High temperature strength of Hastelloy XR under biaxial stress states
International Nuclear Information System (INIS)
Muto, Yasushi; Hada, Kazuhiko; Koikegami, Hajime; Ohno, Nobutada.
1991-01-01
Biaxial(tension/torsion) creep and creep-fatigue tests were conducted on Hastelloy XR at 950degC in air. Hastelloy XR is a nickel base solution-annealed heat resistant alloy. Thin-walled tubular test specimens were employed. As results of the creep tests, the von Mises' flow rule was revealed to be applicable very well. Under the torsion load, sufficient growth of voids was necessary to initiate the fracture and this resulted in longer life time compared with that under the tension load. Only a few number of small voids could be observed and very long life times were attained under the compression load. The creep-fatigue tests revealed that superposition of constant torsion load on a cyclic axial load reduced the cycles to failure significantly and the amount of reduction was consistent with the prediction by the linear life fraction rule. (author)
Applicability of creep damage rules to a nickel-base heat-resistant alloy Hastelloy XR
International Nuclear Information System (INIS)
Tsuji, Hirokazu; Nakajima, Najime; Tanabe, Tatsuhiko; Nakasone, Yuji
1992-01-01
A series of constant load and temperature creep rupture tests and varying load and/or temperature creep rupture tests was carried out on a nickel-base heat-resistant alloy Hastelloy XR, which was developed for applications in the High-Temperature Engineering Test Reactor, at temperatures ranging from 850 to 1000deg C in order to examine the applicability of the conventional creep damage rules, i.e., the life fraction, the strain fraction and their mixed rules. The life fraction rule showed the best applicability of these three criteria. The good applicability of the rule was considered to result from the fact that the creep strength of Hastelloy XR was not strongly affected by the change of the chemical composition and/or the microstructure during exposure to the high-temperature simulated HTGR helium environment. In conclusion the life fraction rule is applicable in engineering design of high-temperature components made of Hastelloy XR. (orig.)
International Nuclear Information System (INIS)
Kurata, Yuji; Tsuji, Hirokazu; Shindo, Masami; Suzuki, Tomio; Tanabe, Tatsuhiko; Mutoh, Isao; Hiraga, Kenjiro
1999-01-01
Creep tests of base metal, weld metal and welded joint of Hastelloy XR, which had the same chemical composition as Hastelloy XR produced for an intermediate heat exchanger of the High-Temperature Engineering Test Reactor, were conducted in simulated primary coolant helium. The weld metal and welded joint showed almost equal to or longer rupture time than the base metal of Hastelloy XR at 850 and 900degC, although they gave shorter rupture time at 950degC under low stress and at 1,000degC. The welded joint of Hastelloy XR ruptured at the base metal region at 850 and 900degC. On the other hand, it ruptured at the weld metal region at 950 and 1,000degC. The steady-state creep rate of weld metal of Hastelloy XR was lower than that of base metal at 850, 900 and 950degC. The creep rupture strengths of base metal, weld metal and welded joint of Hastelloy XR obtained in this study were confirmed to be much higher than the design allowable creep-rupture stress (S R ) of the Design Allowable Limits below 950degC. (author)
International Nuclear Information System (INIS)
Tsuji, Hirokazu; Nakajima, Hajime; Shindo, Masami; Tanabe, Tatsuhiko; Nakasone, Yuji.
1996-01-01
In the design of the high-temperature components, it is often required to predict the creep rupture life under the conditions in which the stress and/or temperature may vary by using the data obtained with the constant load and temperature creep rupture tests. Some conventional creep damage rules have been proposed to meet the above-mentioned requirement. Currently only limited data are available on the behavior of Hastelloy XR, which is a developed alloy as the structural material for high-temperature components of the High-Temperature Engineering Test Reactor (HTTR), under varying stress and/or temperature creep conditions. Hence a series of constant load and temperature creep rupture tests as well as varying load and temperature creep rupture tests was carried out on two kinds of Hastelloy XR alloys whose boron content levels are different, i.e., below 10 and 60 mass ppm. The life fraction rule completely fails in the prediction of the creep rupture life of Hastelloy XR with 60 mass ppm boron under varying load and temperature conditions though the rule shows good applicability for Hastelloy XR with below 10 mass ppm boron. The change of boron content level of the material during the tests is the most probable source of impairing the applicability of the life fraction rule to Hastelloy XR whose boron content level is 60 mass ppm. The modified life fraction rule has been proposed based on the dependence of the creep rupture strength on the boron content level of the alloy. The modified rule successfully predicts the creep rupture life under the two stage creep test conditions from 1000 to 900degC. The trend observed in the two stage creep tests from 900 to 1000degC can be qualitatively explained by the mechanism that the oxide film which is formed during the prior exposure to 900degC plays the role of the protective barrier against the boron dissipation into the environment. (J.P.N.)
Creep properties of 20% cold-worked Hastelloy XR
International Nuclear Information System (INIS)
Kurata, Y.
1996-01-01
The creep properties of Hastelloy XR, in solution-treated and in 20% cold-worked conditions, were studied at 800, 900 and 1000 C. At 800 C, the steady-state creep rate and rupture ductility decrease, while rupture life increases after cold work to 20%. Although the steady-state creep rate and ductility also decrease at 900 C, the beneficial effect on rupture life disappears. Cold work to 20% enhan ces creep resistance of this alloy at 800 and 900 C due to a high density of dislocations introduced by the cold work. Rupture life of the 20% cold-worked alloy becomes shorter and the steady-state creep rate larger at 1000 C during creep of the 20% cold-worked alloy. It is emphasized that these cold work effects should be taken into consideration in design and operation of high-temperature structural components of high-temperature gas-cooled reactors. (orig.)
International Nuclear Information System (INIS)
Watanabe, Katsutoshi; Nakajima, Hajime; Koikegami, Hajime; Higuchi, Makoto; Nakanishi, Tsuneo; Saitoh, Teiichiro; Takatsu, Tamao.
1994-01-01
Creep properties of weldment made from Hastelloy Alloy XR base metals and filler metals for the High Temperature Engineering Test Reactor (HTTR) components were examined by means of creep and creep rupture tests at 900 and 950degC in air. The results obtained are as follows: creep rupture strength was nearly equal or higher than that of Hastelloy Alloy XR master curve and was much higher than design creep rupture strength [S R ]. Furthermore, creep rupture strength and ductility of the present filler metal was in the data band in comparison with those of the previous filler metals. It is concluded from these reasons that this filler metal has fully favorable properties for HTTR uses. (author)
Creep curve formularization at 950degC for Hastelloy XR
International Nuclear Information System (INIS)
Kaji, Yoshiyuki; Muto, Yasushi
1991-03-01
Creep tests under constant stress were conducted on a nickel-base heat-resistant alloy, Hastelloy XR, in air at 950degC. Minimum creep strain rate, time to the onset of tertiary creep and time to rupture were obtained as a function of applied stress. Then, a creep constitutive equation was made based on the Garofalo formula for primary and secondary creep and based on the Kachanov-Rabotnov formula for tertiary creep, which could represent fairly well the experimental creep deformation curves under the constant stress conditions. The creep deformation under the constant load condition corresponding to the stress increment was analysed using the creep constitutive equation and strain hardening law. Then the calculated creep strain showed slightly higher value than the experimental creep strain, and the calculated life was shorter than the experimental one. (author)
International Nuclear Information System (INIS)
Asayama, Tai; Tachibana, Yukio
2007-01-01
This report describes the results of investigation on Task 5 of DOE/ASME Materials Project based on a contract between ASME Standards Technology, LLC (ASME ST-LLC) and Japan Atomic Energy Agency (JAEA). Task 5 is to collect available creep-fatigue data and study existing creep-fatigue evaluation procedures for Grade 91 steel and Hastelloy XR. Part I of this report is devoted to Grade 91 steel. Existing creep-fatigue data were collected (Appendix A) and analyzed from the viewpoints of establishing a creep-fatigue procedure for VHTR design. A fair amount of creep-fatigue data has been obtained and creep-fatigue phenomena have been clarified to develop design standards mainly for fast breeder reactors. Following this, existing creep-fatigue procedures were studied and it was clarified that the creep-fatigue evaluation procedure of the ASME-NH has a lot of conservatisms and they were analyzed in detail from the viewpoints of the evaluation of creep damage of material. Based on the above studies, suggestions to improve the ASME-NH procedure along with necessary research and development items were presented. Part II of this report is devoted to Hastelloy XR. Existing creep-fatigue data used for development of the high temperature structural design guideline for High Temperature Gas-cooled Reactor (HTGR) were collected. Creep-fatigue evaluation procedure in the design guideline and its application to design of the intermediate heat exchanger (IHX) for High Temperature Engineering Test Reactor (HTTR) was described. Finally, some necessary research and development items in relation to creep-fatigue evaluation for Gen IV and VHTR reactors were presented.
Design fatigue curve for Hastelloy-X
International Nuclear Information System (INIS)
Nishiguchi, Isoharu; Muto, Yasushi; Tsuji, Hirokazu
1983-12-01
In the design of components intended for elevated temperature service as the experimental Very High-Temperature gas-cooled Reactor (VHTR), it is essential to prevent fatigue failure and creep-fatigue failure. The evaluation method which uses design fatigue curves is adopted in the design rules. This report discussed several aspects of these design fatigue curves for Hastelloy-X (-XR) which is considered for use as a heat-resistant alloy in the VHTR. Examination of fatigue data gathered by a literature search including unpublished data showed that Brinkman's equation is suitable for the design curve of Hastelloy-X (-XR), where total strain range Δ epsilon sub(t) is used as independent variable and fatigue life Nsub(f) is transformed into log(log Nsub(f)). (author)
Temperature dependence of creep properties of cold-worked Hastelloy XR
International Nuclear Information System (INIS)
Kurata, Yuji; Nakajima, Hajime
1995-01-01
The creep properties of Hastelloy XR, in a solution treated, 10% or 20% cold-worked condition, were investigated at temperatures from 800 to 1,000degC for the duration of creep tests up to about 2,500 ks. At 800 and 850degC, the steady-state creep rate and rupture ductility decreased and the rupture life increased after cold work of 10% or 20%. Although the rupture life of the 10% cold-worked alloy was longer at 900degC than that of the solution treated one, the rupture lives of the 10% cold-worked and solution treated alloys were almost equal at 950degC, which is the highest helium temperature in an intermediate heat exchanger of the High Temperature Engineering Test Reactor (HTTR). The beneficial effect of 10% cold work on the rupture life and the steady-state creep rate disappeared at 1,000degC. The beneficial effect of 20% cold work disappeared at 950degC because significant dynamic recrystallization occurred during creep. While rupture ductility of this alloy decreased after cold work of 10% or 20%, it recovered to a considerable extend at 1,000degC. It is emphasized that these cold work effects should be taken into consideration in design, operation and residual life estimation of high temperature components of the HTTR. (author)
International Nuclear Information System (INIS)
Nakasone, Yuji; Tanabe, Tatsuhiko; Tsuji, Hirokazu; Nakajima, Hajime.
1992-01-01
The present paper investigates early-stage-creep damage of Hastelloy XR and XR-II alloys, modified versions of Hastelloy X alloy, which have been developed in Japan as most promising candidate structural alloys for Japanese high-temperature gas-cooled reactors (HTGRs). Creep tests were made on Hastelloy XR forging, tube and XR-II tube at 1,123 to 1,273 K in a simulated HTGR helium gas environment. The tests were interrupted at different strain levels of up to 5 % in order to evaluate creep damage via intergranular voids. The void sizes along grain boundaries and the A-parameter, the ratio of the number of damaged grain boundaries, on which one or more voids are found, to that of the total grain boundaries observed are used in order to evaluate creep damage. Statistical analysis of the A-parameter as well as the void sizes reveals that the values of the parameter show wide variations and follow the Weibull distribution, reflecting spatial randomness of the voids. The void sizes along grain boundaries, on the other hand, follow the log-normal distribution. The maximum void size d max and the mean value of the A-parameter A m are calculated and plotted against interruption creep strain ε int . The resultant d max vs. ε int and A m vs. ε int diagrams show that Hastelloy XR forging had suffered more damage than Hastelloy XR tube; nevertheless, the forging has longer interruption life, or the time to reach a given interruption creep strain. The result indicates that grains may have been deformed more easily in Hastelloy XR in the form of tube than in the form of forging. The diagrams also imply that the addition of boron has suppressed the nucleation as well as the growth of voids and thus has brought about longer interruption life of Hastelloy XR-II. (author)
International Nuclear Information System (INIS)
Shimizu, S.; Mutoh, Y.
1984-01-01
The characteristics of weld defects in the electron beam (EB) welding and the tungsten inert gas (TIG) arc welding for Hastelloy-XR, a modified version of Hastelloy-X, are clarified through the bead-on-plate test and the Trans-Varestraint test. Based on the results, weldabilities on EB and TIG weldings for Hastelloy-XR are discussed and found to be almost the same as Hastelloy-X. The creep rupture behaviors of the welded joints are evaluated by employing data on creep properties of the base and the weld metals. According to the evaluation, the creep rupture strength of the EB-welded joint may be superior to that of the TIG-welded joint. The corrosion test in helium containing certain impurities is conducted for the weld metals. There is no significant difference of such corrosion characteristics as weight gain, internal oxidation, depleted zone, and so on between the base and the weld metals. Those are superior to Hastelloy-X
Compatibility of heat resistant alloys with boron carbide, (4)
International Nuclear Information System (INIS)
Baba, Sinichi; Saruta, Toru; Ooka, Kiichi; Tanaka, Isao; Aoyama, Isao
1985-07-01
This paper relates to the compatibility test of control rod sheath (Hastelloy XR alloy) and neutron absorber (boronated graphite) for the VHTR, which has been researched and developed by JAERI. The irradiation was conducted by using the OGL-1 irradiation facility in the JMTR in order to study reaction behaviour between Hastelloy XR alloy and boronated graphite as well as to determine a reaction barrier performance of refractory metal foils Nb, Mo, W and Re. Irradiation conditions were as follows. Neutron dose : 4.05 x 10 22 m -2 (E 18 m -2 (E > 0.16 pJ, 1 Mev). Helium coolant : Average temperature 855 0 C, Pressure 2.94 MPa, Total impurity concentration 400 kBq/m 3 . Irradiation time : 5.0 Ms (1390 hours). Post-irradiation examinations i.e. visual inspection, dimensional inspection, weight measurement, metallography, hardness test, morphological observations by SEM and analysis of element distributions by EPMA were carried out. In the result, reaction products of Hastelloy XR alloy were observed in the ellipsoidal form locally. These results were same as those of the out-of-pile tests. Obvious irradiation effects were not detectable but a little accelarated increase in reaction depth of Hastelloy XR alloy by heat effect of specimens was observed. The refractory metal foils had a good performance of reaction barrier between Hastelloy XR alloy and boronated graphite. Furthermore, movement of Ni, Fe and Cr in the reaction area of Hastelloy XR alloy, difference in the reaction depth of B and C, irradiation effects on diffusion coefficient, lithium production and heat effect are discussed. (author)
Manufacture of a heat-resistant alloy with modified specifications for HTGR structural applications
International Nuclear Information System (INIS)
Sahira, K.; Kondo, T.; Takeiri, T.
1984-01-01
A method of manufacturing a nuclear grade nickel-base heat-resistant alloy in application to heliumcooled reactor primary circuit components has been developed. The Hastelloy-XR alloy, a version of Hastelloy-X, was made available by combining the basic studies of the oxidation behavior of Hastelloy-X and the improvement of manufacturing techniques. In the primary and remelting steps, the choice of appropriate processes was made by performing numerical analyses of the statistical deviation of both chemical composition and the products' mechanical properties. The feasibility of making larger electroslag remelting ingots with reasonable control of macrosegregation was examined by the calculation of a molten metal pool shape during melting. The hot workability of Hastelloy-XR was confirmed to be equivalent to that of Hastelloy-X and the importance of controlling the thermal and mechanical processes more closely was stressed in obtaining a higher level of quality assurance for the nuclear applications. The possibility of enhancing the high-temperature mechanical performance of Hastelloy-XR was suggested based on the preliminary test results with the heats manufactured with controlled boron content
Cavitation erosion behavior of Hastelloy C-276 nickel-based alloy
Energy Technology Data Exchange (ETDEWEB)
Li, Zhen [State Key Laboratory of Solid Lubrication, Lanzhou Institute of Chemical Physics, Chinese Academy of Sciences, Lanzhou 730000 (China); University of Chinese Academy of Sciences, Beijing 100039 (China); Han, Jiesheng; Lu, Jinjun [State Key Laboratory of Solid Lubrication, Lanzhou Institute of Chemical Physics, Chinese Academy of Sciences, Lanzhou 730000 (China); Chen, Jianmin, E-mail: chenjm@lzb.ac.cn [State Key Laboratory of Solid Lubrication, Lanzhou Institute of Chemical Physics, Chinese Academy of Sciences, Lanzhou 730000 (China)
2015-01-15
Highlights: • Cavitation erosion behavior of Hastelloy C-276 was studied by ultrasonic apparatus. • The cavitation-induced precipitates formed in the eroded surface for Hastelloy C-276. • The selective cavitation erosion was found in Hastelloy C-276 alloy. - Abstract: The cavitation erosion behavior of Hastelloy C-276 alloy was investigated using an ultrasonic vibratory apparatus and compared with that of 316L stainless steel. The mean depth of erosion (MDE) and erosion rate (ER) curves vs. test time were attained for Hastelloy C-276 alloy. Morphology and microstructure evolution of the eroded surface were observed by scanning electron microscopy (SEM) and field emission scanning electron microscopy (FESEM) and the predominant erosion mechanism was also discussed. The results show that the MDE is about 1/6 times lower than that of the stainless steel after 9 h of testing. The incubation period of Hastelloy C-276 alloy is about 3 times longer than that of 316L stainless steel. The cavitation-induced nanometer-scaled precipitates were found in the local zones of the eroded surface for Hastelloy C-276. The selective cavitation erosion was found in Hastelloy C-276 alloy. The formation of nanometer-scaled precipitates in the eroded surface may play a significant role in the cavitation erosion resistance of Hastelloy C-276.
Cavitation erosion behavior of Hastelloy C-276 nickel-based alloy
International Nuclear Information System (INIS)
Li, Zhen; Han, Jiesheng; Lu, Jinjun; Chen, Jianmin
2015-01-01
Highlights: • Cavitation erosion behavior of Hastelloy C-276 was studied by ultrasonic apparatus. • The cavitation-induced precipitates formed in the eroded surface for Hastelloy C-276. • The selective cavitation erosion was found in Hastelloy C-276 alloy. - Abstract: The cavitation erosion behavior of Hastelloy C-276 alloy was investigated using an ultrasonic vibratory apparatus and compared with that of 316L stainless steel. The mean depth of erosion (MDE) and erosion rate (ER) curves vs. test time were attained for Hastelloy C-276 alloy. Morphology and microstructure evolution of the eroded surface were observed by scanning electron microscopy (SEM) and field emission scanning electron microscopy (FESEM) and the predominant erosion mechanism was also discussed. The results show that the MDE is about 1/6 times lower than that of the stainless steel after 9 h of testing. The incubation period of Hastelloy C-276 alloy is about 3 times longer than that of 316L stainless steel. The cavitation-induced nanometer-scaled precipitates were found in the local zones of the eroded surface for Hastelloy C-276. The selective cavitation erosion was found in Hastelloy C-276 alloy. The formation of nanometer-scaled precipitates in the eroded surface may play a significant role in the cavitation erosion resistance of Hastelloy C-276
Relaxation characteristics of hastelloy X
International Nuclear Information System (INIS)
Suzuki, Kazuhiko
1980-02-01
Relaxation diagrams of Hastelloy X (relaxation curves, relaxation design diagrams, etc.) were generated from the creep constitutive equation of Hastelloy X, using inelastic stress analysis code TEPICC-J. These data are in good agreement with experimental relaxation data of ORNL-5479. Three typical inelastic stress analyses were performed for various relaxation behaviors of the high-temperature structures. An attempt was also made to predict these relaxation behaviors by the relaxation curves. (author)
International Nuclear Information System (INIS)
Ouyang, Fan-Yi; Chang, Chi-Hung; Kai, Ji-Jung
2014-01-01
Highlights: •Corrosion behaviors of Hastelloy-N and -B3 in molten FLiNaK salt at 700 °C. •The alleviated corrosion rate of alloys was observed after long-hour immersion. •Long-term corrosion rate was limited by diffusion from matrix to alloy surface. •Corrosion pattern transferred from intergranular corrosion into general corrosion. •Presence of minor H 2 O did not greatly influence the long-term corrosion behavior. -- Abstract: This study investigated long-term corrosion behaviors of Ni-based Hastelloy-N and Hastelloy-B3 under moisture-containing molten alkali fluoride salt (LiF–NaF–KF: 46.5–11.5–42%) environment at an ambient temperature of 700 °C. The Hastelloy-N and Hastelloy-B3 experienced similar weight losses for tested duration of 100–1000 h, which was caused by aggregate dissolution of Cr and Mo into FLiNaK salts. The corrosion rate of both alloys was high initially, but then reduced during the course of the test. The alleviated corrosion rate was due to the depletion of Cr and Mo near surface of the alloys and thus the long-term corrosion rate was controlled by diffusion of Cr and Mo outward to the alloy surface. The results of microstructural characterization revealed that the corrosion pattern for both alloys tended to be intergranular corrosion at early stage of corrosion test, and then transferred to general corrosion for longer immersion hours
A life evaluation under creep-fatigue-environment interaction of Ni-base wrought alloys
International Nuclear Information System (INIS)
Hattori, Hiroshi; Kitagawa, Masaki; Ohtomo, Akira; Itoh, Mitsuyoshi
1986-01-01
In order to determine a failure criteria under cyclic loading and affective environment for HTGR systems, a series of strain controlled low-cycle fatigue tests were carried out at HTGR maximum gas temperatures in air, in vacuum and in HTGR helium environments on two nickel-base wrought alloys, namely Inconel 617 and Hastelloy XR. This paper first describes the creep-fatigue-environment properties of these alloys followed by a proposal of an evaluation method of creep-fatigue-environment interaction based on the experimental data to define the more reasonable design criteria, which is a modification of the linear damage summation rule. Second, the creep-fatigue properties of Hastelloy XR at 900 deg C and the result evaluated by this proposed method are shown. This criterion is successfully applied to the life prediction at 900 deg C. In addition, the creep-fatigue properties of Hastelloy XR-II are discussed. (author)
International Nuclear Information System (INIS)
Kurata, Yuji; Kondo, Tatsuo
1985-04-01
The influence of heating rate on corrosion and carbon transfer was studied for Ni-base heat resistant alloys exposed to simulated VHTR(very high temperature reactor) coolant environment. Special attention was focused to relationship between oxidation and carburization at early stage of exposure. Tests were conducted on two heats of Hastelloy XR with different boron(B) content and the developmental alloys, 113MA and KSN. Two kinds of heating rates, i.e. 80 0 C/min and 2 0 C/min, were employed. Corrosion tests were carried out at 900 0 C up to 500 h in JAERI Type B helium, one of the simulated VHTR primary coolant specifications. Under higher heating rate, oxidation resistance of both heats of Hastelloy XR(2.8 ppmB and 40 ppmB) were equivalent and among the best, then KSN and 113MA followed in the order. Under lower heating rate only alloy, i.e. Hastelloy XR with 2.8 ppmB, showed some deteriorated oxidation resistance while all others being unaffected by the heating rate. On the other hand the carbon transfer behavior showed strong dependence on the heating rate. In case of higher heating rate, significant carburization occured at early stage of exposure and thereafter the progress of carburization was slow in all the alloys. On the other hand only slow carburization was the case throughout the exposure in case of lower heating rate. The carburization in VHTR helium environment was interpreted as to be affected by oxide film formation in the early stage of exposure. The carbon pick-up was largest in Hastelloy XR with 40 ppmB and it was followed by Hastelloy XR with 2.8 ppmB. 113MA and KSN were carburized only slightly. The observed difference of carbon pick-up among the alloys tested was interpreted to be attributed mainly to the difference of the carbon activity, the carbide precipitation characteristics among the alloys tested. (author)
Evaluation of creep and relaxation data for hastelloy alloy x sheet
International Nuclear Information System (INIS)
Booker, M.K.
1979-02-01
Hastelloy alloy X has been a successful high-temperature structural material for more than two decades. Recently, Hastelloy alloy X sheet has been selected as a prime structural material for the proposed Brayton Isotope Power System (BIPS). The material also sees extensive application in the High-Temperature Gas-Cooled Reactor (HTGR). Design of these systems requires a detailed consideration of the high-temperature creep properties of this material. Therefore, available creep, creep-rupture, and relaxation data for Hastelloy alloy X were collected and analyzed to yield mathematical representations of the behavior for design use
Status of tellurium--hastelloy N studies in molten fluoride salts
International Nuclear Information System (INIS)
Keiser, J.R.
