...

  4. Evaluating Basic Technology Instruction in Nigerian Secondary ...

    African Journals Online (AJOL)

    It is an important technique which when appropriately adopted results into effective teaching and learning of practical subjects. This study focused on identification of evaluating techniques aimed at improving the teaching of Basic technology in Edo State. The area of study comprises of the eighteen Local Government Areas ...

  5. Journal of Community Medicine and Primary Health Care - Vol 30 ...

    African Journals Online (AJOL)

    Assessment of occupational hazards, health problems and safety practices of petrol station attendants in Uyo, Nigeria · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL ... Fitness to drive among commercial intercity drivers in Benin-City, Edo State · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT

  6. International Journal of Basic, Applied and Innovative Research ...

    African Journals Online (AJOL)

    The incidence and pattern of supernumerary digital flexion creases amongst the population of Ekpoma in Edo, Nigeria · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. VA Uko, AO Nwaopara, MA Olugbenga, GP Oyadonghan, P Imah, D Aimiosior, 57 - 62 ...

  7. Estimation Of Measles Sero-conversion in Children Vaccinated ...

    African Journals Online (AJOL)

    A study of seroconversion of 115 children between 9 months to 5 years vaccinated against measles was conducted in Oriowon local government area of Edo State. This has to establish the immune status of the children against measles after immunisation. Haemagglutination inhibition technique was used. Prevaccination ...

  8. Assessment of serum biochemistry in West African Dwarf (WAD ...

    African Journals Online (AJOL)

    Jane

    2011-06-29

    Jun 29, 2011 ... in our local breeds of goats such as West African Dwarf. (WAD) does. ... Farm, Faculty of Agriculture, Ambrose Alli University, Ekpoma in. Edo State ... degree North and latitude 6 degree North located in the rainforest zone of ...

  9. growth and physiological performance of west african dwarf goats

    African Journals Online (AJOL)

    user

    2014-09-02

    Sep 2, 2014 ... Faculty of Agriculture, University of Benin, Benin, Edo State, Nigeria. ... Twenty young growing West African Dwarf (WAD) goats of both sexes with an average body weight of 5.77kg ... Northern part of the country (Ugwu and.

  10. West African Journal of Medicine - Vol 29, No 2 (2010)

    African Journals Online (AJOL)

    Pregnancy Associated with Recurrent Acromegaly: A Case Report · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AE Edo, A Eregie. http://dx.doi.org/10.4314/wajm.v29i2.68207 ...

  11. Author Details

    African Journals Online (AJOL)

    Geophysical Exploration of Gravel Deposits in Abudu Area of Edo State, Nigeria Abstract · Vol 20, No 1 (2012) - Articles Transformation of the Hubbard Hamiltonian to the t-J Hamiltonian using the Raleigh- Schrodinger Perturbation Expansion Abstract. ISSN: 1116-4336. AJOL African Journals Online. HOW TO USE AJOL.

  12. Female Genital Mutilation

    African Journals Online (AJOL)

    FINEPRINT

    Community, Edo State, to help develop programs and interventions to curtail this harmful cultural practice. A community based ... 95%CI=0.028-0.869; p=0.034) and attitude towards FGM (OR=0.115; 95%CI=0.056-0.235; p?0.001)were identified as ..... Nigeria and ICF International.Nigeria. Demographic and Health Survey ...

  13. Author Details

    African Journals Online (AJOL)

    Isibor, J P. Vol 14, No 2 (2005) - Articles Chlamydia trachomatis Infecion Among Apparently Healthy Students of Ambrose Alli University Ekpoma, Edo State, Nigeria Abstract. ISSN: 1116-1043. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL ...

  14. Female access to basic education: a case for open distance learning ...

    African Journals Online (AJOL)

    The purpose of this study was to investigate the impact of Open Distance Learning (ODL) on the female access to basic education. The population of the study consists of all lecturers/teachers of ODL centres in Benin City, Edo State. Five ODL/Community Resource Study centres were identified and used for the study.

  15. Author Details

    African Journals Online (AJOL)

    Abstract · Vol 15, No 1 (2016) - Articles Undergraduates' view of lecturers' age as a factor in their teaching effectiveness. Abstract PDF · Vol 15, No 1 (2016) - Articles Test anxiety, attitude to schooling, parental influence, and peer pressure as predictors of students cheating tendencies in examination in Edo state, Nigeria

  16. Medical cost of Lassa fever treatment in Irrua Specialist Teaching ...

    African Journals Online (AJOL)

    This cross-sectional study sought to estimate the direct medical cost of Lassa fever treatment on patients in South-South Nigeria. All the 73 confirmed Lassa fever cases admitted in the isolation ward of the Institute Of Lassa Fever Research and Control, Irrua Specialist Teaching Hospital (ISTH) Irrua, in Edo State, Nigeria, ...

  17. Download this PDF file

    African Journals Online (AJOL)

    AFFECTING THEIR AGRICULTURAL PRODUCTIVITY 'IN EDO STATE,. NIGERIA .... Divorce 2 1.7. Widow/widowed 3 ' 2.5. 40 .... as also reflected in Table 2 when illiteracy was rated high as one of the factors affecting prevalence of health ...

  18. Relationship between Knowledge and Attitude towards HIV ...

    African Journals Online (AJOL)

    The study assessed the relationship between knowledge and attitude towards HIV voluntary counselling among secondary school adolescents in Edo State. One hypothesis guided the study. This was a descriptive correlational study based on survey research design. The population of the study was one hundred and ...

  19. Federal government financing of grassroots decay in Nigeria: the ...

    African Journals Online (AJOL)

    ... self-reproduction project typical of patron-client politics. In this context, it is assumed that phenomenal growth in statutory and allied revenues accruing to rural locales has not produced the desired development, but undesired decay. Key Words: Nigeria – Federal financing, Edo State, public administration, political science ...

  20. Indications for Surgical Removal of the Eye in Irrua, Nigeria | Enock ...

    African Journals Online (AJOL)

    Objective: To determine the reasons for removal of the eye at the. Irrua Specialist Teaching hospital, Irrua, Edo State, southern Nigeria. Method: A retrospective study of all cases of enucleation and evisceration carried out over a 10-year period – July 1997 to June 2007 – at the Irrua Specialist Teaching Hospital. Data

  1. Fitness to drive among commercial intercity drivers in Benin-City ...

    African Journals Online (AJOL)

    Background: Unfit drivers are prone to road traffic accident, therefore their health is paramount in ensuring the safety of road users. To determine the fitness to drive among commercial intercity bus drivers in Benin City, Edo State Material and methods: A descriptive cross-sectional study was conducted among 194 ...

  2. Characteristics of Commercial Motorcyclists in Benin City ...

    African Journals Online (AJOL)

    The aim of this paper is to evaluate the characteristics of commercial motorcyclists in Ugbowo, Benin-city. A cross-sectional and descriptive study was carried out among commercial motorcyclists in Ugbowo, Benin-city, Edo State. A total of 252 commercial motorcyclists were involved in the study. A cluster sampling method ...

  3. The challenges facing commercial motorcycle occupation in Etsako ...

    African Journals Online (AJOL)

    This study examined the challenges facing commercial motorcycle occupation in Edo State, Nigeria. A descriptive survey design was adopted. Data were collected through questionnaires and in-depth interviews (IDIs) among selected motorcyclists, police officers and road safety officials in Etsako West Local Government ...

  4. The crustacean zooplankton assemblage of a relatively pristine Utor ...

    African Journals Online (AJOL)

    The water quality and crustacean zooplankton of Utor River, a relatively pristine freshwater body in Edo State, Nigeria was investigated at four stations. The Utor River is slightly acidic, well oxygenated, oligotrophic and low in solids, conductivity, cations and heavy metals. A total of 380 individuals comprising eleven taxa ...

  5. Assessment of the Adequacy of Instructional Resources in Business Education Programmes Relative to NCCE Standards for Colleges of Education in Nigeria

    Science.gov (United States)

    Onyesom, Moses; Okolocha, Chimezie Comfort

    2013-01-01

    The study assessed the adequacy of instructional resources available for business education programmes at the colleges of education in Edo and Delta states of Nigeria in relation to the standards stipulated by the National Commission for Colleges of Education (NCCE). The study adopted the ex-post facto research design and was guided by five…

  6. Evaluation of Questionnaire, Reagent Strip and Egg Count as ...

    African Journals Online (AJOL)

    A longitudinal study covering 55 months evaluated the three diagnostic tools used for confirmation of prevalence of urinary schistosomiasis among 1151 consented primary school pupils in 13 communities of Edo State, Nigeria. Questionnaire, reagent strip method and parasitological examination were employed.

  7. Global Journal of Geological Sciences - Vol 2, No 1 (2004)

    African Journals Online (AJOL)

    GEOPHYSICAL INVESTIGATION OF GROUND SUBSIDENCE: A CASE STUDY OF A BEVERAGE FACTORY SITE IN EDO STATE, NIGERIA · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. JO Fatoba, BM Salami, 153-160. http://dx.doi.org/10.4314/gjgs.v2i1.18690 ...