1977-10-01
Tellurium, which is a fission product in nuclear reactor fuels, can embrittle the surface grain boundaries of nickel-base structural materials. This report summarizes results of an experimental investigation conducted to understand the mechanism and to develop a means of controlling this embrittlement in the alloy Hastelloy N. The addition of a chromium telluride to salt can be used to provide small partial pressures of tellurium simulating a reactor environment where tellurium appears as a fission product. The intergranular embrittlement produced in Hastelloy N when exposed to this chromium telluride-salt mixture can be reduced by adding niobium to the Hastelloy N or by controlling the oxidation potential of the salt in the reducing range
Creep properties of hastelloy x and their application to the structural design
International Nuclear Information System (INIS)
Kiyoshige, Masanori; Murase, Hirokazu; Fujioka, Junzo; Shimizu, Shigeki; Satoh, Keisuke.
1978-01-01
In the creep curve of Hastelloy X, it was difficult to divide it into the three stages of creep. However, these stages were made distinguishable by plotting the relationship between creep rates and time in double-logarithmic coordinates. All the creep data of Hastelloy X, except the isochronous stress-strain curves, required for determining the design stress intensities S sub(o) and S sub(t) were arranged through the Larson-Miller parameter. The isochronous stress-strain curves for a heat of Hastelloy X were derived from the constitutive equations obtained from short-term data. A fairly good agreement between the predicted data and the experimental data was obtained. (auth.)
Mechanical characterization of superalloys for space reactors
International Nuclear Information System (INIS)
Duchesne, J.
1989-01-01
The aim of this work is the selection of structural materials that can be used in the temperature range 600-900 0 C for a gas cooled space reactor producing electricity. Superalloys fit best the temperature range required. Five nickel base alloys are chosen for their good mechanical behaviour: HAYNES 230, HASTELLOY S, HASTELLOY X, HASTELLOY XR and PYRAD 38D. Metallography, tensile and hardness tests are realized. Sample contraction is evidenced for some creep tests, under low stress: 20MPa at 800 0 C, on HAYNES 230 and HASTELLOY X, probably related to the structural evolution of these materials corresponding to a decrease of the crystal parameter [fr
Creep properties of Hastelloy X and their application to structural design
International Nuclear Information System (INIS)
Kiyoshige, Masanori; Murase, Koichi; Fujioka, Junzo; Shimizu, Shigeki; Satoh, Keisuke
1977-01-01
Creep and stress rupture tests on three heats of Hastelloy X differing in the manufacturing process were carried out at 800 0 C, 900 0 C and 1000 0 C. Interpretation of the observed creep properties was made, and a method for predicting necessary design data from the experimentally obtained results was discussed. The results are as follows. (1) It was difficult to separate the primary, secondary and tertiary creep stages in the creep curve of Hastelloy X of the present tests. However, those were made distinguishable by plotting the results in a double-logarithmic coordinates. From these creep rate curves, the primary and secondary creep rates and the times to the initiation of secondary and tertiary creeps were derived. (2) It is considered that the same stress and temperature dependences between the primary and secondary creep rates exist in the creep behaviour of Hastelloy X of the present tests. (3) All the creep data, except the isochronous stress-strain curve, required for the design such as stress vs. rupture time, stress vs. secondary creep rate and stress vs. time to initiation of tertiary creep could be arranged through the Larson-Miller parameter. On the other hand, the isochronous stress-strain curve was figured out by estimating creep curves. The constitutive equations of creep for a heat of Hastelloy X proposed in this paper and the isochronous stress-strain curves derived from these constitutive equations were consistent with the experimental data obtained for the corresponding material. (auth.)
FINITE ELEMENT ANALYSIS OF HASTELLOY C-22HS IN END MILLING
Directory of Open Access Journals (Sweden)
K. Kadirgama
2011-12-01
Full Text Available This paper presents a finite element analysis of the stress distribution in the end milling operation of nickel-based superalloy HASTELLOY C-2000. Commercially available finite element software was used to develop the model and analyze the distribution of stress components in the machined surface of HASTELLOY C-22HS following end milling with coated carbide tools. The friction interaction along the tool-chip interface was modeled using the Coulomb friction law. It was found that the stress had lower values under the cut surface and that it increased gradually near the cutting edge.
International Nuclear Information System (INIS)
Strizak, J.P.; Brinkman, C.R.; Booker, M.K.; Rittenhouse, P.L.
1982-04-01
Results are presented for strain-controlled fatigue and tensile tests for two nickel-base, solution-hardened reference structural alloys for use in several High-Temperature Gas-Cooled Reactor (HTGR) concepts. These alloys, Hastelloy X and Inconel 617, were tested from room temperature to 871 0 C in air and impure helium. Materials were tested in both the solution-annealed and the preaged conditios, in which aging consisted of isothermal exposure at one of several temperatures for periods of up to 20,000 h. Comparisons are given between the strain-controlled fatigue lives of these and several other commonly used alloys, all tested at 538 0 C. An analysis is also presented of the continuous cycle fatigue data obtained from room temperature to 427 0 C for Hastelloy G, Hastelloy X, Hastelloy C-276, and Hastelloy C-4, an effort undertaken in support of ASME code development
Kelly, Meredith A; Pavlicova, Martina; Glass, Andrew; Mariani, John J; Bisaga, Adam; Sullivan, Maria A; Nunes, Edward V; Levin, Frances R
2014-11-01
Cannabis-dependent participants with depressive disorder are less likely to achieve abstinence with venlafaxine-XR (VEN-XR) treatment. Individuals on VEN-XR reported more severe withdrawal, despite not reducing their smoking behavior. We hypothesized that withdrawal-like symptoms, likely medication side effects, led to continued marijuana smoking in this group. We conducted a secondary analysis using Marijuana Withdrawal Checklist (MWC) scores and urine THC to test whether severity of withdrawal-like symptoms mediates the relationship between VEN-XR treatment and continued marijuana smoking. We included 103 participants (VEN-XR=51, Placebo=52). Marijuana use was dichotomized into smoking (THC>100 ng/ml) and non-smoking (THC ≤ 100 ng/ml) weeks. MWC scores were obtained weekly. We used three models in a regression based mediation analysis. The estimated risk of smoking marijuana was greater for individuals on VEN-XR in weeks 7-9, even when controlling for MWC scores (week 7 Risk Difference (RD)=0.11, p=0.034; week 8 RD=0.20, p=0.014), and higher scores mediated this effect. In weeks 10 and 11, the estimated effect was stronger (week 10 RD=0.03, p=0.380; week 11 RD=0.07, p=0.504), and worse withdrawal-like symptoms more fully accounted for continued marijuana smoking in the VEN-XR group, according to the models. Individuals treated with VEN-XR had more severe withdrawal-like symptoms, which mediated their continued marijuana smoking. Noradrenergic agents, such as VEN-XR, may negatively impact treatment outcomes in cannabis-dependent patients attempting to reduce or stop their use. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.
The corrosion behavior of molybdenum and Hastelloy B in sulfur and sodium polysulfides at 623 K
International Nuclear Information System (INIS)
Brown, A.P.
1987-01-01
An experimental study was completed to determine the corrosion behavior of molybdenum and Hastelloy B, a nickel-based alloy with high molybdenum content, in sulfur and sodium polysulfides (Na/sub 2/S/sub 3/,Na/sub 2/S/sub 4/, Na/sub 2/S/sub 5/) at 623 K. In sulfur, molybdenum corrodes very slowly, with a parabolic rate constant of 3.6 x 10/sup -9/ cm s/sup -1/2/. Hastelloy B shows no measurable corrosion after 100h of exposure to sulfur. The corrosion reaction of molybdenum in Na/sub 2/S/sub 3/ is characterized by the formation of a protective film that effectively eliminates further corrosion after the first 100h of exposure. Hastelloy B, however, corrodes rapidly in Na/sub 2/S/sub 3/, with corrosion rates approaching those of pure nickel under the same conditions. After the first 4h of exposure, the kinetics for the corrosion of Hastelloy B in Na/sub 2/S/sub 3/ follows a linear rate law. The scale morphology has multiple spalled layers of NiS/sub 2/, with some crystallites of NiS/sub 2/ appearing on the leading face of the scale and between the individual scale layers. This spalling causes smaller coupons of the Hastelloy B to corrode faster than larger coupons
Technical Note: Response time evolution of XR-QA2 GafChromic™ film models.
Aldelaijan, Saad; Tomic, Nada; Papaconstadopoulos, Pavlos; Schneider, James; Seuntjens, Jan; Shih, Shelley; Lewis, David; Devic, Slobodan
2018-01-01
To evaluate the response of the newest XR-QA2 GafChromic™ film model in terms of postexposure signal growth and energy response in comparison with the older XR-QA (Version 2) model. Pieces of film were irradiated to air kerma in air values up to 12 cGy with several beam qualities (5.3-8.25 mm Al) commonly used for CT scanning. Film response was scored in terms of net reflectance from scanned film images at various points in time postirradiation ranging from 1 to 7 days and 5 months postexposure. To reconstruct the measurement signal changes with postirradiation delay, we irradiated one film piece and then scanned it at different point times starting from 2" min and up to 3 days postexposure. For all beam qualities and dose range investigated, it appears that the XR-QA2 film signal completely saturated after 15 h. Compared to 15 h postirradiation scanning time, the observed variation in net reflectance were 3%, 2%, and 1% for film scanned 2" min, 20 min, and 3 h after exposure, respectively, which is well within the measurement uncertainty of the XR-QA2 based reference radiochromic film dosimetry system. A comparison between the XR-QA (Version 2) and the XR-QA2 film response after several months (relative to their responses after 24 h) show differences in up to 8% and 1% for each film model respectively. The replacement of cesium bromide in the older XR-QA (Version 2) film model with bismuth oxide in the newer XR-QA2 film, while keeping the same single sensitive layer structure, lead to a significantly more stable postexposure response. © 2017 American Association of Physicists in Medicine.
Oxidation in air of two refractory alloys (Nicral D and Hastelloy X) at 900 and 1100 deg. C
International Nuclear Information System (INIS)
Sannier, J.; Dominget, R.; Darras, R.
1960-01-01
The oxidation in air of two refractory alloys (Nicral D and Hastelloy X) has been studied at 900 and 1100 deg. C, by means of recording thermo-balances and microscopic cross section examination. At 900 deg. C, the surface oxidation rates of the two alloys are quite similar, but at 1100 deg. C the alloy Nicral D oxidizes faster than the alloy Hastelloy X. On the other hand, after heating at 1100 deg. C for 150 hours, Nicral D shows both intergranular oxidation and a small amount of internal oxidation, whereas Hastelloy X is especially subject to internal oxidation. In addition, two descaling methods were compared: an electrolytic method, in a sodium hydroxide-sodium carbonate bath, and a chemical method using a sodium nitrate-sodium peroxide bath; the latter appears suitable only for Hastelloy X. Reprint of a paper published in Journal of nuclear materials, 3, p. 213-225, 1959 [fr
Preliminary results of the XR2-1 experiment
International Nuclear Information System (INIS)
Gauntt, R.O.; Helmick, P.H.; Humphries, L.
1996-01-01
The XR2-1 (Ex-Reactor) experiment, investigating metallic core-melt relocation in boiling water reactor geometry, was performed on October 12, 1995, following two previous simpler XR1-series tests in August and November of 1993. The XR2-1 test made use of a highly detailed replication of the lower region of the BWR core, including the control blade and channel box structures, fuel rods, fuel canister nosepieces, control blade velocity limiter, and fuel support pieces, in order to investigate a key core melt progression uncertainty for BWR Station Blackout type accidents. The purpose of this experiment program is to examine the behavior of downward-draining molten metallic core materials in a severe reactor accident in a dry BWR core, and to determine conditions under which the molten materials drain out of the core region, or freeze to form blockages in the lower portion of the core. In the event that the draining metallic materials do not form stable blockages in the lower core region, and instead erode the lower core structures such as the lower core plate, then the subsequent core melt progression processes may proceed quite differently than was observed in the TMI-2 accident, with correspondingly different impact on vessel loading and vessel release behavior. The results of the Ex-Reactor tests are preliminary. All of the tests conducted have shown a significant degree of channel box destruction induced by the draining control blade materials. The XR2-1 test further showed that the draining zircaloy melt causes significant disruption of the fuel rod geometry. All of the tests have shown tendencies to form interim blockages as the melts temporarily freeze, but that these blockages re-melt, assisted by eutectic interactions, resulting in the sudden draining of accumulated metallic melt pools
Study on the creep constitutive equation of Hastelloy X, (1)
International Nuclear Information System (INIS)
Suzuki, Kazuhiko; Mutoh, Yasushi
1983-01-01
In order to carry out the structural design of high temperature pipings, intermediate heat exchangers and isolating valves for a multipurpose high temperature gas-cooled reactor, in which coolant temperature reaches 1000 deg C, the creep characteristics of Hastelloy X used as the heat resistant material must be clarified. In addition to usual creep rupture life and the time to reach a specified creep strain, the dependence of creep strain curves on time, temperature and stress must be determined and expressed with equations. Therefore, using the creep data of Hastelloy X given in the literatures, the creep constitutive equation was made. Since the creep strain curves under the same test condition were different according to heats, the sensitivity analysis of the creep constitutive equation was performed. The form of the creep constitutive equation was determined to be Garofalo type. The result of the sensitivity analysis is reported. (Kako, I.)
Creep properties of Hastelloy X in a carburizing helium environment
International Nuclear Information System (INIS)
Nakanishi, T.; Kawakami, H.
1982-01-01
In this work, we investigate the environmental effect on the creep behavior of Hastelloy X at 900 0 C in helium and air. Since helium coolant in HTGR is expected to be carburizing and very weakly oxidizing for most metals, testings were focused on the effect of carburizing and slight oxidation. Carburization decreases secondary creep strain rate and delays tertiary creep initiation. On the other hand, the crack growth rate on the specimen surface is enhanced due to very weak oxidation in helium, therefore the tertiary creep strain rate becomes larger than that in air. The rupture time of Hastelloy X was shorter in helium when compared with in air. Stress versus rupture time curves for both environments do not deviate with each other during up to 5000 hours test, and a ratio of rupture stress in helium to that in air was about 0.9
Hastelloy X fuel element creep relaxation and residual effects
International Nuclear Information System (INIS)
Castle, R.A.
1971-01-01
A worst case, seven element, asymmetric fuel, thermal environment was assumed and a creep relaxation analysis generated. The fuel element clad is .020 inch Hastelloy X. The contact load decreased from 11.6 pounds to 5.87 pounds in 100,000 hours. The residual stresses were then computed for various shutdown times. (U.S.)
Rajagopalan, Krithika; Meyer, Kellie; O'Day, Ken; Denno, Melissa; Loebel, Antony
2015-01-01
Bipolar disorder imposes a high economic burden on patients and society. Lurasidone and quetiapine extended-release (XR) are atypical antipsychotic agents indicated for monotherapy treatment of bipolar depression. Lurasidone is also indicated as adjunctive therapy with lithium or valproate for depressive episodes associated with bipolar disorder. The objective of this analysis was to estimate the cost-effectiveness of lurasidone and quetiapine XR in patients with bipolar depression. A cost-effectiveness model was developed to compare lurasidone to quetiapine XR. The model was based on a US third-party payer perspective over a 3-month time horizon. The effectiveness measure in the model was the percentage of patients achieving remission (Montgomery-Åsberg Depression Rating Scale [MADRS] total score ≤12 by weeks 6-8). The comparison of remission rates was made through an adjusted indirect treatment comparison of lurasidone and quetiapine XR pivotal trials using placebo as the common comparator. Resource utilization for remission vs no remission was estimated from published expert panel data, and resource costs were obtained from a retrospective database study of bipolar I depression patients. Drug costs were estimated using the mean dose from clinical trials and wholesale acquisition costs. Over the 3-month model time period, lurasidone and quetiapine XR patients, respectively, had similar mean numbers of emergency department visits (0.48 vs 0.50), inpatient days (2.1 vs 2.2), and office visits (9.3 vs 9.6). More lurasidone than quetiapine XR patients achieved remission (52.0% vs 43.2%) with slightly higher total costs ($4982 vs $4676), resulting in an incremental cost-effectiveness ratio of $3474 per remission. The probabilistic sensitivity analysis showed lurasidone had an 86% probability of being cost-effective compared to quetiapine XR at a willingness-to-pay threshold of $10,000 per remission. Lurasidone may be a cost-effective option when compared to
Mechanical characterization of superalloys for space reactors
International Nuclear Information System (INIS)
Duchesne, J.
1989-01-01
The purpose of this work is the choice of materials usable between 600 and 900 0 C for nuclear space reactor structures. The main criterion of selection for these materials is their good creep behaviour. Consequently, macroscopic theories of creep and several extrapolation methods were described. Superalloys seem the best materials for the studied range of temperatures. Five of them, base nickel, ones unusual in nuclear industry were selected for their good mechanical properties. Three of them are industrial alloys: the first, HAYNES 230 is a recent one, HASTELLOY S and X are more standard materials. The last two, HASTELLOY XR and PYRAD 38 D are issued from special fabrications. Creep tests metallographic investigations, hardness and tensile tests were performed. A contraction of samples was observed during some creep tests under a low stress, 20MPa at 800 0 C, for HAYNES 230 and HASTELLOY X. This could be due to a structural evolution of these materials connected to a decrease of the cristalline parameter. In addition, correlations were observed between certain characteristics determined from slow tensile tests and short duration creep tests. These correlations present a large interest because, at the present time, creep tests cannot be executed on irradiated materials in our laboratories. Consequently creep behaviour of irradiated materials seem may be deduced. Further studies are needed to explain and confirm the behaviour of the most interesting materials under low stresses: HAYNES 230 and HASTELLOY XR to anticipate their behaviour in working conditions [fr
Directory of Open Access Journals (Sweden)
Graneix Jérémie
2013-11-01
Full Text Available Le procédé de soudage laser YAG est envisagé pour remplacer le procédé de soudage TIG manuel pour la réalisation de pièces de turboréacteur en alliage nickel-chrome-molybdène Hastelloy X. Cette étude expérimentale a permis de définir un domaine de soudabilité de cet alliage répondant aux critères spécifiques du secteur aéronautique. The YAG laser welding process is contemplated to replace the manual TIG welding process for the production of parts of turbojet in Hastelloy X. This experimental study has identified the field of weldability of this alloy to meet the specific requirements of the aerospace industry.
High temperature oxidation characteristics of developed Ni-Cr-W superalloys in air
International Nuclear Information System (INIS)
Suzuki, Tomio; Shindo, Masami
1996-11-01
For expanding utilization of the Ni-Cr-W superalloy, which has been developed as one of new high temperature structural materials used in the advanced High Temperature Gas-cooled Reactors (HTGRs), in various engineering fields including the structural material for heat utilization system, the oxidation behavior of this alloy in air as one of high oxidizing environments becomes one of key factors. The oxidation tests for the industrial scale heat of Ni-Cr-W superalloy with the optimized chemical composition and five kinds of experimental Ni-Cr-W alloys with different Cr/W ratio were carried out at high temperatures in the air compared with Hastelloy XR. The conclusions were obtained as follows. (1) The oxidation resistance of the industrial scale heat of Ni-Cr-W superalloy with the optimized chemical composition was superior to that of Hastelloy XR. (2) The most excellent oxidation resistance was obtained in an alloy with 19% Cr of the industrial scale heat of Ni-Cr-W superalloy. (author)
Application of Hastelloy X in gas-cooled reactor systems
International Nuclear Information System (INIS)
Brinkman, C.R.; Rittenhouse, P.L.; Corwin, W.R.; Strizak, J.P.; Lystrup, A.; DiStefano, J.R.
1976-10-01
Hastelloy X, an Ni--Cr--Fe--Mo alloy, may be an important structural alloy for components of gas-cooled reactor systems. Expected applications of this alloy in the High-Temperature Gas-Cooled Reactor (HTGR) are discussed, and the development of interim mechanical properties and supporting data are reported. Properties of concern include tensile, creep, creep-rupture, fatigue, creep-fatigue interaction, subcritical crack growth, thermal stability, and the influence of helium environments with controlled amounts of impurities on these properties. In order to develop these properties in helium environments that are expected to be prototypic of HTGR operating conditions, it was necessary to construct special environmental test systems. Details of construction and operating parameters are described. Interim results from tests designed to determine the above properties are presented. To date a fairly extensive amount of information has been generated on this material at Oak Ridge National Laboratory and elsewhere concerning behavior in air, which is reviewed. However, only limited data are available from tests conducted in helium. Comparisons of the fatigue and subcritical growth behavior in air between Hastelloy X and a number of other structural alloys are given
International Nuclear Information System (INIS)
Wang, Qin-Ying; Zhang, Yang-Fei; Bai, Shu-Lin; Liu, Zong-De
2013-01-01
Highlights: ► Hastelloy C22 coatings were prepared by diode laser cladding technique. ► Higher laser speed resulted in smaller grain size. ► Size-effect played the key role in the hardness measurements by different ways. ► Coating with higher laser scanning speed displayed higher nano-scratch resistance. ► Small grain size was beneficial for improvement of coating corrosion resistance. -- Abstract: The Hastelloy C22 coatings H1 and H2 were prepared by laser cladding technique with laser scanning speeds of 6 and 12 mm/s, respectively. Their microstructures, mechanical properties and corrosion resistance were investigated. The microstructures and phase compositions were studied by metallurgical microscope, scanning electron microscope and X-ray diffraction analysis. The hardness and scratch resistance were measured by micro-hardness and nanoindentation tests. The polarization curves and electrochemical impedance spectroscopy were tested by electrochemical workstation. Planar, cellular and dendritic solidifications were observed in the coating cross-sections. The coatings metallurgically well-bonded with the substrate are mainly composed of primary phase γ-nickel with solution of Fe, W, Cr and grain boundary precipitate of Mo 6 Ni 6 C. The hardness and corrosion resistance of steel substrate are significantly improved by laser cladding Hastelloy C22 coating. Coating H2 shows higher micro-hardness than that of H1 by 34% and it also exhibits better corrosion resistance. The results indicate that the increase of laser scanning speed improves the microstuctures, mechanical properties and corrosion resistance of Hastelloy C22 coating
International Nuclear Information System (INIS)
Bahari, I.B.
1989-01-01
Results indicate that XR-1 cells were very radiosensitive to gamma-irradiation compared to its parental type, and that this radiosensitivity is cell cycle dependent. Irradiating the cells the G 1 or plateau phase did not induce any delay entering S-phase but mitotic delays were observed in both XR-1 and the wild-type cells. The delays per unit dose were much longer for XR-1. A delay in subculture from plateau phase reduced the mitotic delay in both cell lines. Unlike the wild-type cells which expressed virtually all chromosome-type aberrations after irradiation of G 1 cells, the XR-1 cells expressed both chromatid- as well as chromosome-type aberrations. There was a one-to-one correlation between total aberrations induced and lethality for both cells. Many of these radiobiological properties of XR-1 cells relative to the wild-type cells, mimic the response of A-T cells relative to the normal human cells. However, the restoration of radioresistance and cytogenetic response in the XR1/AT5BI(4) hybrid cells suggest that the XR-1 and A-T cells have different defects because of the complementation in the hybrids. It also appears that this genetic defect is recessive in nature
Apical P2XR contribute to [Ca2+]i signaling and Isc in mouse renal MCD.
Li, Liuzhe; Lynch, I Jeanette; Zheng, Wencui; Cash, Melanie N; Teng, Xueling; Wingo, Charles S; Verlander, Jill W; Xia, Shen-Ling
2007-08-03
We examined P2X receptor expression and distribution in the mouse collecting duct (CD) and their functional role in Ca(2+) signaling. Both P2X(1) and P2X(4) were detected by RT-PCR and Western blot. Immunohistochemistry demonstrated apical P2X(1) and P2X(4) immunoreactivity in principal cells in the outer medullary CD (OMCD) and inner medullary CD (IMCD). Luminal ATP induced an increase in Ca(2+) signaling in native medullary CD (MCD) as measured by fluorescence imaging. ATP also induced an increase in Ca(2+) signaling in MCD cells grown in primary culture but not in the presence of P2XR antagonist PPNDS. Short circuit current (I(sc)) measurement with mouse IMCD cells showed that P2XR agonist BzATP induced a larger I(sc) than did P2YR agonist UTP in the apical membrane. Our data reveal for the first time that P2X(1) and P2X(4) are cell-specific with prominent immunoreactivity in the apical area of MCD cells. The finding that P2XR blockade inhibits ATP-induced Ca(2+) signaling suggests that activation of P2XR is a key step in Ca(2+)-dependent purinergic signaling. The result that activation of P2XR produces large I(sc) indicates the necessity of P2XR in renal CD ion transport.