  8. Demographics as predictors of practice of HIV voluntary counselling ...

    African Journals Online (AJOL)

    This study assessed the demographic variables predicting the practice of HIV Voluntary Counselling among secondary school adolescents in Edo State. Thus, a descriptive survey research was adopted for the study. One thousand, nine hundred and eighty eight (1988) secondary school adolescents were sampled from ...

  9. Author Details

    African Journals Online (AJOL)

    Olusi, FI. Vol 6, No 1 (2009) - Articles Students Perception of Cyber Crime in Edo State: Implications for Teaching and Learning Abstract. ISSN: 1813-2227. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms and Conditions of ...

  10. Job Satisfaction and Psychological Health of Long Distance Drivers ...

    African Journals Online (AJOL)

    This cross-sectional analytical study was designed to assess the level of and factors affecting job satisfaction and psychological health among long distance drivers in Benin City, Edo, Nigeria. A 21-item Job satisfaction questionnaire and the Golberg's General Health Questionnaire (GHQ 28) were used for data collection ...

  11. Physico-chemical analysis of fish pond water in Okada and its ...

    African Journals Online (AJOL)

    Water samples were collected from concrete and earthen fish ponds in different locations in Okada and its environs, Edo State, Nigeria. Twenty-one different physiochemical parameters were analyzed using standard laboratory methods and procedures. In the present study, the values of the parameters ranged from pH 6.75 ...

  12. Socio-Economic status of parents as a correlate of re-entry of girls ...

    African Journals Online (AJOL)

    economic status (SES) and re-entry of girls into school in Edo State, Nigeria. One research question and one hypothesis were formulated for the study. Two research instruments, the “Socio-Economic Status of Parents” and the “Reentry into ...

  13. Soldiers’ Psychological Responses to Tactical Nuclear Warfare

    Science.gov (United States)

    1992-02-01

    530. Greene , T.L. (1987). Description of a nuclear battlefield. In R.H. Young & B.H. Drum (Edo.), Proceedings of the Defense Nuclear Agency Symposium...ATTN: DEPT OF BEHAVOR SCI & LEADERSHIP ATTN: PMS/PMA-423 ATTN: DEPT OF PHYSICS COL J G CAMPBELL ATTN: SCIENCE RESEARCH LAB OPERATIONAL TEST & EVALUATION

  14. Assessment of creatine kinase and lactate dehydrogenase activities ...

    African Journals Online (AJOL)

    Ina bid to investigate the influence of menopausal on coronary heart disease, plasma creatine kinase (CK) and lactate dehydrogenase (LDH) enzymes were analysed on a prospective cohort of 100 women attending Irrua Specialist Teaching Hospital (ISTH), Irrua, Edo state-Nigeria. They were divided into two groups; ...

  15. Relative Contributions of Socio-Cultural Variables to the Prediction ...

    African Journals Online (AJOL)

    Erah

    the Prediction of Maternal Mortality in Edo South. Senatorial ... variables across the two locations (rural and urban) was early marriage/early child bearing (R2 = 0.200;. F = 401.40 ... severe bleeding, infections, obstructed or prolonged .... Analytical System (SAS) mode. Descriptive .... incontinence of urine and faeces due to.

  16. Evaluation of fungicides for the control of false smut of rice caused ...

    African Journals Online (AJOL)

    Benomyl, Copper Oxychloride, Iprodione, Thiabendazole (TBZ) and Mancozeb were evaluated both in the laboratory and field study in 1994, for the control of false smut of rice caused by Ustilaginoidea virens (Cooke) Tak. in upland rice in Edo State, Nigeria. In the laboratory the fungicides were evaluated at three ...

  17. STECH, 3(3), S/NO 12, SEPTEMBER, 2014

    African Journals Online (AJOL)

    DR Nneka

    2014-09-12

    Sep 12, 2014 ... the Nigerian Economy through Integrated Rural Development. Okosun ... Department of General Studies, ... Benin City, Edo State, Nigeria .... create a vast network of growth centres in town and villages. ... farmers to form cooperative farming. ..... Country Case Study Towards a Global Strategy for Cassava.

  18. Zidovudine therapy: Effect(s) on histology of the kidney of wister rats ...

    African Journals Online (AJOL)

    This study investigated the histo-morphological effect(s) of Zidovudine therapy on the kidney of Wister rats. Fifteen Wistar rats obtained from the Animal house of the College of Medicine, Ambrose Alli University, Ekpoma, Edo State, Nigeria, were used for this study. A three week period of acclimatisation was allowed.

  19. Untitled

    African Journals Online (AJOL)

    Hospital (UPTH) who met the criteria for diagnosis of GDM were recruited for the study. It is routine practice in the ... For the purpose of this study the selection criteria for diagnosis of GDM were as follows: The presence of .... populations are predominantly Yoruba / Edo stock who are ethno-linguistically different from the Port.

  20. Development Of Rainfall Erosivity Map For Nigeria | Ogedengbe ...

    African Journals Online (AJOL)

    The indices were used to develop a rainfall erosivity map or Nigeria. The map reveals that Nigeria may be broadly divided into five major erosion risk zones. The south-western part is generally in the low erosion zone, with the exception of the coastal portion of Lagos, Ondo, Edo and Delta states. The south-east and central ...

  1. GENERAL OPHTHALMOLOGY

    African Journals Online (AJOL)

    2016-11-04

    Nov 4, 2016 ... Nelson-Immu JC, Mowatt L, Walters C.A. Patterns of ocular trauma presenting to the ... 11 hospital, Addis Ababa. Ethiop J Health Dev 2001;15:131-7. 12. ... injuries in Irrua Specialist Teaching Hospital, Irrua, Edo State Nigeria.

  2. Journal of Applied Sciences and Environmental Management - Vol 9 ...

    African Journals Online (AJOL)

    Activity of Zymomonas species in palm-sap obtained from three areas in Edo State, Nigeria. ... Flood risk assessment: a review. TE Ologunorisa, MJ Abawua. A preliminary evaluation of otamiri river sands for the production of plain glass ... Health impact assessment of mangrove vegetation in an oil spilled site at the Bodo ...

  3. Marine Corps Systems Command (MCSC) Advanced Planning Briefing To Industry (APBI)

    Science.gov (United States)

    2008-05-14

    Members: 16 • Primes: Columbia Group, DTI , EDO, EG&G, INS/LM, Logis-Tech, ProSol, Titan L3 CEOss FY08 Domain Players 30 Prime...and staff locations – Driver cannot be suspended but will need a reinforced seat and leg protection 61 “$5-8 Million dollars per year are provided

  4. International Journal of Arts and Humanities(IJAH) Bahir Dar- Ethiopia

    African Journals Online (AJOL)

    DrNneka

    of Delta, Rivers, and Edo states in the present south-south geopolitical zone. It is fraught with numerous ... Onitsha known as the generalized form or O̩ni̩cha Igbo. This variety is ... harmony groups in such a way that within any one simple word, only vowels of one group may ..... Elements of modern Igbo grammar. Ibadan: ...

  5. A review of the effects of dams on the hydrology, water quality and ...

    African Journals Online (AJOL)

    In this paper, the effects of dams on the hydrology, water quality and invertebrate fauna of some Nigerian inland waters were reviewed. The freshwaters considered include Awba Reservoir (Oyo State), Shiroro Lake (Kaduna State), Moro Lake (Kwara State), Aiba Reservoir (Osun State), Ikpoba Reservoir (Edo State), Onah ...

  6. Buddhism and breastfeeding.

    Science.gov (United States)

    Segawa, Masashi

    2008-06-01

    Buddhism is an ancient religion that began in India and spread throughout Asia. It is prevalent in modern Japan. Breastfeeding has been a strong practice for centuries with the custom being to continue until the child is 6 or 7 years of age. The Edo period was very influential in establishing breastfeeding customs that continue today.

  7. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 229 of 229 ... Vol 16, No 2 (2004), The deposition of magnesium fluoride (MGF2) thin films by chemical bath deposition (CBD) technique: their characterization and ... Vol 18, No 1 (2006), Variation in well-head gamma radiation levels at the Nigerian Petroleum Development Company oil field, Ologbo, Edo State, ...

  8. African Research Review

    African Journals Online (AJOL)

    The journal is published about four times a year (January, April, July ... As of 2013 all issues of AFRREV will be open access and therefore free to download. ... of students in universities in Nigeria: Edo State as a focal point · EMAIL FREE FULL TEXT ... Use of forensic accounting techniques in the detection of fraud in tertiary ...

  9. eudiometric theoretic eudiometric theoretic-approach to modelling

    African Journals Online (AJOL)

    eobe

    2016-01-01

    Jan 1, 2016 ... 2 DEPARTMENT OF PRODUCTION ENGINEERING, UNIVERSITY OF BENIN, BENIN CITY, EDO STATE NIGERIA ... phenomenon of chemical adsorption and desorption of DO at molecular level in a .... Again, few authors have applied linear regression in .... Our goal in modelling is to replicate this natural.