Possible Evidence for an Event Horizon in Cyg XR-1
Dolan, Joseph F.; Fisher, Richard R. (Technical Monitor)
2001-01-01
The X-ray emitting component in the Cyg XR-1/HDE226868 system is a leading candidate for identification as a stellar-mass sized black hole. The positive identification of a black hole as predicted by general relativity requires the detection of an event horizon surrounding the point singularity. One signature of such an event horizon would be the existence of dying pulse trains emitted by material spiraling into the event horizon from the last stable orbit around the black hole. We observed the Cyg XR-1 system at three different epochs in a 1400 - 3000 A bandpass with 0.1 ms time resolution using the Hubble Space Telescope's High Speed Photometer. Repeated excursions of the detected flux by more than three standard deviations above the mean are present in the UV flux with FWHM 1 - 10 ms. If any of these excursions are pulses of radiation produced in the system (and not just stochastic variability associated with the Poisson distribution of detected photon arrival times), then this short a timescale requires that the pulses originate in the accretion disk around Cyg XR-1. Two series of pulses with characteristics similar to those expected from dying pulse trains were detected in three hours of observation.
International Nuclear Information System (INIS)
Putri, W. B. K.; Kang, B.; Ranot, M.; Lee, J. H.; Kang, W. N.
2014-01-01
We have grown MgB 2 on SiC buffer layer by using metallic Hastelloy tape as the substrate. Hastelloy tape was chosen for its potential practical applications, mainly in the power cable industry. SiC buffer layers were deposited on Hastelloy tapes at 400, 500, and 600 degrees C by using a pulsed laser deposition method, and then by using a hybrid physical-chemical vapor deposition technique, MgB 2 films were grown on the three different SiC buffer layers. An enhancement of critical current density values were noticed in the MgB 2 films on SiC/Hastelloy deposited at 500 and 600 degrees C. From the surface analysis, smaller and denser grains of MgB 2 tapes are likely to cause this enhancement. This result infers that the addition of SiC buffer layers may contribute to the improvement of superconducting properties of MgB 2 tapes.
Directory of Open Access Journals (Sweden)
Nianwen Shi
2012-01-01
Full Text Available Background. Knowledge about real-world use of duloxetine and venlafaxine XR to treat depression in the UK is limited. Aims. To identify predictors of duloxetine or venlafaxine XR initiation. Method. Adult depressed patients who initiated duloxetine or venlafaxine XR between January 1, 2006 and September 30, 2007 were identified in the UK’s General Practice Research Database. Demographic and clinical predictors of treatment initiation with duloxetine and venlafaxine XR were identified using logistic regression. Results. Patients initiating duloxetine (n=909 were 4 years older than venlafaxine XR recipients (n=1286. Older age, preexisting unexplained pain, respiratory disease, and pre-period use of anticonvulsants, opioids, and antihyperlipidemics were associated with increased odds of initiating duloxetine compared to venlafaxine XR. Pre-period anxiety disorder was associated with decreased odds of receiving duloxetine. Conclusion. Initial treatment choice with duloxetine versus venlafaxine XR was primarily driven by patient-specific mental and medical health characteristics. General practitioners in the UK favor duloxetine over venlafaxine XR when pain conditions coexist with depression.
Randomized, Controlled Study of Adderall XR in ADHD
Directory of Open Access Journals (Sweden)
J Gordon Millichap
2002-08-01
Full Text Available The efficacy and safety of Adderall XR in the treatment of attention deficit/hyperactivity disorder and diurnal variation in responses were assessed by a multicenter, randomized, double-blind, parallel group, placebo-controlled trial at 47 sites, and reported from the Massachusetts General Hospital, Boston, MA.
International Nuclear Information System (INIS)
Tsuji, Hirokazu; Tanabe, Tatsuhiko; Nakajima, Hajime
1994-01-01
A series of constant load and temperature creep rupture tests and varying load and temperature creep rupture tests was carried out on Hastelloy XR whose boron content level is 60 mass ppm at 900 and 1000 C in order to examine the behavior of the alloy under varying load and temperature conditions. The life fraction rule completely fails in the prediction of the creep rupture life under varying load and temperature conditions though the rule shows good applicability for Hastelloy XR whose boron content level is below 10 mass ppm. The modified life fraction rule has been proposed based on the dependence of the creep rupture strength on the boron content level of the alloy. The modified rule successfully predicts the creep rupture life under the test conditions from 1000 to 900 C. The trend observed in the tests from 900 to 1000 C can be qualitatively explained by the mechanism that the oxide film which is formed during the prior exposure to 900 C plays the role of the protective barrier against the boron dissipation into the environment. (orig.)
Long-Term Effects of Adderall XR in ADHD
Directory of Open Access Journals (Sweden)
J Gordon Millichap
2005-06-01
Full Text Available The long-term tolerability and effectiveness of extended release mixed amphetamine salts (Adderall XR in children with attention deficit hyperactivity disorder (ADHD were evaluated in a 24-month, multicenter, open-label extension of 2 placebo-controlled studies at UCLA, Massachusetts General Hospital, UC-Irvine, Maitland, FL, and Shire Pharmaceutical, Wayne, PA.
International Nuclear Information System (INIS)
Akhilesh, Philomina; Jamhale, Shramika H.; Sharma, S.D.; Kumar, Rajesh; Datta, D.; Kulkarni, Arti R.
2017-01-01
The purpose of this study was to estimate eye lens dose during brain scans in 16-, 64-, 128- and 256-slice multidetector computed tomography (CT) scanners in helical acquisition mode and to test the feasibility of using radiochromic film as eye lens dosemeter during CT scanning. Eye lens dose measurements were performed using Gafchromic XR-QA2 film on a polystyrene head phantom designed with outer dimensions equivalent to the head size of a reference Indian man. The response accuracy of XR-QA2 film was validated by using thermoluminescence dosemeters. The eye lens dose measured using XR-QA2 film on head phantom for plain brain scanning in helical mode ranged from 43.8 to 45.8 mGy. The XR-QA2 film measured dose values were in agreement with TLD measured dose values within a maximum variation of 8.9%. The good correlation between the two data sets confirms the viability of using XR-QA2 film for eye lens dosimetry. (authors)
Lepik, Katherine J; Yip, Benita; McGovern, Rachel A; Ding, Erin; Nohpal, Adriana; Watson, Birgit E; Toy, Junine; Akagi, Linda; Harrigan, P Richard; Moore, David M; Hogg, Robert S; Montaner, Julio S G; Barrios, Rolando
2015-01-01
Nevirapine 400 mg extended release tablets (nevirapine-XR) are a once-daily alternative to nevirapine 200 mg immediate release tablets (nevirapine-IR). Study objectives were to describe the effectiveness and tolerability of nevirapine-XR in clinical practice and, for patients who switched from once daily 2×200 mg nevirapine-IR to nevirapine-XR, compare virological suppression and plasma nevirapine concentrations during each treatment period. HIV-1-infected adults entered the study cohort if they initiated nevirapine-XR in British Columbia (BC) Canada between 1 April 2012 and 30 September 2012 and were followed until 30 September 2013. Demographic and clinical variables were abstracted from the BC Centre for Excellence in HIV/AIDS databases. Patients who switched from once daily nevirapine-IR to nevirapine-XR were monitored for 6 months pre- and post-switch with comparison of virological suppression (McNeamer's test) and median random plasma nevirapine concentrations (Wilcoxon-Mann-Whitney test) in each period. The 536 nevirapine-XR-treated patients were 96% male, median (IQR) age 49.9 (44.0-56.9) years. Median follow-up was 15.6 (14.7-16.5) months, with 474/536 (88%) maintaining virological suppression. Emergent drug resistance developed in 5/536 (1%), adverse drug reactions in 17/536 (3%) and, although 31/536 (6%) reported 'whole' tablets in their stools, this was not associated with adverse outcomes. Among the 305 patients who switched from nevirapine-IR to nevirapine-XR, median (IQR) random plasma nevirapine concentration was higher during nevirapine-IR 5,000 (3,690-6,090) ng/ml than nevirapine-XR 3,930 (3,050-5,150) ng/ml (Pmarketing study affirms the effectiveness and tolerability of nevirapine-XR as an alternative to nevirapine-IR in adults.
Effect of temperature upon the fatigue-crack propagation behavior of Hastelloy X-280
International Nuclear Information System (INIS)
James, L.A.
1976-05-01
The techniques of linear-elastic fracture mechanics were employed to characterize the effect of temperature upon the fatigue-crack propagation behavior of Hastelloy X-280 in an air environment. Also included in this study are survey tests to determine the effects of thermal aging and stress ratio upon crack growth behavior in this alloy
International Nuclear Information System (INIS)
Tsuji, Hirokazu; Nakajima, Hajime; Tanabe, Tatsuhiko.
1993-09-01
A series of constant load and temperature creep rupture tests and varying load and temperature creep rupture tests was carried out on Hastelloy XR whose boron content level is 60 mass ppm at 900 and 1000degC in order to examine the behavior of the alloy under varying load and temperature conditions. The life fraction rule completely fails in the prediction of the creep rupture life under varying load and temperature conditions though the rule shows good applicability for Hastelloy XR whose boron content level is below 10 mass ppm. The modified life fraction rule has been proposed based on the dependence of the creep rupture strength on the born content level of the alloy. The modified rule successfully predicts the creep rupture life under the test conditions from 1000degC to 900degC. The trend observed in the tests from 900degC to 1000degC can be qualitatively explained by the mechanism that the oxide film which is formed during the prior exposure to 900degC plays the role of the protective barrier against the boron dissipation into the environment. (author)
Yoon, Sumin; Rhee, Su-Jin; Park, Sang-In; Yoon, Seo Hyun; Cho, Joo-Youn; Jang, In-Jin; Lee, SeungHwan; Yu, Kyung-Sang
2017-06-01
The aim of this study was to compare the pharmacokinetic (PK) characteristics of evogliptin and metformin following the administration of 2 evogliptin/metformin extended-release (XR) 2.5/500 mg FDC tablets with the coadministration of separate evogliptin 5-mg and metformin XR 1,000-mg tablets (separate formulations). A randomized, two-period, two-sequence crossover study was conducted. Subjects were randomly assigned to receive 2 FDC tablets or the individual tablets, followed by a 14-day washout period and the administration of the alternate treatment. Blood samples were collected predose and up to 72 hours postdose for each period. PK parameters including Cmax and AUClast were calculated. The geometric mean ratios (GMRs) and the 90% confidence intervals (CIs) between FDC and the separate formulations were calculated for the Cmax and AUClast of evogliptin and metformin. 33 subjects completed the study. The GMR (90% CI) values of Cmax and AUClast for evogliptin were 1.011 (0.959 - 1.066) and 1.010 (0.977 - 1.043), respectively. The GMR (90% CI) values of Cmax and AUClast for metformin were 0.892 (0.827 - 0.963) and 0.893 (0.841 - 0.947), respectively. There was no significant difference between the FDC and separate formulations regarding the occurrence of adverse events. All drug-related adverse events were considered to be mild and resolved without any treatment. Two FDC tablets of evogliptin/metformin XR 2.5/500 mg showed a similar PK profile to the separate formulations of evogliptin 5 mg and metformin XR 1,000 mg. All of the 90% CIs of GMR satisfied the regulatory bioequivalence criteria of 0.800 - 1.250. .
Dosimetry using Gafchromic XR-RV2 radiochromic films in interventional radiology
International Nuclear Information System (INIS)
Neocleous, A.; Yakoumakis, E.; Gialousis, G.; Dimitriadis, A.; Yakoumakis, N.; Georgiou, E.
2011-01-01
Patient dose measurements of local entrance dose to the skin have been carried out using radiochromic film (Gafchromic XR-RV2) in a sample of interventional procedures. The major aim of the work was to measure patient entrance dose from such examinations using Gafchromic XR-RV2. Forty-five various interventional procedures (including nephrostomies and urinary stenting, biliary stenting and percutaneous transhepatic biliary drainage (PTBD) and aorta stent grafting) were evaluated. Maximum entrance doses were 537±119 mGy in nephrostomies, 943±631 mGy in biliary stenting and PTBD and 2425±569 mGy in aorta stent grafting. Results indicate that all patients undergoing aorta stent grafting received skin dose above 1500 mGy, which means that there is an increasing potential to suffer radiation-induced skin injuries. The film provides dose mapping, the position of the skin area with highest dose and can be used for immediate qualitative and as well as for quantitative assessment of patient skin dose. (authors)
Chen, Lin; Bai, Shu-Lin
2018-04-01
Hastelloy C22 coating was prepared on substrate of Q235 steel by high power multilayer laser cladding. The microstructure, hardness and anti-corrosion properties of coating were investigated. The corrosion tests in 3.5% NaCl solution were carried out with variation of impingement angle and velocity, and vibration frequency of sample. The microstructure of coating changes from equiaxed grain at the top surface to dendrites oriented at an angle of 60° to the substrate inside the coating. The corrosion rate of coating increases with the increase of impingement angle and velocity, and vibrant frequency of sample. Corrosion mechanisms relate to repassivation and depassivation of coating according to electrochemical measurements. Above results show that multilayer laser cladding can endow Hastelloy C22 coating with fine microstructures, high hardness and good anti-corrosion performances.
Energy Technology Data Exchange (ETDEWEB)
Bellanger, G.
1994-03-01
Polarization and electrochemical impedance spectrometry curves are presented and discussed. These curves make it possible to ascertain the corrosion domains and to compare the slow and fast kinetics (voltammetry) of different stainless steel alloys. These corrosion kinetics, the actual or simulated tritiated water redox potentials, and the corrosion potentials provide a classification of the steels studied here: 316L, Hastelloy, Maraging, Inconel 600, Elgiloy, carbon steel and TiN and NiCr deposits. From the results it can be concluded that Hastelloy and Elgiloy have the best corrosion resistance. (author). 49 refs., 695 figs., tabs.
Energy Technology Data Exchange (ETDEWEB)
Gao, Jie [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); School of Physical Sciences, University of Chinese Academy of Sciences, Beijing 100049 (China); Bao, Liangman [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); Huang, Hefei, E-mail: huanghefei@sinap.ac.cn [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); Li, Yan, E-mail: liyan@sinap.ac.cn [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); Lei, Qiantao [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); Institute of Modern Physics, Fudan University, Shanghai 200433 (China); Deng, Qi [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); Liu, Zhe; Yang, Guo [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); School of Physical Sciences, University of Chinese Academy of Sciences, Beijing 100049 (China); Shi, Liqun [Institute of Modern Physics, Fudan University, Shanghai 200433 (China)
2017-05-15
Hastelloy N alloy was implanted with 30 keV, 5 × 10{sup 16} ions/cm{sup 2} helium ions at room temperature, and subsequent annealed at 600 °C for 1 h and further annealed at 850 °C for 5 h in vacuum. Using elastic recoil detection analysis (ERDA) and transmission electron microscopy (TEM), the depth profiles of helium concentration and helium bubbles in helium-implanted Hastelloy N alloy were investigated, respectively. The diffusion of helium and molybdenum elements to surface occurred during the vacuum annealing at 850 °C (5 h). It was also observed that bubbles in molybdenum-enriched region were much larger in size than those in deeper region. In addition, it is worth noting that plenty of nano-holes can be observed on the surface of helium-implanted sample after high temperature annealing by scanning electron microscope (SEM). This observation provides the evidence for the occurrence of helium release, which can be also inferred from the results of ERDA and TEM analysis.
International Nuclear Information System (INIS)
Kurata, Yuji; Ogawa, Yutaka; Nakajima, Hajime
1988-01-01
Creep tests were conducted on Ni-base heat-resistant alloys Hastelloy XR and XR-II, i.e. versions of Hastelloy X modified for nuclear applications, at 950degC using four types of helium environment with different impurity compositions, and mainly the effect of carburization was examined. For all the materials tested, the values of creep rupture time obtained under the carburizing conditions were similar to or longer than those in the commonly used, standard test environment (JAERI Type B helium). The difference among the results was interpreted by the counterbalancing effects of the strengthening due to carburization and possible weakening caused under very low oxidizing potential. In the corrosion monitoring specimens pronounced carbon pick-up was observed in the environment with high carbon activity and very low oxidizing potential. Based on the results obtained in the present and the previous works, it is suggested that a moderate control of the impurity chemistry is important rather than simple purification of the coolant in protecting the material from the environment-enhanced degradation. Either condition with high or low extremes in the oxidizing and carburizing potentials may cause enhanced degradation and thus are desirable to be avoided at the elevated temperatures. (author)
Dose area product evaluations with Gafchromic XR-R films and a flat-bed scanner.
Rampado, O; Garelli, E; Deagostini, S; Ropolo, R
2006-12-07
Gafchromic XR-R films are a useful tool to evaluate entrance skin dose in interventional radiology. Another dosimetric quantity of interest in diagnostic and interventional radiology is the dose area product (DAP). In this study, a method to evaluate DAP using Gafchromic XR-R films and a flat-bed scanner was developed and tested. Film samples were exposed to an x-ray beam of 80 kVp over a dose range of 0-10 Gy. DAP measurements with films were obtained from the digitalization of a film sample positioned over the x-ray beam window during the exposure. DAP values obtained with this method were compared for 23 cardiological interventional procedures with DAP values displayed by the equipment. The overall one-sigma dose measurement uncertainty depended on the absorbed dose, with values below 6% for doses above 1 Gy. A maximum discrepancy of 16% was found, which is of the order of the differences in the DAP measurements that may occur with different calibration procedures. Based on the results presented, after an accurate calibration procedure and a thorough inspection of the relationship between the actual dose and the direct measured quantity (net optical density or net pixel value variation), Gafchromic XR-R films can be used to assess the DAP.
Metallurgical and environmental factors influencing creep behaviour of hastelloy-X
International Nuclear Information System (INIS)
Kiuchi, Kiyoshi; Kondo, Tatsuo
1979-03-01
Creep and rupture behaviours of Hastelloy-X and its modified version were examined with special reference to the effect of different test environments; i.e. air, high vacuum and the simulated HTR helium coolant. The respective environments showed different effects. The vacuum environment of about 10 -8 torr. gave best reproducible behaviour with essentially no surface-to-volume ratio effect. Such size effect was significant in the other two environments. The simulated HTR environment was characterized in its potentiality of both oxidizing selected alloy constituents and carburization. The observed behaviour was attributed to the depletion of strengthning solute elements caused by the surface reactions and the associated solid state reactions. (author)
The high-energy X-ray spectrum of Centaurus XR-3 observed from OSO 8
Dolan, J. F.; Crannell, C. J.; Dennis, B. R.; Frost, K. J.; Orwig, L. E.
1984-01-01
Observations of the X-ray binary Cen XR-3 in the 20-120 keV energy range by means of OSO 8's high energy X-ray spectrometer, during July 16-19, 1975, and July 5-14 and 28-29, 1978, indicate that the source was in a high luminosity state during 1975 and a low luminosity one in 1978. While mean orbital light curves appear similar in shape in both years, orbit-to-orbit intensity variations are noted. Spectral, luminosity, and the 4.84 sec modulation are characterized. Cen XR-3 may be a system in which mass transfer by Roche lobe overflow, and by accretion from a stellar wind, are both effective in the production of observable X-ray radiation.
Li, Ranran; Wu, Renrong; Chen, Jun; Kemp, David E; Ren, Ming; Conroy, Carla; Chan, Philip; Serrano, Mary Beth; Ganocy, Stephen J; Calabrese, Joseph R; Gao, Keming
2016-03-01
To pilot efficacy and safety data of quetiapine-XR monotherapy or adjunctive therapy to antidepressant(s) in the acute treatment of MDD with current generalized anxiety disorder (GAD). The Mini International Neuropsychiatric Interview was used to ascertain the diagnosis of DSM-IV Axis I disorders. Eligible patients were randomly assigned to quetiapine-XR or placebo for up to 8 weeks. Changes from baseline to endpoint in Hamilton Depression Rating Scale-17 items (HAMD-17), Hamilton Anxiety Rating Scale (HAM-A), Clinical Global Impression-Severity (CGI-S), Quick Inventory of Depression Symptomatology-16 items Self-Report (QIDS-16-SR) total scores, and other outcome measures were analyzed with the last observation carried forward strategy and/or mixed-effects modeling for repeated measures. Of the 34 patients screened, 23 patients were randomized to receive quetiapine-XR (n = 11) or placebo (n = 12), with 5 and 4 completing the study, respectively. The mean dose of quetiapine-XR was 154 ± 91 mg/d. The change from baseline to endpoint in the total scores of HAMD-17, HAM-A, QIDS-16-SR, and CGI-S were significant in the quetiapine-XR group, but only the change in HAM-A total score was significant in the placebo group. The differences in these changes between the two groups were only significant in CGI-S scores, with the rest of numerical larger in the quetiapine-XR group. The most common side effects from quetiapine-XR were dry mouth, somnolence/sedation, and fatigue. In this pilot study, quetiapine-XR was numerically superior to placebo in reducing depressive and anxiety symptoms in patients with MDD and current GAD. Large sample studies are warranted to support or refute these preliminary findings.
Dose area product evaluations with Gafchromic[reg] XR-R films and a flat-bed scanner
International Nuclear Information System (INIS)
Rampado, O; Garelli, E; Deagostini, S; Ropolo, R
2006-01-01
Gafchromic[reg] XR-R films are a useful tool to evaluate entrance skin dose in interventional radiology. Another dosimetric quantity of interest in diagnostic and interventional radiology is the dose area product (DAP). In this study, a method to evaluate DAP using Gafchromic[reg] XR-R films and a flat-bed scanner was developed and tested. Film samples were exposed to an x-ray beam of 80 kVp over a dose range of 0-10 Gy. DAP measurements with films were obtained from the digitalization of a film sample positioned over the x-ray beam window during the exposure. DAP values obtained with this method were compared for 23 cardiological interventional procedures with DAP values displayed by the equipment. The overall one-sigma dose measurement uncertainty depended on the absorbed dose, with values below 6% for doses above 1 Gy. A maximum discrepancy of 16% was found, which is of the order of the differences in the DAP measurements that may occur with different calibration procedures. Based on the results presented, after an accurate calibration procedure and a thorough inspection of the relationship between the actual dose and the direct measured quantity (net optical density or net pixel value variation), Gafchromic[reg] XR-R films can be used to assess the DAP. (note)
Dose area product evaluations with Gafchromic[reg] XR-R films and a flat-bed scanner
Energy Technology Data Exchange (ETDEWEB)
Rampado, O; Garelli, E; Deagostini, S; Ropolo, R [Struttura Complessa Fisica Sanitaria, Azienda Ospedaliera San Giovanni Battista, Corso Bramante 88, 10126 Turin (Italy)
2006-12-07
Gafchromic[reg] XR-R films are a useful tool to evaluate entrance skin dose in interventional radiology. Another dosimetric quantity of interest in diagnostic and interventional radiology is the dose area product (DAP). In this study, a method to evaluate DAP using Gafchromic[reg] XR-R films and a flat-bed scanner was developed and tested. Film samples were exposed to an x-ray beam of 80 kVp over a dose range of 0-10 Gy. DAP measurements with films were obtained from the digitalization of a film sample positioned over the x-ray beam window during the exposure. DAP values obtained with this method were compared for 23 cardiological interventional procedures with DAP values displayed by the equipment. The overall one-sigma dose measurement uncertainty depended on the absorbed dose, with values below 6% for doses above 1 Gy. A maximum discrepancy of 16% was found, which is of the order of the differences in the DAP measurements that may occur with different calibration procedures. Based on the results presented, after an accurate calibration procedure and a thorough inspection of the relationship between the actual dose and the direct measured quantity (net optical density or net pixel value variation), Gafchromic[reg] XR-R films can be used to assess the DAP. (note)
International Nuclear Information System (INIS)
Bellanger, G.
1994-03-01
Polarization and electrochemical impedance spectrometry curves are presented and discussed. These curves make it possible to ascertain the corrosion domains and to compare the slow and fast kinetics (voltammetry) of different stainless steel alloys. These corrosion kinetics, the actual or simulated tritiated water redox potentials, and the corrosion potentials provide a classification of the steels studied here: 316L, Hastelloy, Maraging, Inconel 600, Elgiloy, carbon steel and TiN and NiCr deposits. From the results it can be concluded that Hastelloy and Elgiloy have the best corrosion resistance. (author). 49 refs., 695 figs., tabs
Composition of eta carbide in Hastelloy N after aging 10,000 hr at 8150C
International Nuclear Information System (INIS)
Leitnaker, J.M.; Potter, G.A.; Bradley, D.J.; Franklin, J.C.; Laing, W.R.
1977-11-01
The composition of the eta carbide in Hastelloy N containing 0.7 wt percent Si in the alloy approaches M 12 C, rather than M 6 C as indicated in the alloy literature. The silicon content of the eta phase in this case was about 25 at. percent, much higher than has been observed in less highly alloyed material. The data do not permit a definition of the limiting compositions of the phases
Study on the creep constitutive equation of Hastelloy X, (1)
International Nuclear Information System (INIS)
Hada, Kazuhiko; Mutoh, Yasushi
1983-01-01
A creep constitutive equation of Hastelloy X was obtained from available experimental data. A sensitivity analysis of this creep constitutive equation was carried out. As the result, the following were revealed: (i) Variations in creep behavior with creep constitutive equation are not small. (ii) In a simpler stress change pattern, variations in creep behavior are similar to those in the corresponding fundamental creep characteristics (creep strain curve, stress relaxation curve, etc.). (iii) Cumulative creep damage estimated in accordance with ASME Boiler and Pressure Vessel Code Case N-47 from a stress history predicted by ''the standard creep constitutive equation'' which predicts the average behavior of creep strain curve data is not thought to be on the safe side on account of uncertainties in creep damage caused by variations in creep strain curve. (author)
This randomized phase IIb trial studies how well ACTOplus met XR works in treating in patients with stage I-IV oral cavity or oropharynx cancer that are undergoing definitive treatment. Chemoprevention is the use of drugs to keep oral cavity or oropharynx cancer from forming or coming back. The use of ACTOplus met XR may slow disease progression in patients with oral cavity or
Corrosion tests of 316L and Hastelloy C-22 in simulated tank waste solutions
International Nuclear Information System (INIS)
Danielson, M.J.; Pitman, S.G.
2000-01-01
Both the 316L stainless steel and Hastelloy C-22 gave satisfactory corrosion performance in the simulated test environments. They were subjected to 100 day weight loss corrosion tests and electrochemical potentiodynamic evaluation. This activity supports confirmation of the design basis for the materials of construction of process vessels and equipment used to handle the feed to the LAW-melter evaporator. BNFL process and mechanical engineering will use the information derived from this task to select material of construction for process vessels and equipment
Harvey, Philip D; Siu, Cynthia O; Loebel, Antony D
2017-12-01
Objective: The objective of this post-hoc analysis was to evaluate the effect of lurasidone and quetiapine extended-release (XR) on insight and judgment and assess the longitudinal relationships between improvement in insight and cognitive performance, functional capacity, quality of well-being, and depressive symptoms in patients with schizophrenia. Design: Clinically unstable patients with schizophrenia (N=488) were randomized to once-daily, fixed-dose treatment with lurasidone 80mg, lurasidone 160mg, quetiapine XR 600mg, or placebo, followed by a long-term, double-blind, flexible-dose continuation study involving these agents. Results: Significantly greater improvement in insight and judgment (assessed by the Positive and Negative Syndrome Scale G12 item) for the lurasidone and quetiapine XR groups, compared to the placebo group, was observed at Week 6. Over a subsequent six-month continuation period, the flexible dose lurasidone group showed significantly greater improvement in insight from acute phase baseline compared to the flexible-dose quetiapine XR group (QXR-QXR) (p=0.032). Improvement in insight was significantly correlated with improvement in cognition ( p =0.014), functional capacity (p=0.006, UPSA-B), quality of well-being ( p =0.033, QWB), and depressive symptoms ( p =0.05, Montgomery-Åsberg Depression Rating Scale [MADRS] score) across treatment groups and study periods. Conclusion: In this post-hoc analysis, flexibly dosed lurasidone 40 to 160mg/d was found to be associated with significantly greater improvement in insight compared to flexibly dosed quetiapine XR 200 to 800mg/d over long-term treatment in patients with schizophrenia. Across treatment groups, improvement in insight and judgment was significantly associated with improvement in cognition, functional capacity, quality of well-being, and depressive symptoms over time.
Effects of OROS-MPH Versus Dl-Amphetamine-XR on Driving Performance of ADHD Adolescents
Directory of Open Access Journals (Sweden)
J Gordon Millichap
2006-10-01
Full Text Available Driving performance of 35 adolescent ADHD patients (19 boys/16 girls; mean age 17.8 years on a driving simulator was compared while taking OROS methylphenidate (Concerta, 72 mg, mixed dl-amphetamine salts (Adderall XR, 30 mg, or placebo in a randomized, double-blind, crossover study at University of Virginia, Charlottesville.
International Nuclear Information System (INIS)
Inouye, H.; Rittenhouse, P.L.
1981-01-01
Typical HTGR candidate alloys can carburize when exposed to simulated service environments. The carbon concentration gradients so formed give rise to internal stresses which could cause dilation. Studies performed with Hastelloy X and Alloy 800H showed that dilations of up to almost 1% can occur at 1000 0 C when carbon pickup is high. Dilation was normally observed only when the carbon increase was >1000 μg/cm 2 and ceased when diffusing carbon reached the center of the specimen. (Auth.)
Creep curve modeling of hastelloy-X alloy by using the theta projection method
International Nuclear Information System (INIS)
Woo Gon, Kim; Woo-Seog, Ryu; Jong-Hwa, Chang; Song-Nan, Yin
2007-01-01
To model the creep curves of the Hastelloy-X alloy which is being considered as a candidate material for the VHTR (Very High Temperature gas-cooled Reactor) components, full creep curves were obtained by constant-load creep tests for different stress levels at 950 C degrees. Using the experimental creep data, the creep curves were modeled by applying the Theta projection method. A number of computing processes of a nonlinear least square fitting (NLSF) analysis was carried out to establish the suitably of the four Theta parameters. The results showed that the Θ 1 and Θ 2 parameters could not be optimized well with a large error during the fitting of the full creep curves. On the other hand, the Θ 3 and Θ 4 parameters were optimized well without an error. For this result, to find a suitable cutoff strain criterion, the NLSF analysis was performed with various cutoff strains for all the creep curves. An optimum cutoff strain range for defining the four Theta parameters accurately was found to be a 3% cutoff strain. At the 3% cutoff strain, the predicted curves coincided well with the experimental ones. The variation of the four Theta parameters as the function of a stress showed a good linearity, and the creep curves were modeled well for the low stress levels. Predicted minimum creep rate showed a good agreement with the experimental data. Also, for a design usage of the Hastelloy-X alloy, the plot of the log stress versus log the time to a 1% strain was predicted, and the creep rate curves with time and a cutoff strain at 950 C degrees were constructed numerically for a wide rang of stresses by using the Theta projection method. (authors)
DEFF Research Database (Denmark)
Lystrup, Aage; Rittenhouse, P. L.; DiStefano, J. R.
Hastelloy X and 2/sup 1///sub 4/ Cr-1 Mo steel are being considered as structural alloys for components of a High-Temperature Gas-Cooled Reactor (HTGR) system. Among other mechanical properties, the creep behavior of these materials in HTGR primary coolant helium must be established to form part...
Corrosion characteristics of Hastelloy N alloy after He+ ion irradiation
International Nuclear Information System (INIS)
Lin Jianbo; Yu Xiaohan; Li Aiguo; He Shangming; Cao Xingzhong; Wang Baoyi; Li Zhuoxin
2014-01-01
With the goal of understanding the invalidation problem of irradiated Hastelloy N alloy under the condition of intense irradiation and severe corrosion, the corrosion behavior of the alloy after He + ion irradiation was investigated in molten fluoride salt at 700 °C for 500 h. The virgin samples were irradiated by 4.5 MeV He + ions at room temperature. First, the virgin and irradiated samples were studied using positron annihilation lifetime spectroscopy (PALS) to analyze the influence of irradiation dose on the vacancies. The PALS results showed that He + ion irradiation changed the size and concentration of the vacancies which seriously affected the corrosion resistance of the alloy. Second, the corroded samples were analyzed using synchrotron radiation micro-focused X-ray fluorescence, which indicated that the corrosion was mainly due to the dealloying of alloying element Cr in the matrix. Results from weight-loss measurement showed that the corrosion generally correlated with the irradiation dose of the alloy. (author)
Directory of Open Access Journals (Sweden)
Wang G
2014-01-01
Full Text Available Gang Wang,1 Alexander McIntyre,2 Willie R Earley,3 Shane R Raines,3 Hans Eriksson4 1Beijing Anding Hospital, Capital Medical University, Beijing, People's Republic of China; 2Department of Psychiatry, Penticton Regional Hospital, Penticton, BC, Canada; 3AstraZeneca Pharmaceuticals, Wilmington, DE, USA; 4AstraZeneca R&D, Södertälje, Sweden Objectives: To evaluate the efficacy and tolerability of once-daily extended release quetiapine fumarate (quetiapine XR monotherapy in patients with major depressive disorder (MDD. Patients and methods: This was a 10-week (8-week active treatment/2-week post-treatment randomized, double-blind, placebo- and active-controlled study (D1448C00004. Patients received quetiapine XR 150 mg/day, escitalopram 10 mg/day, or placebo; patients with an inadequate response (<20% improvement in Montgomery–Åsberg Depression Rating Scale [MADRS] total score at week two received double-dose treatment. The primary end point was week eight change from randomization in MADRS total score. Secondary end points included MADRS response (≥50% improvement and remission (score ≤8; Hamilton Rating Scale for Depression total and item 1; Hamilton Rating Scale for Anxiety total, psychic, and somatic; Clinical Global Impressions – Severity of Illness total; Pittsburgh Sleep Quality Index (PSQI global; and Quality of Life Enjoyment and Satisfaction Questionnaire – Short Form percentage maximum total scores. Tolerability was assessed throughout. Results: A total of 471 patients was randomized. No significant improvements in MADRS total score were observed at week eight (last observation carried forward with either active treatment (quetiapine XR, -17.21 [P=0.174]; escitalopram, -16.73 [P=0.346] versus placebo (-15.61. There were no significant differences in secondary end points versus placebo, with the exception of week-eight change in PSQI global score (quetiapine XR, -4.96 [P<0.01] versus placebo, -3.37. Mixed-model repeated
International Nuclear Information System (INIS)
Mendoza-Moctezuma, A. I.; Aguilar, J. Garcia; Garcia-Garduno, O. A.
2010-01-01
Interventional cardiology procedures are an effective alternative for the reestablishment of correct sanguineous circulation in the heart. However, this kind of procedures exposes to the patients to a relatively high radiation doses. Usually, the surface peak skin dose is evaluated using a visual scale with a comparator strip, nevertheless, even if the comparator strip provides a simple and quick method for estimating the dose it has an uncertainty of ±25%. For this reason, a better evaluation method is needed. The objective of our project is to determine the surface peak skin dose of interventional cardiology procedures using GafChromic XR-RV2 film together with a commercial flatbed scanner in reflection mode. Here we report a protocol to handle GafChromic XR-RV2 film using a commercial flat bed scanner in reflection mode aiming at an uncertainty of ±3%.
International Nuclear Information System (INIS)
Chin, J.; Johnson, W.R.; Chen, K.
1982-03-01
Commercially prepared aluminide coatings on Hastelloy X and Inconel 617 substrates were exposed to controlled-impurity helium at 850 0 and 950 0 C for 3000 h. Optical and scanning electron (SEM) microscopy, electron microprobe profiles, and SEM X-ray mapping were used to evaluate and compare exposed and unexposed control samples. Four coatings were evaluated: aluminide, aluminide with platinum, aluminide with chromium, and aluminide with rhodium. With extended time at elevated temperature, nickel diffused into the aluminide coatings to form epsilon-phase (Ni 3 Al). This diffusion was the primary cause of porosity formation at the aluminide/alloy interface
The orbital inclination of Cygnus XR-1 measured polarimetrically
International Nuclear Information System (INIS)
Dolan, J.F.; Tapia, S.
1989-01-01
The X-ray binary Cyg XR-1/HDE 226868 was observed polarimetrically over one orbit at three different optical wavelengths. The standard theory of Brown, et al. (1978) is used to derive an orbital inclination i = 62 deg (+5 deg, -37 deg), where the error is the 90-percent-confidence interval derived by the method of Simmons, et al. (1980). The value of the orbital inclination is significantly lower than values based on polarimetric observations. The difference is a result of the observational protocols used. A bias toward larger values of the inclination caused by the tidal distortion of the primary is still found in the present result. The inclination derived corresponds to a mass of the compact component of 6.3 solar masses, above the maximum mass of any degenerate configuration consistent with general relativity except a black hole. 37 refs
Quantum effective potential in S1xR3
International Nuclear Information System (INIS)
Denardo, G.; Spallucci, E.; Doebner, H.D.
1981-07-01
The functional integral formulation of quantum field theory is applied to the study of the vacuum state in spacetimes with S 1 xR 3 topology. Such a global spacetime structure can be physically realized both in flat and in curved spacetime. In the first case one deals with finite temperature quantum field theories (if S 1 is time-like) or with field theories in a spacetime with a compact space dimension (if S 1 is spacelike). When curvature is present, a S 1 time-like dimension is induced by the Wick rotation whenever the metric is endowed with an event horizon, and this leads to the thermal nature of the vacuum in these cases. We shall take into account here only conformally flat spacetimes. Finally we discuss in some details the topological restoration of a spontaneously broken symmetry and the strictly related problem of the mass dynamical generation. (author)
Compatibility of heat resistant alloys with boron carbide, 5
International Nuclear Information System (INIS)
Baba, Shinichi; Kurasawa, Toshimasa; Endow, Taichi; Someya, Hiroyuki; Tanaka, Isao.
1986-08-01
This paper includes an experimental result of out-of-pile compatibility and capsule design for irradiation test in Japan Materials Testing Reactor (JMTR). The compatibility between sheath material and neutron absorber materials for control rod devices (CRD) was examined for potential use in a very high temperature reactor (VHTR) which is under development at JAERI. The purpose of the compatibility tests are preliminary evaluation of safety prior to irradiation tests. Preliminary compatibility evaluation was concerned with three items as follows : 1) Lithium effects on the penetrating reaction of Incoloy 800H alloy in contact with a mixture of boronated graphite and lithium hydroxide powders, 2) Short term tensile properties of Incoloy 800H and Hastelloy XR alloy reacted with boronated graphite and fracture mode analysis, 3) Reaction behavior of both alloys under transient power conditions of a VHTR. It was clear that the reaction rate constant of the Incoloy 800H alloy was accelerated by doping lithium hydroxide into the boron carbide and graphite powder. The mechanical properties of Incoloy 800H and Hastelloy XR alloy reacted with boronated graphite were decreased. Ultimate tensile strength and tensile ductilities at temperatures over 850 deg C were reduced, but there was no change in the proof (yield) stress. Both alloys exhibited a brittle intergranular fracture mode during transient power conditions of a VHTR and also exhibited severe penetration. Irradiation capsules for compatibility test were designed to simulate three irradiation conditions of VHTR: 1) steady state for VHTR, 2) Transient power condition, 3) Service limited life of CRD. Capsule irradiation experiments have been carried out satisfactorily and thus confirm the validity of the capsule design procedure. (author)
Effect of grain size and cold working on high temperature strength of Hastelloy X
International Nuclear Information System (INIS)
Fujioka, J.; Murase, H.; Matsuda, S.
1980-01-01
Effect of grain size and cold working on creep, creep rupture, low cycle fatigue and tensile strengths of Hastelloy X were studied at temperatures ranging from 800 to 1000 0 C. In order to apply these data to design, the allowable design stresses were estimated by expanding the criteria of ASME Code Case 1592 to such a high temperature range. The allowable design stress increased, on the other hand, the low cycle fatigue life decreased with increasing grain size. Cold working up to a ratio of 5 per cent may not be a serious problem in design, because the allowable design stress and the fatigue life were little affected. The cause of these variations in strength was discussed by examining the initiation and growth of cracks, and the microstructures. (author)
High-energy X-ray spectra of Cygnus XR-1 observed from OSO 8
Dolan, J. F.; Crannell, C. J.; Dennis, B. R.; Frost, K. J.; Orwig, L. E.
1979-01-01
X-ray spectra of Cygnus XR-1 were measured with the scintillation spectrometer aboard the OSO 8 satellite during a period of one-and-one-half to three weeks in each of the years from 1975 to 1977. Typical spectra of the source between 15 and 250 keV are presented and the spectra are found to be well represented by a single power-law expression whose photon number spectral index is different for the two intensity states that were considered. The observed pivoting effect is consistent with two-temperature accretion disk models of the X-ray emitting region.
Compatibility studies of type 316 stainless steel and Hastelloy N in KNO3--NaNO2--NaNO3
International Nuclear Information System (INIS)
Devan, J.H.; Keiser, J.R.
1978-01-01
The nitrate-based fused salt mixture KNO 3 --NaNO 2 --NaNO 3 (44--49--7 mol %) has been widely used as a heat transport fluid and for metallurgical heat-treating. We have measured the corrosion rate of this salt in the presence of a temperature gradient for an iron-base material, type 316 stainless steel, and a nickel-base material, Hastelloy N. Corrosion rates were measured with maximum loop temperatures of 431 and 504 0 C. Measured corrosion rates were in all cases less than 8 μm/year
International Nuclear Information System (INIS)
Helbig, R.; Speit, G.; Zdzienicka, M.Z.
1995-01-01
The radiosensitive Chinese hamster cell line XR-V15B was used to study the effect of decreased rejoining of DNA double-strand breaks (DSBs) on gene mutations and chromosome aberrations. XR-V15B cells are hypersensitive to the cytotoxic effects of neocarzinostatin (NCS) and methyl methanesulfonate (MMS). Both mutagens induced more chromosome aberrations in XR-V15B cells than in the parental cell strain. The clastogenic action of NCS was characterized by the induction of predominantly chromosome-type aberrations in cells of both strains, whereas MMS induced mainly chromatid aberrations. The frequency of induced gene mutations at the hprt locus was not increased compared to the parental V79 cells when considering the same survival level. Molecular analysis by multiplex polymerase chain reaction (PCR) of mutants induced by NCS revealed a high frequency of deletions in cells of both cell lines. Methyl methane-sulfonate induced mainly mutations without visible change in the PCR pattern, which probably represent point mutations. Our findings suggest a link between a defect in DNA DSB repair and increased cytotoxic and clastogenic effects. However, a decreased ability to rejoin DNA DSBs does not seem to influence the incidence and types of gene mutations at the hprt locus induced by NCS and MMS. 28 refs., 4 figs., 3 tabs
Ion irradiation-induced swelling and hardening effect of Hastelloy N alloy
Energy Technology Data Exchange (ETDEWEB)
Zhang, S.J. [Key Laboratory of Artificial Micro-and Nano-structures of Ministry of Education, School of Physics and Technology, Wuhan University, Wuhan 430072 (China); Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); Li, D.H.; Chen, H.C.; Lei, G.H.; Huang, H.F.; Zhang, W.; Wang, C.B. [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); Yan, L., E-mail: yanlong@sinap.ac.cn [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); Fu, D.J. [Key Laboratory of Artificial Micro-and Nano-structures of Ministry of Education, School of Physics and Technology, Wuhan University, Wuhan 430072 (China); Tang, M. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States)
2017-06-15
The volumetric swelling and hardening effect of irradiated Hastelloy N alloy were investigated in this paper. 7 MeV and 1 MeV Xe ions irradiations were performed at room temperature (RT) with irradiation dose ranging from 0.5 to 27 dpa. The volumetric swelling increases with increasing irradiation dose, and reaches up to 3.2% at 27 dpa. And the irradiation induced lattice expansion is also observed. The irradiation induced hardening initiates at low ion dose (≤1dpa) then saturates with higher ion dose. The irradiation induced volumetric swelling may be ascribed to excess atomic volume of defects. The irradiation induced hardening may be explained by the pinning effect where the defects can act as obstacles for the free movement of dislocation lines. And the evolution of the defects' size and number density could be responsible for the saturation of hardness. - Highlights: •Irradiation Swelling: The irradiation induced volumetric swelling increases with ion dose. •Irradiation Hardening: The irradiation hardening initiates below 1 dpa, then saturates with higher ion dose (1–10 dpa). •Irradiation Mechanism: The irradiation phenomena are ascribed to the microstructural evolution of the irradiation defects.
Klippel, A.; Zhao, J.; Masrur, A.; Wallgruen, J. O.; La Femina, P. C.
2017-12-01
We present work along the virtuality continuum showcasing both AR and VR environments for geoscience applications and research. The AR/VR project focusses on one of the most prominent landmarks on the Penn State campus which, at the same time, is a representation of the geology of Pennsylvania. The Penn State Obelisk is a 32" high, 51 ton monument composed of 281 rocks collected from across Pennsylvania. While information about its origins and composition are scattered in articles and some web databases, we compiled all the available data from the web and archives and curated them as a basis for an immersive xR experience. Tabular data was amended by xR data such as 360° photos, videos, and 3D models (e.g., the Obelisk). Our xR (both AR and VR) prototype provides an immersive analytical environment that supports interactive data visualization and virtual navigation in a natural environment (a campus model of today and of 1896, the year of the Obelisk's installation). This work-in-progress project can provide an interactive immersive learning platform (specifically, for K-12 and introductory level geosciences students) where learning process is enhanced through seamless navigation between 3D data space and physical space. The, second, VR focused application is creating and empirically evaluating virtual reality (VR) experiences for geosciences research, specifically, an interactive volcano experience based on LiDAR and image data of Iceland's Thrihnukar volcano. The prototype addresses the lack of content and tools for immersive virtual reality (iVR) in geoscientific education and research and how to make it easier to integrate iVR into research and classroom experiences. It makes use of environmentally sensed data such that interaction and linked content can be integrated into a single experience. We discuss our workflows as well as methods and authoring tools for iVR analysis and creation of virtual experiences. These methods and tools aim to enhance the utility
Creep strength of hastelloy X TIG-welded cylinder under internal pressure at elevated temperature
International Nuclear Information System (INIS)
Udoguchi, Teruyoshi; Indo, Hirosato; Isomura, Kazuyuki; Kobatake, Kiyokazu; Nakanishi, Tsuneo.
1981-01-01
Creep tests on circumferentially TIG-welded Hastelloy x cylinders were carried out under internal pressure for the investigation of structural behavior of welded components in high temperature environment. The creep rupture strength of TIG-welded cylinders was much lower than that of non-welded cylinders, while such reduction was not found in uniaxial creep tests on TIG-welded bars. It was deduced that the reduction was due to the low ductility (ranging from 1 to 5%) of the weld metal to which enhanced creep was induced by the adjacent base metal whose creep strain rate was much higher than that of the weld metal. Therefore, uniaxial creep tests on bar specimens is not sufficient for proper assessment of the creep rupture strength of welded components. Both creep strain rate and creep ductility should be concerned for the assessment. Creep tests by using components such as cylinder under internal pressure are recommendable for the confirmation of creep strength of welded structures and components. (author)
Common aperture multispectral spotter camera: Spectro XR
Petrushevsky, Vladimir; Freiman, Dov; Diamant, Idan; Giladi, Shira; Leibovich, Maor
2017-10-01
The Spectro XRTM is an advanced color/NIR/SWIR/MWIR 16'' payload recently developed by Elbit Systems / ELOP. The payload's primary sensor is a spotter camera with common 7'' aperture. The sensor suite includes also MWIR zoom, EO zoom, laser designator or rangefinder, laser pointer / illuminator and laser spot tracker. Rigid structure, vibration damping and 4-axes gimbals enable high level of line-of-sight stabilization. The payload's list of features include multi-target video tracker, precise boresight, strap-on IMU, embedded moving map, geodetic calculations suite, and image fusion. The paper describes main technical characteristics of the spotter camera. Visible-quality, all-metal front catadioptric telescope maintains optical performance in wide range of environmental conditions. High-efficiency coatings separate the incoming light into EO, SWIR and MWIR band channels. Both EO and SWIR bands have dual FOV and 3 spectral filters each. Several variants of focal plane array formats are supported. The common aperture design facilitates superior DRI performance in EO and SWIR, in comparison to the conventionally configured payloads. Special spectral calibration and color correction extend the effective range of color imaging. An advanced CMOS FPA and low F-number of the optics facilitate low light performance. SWIR band provides further atmospheric penetration, as well as see-spot capability at especially long ranges, due to asynchronous pulse detection. MWIR band has good sharpness in the entire field-of-view and (with full HD FPA) delivers amount of detail far exceeding one of VGA-equipped FLIRs. The Spectro XR offers level of performance typically associated with larger and heavier payloads.
Laser texturing of Hastelloy C276 alloy surface for improved hydrophobicity and friction coefficient
Yilbas, B. S.; Ali, H.
2016-03-01
Laser treatment of Hastelloy C276 alloy is carried out under the high pressure nitrogen assisting gas environment. Morphological and metallurgical changes in the laser treated layer are examined using the analytical tools including, scanning electron and atomic force microscopes, X-ray diffraction, energy dispersive spectroscopy, and Fourier transform infrared spectroscopy. Microhardness is measured and the residual stress formed in the laser treated surface is determined from the X-ray data. The hydrophibicity of the laser treated surface is assessed using the sessile drop method. Friction coefficient of the laser treated layer is obtained incorporating the micro-tribometer. It is found that closely spaced laser canning tracks create a self-annealing effect in the laser treated layer and lowers the thermal stress levels through modifying the cooling rates at the surface. A dense structure, consisting of fine size grains, enhances the microhardness of the surface. The residual stress formed at the surface is compressive and it is in the order of -800 MPa. Laser treatment improves the surface hydrophobicity significantly because of the formation of surface texture composing of micro/nano-pillars.
Creep properties of EB welded joint on Hastelloy X
International Nuclear Information System (INIS)
Arata, Yoshiaki; Susei, Shuzo; Shimizu, Shigeki; Satoh, Keisuke; Nagai, Hiroyoshi.