  10. Sodium concentration in home made salt – sugar – solution (sss ...

    African Journals Online (AJOL)

    In a cohort of 210 young mothers, selected through cluster sampling technique from Ogida health district of Egor Local Government Area of Edo State, the electrolyte concentration of prepared salt-sugar-solutions (SSS) were evaluated. This was predicated on the need to determine the effects of introduction of various ...

  11. Child adoption amongst women attending infertility clinic in a tertiary ...

    African Journals Online (AJOL)

    Worldwide, child adoption is one of the main options for infertile couples that help in alleviating the psychological and social consequences of childlessness. The study set out to assess the knowledge, attitude and practice to adoption in a rural community in Esan central Local government area of Edo state, Nigeria.

  12. Male Infertility Secondary to Varicocele: A Study of the Management ...

    African Journals Online (AJOL)

    Varicocele is a common condition worldwide. The aim of this five-year prospective study is to examine the effect of varicocelectomy on the fertility profile of affected men in a male infertility clinic in Benin City, Edo State. A total of 45 men aged 16-65 years were diagnosed with varicocele during the period. Forty one (91.1%) ...

  13. 2018-03-05T17:24:19Z https://www.ajol.info/index.php/index/oai oai ...

    African Journals Online (AJOL)

    article/55691 2018-03-05T17:24:19Z ajrh:ART Vulnerability of Nigerian Secondary School to Human Sex Trafficking in Nigeria Omorodion, FI Adolescents; Delta State; Edo State; in-school students; Nigeria; sex trafficking Sex trafficking ...

  14. Download this PDF file

    African Journals Online (AJOL)

    user

    ABSTRACT. Onchocerciasis among 278 children (0-15yrs) of Ekpan village, a hyperendemic community in Uhunmwode. Local Government Area of Edo State, Nigeria was investigated using the prevalence of nodules as index. The overall prevalence of palpable nodules was 26.3%. Nodule prevalence increased with age ...

  15. Silk, porcelain and lacquer : China and Japan and their trade with Western Europe and the New World, 1500-1644. A survey of documentary and material evidence

    NARCIS (Netherlands)

    Llorens Planella, Maria Teresa (Teresa Canepa)

    2015-01-01

    This dissertation focused on the prolific early European trade and consumption of three Asian manufactured goods: Chinese silk and porcelain, and Japanese lacquer in the sixteenth and early seventeenth centuries, and has shown how the material cultures of late Ming China and Momoyama/early Edo Japan

  16. Nigerian Hospital Practice - Vol 7, No 5-6 (2011)

    African Journals Online (AJOL)

    Awareness of Sickle Cell Disease amongst Mothers of Under-Fives in Ekosodin community, Edo state, Nigeria. EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. BI Abhulimhen-Iyoba, ME Odunvbun, AA Okolo, 57-63. http://dx.doi.org/10.4314/nhp.v7i5-6.70347 ...

  17. Zerbitzu-marketineko terminologiaren azterketa

    OpenAIRE

    Oyarzabal Zapirain, Yon

    2017-01-01

    UPV/EHUko Enpresen Administrazio eta Zuzendaritza gradu amaierako lan honen helburua Marketin sektoriala edo Sektore-marketina irakasgaiaren barruan kokatzen den Zerbitzu-marketin arloko terminologia erreala biltzen duen termino-zerrenda eleaniztun bat egitea da. Honekin, Ekonomia Zientzien esparruan euskarazko terminologia errealaren garapen eta finkapenean ekarpen bat egin nahi dugu eta terminoak testuetan nola erabiltzen diren erakutsi.

  18. 10 CFR 20.1007 - Communications.

    Science.gov (United States)

    2010-01-01

    ... addressed to the Executive Director for Operations (EDO), and sent either by mail to the U.S. Nuclear... Pike, Rockville, Maryland; or, where practicable, by electronic submission, for example, via Electronic Information Exchange, or CD-ROM. Electronic submissions must be made in a manner that enables the NRC to...

  19. Causes and Management of Domestic Conflicts among Couples ...

    African Journals Online (AJOL)

    Whereas the issue of domestic conflict is universal, its manifestation differs between and within ethnographic regions of the world. This paper examines the phenomenon of domestic conflict among couples in Esan-speaking area of Edo State. Particularly the paper addresses the main causes of the problem and the ...

  20. The relation between invasive and non-invasive tear break-up time ...

    African Journals Online (AJOL)

    Tear stability normal to Nigerians with consideration of gender and age has not been reported. Tear stability in young adults was measured using invasive and non-invasive tear break-up time (TBUT and NIBUT). Forty –five subjects aged 20 to 30 years were selected from among the students of University of. Benin, Edo ...