1980-01-01
In order to clarify the creep properties of EB welds on Hastelloy X which is one of the candidate alloys for components of VHTR, creep tests on EB weld metal and welded joint were carried out. The results were discussed in comparison with those of base metal and TIG welds. Further, EB welds were evaluated from the standpoint of high temperature structural design. The results obtained are summarized as follows. 1) Both creep rupture strengths of EB weld metal and EB welded joint are almost equal to that of base metal, but those of TIG welds are lower than base metal. As for the secondary creep rate, EB weld metal is higher and TIG weld metal is lower than base metal. As for the time to onset of tertiary creep, no remarkable difference among base metal, EB weld metal and TIG weld metal is observed. 2) In case of EB weld metal, although anisotropy is slightly observed, the ductility is same or more as compared with base metal. In case of TIG weld metal, on the contrary, anisotropy is not observed and the ductility is essentially low. 3) Such rupture morphology of EB weld metal as appears to have resulted from interconnection of voids which occurred at grain boundary is similar to base metal. In case of TIG weld metal, however, many cracks with sharp tips are observed at grain boundary, and the rupture appears to have occurred in brittle by propagation and connection of the cracks. 4) It can be said from the standpoint of high temperature structural design that EB welding is very suitable to welding for structure where creep effects are significant, because both of the creep ductility and the rupture strength are almost equal to those of base metal. (author)
Načrtovanje virtualne in realne robotske celice za varjenje z ATIG postopkom z robotom ACMA XR701
Pal, Matej
2016-01-01
Cilj tega magistrskega dela je preveriti razliko med navadnim TIG varjenjem in ATIG varjenjem z aktivnima praškoma oz. premazoma dveh različnih proizvajalcev, ter hkrati preveriti obstoječo virtualno in realno robotsko celico in ju po potrebi popraviti. Pri tem je bilo naprej potrebno dopolniti virtualno in realno robotsko celico. Varjenje smo izvedli z industrijskim robotom ACMA XR701 z navadnim TIG varjenjem in ATIG varjenjem z različnima aktivnima praškoma oz. premazoma (QuickTIG in BC-31)...
International Nuclear Information System (INIS)
Lai, G.Y.; Wolwowicz, R.J.
1979-12-01
Creep-rupture testing was conducted on 1 1/4 Cr-1 Mo steel, Alloy 800H and Hastelloy Alloy X in flowing helium containing nominal concentration of following gases: 1500 μatm H 2 , 450 μatm CO, 50 μatm CH 4 , 50 μatm H 2 O and 5 μatm CO 2 . This environment is believed to represent maximum permissible levels of impurities in the primary coolant for the steam-cycle system of a high-temperature gas-cooled reactor (HTGR) when it is operating continuously with a water and/or steam leak at technical specification limits. Two or three heats of material for each alloy were investigated. Tests were conducted at 482 0 C and 760 0 C (1200 0 F and 1400 0 F) for Alloy 800H, and at 760 0 C and 871 0 C (1400 0 F and 1600 0 F) for Hastelloy Alloy X for times up to 10,000 h. Selected tests were performed on same heat of material in both air and helium environments to make a direct comparison of creep-rupture behaviors between two environments. Metallurgical evaluation was performed on selected post test specimens with respect to gas-metal interactions which included oxidation, carburization and/or decarburization. Correlation between gaseous corrosion and creep-rupture behavior was attempted. Limited tests were also performed to investigate the specimen size effects on creep-rupture behavior in the helium environment
Valorization of the GAFCHROMIC XR-R film for radiation dose estimation in the skin
International Nuclear Information System (INIS)
Sanchez Garcia, M.; Otero Martinez, C.; Camino, X. M.; Sendon del Rio, J. R.; Luna Vega, V.; Lobato Busto, R.; Mosquera Sueiro, J.; Pombar Camean, M.
2006-01-01
The adequacy of the couple formed by the GAFCHROMIC XR-R film and the MICROTEK Scan Maker 8700 for skin dose determination has been evaluated. The main advantages are the ease of use the films, since it can be manipulated without special care and the ability to archive it in the dosimetric history of the patient. The main limiting factors coming from the scanner are the reproducibility over time and noise in the digitization; it is shown that this last component can be minimized at the cost of resolution. From the film itself, the limiting factors are the inter and intra film uniformity. Contributing an 6,5% to the overall uncertainty in dose determination. Overall, it has been shown that skin dose determination is possible with this film with an uncertainty below 10%. (Author)
Energy Technology Data Exchange (ETDEWEB)
Farah, J., E-mail: jad.farah@irsn.fr; Clairand, I.; Huet, C. [External Dosimetry Department, Institut de Radioprotection et de Sûreté Nucléaire (IRSN), BP-17, 92260 Fontenay-aux-Roses (France); Trianni, A. [Medical Physics Department, Udine University Hospital S. Maria della Misericordia (AOUD), p.le S. Maria della Misericordia, 15, 33100 Udine (Italy); Ciraj-Bjelac, O. [Vinca Institute of Nuclear Sciences (VINCA), P.O. Box 522, 11001 Belgrade (Serbia); De Angelis, C. [Department of Technology and Health, Istituto Superiore di Sanità (ISS), Viale Regina Elena 299, 00161 Rome (Italy); Delle Canne, S. [Fatebenefratelli San Giovanni Calibita Hospital (FBF), UOC Medical Physics - Isola Tiberina, 00186 Rome (Italy); Hadid, L.; Waryn, M. J. [Radiology Department, Hôpital Jean Verdier (HJV), Avenue du 14 Juillet, 93140 Bondy Cedex (France); Jarvinen, H.; Siiskonen, T. [Radiation and Nuclear Safety Authority (STUK), P.O. Box 14, 00881 Helsinki (Finland); Negri, A. [Veneto Institute of Oncology (IOV), Via Gattamelata 64, 35124 Padova (Italy); Novák, L. [National Radiation Protection Institute (NRPI), Bartoškova 28, 140 00 Prague 4 (Czech Republic); Pinto, M. [Istituto Nazionale di Metrologia delle Radiazioni Ionizzanti (ENEA-INMRI), C.R. Casaccia, Via Anguillarese 301, I-00123 Santa Maria di Galeria (RM) (Italy); Knežević, Ž. [Ruđer Bošković Institute (RBI), Bijenička c. 54, 10000 Zagreb (Croatia)
2015-07-15
Purpose: To investigate the optimal use of XR-RV3 GafChromic{sup ®} films to assess patient skin dose in interventional radiology while addressing the means to reduce uncertainties in dose assessment. Methods: XR-Type R GafChromic films have been shown to represent the most efficient and suitable solution to determine patient skin dose in interventional procedures. As film dosimetry can be associated with high uncertainty, this paper presents the EURADOS WG 12 initiative to carry out a comprehensive study of film characteristics with a multisite approach. The considered sources of uncertainties include scanner, film, and fitting-related errors. The work focused on studying film behavior with clinical high-dose-rate pulsed beams (previously unavailable in the literature) together with reference standard laboratory beams. Results: First, the performance analysis of six different scanner models has shown that scan uniformity perpendicular to the lamp motion axis and that long term stability are the main sources of scanner-related uncertainties. These could induce errors of up to 7% on the film readings unless regularly checked and corrected. Typically, scan uniformity correction matrices and reading normalization to the scanner-specific and daily background reading should be done. In addition, the analysis on multiple film batches has shown that XR-RV3 films have generally good uniformity within one batch (<1.5%), require 24 h to stabilize after the irradiation and their response is roughly independent of dose rate (<5%). However, XR-RV3 films showed large variations (up to 15%) with radiation quality both in standard laboratory and in clinical conditions. As such, and prior to conducting patient skin dose measurements, it is mandatory to choose the appropriate calibration beam quality depending on the characteristics of the x-ray systems that will be used clinically. In addition, yellow side film irradiations should be preferentially used since they showed a lower
Weldability of the superalloys Haynes 188 and Hastelloy X by Nd:YAG
Directory of Open Access Journals (Sweden)
Graneix Jérémie
2014-01-01
Full Text Available The requirements for welded aircraft parts have become increasingly severe, especially in terms of the reproducibility of the geometry and metallurgical grade of the weld bead. Laser welding is a viable method of assembly to meet these new demands, because of automation, to replace the manual TIG welding process. The purpose of this study is to determine the weldability of Hastelloy X and Haynes 188 alloys by the butt welding process with a Nd:YAG laser. To identify the influential parameters of the welding process (laser power, feed rate, focal diameter and flow of gas while streamlining testing, an experimental design was established with the CORICO software using the graphic correlation method. The position of the focal point was fixed at 1/3 of the thickness of the sheet. The gas flow rate and the power of the beam have a major effect on the mechanical properties and geometry of the weld. The strength of the weld is comparable to that of the base metal. However, there is a significant decrease in the elongation at break of approximately 30%. The first observations of the cross section of the weld by scanning electron microscopy coupled with EBSD analysis show a molten zone presenting dendritic large grains compared to the equiaxed grains of the base metals without a heat affected zone.
International Nuclear Information System (INIS)
McCabe, Bradley P.; Speidel, Michael A.; Pike, Tina L.; Van Lysel, Michael S.
2011-01-01
Purpose: In this study, newly formulated XR-RV3 GafChromic film was calibrated with National Institute of Standards and Technology (NIST) traceability for measurement of patient skin dose during fluoroscopically guided interventional procedures. Methods: The film was calibrated free-in-air to air kerma levels between 15 and 1100 cGy using four moderately filtered x-ray beam qualities (60, 80, 100, and 120 kVp). The calibration films were scanned with a commercial flatbed document scanner. Film reflective density-to-air kerma calibration curves were constructed for each beam quality, with both the orange and white sides facing the x-ray source. A method to correct for nonuniformity in scanner response (up to 25% depending on position) was developed to enable dose measurement with large films. The response of XR-RV3 film under patient backscattering conditions was examined using on-phantom film exposures and Monte Carlo simulations. Results: The response of XR-RV3 film to a given air kerma depended on kVp and film orientation. For a 200 cGy air kerma exposure with the orange side of the film facing the source, the film response increased by 20% from 60 to 120 kVp. At 500 cGy, the increase was 12%. When 500 cGy exposures were performed with the white side facing the x-ray source, the film response increased by 4.0% (60 kVp) to 9.9% (120 kVp) compared to the orange-facing orientation. On-phantom film measurements and Monte Carlo simulations show that using a NIST-traceable free-in-air calibration curve to determine air kerma in the presence of backscatter results in an error from 2% up to 8% depending on beam quality. The combined uncertainty in the air kerma measurement from the calibration curves and scanner nonuniformity correction was ±7.1% (95% C.I.). The film showed notable stability. Calibrations of film and scanner separated by 1 yr differed by 1.0%. Conclusions: XR-RV3 radiochromic film response to a given air kerma shows dependence on beam quality and film
Energy Technology Data Exchange (ETDEWEB)
Sotelo, J. C.; Gonzalez, M.; Porto, E.
2014-07-01
A study of the high vacuum brazing process of solid solution strengthened Hastelloy B2 nickel alloy has been done. A first stage of research has focused on the selection of the most appropriate brazing filler metal to the base material and vacuum furnace brazing process. The influence of welding parameters on joint microstructure constituents, relating the microstructure of the joint to its mechanical properties, has been evaluated. Two gaps of 50 and 200 micrometers, and two dwell times at brazing temperature of 10 and 90 minutes were studied. The braze joint mainly consists of the nickel rich matrix, nickel silicide and ternary compounds. Finally, the results of this study have shown the high bond strength for small gaps and increased dwell times of 90 minutes. (Author)
International Nuclear Information System (INIS)
Razak, N H; Rahman, M M; Kadirgama, K
2012-01-01
This paper presents to develop of the response surface design model to predict the surface roughness for end-milling operation of Hastelloy C-2000 using uncoated carbide insert. Mathematical model is developed to study the effect of three input cutting parameters includes the feed rate, axial depth of cut and cutting speed. Design of experiments (DOE) was implemented with the aid of the statistical software package. Analysis of variance (ANOVA) has been performed to verify the fit and adequacy of the developed mathematical model. The result shows that the feed rate gave the more effect on the both prediction values of Ra compared to the cutting speed and axial depth of cut. SEM and EDX analyses were performed in different cutting conditions. It can be concluded that the feed rate and cutting force give the higher impact to influence the machining characteristics of surface roughness. Thus, the optimizing the cutting conditions are essential in order to improve the surface roughness in machining of Hastlelloy C-2000.
International Nuclear Information System (INIS)
Tsuji, Hirokazu; Kondo, Tatsuo
1988-06-01
A series of strain controlled low-cycle fatigue tests at 900 deg C in the simulated HTGR helium environment were conducted on Hastelloy X and its modified version, Hastelloy XR in order to examine time-dependent high-temperature low-cycle fatigue behavior. In the tests with the symmetric triangular strain waveform, decreasing the strain rate led to notable reductions in the fatigue life. In the tests with the trapezoidal strain waveform with different holding types, the fatigue life was found to be reduced most effectively in tensile hold-time experiments. Based on the observations of the crack morphology the strain holding in the compressive side was suggested to play the role of suppressing the initiation and the growth of internal cracks or cavities, and to cause crack branching. When the frequency modified fatigue life method and/or the prediction of life by use of the ductility were applied, both the data obtained with the symmetric triangular strain waveform and those with the tensile hold-time experiments lay on the straight line plots. The data, however, obtained with the compressive and/or both hold-time experiments could not be handled satisfactorily by those methods. When the cumulative damage rule was applied, it was found that the reliability of HTGR components was ensured by limiting the creep-fatigue damage fraction within the value of 1. (author)
Energy Technology Data Exchange (ETDEWEB)
Sanchez Garcia, M.; Otero Martinez, C.; Camino, X. M.; Sendon del Rio, J. R.; Luna Vega, V.; Lobato Busto, R.; Mosquera Sueiro, J.; Pombar Camean, M.
2006-07-01
The adequacy of the couple formed by the GAFCHROMIC XR-R film and the MICROTEK Scan Maker 8700 for skin dose determination has been evaluated. The main advantages are the ease of use the films, since it can be manipulated without special care and the ability to archive it in the dosimetric history of the patient. The main limiting factors coming from the scanner are the reproducibility over time and noise in the digitization; it is shown that this last component can be minimized at the cost of resolution. From the film itself, the limiting factors are the inter and intra film uniformity. Contributing an 6,5% to the overall uncertainty in dose determination. Overall, it has been shown that skin dose determination is possible with this film with an uncertainty below 10%. (Author)
Qi, Qian; Liu, Yan; Wang, Lujie; Zhang, Hui; Huang, Jian; Huang, Zhengren
2017-09-01
TiC/hastelloy composites with suitable thermal expansion and excellent electrical conductivity are promising candidates for IT-SOFC interconnect. In this paper, the TiC/hastelloy composites are fabricated by in-situ reactive infiltration, and the oxidation resistance of composites is optimized by increasing graphite particle size. Results show that the increase of graphite particles size from 1 μm to 40 μm reduces TiC particle size from 2.68 μm to 2.22 μm by affecting the formation process of TiC. Moreover, the decrease of TiC particles size accelerates the fast formation of dense and continuous TiO2/Cr2O3 oxide layer, which bring down the mass gain (800 °C/100 h) from 2.03 mg cm-2 to 1.18 mg cm-2. Meanwhile, the coefficient of thermal expansion decreases from 11.15 × 10-6 °C-1 to 10.80 × 10-6 °C-1, and electrical conductivity maintains about 5800 S cm-1 at 800 °C. Therefore, the decrease of graphite particle size is one simple and effective route to optimize the oxidation resistance of composites, and meantime keeps suitable thermal expansion and good electrical conductivity.
Creep collapse of thick-walled heat transfer tube subjected to external pressure at high temperature
International Nuclear Information System (INIS)
Ioka, Ikuo; Kaji, Yoshiyuki; Terunuma, Isao; Nekoya, Shin-ichi; Miyamoto, Yoshiaki
1994-09-01
A series of creep collapse tests of thick-walled heat transfer tube were examined experimentally and analytically to confirm an analytical method for creep deformation behavior of a heat transfer tube of an intermediate heat exchanger (IHX) at a depressurization accident of secondary cooling system of HTTR (High Temperature Engineering Test Reactor). The tests were carried out using thick-walled heat transfer tubes made of Hastelloy XR at 950degC in helium gas environment. The predictions of creep collapse time obtained by a general purpose FEM-code ABAQUS were in good agreement with the experimental results. A lot of cracks were observed on the outer surface of the test tubes after the creep collapse. However, the cracks did not pass through the tube wall and, therefore, the leak tightness was maintained regardless of a collapse deformation for all tubes tested. (author)
Final results of the XR2-1 BWR metallic melt relocation experiment
International Nuclear Information System (INIS)
Gauntt, R.O.; Humphries, L.L.
1997-08-01
This report documents the final results of the XR2-1 boiling water reactor (BWR) metallic melt relocation experiment, conducted at Sandia National Laboratories for the U.S. Nuclear Regulatory Commission. The objective of this experiment was to investigate the material relocation processes and relocation pathways in a dry BWR core following a severe nuclear reactor accident such as an unrecovered station blackout accident. The imposed test conditions (initial thermal state and the melt generation rates) simulated the conditions for the postulated accident scenario and the prototypic design of the lower core test section (in composition and in geometry) ensured that thermal masses and physical flow barriers were modeled adequately. The experiment has shown that, under dry core conditions, the metallic core materials that melt and drain from the upper core regions can drain from the core region entirely without formation of robust coherent blockages in the lower core. Temporary blockages that suspended pools of molten metal later melted, allowing the metals to continue draining downward. The test facility and instrumentation are described in detail. The test progression and results are presented and compared to MERIS code analyses. 6 refs., 55 figs., 4 tabs
Auiler, J F; Liu, K; Lynch, J M; Gelotte, C K
2002-01-01
Stimulant therapy is the mainstay of treatment for children, adolescents and adults with attention-deficit/hyperactivity disorder (ADHD). Once-daily, extended-release oral formulations offer long acting control of symptoms by modifying drug delivery and absorption. In particular, consistency in early drug exposure is important for symptom control during school or work hours. Because these once-daily formulations are usually taken in the morning, the timing of the doses with breakfast is important. This study compared the effect of a high-fat breakfast on early drug exposure from a morning dose of two extended-release stimulant formulations: the osmotic-controlled OROS tablet of methylphenidate HCI (CONCERTA) and the capsule containing extended-release beads of mixed amphetamine salts (ADDERALL XR). The study had a single-dose, open-label, randomised, four-treatment, crossover design in which healthy subjects received either 36 mg CONCERTA or 20 mg ADDERALL XR in the morning after an overnight fast or a high-fat breakfast. Serial blood samples were collected over 28h to determine plasma concentrations of methylphenidate and amphetamine. The food effect on early drug exposure and the pharmacokinetic profiles up to 8 h after dosing of the two extended-release stimulants were directly compared using partial area (AUC(p4h), AUC(p6h) and AUC(p8h)) fed/fasted ratios. Amphetamine concentrations were markedly lower when the subjects had eaten breakfast, resulting in lower early drug exposures (p food, for patients with ADHD.
International Nuclear Information System (INIS)
Kodaira, Tsuneo; Suzuki, Michiaki; Uga, Takeo
1975-08-01
The preliminary structural design guidelines for the experimental multi-purpose very-high temperature gas-cooled reactor have recently been prepared. The components of the primary system operating at temperatures of creep dominant range are grouped in those of pressure and temperature boundaries respectively. In the material selection, 2 1/4Cr-1Mo steel is chosen for the former and Hastelloy-X for the latter taking into account of material properties at operating temperature. Deriving from the literature in the field, material design data of the alloys are established in design forms such as Sy, So, Sm, St, 100% of minimum stress to rupture, design fatigue curves, isochronous stress-strain curves, creep-fatigue interaction damage factor and so on, which are defined in ASME Code Section III, Code Case 1592. (auth.)
Effect of test temperature on tensile and fatigue properties of nickel-base heat-resistant alloys
International Nuclear Information System (INIS)
Tsuji, Hirokazu; Nakajima, Hajime
1987-01-01
A series of tensile and strain controlled low-cycle fatigue tests were conducted at temperatures ranging from RT to 900 0 C on a nickel-base heat-resistant alloy, Hastelloy XR-II, which is one of the candidate alloys for applications in the process heating high-temperature gas-cooled reactor (HTGR). Fatigue tests at room temperature and all tensile tests were conducted in air, while fatigue tests at and above 400 0 C were conducted in the simulated HTGR helium environment. In those tests the effect of test temperature on tensile and fatigue properties was investigated. The ductility minimum point was observed near 600 0 C, while tensile and fatigue strengths decreased with increasing test temperature. The fatigue lives estimated with the method proposed by Manson were compatible with the experimental results under the given conditions. For the specimens fatigued at and above 700 0 C, the percentage of the intergranular fracture mode gradually increased with increasing test temperature. (orig.)
International Nuclear Information System (INIS)
Bordier, C.; Klausz, R.; Desponds, L.
2015-01-01
To help avoiding secondary effects of interventional procedures like skin damage, a dose map method has been developed to provide an indication of the local dose on a surface representative of individual patient shapes. To minimise user interactions, patient envelope shapes are automatically determined depending on simple patient data information. Local doses are calculated in 1-cm 2 areas depending on the estimated air kerma, table and gantry positions and system settings, taking into account the table and mattress attenuations and estimated backscatter from the patient. These local doses are cumulated for each location of the patient envelope during the clinical procedure. To assess the accuracy of the method, Gafchromic XR-RV3 films have been used in several operating configurations. Good visual agreements on cumulated dose localisation were obtained within the 1-cm 2 precision of the map and the dose values agreed within 24.9 % accuracy. The resulting dose map method has been integrated into GE Healthcare X-Ray angiographic systems and should help in the management of the dose by the users during the procedure. (authors)
Prediction of inelastic behavior and creep-fatigue life of perforated plates
International Nuclear Information System (INIS)
Igari, Toshihide; Yamauchi, Masafumi; Nomura, Shinichi.
1992-01-01
Prediction methods of macroscopic and local stress-strain behaviors of perforated plates in plastic and creep regime are proposed in this paper, and are applied to the creep-fatigue life prediction of perforated plates. Both equivalent-solid-plate properties corresponding to the macroscopic behavior and the stress-strain concentration around a hole were obtained by assuming the analogy between plasticity and creep and also by extending the authors' proposal in creep condition. The perforated plates which were made of Hastelloy XR were subjected to the strain-controlled cyclic test at 950degC in air in order to experimentally obtain the macroscopic behavior such as the cyclic stress-strain curve and creep-fatigue life around a hole. The results obtained are summarized as follows. (1) The macroscopic behavior of perforated plates including cyclic stress-strain behavior and relaxation is predictable by using the proposed method in this paper. (2) The creep-fatigue life around a hole can be predicted by using the proposed method for stress-strain concentration around a hole. (author)
Finite energy shifts in SU(n) supersymmetric Yang-Mills theory on T3xR at weak coupling
International Nuclear Information System (INIS)
Ohlsson, Fredrik
2010-01-01
We consider a perturbative treatment, in the regime of weak gauge coupling, of supersymmetric Yang-Mills theory in a space-time of the form T 3 xR with SU(n)/Z n gauge group and a nontrivial gauge bundle. More specifically, we consider the theories obtained as power series expansions around a certain class of normalizable vacua of the classical theory, corresponding to isolated points in the moduli space of flat connections, and the perturbative corrections to the free energy eigenstates and eigenvalues in the weakly interacting theory. The perturbation theory construction of the interacting Hilbert space is complicated by the divergence of the norm of the interacting states. Consequently, the free and interacting Hilbert spaces furnish unitarily inequivalent representations of the algebra of creation and annihilation operators of the quantum theory. We discuss a consistent redefinition of the Hilbert space norm to obtain the interacting Hilbert space and the properties of the interacting representation. In particular, we consider the lowest nonvanishing corrections to the free energy spectrum and discuss the crucial importance of supersymmetry for these corrections to be finite.
International Nuclear Information System (INIS)
Khidhir, Basim A; Mohamed, Bashir
2011-01-01
Machining parameters has an important factor on tool wear and surface finish, for that the manufacturers need to obtain optimal operating parameters with a minimum set of experiments as well as minimizing the simulations in order to reduce machining set up costs. The cutting speed is one of the most important cutting parameter to evaluate, it clearly most influences on one hand, tool life, tool stability, and cutting process quality, and on the other hand controls production flow. Due to more demanding manufacturing systems, the requirements for reliable technological information have increased. For a reliable analysis in cutting, the cutting zone (tip insert-workpiece-chip system) as the mechanics of cutting in this area are very complicated, the chip is formed in the shear plane (entrance the shear zone) and is shape in the sliding plane. The temperature contributed in the primary shear, chamfer and sticking, sliding zones are expressed as a function of unknown shear angle on the rake face and temperature modified flow stress in each zone. The experiments were carried out on a CNC lathe and surface finish and tool tip wear are measured in process. Machining experiments are conducted. Reasonable agreement is observed under turning with high depth of cut. Results of this research help to guide the design of new cutting tool materials and the studies on evaluation of machining parameters to further advance the productivity of nickel based alloy Hastelloy - 276 machining.
Directory of Open Access Journals (Sweden)
Sotelo, José Carlos
2014-09-01
Full Text Available A study of the high vacuum brazing process of solid solution strengthened Hastelloy B2 nickel alloy has been done. A first stage of research has focused on the selection of the most appropriate brazing filler metal to the base material and vacuum furnace brazing process. The influence of welding parameters on joint microstructure constituents, relating the microstructure of the joint to its mechanical properties, has been evaluated. Two gaps of 50 and 200 micrometers, and two dwell times at brazing temperature of 10 and 90 minutes were studied. The braze joint mainly consists of the nickel rich matrix, nickel silicide and ternary compounds. Finally, the results of this study have shown the high bond strength for small gaps and increased dwell times of 90 minutes.Se realizó un estudio pormenorizado del proceso de soldeo fuerte en horno de alto vacío de la aleación base níquel Hastelloy B2 fortalecida por solución sólida. En una primera fase del trabajo se seleccionó el material de aporte acorde al material objeto de unión y a la fuente de calentamiento seleccionada. Posteriormente, se evaluó la influencia del gap (50 y 200 micrómetros y tiempo de permanencia a temperatura de soldeo (10 y 90 minutos sobre los microconstituyentes de la unión, relacionando la microestructura con las propiedades mecánicas de la junta. Los análisis metalográficos mostraron una unión constituida por una matriz rica en níquel, siliciuros de níquel y compuestos ternarios. Finalmente, los resultados de los ensayos mecánicos a esfuerzos cortantes mostraron una elevada resistencia para gaps de 50 micrómetros y tiempos de permanencia de 90 minutos.
Research and Development programs for HTGRs in JAERI
Energy Technology Data Exchange (ETDEWEB)
Nishiguchi, Isoharu; Saito, Sinzo [Department of HTTR Project, Japan Atomic Energy Research Institute (Japan)
1990-07-01
Since 1969, JAERI has conducted research and development (R and D) programs for High-Temperature Gas-Cooled Reactors (HTGR). And the High Temperature engineering Test Reactor (HTTR), which will be the first High Temperature Gas Cooled Reactor (HTGR) in Japan, is under licensing process now. In this paper, some of the results of R and D are outlined in the following fields which are closely connected with the HTTR design, that is: i) fuel; ii) nuclear design; iii) thermal-hydraulic design; iv) graphite structure and v) high temperature metal structure. In the field of fuel, extensive investigations have been performed to develop the fabrication technology of coated particle fuel (cpf). In parallel, data of coated fuel particle failure and fission product release in in- and ex-reactor experiments as well as mechanical properties data were obtained and irradiation tests have been done using the Oarai Gas Loop No.1 (OGL-1) to verify the integrity of mass-produced fuel. Concerning the nuclear design, critical experiments were conducted using the Very High-Temperature Reactor Critical Assembly (VHTRC). Also carried out were hydrodynamical and thermal experiments using the Helium Engineering Demonstration Loop (HENDEL). On the graphite structures which compose the reactor internals, design criteria have been developed based on ASME BandPV Code Section III Div.2, subsection CE and design data have been accumulated on a domestic graphite material. High temperature metal structure is also one of major subjects of R and D for HTGRs. Hastelloy XR, which is a modified version of Hastelloy X, was developed and various tests have been conducted which include creep tests, creep-fatigue tests, etc. to establish design criteria and allowables. Component tests of the Intermediate Heat Exchanger (IHX) have been also performed. (author)
Research and Development programs for HTGRs in JAERI
International Nuclear Information System (INIS)
Nishiguchi, Isoharu; Saito, Sinzo
1990-01-01
Since 1969, JAERI has conducted research and development (R and D) programs for High-Temperature Gas-Cooled Reactors (HTGR). And the High Temperature engineering Test Reactor (HTTR), which will be the first High Temperature Gas Cooled Reactor (HTGR) in Japan, is under licensing process now. In this paper, some of the results of R and D are outlined in the following fields which are closely connected with the HTTR design, that is: i) fuel; ii) nuclear design; iii) thermal-hydraulic design; iv) graphite structure and v) high temperature metal structure. In the field of fuel, extensive investigations have been performed to develop the fabrication technology of coated particle fuel (cpf). In parallel, data of coated fuel particle failure and fission product release in in- and ex-reactor experiments as well as mechanical properties data were obtained and irradiation tests have been done using the Oarai Gas Loop No.1 (OGL-1) to verify the integrity of mass-produced fuel. Concerning the nuclear design, critical experiments were conducted using the Very High-Temperature Reactor Critical Assembly (VHTRC). Also carried out were hydrodynamical and thermal experiments using the Helium Engineering Demonstration Loop (HENDEL). On the graphite structures which compose the reactor internals, design criteria have been developed based on ASME BandPV Code Section III Div.2, subsection CE and design data have been accumulated on a domestic graphite material. High temperature metal structure is also one of major subjects of R and D for HTGRs. Hastelloy XR, which is a modified version of Hastelloy X, was developed and various tests have been conducted which include creep tests, creep-fatigue tests, etc. to establish design criteria and allowables. Component tests of the Intermediate Heat Exchanger (IHX) have been also performed. (author)
Purwaningsih, S.; Lubis, L. E.; Pawiro, S. A.; Soejoko, D. S.
2016-03-01
This research was aimed to check the patterns of dose profile on adult and pediatric head scan. We compared measurement result on dose profile along the z- axis rotation at peripheries and center phantom with a variety of pitch, i.e. 0.75, 1, 1.5 for adult and pediatric head protocol, keeping the rest of the scan parameters constant. Measurements were performed on homogeneous, cylindrical PMMA phantom with diameters of 16 and 10 cm using XR-QA2 Gafchromic film and TLD as dosimeters. The measurement result indicated a decrease in the dose about 50% and 47% for adult and pediatric head scan with the increase of pitch. For 0.75 value of pitch adult head scan, dose range for each position were (2.4 - 5.0) cGy, (3.1 - 5.3) cGy, (2.2 - 4.5) cGy, (2.8 - 5.3) cGy, and (3.3 - 5.6) cGy for position of center, 3, 6, 9 and 12 o'clock peripheral phantom position respectively. Dose profile for adult and pediatric head scan protocols has pattern curve with the maximum dose in the middle and tendency of symmetry near the edges, with different the plateau length along z- axis direction in accordance to the measurement position in the phantom.
International Nuclear Information System (INIS)
Kivak, Turgay; Mert, Senol
2017-01-01
In this study, the effects of machining parameters on surface roughness (Ra) and tool life (Tl) were investigated in the milling of Hastelloy C22 alloy with TiAlN-coated carbide inserts. A number of milling experiments were conducted using the L_2_7 (3"3) Taguchi orthogonal array on a CNC milling machine under different cutting conditions (dry, compressed air and wet). The cutting condition, cutting speed and feed rate were determined as the essential machining parameters. Analysis of variance (ANOVA) and signal-to-noise (S/N) ratio were employed to evaluate the effects of the machining parameters on Ra and Tl, and prediction models were created using quadratic regression analyses. The results revealed that the feed rate and cutting condition were the most influential factors on surface roughness and flank wear. The maximum tool life was achieved under wet cutting condition using a cutting speed of 30 x min"-"1 and a feed rate of 0.08 mm x rev"-"1, while the minimum surface roughness value was obtained under wet cutting condition using a cutting speed of 50 m x min"-"1 and the same feed rate. Using the optimum cutting parameters for Tl (30 m x min"-"1, 0.08 mm x rev"-"1), increases of 234 % and 67 % in tool life were observed under wet and compressed air cutting conditions, respectively, compared to the dry cutting condition.
Energy Technology Data Exchange (ETDEWEB)
Kivak, Turgay; Mert, Senol [Duezce Univ. (Turkey). Dept. of Manufacturing Engineering
2017-02-01
In this study, the effects of machining parameters on surface roughness (Ra) and tool life (Tl) were investigated in the milling of Hastelloy C22 alloy with TiAlN-coated carbide inserts. A number of milling experiments were conducted using the L{sub 27} (3{sup 3}) Taguchi orthogonal array on a CNC milling machine under different cutting conditions (dry, compressed air and wet). The cutting condition, cutting speed and feed rate were determined as the essential machining parameters. Analysis of variance (ANOVA) and signal-to-noise (S/N) ratio were employed to evaluate the effects of the machining parameters on Ra and Tl, and prediction models were created using quadratic regression analyses. The results revealed that the feed rate and cutting condition were the most influential factors on surface roughness and flank wear. The maximum tool life was achieved under wet cutting condition using a cutting speed of 30 x min{sup -1} and a feed rate of 0.08 mm x rev{sup -1}, while the minimum surface roughness value was obtained under wet cutting condition using a cutting speed of 50 m x min{sup -1} and the same feed rate. Using the optimum cutting parameters for Tl (30 m x min{sup -1}, 0.08 mm x rev{sup -1}), increases of 234 % and 67 % in tool life were observed under wet and compressed air cutting conditions, respectively, compared to the dry cutting condition.
Energy Technology Data Exchange (ETDEWEB)
Takeda, Takeshi; Tachibana, Yukio; Nakagawa, Shigeaki [Japan Atomic Energy Research Inst., Oarai, Ibaraki (Japan). Oarai Research Establishment
2002-12-01
A helium/helium intermediate heat exchanger (IHX) in the high temperature engineering test reactor (HTTR) is an essential component for demonstration of future nuclear process heat utilization of high temperature gas-cooled reactor (HTGR). The IHX with a heat capacity of 10 MW has 96 helically-coiled heat transfer tubes. Structural design for the IHX had been conducted through elastic-creep analysis of superalloy Hastelloy XR components such as heat transfer tubes and center pipe. In the HTTR rise-to-power test, it was clarified that temperature of the coolant in the IHX at the reactor scrams changes more rapidly than expected in the design. Effects of the IHX coolant temperature change, at anticipated reactor scram from the full power of 30 MW at high temperature test operation, on structural integrity of the heat transfer tubes and the lower reducer of the center pipe were investigated analytically based on the coolant temperature data obtained from the rise-to-power test. As results of the assessment, it was confirmed that cumulative principal creep strain, cumulative creep and fatigue damage factor of the IHX components during 10{sup 5} h of the HTTR lifetime should be below the allowable limits, which are established in the high-temperature structural design code for the HTGR Class 1 components. (author)
Evaluation of creep-fatigue/ environment interaction in Ni-base wrought alloys for HTGR application
International Nuclear Information System (INIS)
Hattori, Hiroshi; Kitagawa, Masaki; Ohtomo, Akira
1986-01-01
High Temperature Gas-cooled Reactor (HTGR) systems should be designed based on the high temperature structural strength design procedures. On the development of design code, the determination of failure criteria under cyclic loading and severe environments is one of the most important items. By using the previous experimental data for Ni-base wrought alloys, Inconel 617 and Hastelloy XR, several evaluation methods for creep-fatigue interaction were examined for their capability to predict their cyclic loading behavior for HTGR application. At first, the strainrange partitioning method, the frequency modified damage function and the linear damage summation rule were discussed. However, these methods were not satisfactory with the above experimental results. Thus, in this paper, a new fracture criterion, which is a modification of the linear damage summation rule, is proposed based on the experimental data. In this criterion, fracture is considered to occur when the sum of the fatigue damage, which is the function of the applied cyclic strain magnitude, and the modified creep damage, which is the function of the applied cyclic stress magnitude (determined as time devided by cyclic creep rupture time reflecting difference of creep damages by tensile creep and compressive creep), reaches a constant value. This criterion was successfully applied to the life prediction of materials at HTGR temperatures. (author)
JAERI Material Performance Database (JMPD); outline of the system
International Nuclear Information System (INIS)
Yokoyama, Norio; Tsukada, Takashi; Nakajima, Hajime.
1991-01-01
JAERI Material Performance Database (JMPD) has been developed since 1986 in JAERI with a view to utilizing the various kinds of characteristic data of nuclear materials efficiently. Management system of relational database, PLANNER was employed and supporting systems for data retrieval and output were expanded. JMPD is currently serving the following data; (1) Data yielded from the research activities of JAERI including fatigue crack growth data of LWR pressure vessel materials as well as creep and fatigue data of the alloy developed for the High Temperature Gas-cooled Reactor (HTGR), Hastelloy XR. (2) Data of environmentally assisted cracking of LWR materials arranged by Electric power Research Institute (EPRI) including fatigue crack growth data (3000 tests), stress corrosion data (500 tests) and Slow Strain Rate Technique (SSRT) data (1000 tests). In order to improve user-friendliness of retrieval system, the menu selection type procedures have been developed where knowledge of system and data structures are not required for end-users. In addition a retrieval via database commands, Structured Query Language (SQL), is supported by the relational database management system. In JMPD the retrieved data can be processed readily through supporting systems for graphical and statistical analyses. The present report outlines JMPD and describes procedures for data retrieval and analyses by utilizing JMPD. (author)
Dose and energy dependence of response of Gafchromic XR-QA film for kilovoltage x-ray beams.
Rampado, O; Garelli, E; Deagostini, S; Ropolo, R
2006-06-07
There is a growing interest in Gafchromic films for patient dosimetry in radiotherapy and in radiology. A new model (XR-QA) with high sensitivity to low dose was tested in this study. The response of the film to different x-ray beam energies (range 28-145 kVp with various filtrations, dose range 0-100 mGy) and to visible light was investigated, together with the after exposure darkening properties. Exposed films were digitized with a commercially available, optical flatbed scanner. A single functional form for dose versus net pixel value variation has been determined for all the obtained calibration curves, with a unique fit parameter different for each of the used x-ray beams. The film response was dependent on beam energy, with higher colour variations for the beams in the range 80-140 kVp. Different sources of uncertainties in dose measurements, governed by the digitalization process, the film response uniformity and the calibration curve fit procedure, have been considered. The overall one-sigma dose measurement uncertainty depended on the beam energy and decreased with increasing absorbed dose. For doses above 10 mGy and beam energies in the range 80-140 kVp the total uncertainty was less than 5%, whereas for the 28 kVp beam the total uncertainty at 10 mGy was about 10%. The post-exposure colour variation was not negligible in the first 24 h after the exposure, with a consequent increase in the calculated dose of about 10%. Results of the analysis of the sensitivity to visible light indicated that a short exposure of this film to ambient and scanner light during the measurements will not have a significant impact on the radiation dosimetry.
International Nuclear Information System (INIS)
Hwang, Yi-Shuan; Lin, Yu-Ying; Cheung, Yun-Chung; Tsai, Hui-Yu
2014-01-01
This study was aimed to establish three-dimensional dose distributions for contrast-enhanced digital mammography (CEDM) using self-developed Gafchromic XR-QA2 films. Dose calibration and distribution evaluations were performed on a full-field digital mammography unit with dual energy (DE) contrast-enhanced option. Strategy for dose calibration of films in the DE mode was based on the data obtained from common target/filter/kVp combinations used clinically and the dose response model modified from Rampado's model. Dose derived from films were also verified by measured data from an ionization chamber. The average difference of dose was 8.9% in the dose range for clinical uses. Three-dimensional dose distributions were estimated using triangular acrylic phantom equipped with the mammography system. Five pieces of film sheets were separately placed between the acrylic slabs to evaluate the dose distribution at different depths. After normalizing the dose in each pixel to the maximum dose at the top-center position of the acrylic, normalized dose distribution for transverse, coronal and sagittal planes, could thus be obtained. The depth dose distribution evaluated in this study may further serve as a reference for evaluating the patient glandular dose at different depths based on the entrance exposure information. - Highlights: • CEDM techniques can enhance contrast uptake areas and suppress background tissue. • Dose for the dual-energy acquisition is about 20% higher than standard mode. • A new method is proposed to estimate the 3D dose distribution in dual-energy CEDM. • Depth of normalized dose ratio of 0.5 is less than but near 1 cm in the DE mode
Taengchaiyaphum, Suparat; Nakayama, Hideki; Srisala, Jiraporn; Khiev, Ratny; Aldama-Cano, Diva January; Thitamadee, Siripong; Sritunyalucksana, Kallaya
2017-11-01
To improve the efficacy of WSSV protection, multimeric (tetrameric) recombinant VP28 (4XrVP28) was produced and tested in comparison with those of monomeric VP28 (1XrVP28). In vitro binding of either 1XrVP28 or 4XrVP28 to shrimp hemocyte surface was evident as early as 10 min after protein inoculation. Similar results were obtained in vivo when shrimp were injected with recombinant proteins that the proteins bound to the hemocyte surface could be detected since 5 min after injection. Comparison of the WSSV protection efficiencies of 1XrVP28 or 4XrVP28 were performed by injection the purified 1XrVP28 or 4XrVP28 (22.5 μg/shrimp) and WSSV inoculum (1000 copies/shrimp) into shrimp. At 10 dpi, while shrimp injected with WSSV inoculum reached 100% mortality, shrimp injected with 1XrVP28 + WSSV or 4XrVP28 + WSSV showed relative percent survival (RPS) of 67% and 81%, respectively. PCR quantification revealed high number of WSSV in the moribund shrimp of WSSV- and 1XrVP28+WSSV-injected group. In contrast, lower number of WSSV copies were found in the survivors both from 1XrVP28+WSSV- or 4XrVP28+WSSV- injected groups. Histopathological analysis demonstrated the WSSV infected lesions found in the moribund from WSSV-infected group and 1XrVP28+WSSV-injected group, but less or none in the survivors. ELISA demonstrated that 4XrVP28 exhibited higher affinity binding to rPmRab7, a WSSV binding protein essential for WSSV entry to the cell than 1XrVP28. Taken together, the protection against WSSV in shrimp could be improved by application of multimeric rVP28. Copyright © 2017 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Rampado, O; Garelli, E; Deagostini, S; Ropolo, R [Struttura Complessa fisica Sanitaria, Azienda Ospedaliera San Giovanni Battista, Corso Bramante 88, 10126 Turin (Italy)
2006-06-07
There is a growing interest in Gafchromic (registered) films for patient dosimetry in radiotherapy and in radiology. A new model (XR-QA) with high sensitivity to low dose was tested in this study. The response of the film to different x-ray beam energies (range 28-145 kVp with various filtrations, dose range 0-100 mGy) and to visible light was investigated, together with the after exposure darkening properties. Exposed films were digitized with a commercially available, optical flatbed scanner. A single functional form for dose versus net pixel value variation has been determined for all the obtained calibration curves, with a unique fit parameter different for each of the used x-ray beams. The film response was dependent on beam energy, with higher colour variations for the beams in the range 80-140 kVp. Different sources of uncertainties in dose measurements, governed by the digitalization process, the film response uniformity and the calibration curve fit procedure, have been considered. The overall one-sigma dose measurement uncertainty depended on the beam energy and decreased with increasing absorbed dose. For doses above 10 mGy and beam energies in the range 80-140 kVp the total uncertainty was less than 5%, whereas for the 28 kVp beam the total uncertainty at 10 mGy was about 10%. The post-exposure colour variation was not negligible in the first 24 h after the exposure, with a consequent increase in the calculated dose of about 10%. Results of the analysis of the sensitivity to visible light indicated that a short exposure of this film to ambient and scanner light during the measurements will not have a significant impact on the radiation dosimetry.
Analytical evaluation of the environment effect on creep rupture strength
International Nuclear Information System (INIS)
Tamura, Manabu; Ogawa, Yutaka; Kurata, Yuji; Kondo, Tatsuo
1982-04-01
An analytical approach was made in evaluating semi-quantitatively the effect of environment on rupture strength of materials. In the analysis the zone formed in the material by reaction with the environment was assumed to bear the applied load as one of the strength members. In calculations a law of mixtures of creep strength and the linear damage rule were applied. In the modeling of the load bearing by the composite structure of the environment-affected and intact zones, both parallel and series models were considered to formulate the equations. The equation for the parallel-loaded model was properly adopted in explaining semi-quantitatively the case of Incoloy alloy 800 crept in air, which was strengthened with the layer formed by nitrization. The equation for the serially loaded model was more successfully adopted to the evaluation of the rupture strength of dissimilar weld joints. The latter was also considered to be potentially adoptable to the problems of the effect of specimen size and shape on rupture strength, which had been often taken into account in evaluating the environment effect. For application of the developed method, examination was made to the possible decrease in rupture strength of Hastelloy alloy XR in long term tests by the formation of Cr depleted zone due to oxidation in HTGR impure helium, and the results were compared with the values obtained by experiments. (author)
Update on extended release quetiapine fumarate in schizophrenia and bipolar disorders
Directory of Open Access Journals (Sweden)
El-Khalili N
2012-11-01
Full Text Available Nizar El-KhaliliAlpine Clinic, Lafayette, IN, USAAbstract: The atypical antipsychotic quetiapine fumarate is available both as an immediate release (IR and as an extended release (XR formulation allowing flexibility of dosing for individual patients. Approved uses of quetiapine XR include the treatment of schizophrenia (including maintenance therapy for prevention of relapse, the treatment of bipolar disorder (manic and depressive episodes, and the prevention of recurrence in patients with bipolar disorder who respond to quetiapine XR. This narrative review provides an update on quetiapine XR in these indications. The pharmacological profile of quetiapine, including a moderate affinity for dopamine D2 receptors and higher affinity for serotonin 5-hydroxytryptophan (5-HT2A receptors, may explain its broad efficacy and low propensity for extrapyramidal symptoms (EPS. The XR formulation has similar bioavailability but prolonged plasma levels compared with the IR formulation, allowing for less frequent (once-daily dosing. Clinical studies have confirmed the efficacy of quetiapine XR in relieving the acute symptoms of schizophrenia during short-term trials, and reducing the risk for relapse in long-term studies. Direct switching from the IR formulation to the same dose of the XR formulation did not reveal any loss of efficacy or tolerability issues, and switching patients to quetiapine XR from conventional or other atypical antipsychotics (for reasons of insufficient efficacy or tolerability also proved to be beneficial and generally well tolerated. In bipolar disorder, quetiapine XR has also proven effective in relieving acute depressive and manic symptoms. Adverse events with quetiapine XR in patients with either schizophrenia or bipolar disorder are similar to those associated with the IR formulation, the most common being sedation, dry mouth, somnolence, dizziness, and headache. The low propensity for EPS is maintained with the XR formulation
Ontiveros, Cordelia
1988-01-01
Various vacuum jacketed cryogenic supply lines at the Shuttle launch site use convoluted flexible expansion joints. The atmosphere at the launch site has a very high salt content, and during a launch, fuel combustion products include hydrochloric acid. This extremely corrosive environment has caused pitting corrosion failure in the flex hoses, which were made of 304L stainless steel. A search was done to find a more corrosion resistant replacement material. This study focused on 19 metal alloys. Tests which were performed include electrochemical corrosion testing, accelerated corrosion testing in a salt fog chamber, long term exposure at the beach corrosion testing site, and pitting corrosion tests in ferric chloride solution. Based on the results of these tests, the most corrosion resistant alloys were found to be (in order) Hastelloy C-22, Inconel 625, Hastelloy C-276, Hastelloy C-4, and Inco Alloy G-3. Of these top five alloys, the Hastelloy C-22 stands out as being the best of those tested for this application.
Saccharomyces strains engineered to ferment xylose using Scheffersomyces stipitis xylose reductase (XR) and xylitol dehydrogenase (XDH) genes appear to be limited by metabolic imbalances due to differing cofactor specificities of XR and XDH. The S. stipitis XR, which uses nicotinamide adenine dinucl...
Energy Technology Data Exchange (ETDEWEB)
Christersson, Albert; Larsson, Sune [Uppsala University, Department of Orthopaedics, Uppsala (Sweden); Nysjoe, Johan; Malmberg, Filip; Sintorn, Ida-Maria; Nystroem, Ingela [Uppsala University, Centre for Image Analysis, Uppsala (Sweden); Berglund, Lars [Uppsala University, Uppsala Clinical Research Centre, UCR Statistics, Uppsala (Sweden)
2016-06-15
The aim of the present study was to compare the reliability and agreement between a computer tomography-based method (CT) and digitalised 2D radiographs (XR) when measuring change in dorsal angulation over time in distal radius fractures. Radiographs from 33 distal radius fractures treated with external fixation were retrospectively analysed. All fractures had been examined using both XR and CT at six times over 6 months postoperatively. The changes in dorsal angulation between the first reference images and the following examinations in every patient were calculated from 133 follow-up measurements by two assessors and repeated at two different time points. The measurements were analysed using Bland-Altman plots, comparing intra- and inter-observer agreement within and between XR and CT. The mean differences in intra- and inter-observer measurements for XR, CT, and between XR and CT were close to zero, implying equal validity. The average intra- and inter-observer limits of agreement for XR, CT, and between XR and CT were ± 4.4 , ± 1.9 and ± 6.8 respectively. For scientific purpose, the reliability of XR seems unacceptably low when measuring changes in dorsal angulation in distal radius fractures, whereas the reliability for the semi-automatic CT-based method was higher and is therefore preferable when a more precise method is requested. (orig.)
International Nuclear Information System (INIS)
Sainfort, G.; Cappelaere, M.; Gregoire, J.; Sannier, J.
1984-01-01
In the French R and D program for high-temperature gas-cooled reactors (HTGRs), three metallic alloys were studied: steel Chromesco-3 with 2.25% chromium, alloy 800H, and Hastelloy-X. The Chromesco-3 and alloy 800H creep behavior is the same in air and in HTGR atmosphere (helium). The tensile tests of Hastelloy-X specimens reveal that aging has embrittlement and hardening effects up to 700 0 C, but the creep tests at 800 0 C show opposite effects. This particular behavior could be due to induced precipitation by aging and the depletion of hardening elements from the matrix. Tests show a low influence of cobalt content on mechanical properties of Hastelloy-X
A adição de xisto retortado aumenta a retenção do carbono de resíduos vegetais no solo
Directory of Open Access Journals (Sweden)
Ricardo Elso Leão
2014-10-01
Full Text Available O objetivo deste trabalho foi avaliar o efeito de curto prazo e o residual de doses de xisto retortado (XR sobre a retenção do C de resíduos culturais no solo. Foram avaliadas a mineralização e a retenção de C de folhas e talos de soja enriquecidos com 13C, em solo com e sem histórico de aplicação de XR e na presença e na ausência de doses crescentes de XR. Houve efeito de curto prazo do XR sobre a retenção de C no solo. Esse efeito ocorreu somente com a mistura de folhas + 3 Mg ha-1 de XR, em que a retenção de C no solo superou em 21% aquela observada com a aplicação isolada das folhas. O XR apresenta potencial de reter C no solo.
DeFulio, Anthony; Everly, Jeffrey J; Leoutsakos, Jeannie-Marie S; Umbricht, Annie; Fingerhood, Michael; Bigelow, George E; Silverman, Kenneth
2012-01-01
Naltrexone provides excellent opioid blockade, but its clinical utility is limited because opioid-dependent patients typically refuse it. An injectable suspension of naltrexone for extended release (XR-NTX) was recently approved by the FDA for treatment of opioid dependence. XR-NTX treatment may require concurrent behavioral intervention to maximize adherence and effectiveness, thus we sought to evaluate employment-based reinforcement as a method of improving adherence to XR-NTX in opiate dependent adults. Opioid-dependent adults (n=38) were detoxified and inducted onto oral naltrexone, then randomly assigned to contingency or prescription conditions. Participants received up to six doses of XR-NTX at four-week intervals. All participants could earn vouchers for attendance and performance at a therapeutic workplace. Contingency participants were required to accept XR-NTX injections to access the workplace and earn vouchers. Prescription participants could earn vouchers independent of their acceptance of XR-NTX injections. Contingency participants accepted significantly more naltrexone injections than prescription participants (87% versus 52%, p=.002), and were more likely to accept all injections (74% versus 26%, p=.004). Participants in the two conditions provided similar percentages of samples negative for opiates (72% versus 65%) and for cocaine (58% versus 54%). Opiate positivity was significantly more likely when samples were also cocaine positive, independent of naltrexone blockade (p=.002). Long-term adherence to XR-NTX in unemployed opiate dependent adults is low under usual care conditions. Employment-based reinforcement can maintain adherence to XR-NTX. Ongoing cocaine use appears to interfere with the clinical effectiveness of XR-NTX on opiate use. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.
Cation Binding to Xanthorhodopsin: Electron Paramagnetic Resonance and Magnetic Studies.
Smolensky Koganov, Elena; Leitus, Gregory; Rozin, Rinat; Weiner, Lev; Friedman, Noga; Sheves, Mordechai
2017-05-04
Xanthorhodopsin (xR) is a member of the retinal protein family and acts as a proton pump in the cell membranes of the extremely halophilic eubacterium Salinibacter ruber. In addition to the retinal chromophore, xR contains a carotenoid, which acts as a light-harvesting antenna as it transfers 40% of the quanta it absorbs to the retinal. Our previous studies have shown that the CD and absorption spectra of xR are dramatically affected due to the protonation of two different residues. It is still unclear whether xR can bind cations. Electron paramagnetic resonance (EPR) spectroscopy used in the present study revealed that xR can bind divalent cations, such as Mn 2+ and Ca 2+ , to deionized xR (DI-xR). We also demonstrate that xR can bind 1 equiv of Mn 2+ to a high-affinity binding site followed by binding of ∼40 equiv in cooperative manner and ∼100 equiv of Mn 2+ that are weakly bound. SQUID magnetic studies suggest that the high cooperative binding of Mn 2+ cations to xR is due to the formation of Mn 2+ clusters. Our data demonstrate that Ca 2+ cations bind to DI-xR with a lower affinity than Mn 2+ , supporting the assumption that binding of Mn 2+ occurs through cluster formation, because Ca 2+ cations cannot form clusters in contrast to Mn 2+ .
Preliminary lifetime predictions for 304 stainless steel as the LANL ABC blanket material
International Nuclear Information System (INIS)
Park, J.J.; Buksa, J.J.; Houts, M.G.; Arthur, E.D.
1997-11-01
The prediction of materials lifetime in the preconceptual Los Alamos National Laboratory (LANL) Accelerator-Based Conversion of Plutonium (ABC) is of utmost interest. Because Hastelloy N showed good corrosion resistance to the Oak Ridge National Laboratory Molten Salt Reactor Experiment fuel salt that is similar to the LANL ABC fuel salt, Hastelloy N was originally proposed for the LANL ABC blanket material. In this paper, the possibility of using 304 stainless steel as a replacement for the Hastelloy N is investigated in terms of corrosion issues and fluence-limit considerations. An attempt is made, based on the previous Fast Flux Test Facility design data, to predict the preliminary lifetime estimate of the 304 stainless steel used in the blanket region of the LANL ABC
Creep properties of superalloys for the HTGR in impure helium environments
International Nuclear Information System (INIS)
Kawakami, H.; Nakanishi, T.
1981-01-01
This paper describes creep behaviors of two heat resistant alloys, Hastelloy X and Incoloy 800, in helium environments of the HTGR. In impure helium environments, these alloys are susceptible to carburization and oxidization. We have investigated these effects separately, and related them to the creep behaviors of the alloys. Experiments were carried out at 900 0 C both in helium and in air. Carburization results in decrease of secondary creep strain rate and delay of tertiary creep initiation. Oxidization caused decrease in tertiary creep strain rate of Hastelloy X, but did not that of Incoloy 800. Enhancement in tertiary creep strain rate of Hastelloy X in a very weakly oxidizing environment was confirmed in creep crack growth experiment using notched plate specimens. The rupture time of Hastelloy X in helium was short when compared with in air. Stress versus rupture time curves for both environments were parallel up to 5000 hours test, and a ratio of rupture stress in helium to that in air was about 0.9. In case of Incoloy 800, rupture time in helium was markedly prolonged as compared with that in air. (orig.)
Design and qualification testing of a strontium-90 fluoride heat source
International Nuclear Information System (INIS)
Fullam, H.T.
1981-12-01
The Strontium Heat Source Development Program began at the Pacific Northwest Laboratory (PNL) in 1972 and is scheduled to be completed by the end of FY-1981. The program is currently funded by the US Department of Energy (DOE) By-Product Utilization Program. The primary objective of the program has been to develop the data and technology required to permit the licensing of power systems for terrestrial applications that utilize 90 SrF 2 -fueled radioisotope heat sources. A secondary objective of the program has been to design and qualification-test a general purpose 90 SrF 2 -fueled heat source. The effort expended in the design and testing of the heat source is described. Detailed information is included on: heat source design, licensing requirements, and qualification test requirements; the qualification test procedures; and the fabrication and testing of capsules of various materials. The results obtained in the qualification tests show that the outer capsule design proposed for the 90 SrF 2 heat source is capable of meeting current licensing requirements when Hastelloy S is used as the outer capsule material. The data also indicate that an outer capsule of Hastelloy C-4 would probably also meet licensing requirements, although Hastelloy S is the preferred material. Therefore, based on the results of this study, the general purpose 90 SrF 2 heat source will consist of a standard WESF Hastelloy C-276 inner capsule filled with 90 SrF 2 and a Hastelloy S outer capsule having a 2.375-in. inner diameter and 0.500-in. wall thickness. The end closures for this study, the general purpose 90 SrF 2 heat a Hastelloy S outer capsule having a 2.375-in. inner diameter and 0.500-in. wall thickness. The end closures for the outer capsule will utilize an interlocking joint design requiring a 0.1-in. penetration closure weld
Creep rupture behavior of candidate materials for nuclear process heat applications
International Nuclear Information System (INIS)
Schubert, F.; te Heesen, E.; Bruch, U.; Cook, R.; Diehl, H.; Ennis, P.J.; Jakobeit, W.; Penkalla, H.J.; Ullrich, G.
1984-01-01
Creep and stress rupture properties are determined for the candidate materials to be used in hightemperature gas-cooled reactor (HTGR) components. The materials and test methods are briefly described based on experimental results of test durations of about20000 h. The medium creep strengths of the alloys Inconel-617, Hastelloy-X, Nimonic-86, Hastelloy-S, Manaurite-36X, IN-519, and Incoloy-800H are compared showing that Inconel-617 has the best creep rupture properties in the temperature range above 800 0 C. The rupture time of welded joints is in the lower range of the scatterband of the parent metal. The properties determined in different simulated HTGR atmospheres are within the scatterband of the properties obtained in air. Extrapolation methods are discussed and a modified minimum commitment method is favored
Clinical utility of guanfacine extended release in the treatment of ADHD in children and adolescents
Directory of Open Access Journals (Sweden)
Bello NT
2015-06-01
Full Text Available Nicholas T Bello Department of Animal Sciences, Rutgers, The State University of New Jersey, New Brunswick, NJ, USA Abstract: Attention deficit hyperactivity disorder (ADHD is the most common psychiatric illness in children and adolescents. Several stimulant medications, such as methylphenidate and amphetamine derivatives, are available to treat ADHD in pediatric patients. Nonstimulant medications are more preferred by some parents, other caregivers, and patients because they lack the abuse potential of stimulant medications. In the US, one available nonstimulant option is guanfacine extended release (XR. As a selective α2A adrenergic receptor, guanfacine acts on the central noradrenergic pathways and cortical noradrenergic targets to improve working memory and attention. The XR formulation of guanfacine, compared with the immediate-release formulation, is more effective for the long-term management of ADHD and is associated with fewer adverse effects. Available data also indicate that guanfacine XR is superior to atomoxetine and is as effective as the nonselective α2 adrenergic receptor agonist, clonidine XR. The most common adverse effects associated with guanfacine XR are somnolence, fatigue, bradycardia, and hypotension. Somnolence is the most often cited reason for discontinuation. Guanfacine XR is also labeled for use as an adjuvant to stimulant treatment for ADHD. A similar profile of adverse effects as reported with monotherapy is reported when guanfacine XR is “added on” to stimulant therapy with somnolence as the most commonly reported adverse event. This review discusses the clinical efficacy and patient preference of guanfacine XR based on available published data on the safety, relative effectiveness, and tolerance of this medication to treat ADHD. Keywords: Intuniv, norepinephrine, prefrontal cortex, locus coeruleus, impulsivity, inattentive
Yamamichi, Nobutake; Hirano, Chigaya; Takahashi, Yu; Minatsuki, Chihiro; Nakayama, Chiemi; Matsuda, Rie; Shimamoto, Takeshi; Takeuchi, Chihiro; Kodashima, Shinya; Ono, Satoshi; Tsuji, Yosuke; Fujishiro, Mitsuhiro; Wada, Ryoichi; Mitsushima, Toru; Koike, Kazuhiko
2016-04-01
Upper gastrointestinal endoscopy (UGI-ES) and double-contrast upper gastrointestinal barium X-ray radiography (UGI-XR) are two major image-based methods to diagnose atrophic gastritis, which is mostly induced by Helicobacter pylori infection. However, there have been few studies directly comparing them. Atrophic gastritis was evaluated using the data of 962 healthy subjects who underwent UGI-ES and UGI-XR within 1 year. Based on UGI-ES and UGI-XR, 602 subjects did not have atrophic gastritis and 254 subjects did have it. Considering UGI-ES-based atrophic gastritis as the standard, sensitivity and specificity of UGI-XR-based atrophic gastritis were 92.0 % (254/276) and 92.8 % (602/649), respectively. The seven-grade Kimura-Takemoto classification of UGI-ES-based atrophic gastritis showed a strong and significant association with the four-grade UGI-XR-based atrophic gastritis. Sensitivity and specificity of serum anti-Helicobacter pylori IgG to detect UGI-ES/UGI-XR-based atrophic gastritis were 89.4 % (227/254) and 99.8 % (601/602), indicating that atrophic gastritis can be overlooked according to serum anti-Helicobacter pylori IgG alone.
The management of schizophrenia: focus on extended-release quetiapine fumarate
Directory of Open Access Journals (Sweden)
Peuskens J
2011-09-01
Full Text Available Joseph Peuskens Universitair Psychiatrisch Centrum KU Leuven, Campus St Jozef Kortenberg, Kortenberg, Belgium Abstract: Effective management of schizophrenia remains a significant clinical challenge. While antipsychotic medications have proven efficacy in this disease, there remains an opportunity to further improve symptom control and long-term relapse prevention. Also, a number of factors, including tolerability and complex dosing regimens, can result in nonadherence to medication. Quetiapine is an atypical antipsychotic with proven efficacy and an established tolerability profile in schizophrenia. The once-daily extended-release formulation (quetiapine XR offers a simplified dosing regimen and titration schedule. Short-term clinical studies have shown that quetiapine XR (400–800 mg/d is efficacious in the acute treatment of schizophrenia, while a long-term study has shown that quetiapine XR was significantly more effective than placebo at preventing relapse. Furthermore, an investigation in which stable patients switched from the immediate-release formulation (quetiapine IR to quetiapine XR showed that quetiapine XR is generally well tolerated and has no loss of efficacy compared with quetiapine IR. In patients who experienced insufficient efficacy or poor tolerability on their previous antipsychotic, switching to quetiapine XR significantly improved efficacy compared with the previous treatment. In conclusion, quetiapine XR is an effective and generally well tolerated treatment for schizophrenia. Furthermore, once-daily dosing may improve patient adherence, which may impact positively on patient outcomes. Keywords: adherence, atypical antipsychotics, adverse events
Null structure groups in eleven dimensions
International Nuclear Information System (INIS)
Cariglia, Marco; Mac Conamhna, Oisin A. P.
2006-01-01
We classify all the structure groups which arise as subgroups of the isotropy group (Spin(7)xR 8 )xR, of a single null Killing spinor in 11 dimensions. We construct the spaces of spinors fixed by these groups. We determine the conditions under which structure subgroups of the maximal null structure group (Spin(7)xR 8 )xR may also be embedded in SU(5), and hence the conditions under which a supersymmetric spacetime admits only null, or both timelike and null, Killing spinors. We discuss how this purely algebraic material will facilitate the direct analysis of the Killing spinor equation of 11 dimensional supergravity, and the classification of supersymmetric spacetimes therein
Directory of Open Access Journals (Sweden)
Röder Anja
2008-06-01
Full Text Available Abstract Background Pichia stipitis xylose reductase (Ps-XR has been used to design Saccharomyces cerevisiae strains that are able to ferment xylose. One example is the industrial S. cerevisiae xylose-consuming strain TMB3400, which was constructed by expression of P. stipitis xylose reductase and xylitol dehydrogenase and overexpression of endogenous xylulose kinase in the industrial S. cerevisiae strain USM21. Results In this study, we demonstrate that strain TMB3400 not only converts xylose, but also displays higher tolerance to lignocellulosic hydrolysate during anaerobic batch fermentation as well as 3 times higher in vitro HMF and furfural reduction activity than the control strain USM21. Using laboratory strains producing various levels of Ps-XR, we confirm that Ps-XR is able to reduce HMF both in vitro and in vivo. Ps-XR overexpression increases the in vivo HMF conversion rate by approximately 20%, thereby improving yeast tolerance towards HMF. Further purification of Ps-XR shows that HMF is a substrate inhibitor of the enzyme. Conclusion We demonstrate for the first time that xylose reductase is also able to reduce the furaldehyde compounds that are present in undetoxified lignocellulosic hydrolysates. Possible implications of this newly characterized activity of Ps-XR on lignocellulosic hydrolysate fermentation are discussed.
Lee, Sung-Haeng; Kodaki, Tsutomu; Park, Yong-Cheol; Seo, Jin-Ho
2012-04-30
Efficient conversion of xylose to ethanol is an essential factor for commercialization of lignocellulosic ethanol. To minimize production of xylitol, a major by-product in xylose metabolism and concomitantly improve ethanol production, Saccharomyces cerevisiae D452-2 was engineered to overexpress NADH-preferable xylose reductase mutant (XR(MUT)) and NAD⁺-dependent xylitol dehydrogenase (XDH) from Pichia stipitis and endogenous xylulokinase (XK). In vitro enzyme assay confirmed the functional expression of XR(MUT), XDH and XK in recombinant S. cerevisiae strains. The change of wild type XR to XR(MUT) along with XK overexpression led to reduction of xylitol accumulation in microaerobic culture. More modulation of the xylose metabolism including overexpression of XR(MUT) and transaldolase, and disruption of the chromosomal ALD6 gene encoding aldehyde dehydrogenase (SX6(MUT)) improved the performance of ethanol production from xylose remarkably. Finally, oxygen-limited fermentation of S. cerevisiae SX6(MUT) resulted in 0.64 g l⁻¹ h⁻¹ xylose consumption rate, 0.25 g l⁻¹ h⁻¹ ethanol productivity and 39% ethanol yield based on the xylose consumed, which were 1.8, 4.2 and 2.2 times higher than the corresponding values of recombinant S. cerevisiae expressing XR(MUT), XDH and XK only. Copyright © 2011 Elsevier B.V. All rights reserved.
The roles of Bcl-xL in modulating apoptosis during development of Xenopus laevis
Directory of Open Access Journals (Sweden)
Calderon-Segura Maria
2005-09-01
Full Text Available Abstract Background Apoptosis is a common and essential aspect of development. It is particularly prevalent in the central nervous system and during remodelling processes such as formation of the digits and in amphibian metamorphosis. Apoptosis, which is dependent upon a balance between pro- and anti-apoptotic factors, also enables the embryo to rid itself of cells damaged by gamma irradiation. In this study, the roles of the anti-apoptotic factor Bcl-xL in protecting cells from apoptosis were examined in Xenopus laevis embryos using transgenesis to overexpress the XR11 gene, which encodes Bcl-xL. The effects on developmental, thyroid hormone-induced and γ-radiation-induced apoptosis in embryos were examined in these transgenic animals. Results Apoptosis was abrogated in XR11 transgenic embryos. However, the transgene did not prevent the apoptotic response of tadpoles to thyroid hormone during metamorphosis. Post-metamorphic XR11 frogs were reared to sexual maturity, thus allowing us to produce second-generation embryos and enabling us to distinguish between the maternal and zygotic contributions of Bcl-xL to the γ-radiation apoptotic response. Wild-type embryos irradiated before the mid-blastula transition (MBT underwent normal cell division until reaching the MBT, after which they underwent massive, catastrophic apoptosis. Over-expression of Bcl-xL derived from XR11 females, but not males, provided partial protection from apoptosis. Maternal expression of XR11 was also sufficient to abrogate apoptosis triggered by post-MBT γ-radiation. Tolerance to post-MBT γ-radiation from zygotically-derived XR11 was acquired gradually after the MBT in spite of abundant XR11 protein synthesis. Conclusion Our data suggest that Bcl-xL is an effective counterbalance to proapoptotic factors during embryonic development but has no apparent effect on the thyroid hormone-induced apoptosis that occurs during metamorphosis. Furthermore, post-MBT apoptosis
Watanabe, Seiya; Abu Saleh, Ahmed; Pack, Seung Pil; Annaluru, Narayana; Kodaki, Tsutomu; Makino, Keisuke
2007-09-01
A recombinant Saccharomyces cerevisiae strain transformed with xylose reductase (XR) and xylitol dehydrogenase (XDH) genes from Pichia stipitis (PsXR and PsXDH, respectively) has the ability to convert xylose to ethanol together with the unfavourable excretion of xylitol, which may be due to intercellular redox imbalance caused by the different coenzyme specificity between NADPH-preferring XR and NAD(+)-dependent XDH. In this study, we focused on the effect(s) of mutated NADH-preferring PsXR in fermentation. The R276H and K270R/N272D mutants were improved 52- and 146-fold, respectively, in the ratio of NADH/NADPH in catalytic efficiency [(k(cat)/K(m) with NADH)/(k(cat)/K(m) with NADPH)] compared with the wild-type (WT), which was due to decrease of k(cat) with NADPH in the R276H mutant and increase of K(m) with NADPH in the K270R/N272D mutant. Furthermore, R276H mutation led to significant thermostabilization in PsXR. The most positive effect on xylose fermentation to ethanol was found by using the Y-R276H strain, expressing PsXR R276H mutant and PsXDH WT: 20 % increase of ethanol production and 52 % decrease of xylitol excretion, compared with the Y-WT strain expressing PsXR WT and PsXDH WT. Measurement of intracellular coenzyme concentrations suggested that maintenance of the of NADPH/NADP(+) and NADH/NAD(+) ratios is important for efficient ethanol fermentation from xylose by recombinant S. cerevisiae.
Yamamichi, Nobutake; Hirano, Chigaya; Shimamoto, Takeshi; Minatsuki, Chihiro; Takahashi, Yu; Nakayama, Chiemi; Matsuda, Rie; Fujishiro, Mitsuhiro; Konno-Shimizu, Maki; Kato, Jun; Kodashima, Shinya; Ono, Satoshi; Niimi, Keiko; Mochizuki, Satoshi; Tsuji, Yosuke; Sakaguchi, Yoshiki; Asada-Hirayama, Itsuko; Takeuchi, Chihiro; Yakabi, Seiichi; Kakimoto, Hikaru; Wada, Ryoichi; Mitsushima, Toru; Ichinose, Masao; Koike, Kazuhiko
2014-01-01
Double-contrast upper gastrointestinal barium X-ray radiography (UGI-XR) is one of the most widely conducted gastric cancer screening methods. It has been executed to find gastric cancer, but has not been usually executed to detect premalignant atrophic mucosa of stomach. To understand the meaning of UGI-XR-based atrophic gastritis, we analyzed its association with several causative factors including Helicobacter pylori (HP) infection. We evaluated 6,901 healthy adults in Japan. UGI-XR-based atrophic gastritis was diagnosed based on the irregular shape of areae gastricae and its expansion in the stomach. Of the 6,433 subjects with no history of HP eradication and free from gastric acid suppressants, 1,936 were diagnosed as UGI-XR-based atrophic gastritis (mild: 234, moderate: 822, severe: 880). These were univariately associated with serum HP IgG and serum pepsinogen I/II ratio with statistical significance. The multiple logistic analysis calculating standardized coefficients (β) and odds ratio (OR) demonstrated that serum HP IgG (β = 1.499, OR = 4.48), current smoking (β = 0.526, OR = 1.69), age (β = 0.401, OR = 1.49), low serum pepsinogen I/II ratio (β = 0.339, OR = 1.40), and male gender (β = 0.306, OR = 1.36) showed significant positive association with UGI-XR-based atrophic gastritis whereas drinking and body mass index did not. Among the age/sex/smoking/drinking-matched 227 pairs derived from chronically HP-infected and successfully HP-eradicated subjects, UGI-XR-based atrophic gastritis was detected in 99.1% of the former but in only 59.5% of the latter subjects (p<0.0001). Contrastively, UGI-XR-based atrophic gastritis was detected in 13 of 14 HP-positive proton pump inhibitor users (92.9%) and 33 of 34 HP-positive histamine H2-receptor antagonist users (97.1%), which are not significantly different from gastric acid suppressant-free subjects. The presence of UGI-XR-based atrophic gastritis is positively
Pratter, S M; Eixelsberger, T; Nidetzky, B
2015-12-01
A novel Saccharomyces cerevisiae whole-cell biocatalyst for xylitol production based on Candida tenuis xylose reductase (CtXR) is presented. Six recombinant strains expressing wild-type CtXR or an NADH-specific mutant were constructed and evaluated regarding effects of expression mode, promoter strength, biocatalyst concentration and medium composition. Intracellular XR activities ranged from 0.09 U mgProt(-1) to 1.05 U mgProt(-1) but did not correlate with the strains' xylitol productivities, indicating that other factors limited xylose conversion in the high-activity strains. The CtXR mutant decreased the biocatalyst's performance, suggesting use of the NADPH-preferring wild-type enzyme when (semi-)aerobic conditions are applied. In a bioreactor process, the best-performing strain converted 40 g L(-1) xylose with an initial productivity of 1.16 g L(-1)h(-1) and a xylitol yield of 100%. The obtained results underline the potential of CtXR wild-type for xylose reduction and point out parameters to improve "green" xylitol production. Copyright © 2015 Elsevier Ltd. All rights reserved.
ADHM construction of instantons on the torus
International Nuclear Information System (INIS)
Ford, C.; Pawlowski, J.M.; Tok, T.; Wipf, A.
2001-01-01
We apply the ADHM instanton construction to SU(2) gauge theory on T n xR 4-n for n=1,2,3,4. To do this we regard instantons on T n xR 4-n as periodic (modulo gauge transformations) instantons on R 4 . Since the R 4 topological charge of such instantons is infinite the ADHM algebra takes place on an infinite dimensional linear space. The ADHM matrix M is related to a Weyl operator (with a self-dual background) on the dual torus T-tilde n . We construct the Weyl operator corresponding to the one-instantons on T n xR 4-n . In order to derive the self-dual potential on T n xR 4-n it is necessary to solve a specific Weyl equation. This is a variant of the Nahm transformation. In the case n=2 (i.e., T 2 xR 2 ) we essentially have an Aharonov-Bohm problem on T-tilde 2 . In the one-instanton sector we find that the scale parameter, λ, is bounded above, λ 2 V-tilde 2
Creep properties of heat-resistant superalloys for nuclear plants in helium
International Nuclear Information System (INIS)
Shimizu, Shigeki; Satoh, Keisuke; Matsuda, Shozo; Murase, Hirokazu; Fujioka, Junzo.
1979-01-01
In order to estimate the creep and rupture strengths of candidate alloys for the intermediate heat exchanger of VHTR, creep and stress rupture tests in impure helium were conducted on Hastelloy X, Inconel 617, Inconel 625, Incoloy 800 and Incoloy 807 at 900 0 C. The results were discussed in comparison with those in air and the alloys were examined from the point of view of the elevated temperature structural design. The main results obtained are summarized as follows: (1) No appreciable decrease in creep and rupture strengths in helium as compared with those in air is observed on Hastelloy X and Inconel 625. On the contrary, the creep and rupture strengths of Inconel 617 in helium decrease slightly as compared with those in air. In the case of Incoloy 807, the creep strength to cause 1 percent total strain and that to initiate secondary creep increase remarkably in helium as compared with those in air. However, the creep strength to cause initiation of tertiary creep and the rupture strength in helium remarkably decrease as compared with those in air. (2) The order of magnitude of the S 0 value for each material in helium is as follows; Hastelloy X > Inconel 617 > Incoloy 807 > Inconel 625 > Incoloy 800 Meanwhile, that of the S sub(t) value in helium is; Inconel 617 > Hastelloy X > Incoloy 807 > Inconel 625 > Incoloy 800. (author)
Notzon, Daniel P; Mariani, John J; Pavlicova, Martina; Glass, Andrew; Mahony, Amy L; Brooks, Daniel J; Grabowski, John; Levin, Frances R
2016-12-01
The prevalence of ADHD is greater in substance use disorders than the general population, and ADHD and substance use disorders share neurobiological features such as dysregulation of reward circuitry. We tested the hypothesis that stimulants would decrease marijuana use in a randomized controlled trial of extended release mixed amphetamine salts (MAS-XR) for treatment of co-occurring ADHD and cocaine use disorders. Marijuana users were defined as participants reporting use in the 30 days before study initiation, collected with timeline follow-back. The original 14-week trial utilized a 3-arm randomized design, comparing placebo, MAS-XR 60 mg, and MAS-XR 80 mg. For this analysis, both MAS-XR groups were combined, leaving n = 20 in the placebo group and n = 37 in the MAS-XR group. The primary outcome was proportion of subjects reporting any marijuana use per study week. Comparisons between groups were made using a logistic mixed effects model incorporating multiple predictors and modeling time-by-treatment interactions. There were no significant baseline differences in marijuana use frequency and quantity. There was a significant decrease in the proportion of participants using marijuana over time in the MAS-XR group, but no difference in the proportion of marijuana-use days over time. Treatment of ADHD and comorbid cocaine use disorders with MAS-XR is associated with increased weekly abstinence from marijuana but not with a decrease in the proportion of marijuana using days per week. Stimulant treatment of ADHD and cocaine use disorders may diminish co-occurring cannabis use. (Am J Addict 2016;25:666-672). © 2016 American Academy of Addiction Psychiatry.
Swelling in neutron irradiated nickel-base alloys
International Nuclear Information System (INIS)
Brager, H.R.; Bell, W.L.
1972-01-01
Inconel 625, Incoloy 800 and Hastelloy X were neutron irradiated at 500 to 700 0 C. It was found that of the three alloys investigated, Inconel 625 offers the greatest swelling resistance. The superior swelling resistance of Inconel 625 relative to that of Hastelloy-X is probably related to differences in the concentrations of the minor rather than major alloy constituents, and can involve (a) enhanced recombination of defects in the Inconel 625 and (b) preferential attraction of vacancies to incoherent precipitates. (U.S.)
Directory of Open Access Journals (Sweden)
Nobutake Yamamichi
Full Text Available Double-contrast upper gastrointestinal barium X-ray radiography (UGI-XR is one of the most widely conducted gastric cancer screening methods. It has been executed to find gastric cancer, but has not been usually executed to detect premalignant atrophic mucosa of stomach. To understand the meaning of UGI-XR-based atrophic gastritis, we analyzed its association with several causative factors including Helicobacter pylori (HP infection.We evaluated 6,901 healthy adults in Japan. UGI-XR-based atrophic gastritis was diagnosed based on the irregular shape of areae gastricae and its expansion in the stomach.Of the 6,433 subjects with no history of HP eradication and free from gastric acid suppressants, 1,936 were diagnosed as UGI-XR-based atrophic gastritis (mild: 234, moderate: 822, severe: 880. These were univariately associated with serum HP IgG and serum pepsinogen I/II ratio with statistical significance. The multiple logistic analysis calculating standardized coefficients (β and odds ratio (OR demonstrated that serum HP IgG (β = 1.499, OR = 4.48, current smoking (β = 0.526, OR = 1.69, age (β = 0.401, OR = 1.49, low serum pepsinogen I/II ratio (β = 0.339, OR = 1.40, and male gender (β = 0.306, OR = 1.36 showed significant positive association with UGI-XR-based atrophic gastritis whereas drinking and body mass index did not. Among the age/sex/smoking/drinking-matched 227 pairs derived from chronically HP-infected and successfully HP-eradicated subjects, UGI-XR-based atrophic gastritis was detected in 99.1% of the former but in only 59.5% of the latter subjects (p<0.0001. Contrastively, UGI-XR-based atrophic gastritis was detected in 13 of 14 HP-positive proton pump inhibitor users (92.9% and 33 of 34 HP-positive histamine H2-receptor antagonist users (97.1%, which are not significantly different from gastric acid suppressant-free subjects.The presence of UGI-XR-based atrophic gastritis is positively
Meyer, Jonathan M; Mao, Yongcai; Pikalov, Andrei; Cucchiaro, Josephine; Loebel, Antony
2015-11-01
The objective of this analysis was to evaluate the effect of 12 months of treatment with lurasidone on weight in patients with schizophrenia. Post-hoc, observed-case analysis included pooled data from six studies on 40-160 mg/day lurasidone; two studies included active comparators (2-6 mg/day risperidone or 200-800 mg/day quetiapine XR). Overall, 593 patients completed 12 months of treatment (N=471 lurasidone, N = 89 risperidone, N = 33 quetiapine XR). The mean baseline weight was 72.8, 80.8, and 72.4 kg in the lurasidone, risperidone, and quetiapine XR groups, respectively. The mean weight change at month 12 was -0.4 kg with lurasidone, +2.6 kg with risperidone, and +1.2 kg with quetiapine XR. Weight gain of at least 7% from study baseline was observed in 16.0, 25.8, and 15.2% of patients, and weight loss of at least 7% was seen in 18.5, 6.7, and 9.1% of patients treated with lurasidone, risperidone, and quetiapine XR, respectively. A shift from normal/underweight baseline BMI status to overweight/obese at month 12 occurred in 10.2, 27.6, and 15.0% of patients in the lurasidone, risperidone, and quetiapine XR groups, respectively. Conversely, 14.3, 1.7, and 7.7% of patients, respectively, shifted from overweight/obese to normal/underweight. In summary, a low potential for clinically significant weight gain was observed in patients with schizophrenia treated continuously with lurasidone for 12 months.
Wang, Rong; Fletcher, Tracey; Alvey, Christine; Kushner, Joseph; Stock, Thomas C.
2016-01-01
Abstract Tofacitinib is an oral Janus kinase inhibitor for the treatment of rheumatoid arthritis. An extended‐release (XR) formulation has been designed to provide a once‐daily (QD) dosing option to patients to achieve comparable pharmacokinetic (PK) parameters to the twice‐daily immediate‐release (IR) formulation. We conducted 2 randomized, open‐label, phase 1 studies in healthy volunteers. Study A characterized single‐dose and steady‐state PK of tofacitinib XR 11 mg QD and intended to demonstrate equivalence of exposure under single‐dose and steady‐state conditions to tofacitinib IR 5 mg twice daily. Study B assessed the effect of a high‐fat meal on the bioavailability of tofacitinib from the XR formulation. Safety and tolerability were monitored in both studies. In study A (N = 24), the XR and IR formulations achieved time to maximum plasma concentration at 4 hours and 0.5 hours postdose, respectively; terminal half‐life was 5.9 hours and 3.2 hours, respectively. Area under plasma concentration‐time curve (AUC) and maximum plasma concentration (Cmax) after single‐ and multiple‐dose administration were equivalent between the XR and IR formulations. In study B (N = 24), no difference in AUC was observed for fed vs fasted conditions. Cmax increased by 27% under the fed state. On repeat administration, negligible accumulation (Tofacitinib administration as an XR or IR formulation was generally well tolerated in these studies. PMID:26970526
Compatibility studies of potential molten-salt breeder reactor materials in molten fluoride salts
International Nuclear Information System (INIS)
Keiser, J.R.
1977-05-01
The molten fluoride salt compatibility studies carried out during the period 1974--76 in support of the Molten-Salt Reactor Program are summarized. Thermal-convection and forced-circulation loops were used to measure the corrosion rate of selected alloys. Results confirmed the relationship of time, initial chromium concentration, and mass loss developed by previous workers. The corrosion rates of Hastelloy N and Hastelloy N modified by the addition of 1--3 wt percent Nb were well within the acceptable range for use in an MSBR. 13 figures, 3 tables
Singhatanadgige, Weerasak; Kang, Daniel G.; Luksanapruksa, Panya; Peters, Colleen; Riew, K. Daniel
2015-01-01
Study Design Retrospective analysis. Objective To evaluate the correlation and reliability of cervical sagittal alignment parameters obtained from lateral cervical radiographs (XRs) compared with lateral whole-body stereoradiographs (SRs). Methods We evaluated adults with cervical deformity using both lateral XRs and lateral SRs obtained within 1 week of each other between 2010 and 2014. XR and SR images were measured by two independent spine surgeons using the following sagittal alignment parameters: C2–C7 sagittal Cobb angle (SCA), C2–C7 sagittal vertical axis (SVA), C1–C7 translational distance (C1–7), T1 slope (T1-S), neck tilt (NT), and thoracic inlet angle (TIA). Pearson correlation and paired t test were used for statistical analysis, with intra- and interrater reliability analyzed using intraclass correlation coefficient (ICC). Results A total of 35 patients were included in the study. We found excellent intrarater reliability for all sagittal alignment parameters in both the XR and SR groups with ICC ranging from 0.799 to 0.994 for XR and 0.791 to 0.995 for SR. Interrater reliability was also excellent for all parameters except NT and TIA, which had fair reliability. We also found excellent correlations between XR and SR measurements for most sagittal alignment parameters; SCA, SVA, and C1–C7 had r > 0.90, and only NT had r < 0.70. There was a significant difference between groups, with SR having lower measurements compared with XR for both SVA (0.68 cm lower, p < 0.001) and C1–C7 (1.02 cm lower, p < 0.001). There were no differences between groups for SCA, T1-S, NT, and TIA. Conclusion Whole-body stereoradiography appears to be a viable alternative for measuring cervical sagittal alignment parameters compared with standard radiography. XR and SR demonstrated excellent correlation for most sagittal alignment parameters except NT. However, SR had significantly lower average SVA and C1–C7 measurements than XR
Yamamichi, Nobutake; Hirano, Chigaya; Shimamoto, Takeshi; Minatsuki, Chihiro; Takahashi, Yu; Nakayama, Chiemi; Matsuda, Rie; Fujishiro, Mitsuhiro; Konno-Shimizu, Maki; Kato, Jun; Kodashima, Shinya; Ono, Satoshi; Niimi, Keiko; Mochizuki, Satoshi; Tsuji, Yosuke; Sakaguchi, Yoshiki; Asada-Hirayama, Itsuko; Takeuchi, Chihiro; Yakabi, Seiichi; Kakimoto, Hikaru; Wada, Ryoichi; Mitsushima, Toru; Ichinose, Masao; Koike, Kazuhiko
2014-01-01
Background Double-contrast upper gastrointestinal barium X-ray radiography (UGI-XR) is one of the most widely conducted gastric cancer screening methods. It has been executed to find gastric cancer, but has not been usually executed to detect premalignant atrophic mucosa of stomach. To understand the meaning of UGI-XR-based atrophic gastritis, we analyzed its association with several causative factors including Helicobacter pylori (HP) infection. Methods We evaluated 6,901 healthy adults in Japan. UGI-XR-based atrophic gastritis was diagnosed based on the irregular shape of areae gastricae and its expansion in the stomach. Results Of the 6,433 subjects with no history of HP eradication and free from gastric acid suppressants, 1,936 were diagnosed as UGI-XR-based atrophic gastritis (mild: 234, moderate: 822, severe: 880). These were univariately associated with serum HP IgG and serum pepsinogen I/II ratio with statistical significance. The multiple logistic analysis calculating standardized coefficients (β) and odds ratio (OR) demonstrated that serum HP IgG (β = 1.499, OR = 4.48), current smoking (β = 0.526, OR = 1.69), age (β = 0.401, OR = 1.49), low serum pepsinogen I/II ratio (β = 0.339, OR = 1.40), and male gender (β = 0.306, OR = 1.36) showed significant positive association with UGI-XR-based atrophic gastritis whereas drinking and body mass index did not. Among the age/sex/smoking/drinking-matched 227 pairs derived from chronically HP-infected and successfully HP-eradicated subjects, UGI-XR-based atrophic gastritis was detected in 99.1% of the former but in only 59.5% of the latter subjects (pgastritis was detected in 13 of 14 HP-positive proton pump inhibitor users (92.9%) and 33 of 34 HP-positive histamine H2-receptor antagonist users (97.1%), which are not significantly different from gastric acid suppressant-free subjects. Conclusions The presence of UGI-XR-based atrophic gastritis is positively associated with
Lamba, Manisha; Wang, Rong; Fletcher, Tracey; Alvey, Christine; Kushner, Joseph; Stock, Thomas C
2016-11-01
Tofacitinib is an oral Janus kinase inhibitor for the treatment of rheumatoid arthritis. An extended-release (XR) formulation has been designed to provide a once-daily (QD) dosing option to patients to achieve comparable pharmacokinetic (PK) parameters to the twice-daily immediate-release (IR) formulation. We conducted 2 randomized, open-label, phase 1 studies in healthy volunteers. Study A characterized single-dose and steady-state PK of tofacitinib XR 11 mg QD and intended to demonstrate equivalence of exposure under single-dose and steady-state conditions to tofacitinib IR 5 mg twice daily. Study B assessed the effect of a high-fat meal on the bioavailability of tofacitinib from the XR formulation. Safety and tolerability were monitored in both studies. In study A (N = 24), the XR and IR formulations achieved time to maximum plasma concentration at 4 hours and 0.5 hours postdose, respectively; terminal half-life was 5.9 hours and 3.2 hours, respectively. Area under plasma concentration-time curve (AUC) and maximum plasma concentration (C max ) after single- and multiple-dose administration were equivalent between the XR and IR formulations. In study B (N = 24), no difference in AUC was observed for fed vs fasted conditions. C max increased by 27% under the fed state. On repeat administration, negligible accumulation (Tofacitinib administration as an XR or IR formulation was generally well tolerated in these studies. © 2016, The Authors. The Journal of Clinical Pharmacology published by Wiley Periodicals, Inc. on behalf of American College of Clinical Pharmacology.
High cell density strategy for poly(3-hydroxybutyrate production by Cupriavidus necator
Directory of Open Access Journals (Sweden)
J. L. Ienczak
2011-12-01
Full Text Available Poly(3-hydroxybutyrate (P(3HB is a carbon and intracellular storage source for different microorganisms and its production can achieve high productivities by means of high cell density cultures. The aim of this study was to propose a high cell density strategy for P(3HB production by Cupriavidus necator. The exponential growth phase demands an accurate control of the oxygen transfer system in the bioreactor, due to maximum specific growth rate (µXr, and, consequently, a maximum specific oxygen uptake rate (QO2, in addition to significant residual biomass (Xr growth in high cell density cultures. In this context, this work investigated the strategy for obtaining high cell density, with the inclusion of a linear growth phase for P(3HB production by C. necator in a fed-batch culture. The linear growth phase was included between the exponential growth phase and the P(3HB production phase as a strategy to reduce the specific growth rate (µXr and specific oxygen uptake rate (QO2, with constant residual biomass growth rate (d(V.Xr/dt = k = constant and linear increase of biomass. Three strategies of culture were performed. The results showed that a high residual biomass concentration (30 gXr.L-1 can be reached by the inclusion of the linear growth strategy and specific growth rates (µXr between 0.08 and 0.05 h-1, at the beginning of the production phase, are necessary to attain a high P(3HB productivity.
Environmental Assessment of Lead at Camp Edwards, Massachusetts, Small Arms Ranges
2007-08-01
hydroxyapatite [Pb5(PO4)3(OH)], and lead oxyphosphate [Pb4O(PO4)2]. Lead phosphate minerals, in particular, are so sparingly soluble, thermodynamic...M ea n XR F Le ad Pr of ile R es ul ts (m g/ kg ) 1 -1 0 in ch es bg s M ea n XR F Le ad Pr of ile R es ul ts (m g/ kg ) 1 0- 20 in...ch es bg s M ea n XR F Le ad Pr of ile R es ul ts (m g/ kg ) 2 0- 30 in ch es
On the image formation in x-ray radiography using aligned carbon nanofibers
International Nuclear Information System (INIS)
Okuyama, F.
2017-01-01
Evidence is presented that field electrons emitted from vertically-aligned carbon nanofibers (CNFs) yield clearer x-ray images than do thermionic electrons, under the identical electron-optical condition. Specifically, the same sample, an LSI circuit, mounted on the same x-ray chamber could be imaged far more sharply with a CNF emitter than with a thermionic one. It is hypothesized that electrons discharged from CNF tips hit the target to form “discrete focal points” thereon, thereby generating multiple x-ray beams that interplay to form a brilliant, sharply-delineated x-ray image. This hypothesis may stimulate open discussion on how to define the “focal point” for the x-ray imaging using nano-structured electron sources. Also, the improved resolution attained with CNFs might indicate that the heat generation originating in electron-target interactions is not so serious in the present field-emission mode. - Highlights: • Field-emission (FE) x-ray radiography (XR) is based on nanotechnology. • FE-XR surpasses thermionic XR in image resolution and brilliance. • Highly-resolved FE-XR images are due possibly to a discrete array of x-ray spots. • This hypothesis stimulates open discussion on how to define the focal-point in FE-XR.
On the image formation in x-ray radiography using aligned carbon nanofibers
Energy Technology Data Exchange (ETDEWEB)
Okuyama, F., E-mail: okuya@mui.biglobe.ne.jp
2017-04-11
Evidence is presented that field electrons emitted from vertically-aligned carbon nanofibers (CNFs) yield clearer x-ray images than do thermionic electrons, under the identical electron-optical condition. Specifically, the same sample, an LSI circuit, mounted on the same x-ray chamber could be imaged far more sharply with a CNF emitter than with a thermionic one. It is hypothesized that electrons discharged from CNF tips hit the target to form “discrete focal points” thereon, thereby generating multiple x-ray beams that interplay to form a brilliant, sharply-delineated x-ray image. This hypothesis may stimulate open discussion on how to define the “focal point” for the x-ray imaging using nano-structured electron sources. Also, the improved resolution attained with CNFs might indicate that the heat generation originating in electron-target interactions is not so serious in the present field-emission mode. - Highlights: • Field-emission (FE) x-ray radiography (XR) is based on nanotechnology. • FE-XR surpasses thermionic XR in image resolution and brilliance. • Highly-resolved FE-XR images are due possibly to a discrete array of x-ray spots. • This hypothesis stimulates open discussion on how to define the focal-point in FE-XR.
Vecellio, Elia; Georgiou, Andrew
2016-01-01
Repeat and redundant procedures in medical imaging are associated with increases in resource utilisation and labour costs. Unnecessary medical imaging in some modalities, such as X-Ray (XR) and Computed Tomography (CT) is an important safety issue because it exposes patients to ionising radiation which can be carcinogenic and is associated with higher rates of cancer. The aim of this study was to assess the impact of implementing an integrated Computerised Provider Order Entry (CPOE)/Radiology Information System (RIS)/Picture Archiving and Communications System (PACS) system on the number of XR and CT imaging procedures (including repeat imaging requests) for inpatients at a large metropolitan hospital. The study found that patients had an average 0.47 fewer XR procedures and 0.07 fewer CT procedures after the implementation of the integrated system. Part of this reduction was driven by a lower rate of repeat procedures: the average inpatient had 0.13 fewer repeat XR procedures within 24-hours of the previous identical XR procedure. A similar decrease was not evident for repeat CT procedures. Reduced utilisation of imaging procedures (especially those within very short intervals from the previous identical procedure, which are more likely to be redundant) has implications for the safety of patients and the cost of medical imaging services.
Summary of Dissimilar Metal Joining Trials Conducted by Edison Welding Institute
Energy Technology Data Exchange (ETDEWEB)
MJ Lambert
2005-11-18
Under the direction of the NASA-Glenn Research Center, the Edison Welding Institute (EWI) in Columbus, OH performed a series of non-fusion joining experiments to determine the feasibility of joining refractory metals or refractory metal alloys to Ni-based superalloys. Results, as reported by EWI, can be found in the project report for EWI Project 48819GTH (Attachment A, at the end of this document), dated October 10, 2005. The three joining methods used in this investigation were inertia welding, magnetic pulse welding, and electro-spark deposition joining. Five materials were used in these experiments: Mo-47Re, T-111, Hastelloy X, Mar M-247 (coarse-grained, 0.5 mm to several millimeter average grain size), and Mar M-247 (fine-grained, approximately 50 {micro}m average grain size). Several iterative trials of each material combination with each joining method were performed to determine the best practice joining method. Mo-47Re was found to be joined easily to Hastelloy X via inertia welding, but inertia welding of the Mo-alloy to both Mar M-247 alloys resulted in inconsistent joint strength and large reaction layers between the two metals. T-111 was found to join well to Hastelloy X and coarse-grained Mar M-247 via inertia welding, but joining to fine-grained Mar M-247 resulted in low joint strength. Magnetic pulse welding (MPW) was only successful in joining T-111 tubing to Hastelloy X bar stock. The joint integrity and reaction layer between the metals were found to be acceptable. This single joining trial, however, caused damage to the electromagnetic concentrators used in this process. Subsequent design efforts to eliminate the problem resulted in a loss of power imparted to the accelerating work piece, and results could not be reproduced. Welding trials of Mar M-247 to T-111 resulted in catastrophic failure of the bar stock, even at lower power. Electro-spark deposition joining of Mo-47Re, in which the deposited material was Hastelloy X, did not have a
Summary of Dissimilar Metal Joining Trials Conducted by Edison Welding Institute
International Nuclear Information System (INIS)
MJ Lambert
2005-01-01
Under the direction of the NASA-Glenn Research Center, the Edison Welding Institute (EWI) in Columbus, OH performed a series of non-fusion joining experiments to determine the feasibility of joining refractory metals or refractory metal alloys to Ni-based superalloys. Results, as reported by EWI, can be found in the project report for EWI Project 48819GTH (Attachment A, at the end of this document), dated October 10, 2005. The three joining methods used in this investigation were inertia welding, magnetic pulse welding, and electro-spark deposition joining. Five materials were used in these experiments: Mo-47Re, T-111, Hastelloy X, Mar M-247 (coarse-grained, 0.5 mm to several millimeter average grain size), and Mar M-247 (fine-grained, approximately 50 (micro)m average grain size). Several iterative trials of each material combination with each joining method were performed to determine the best practice joining method. Mo-47Re was found to be joined easily to Hastelloy X via inertia welding, but inertia welding of the Mo-alloy to both Mar M-247 alloys resulted in inconsistent joint strength and large reaction layers between the two metals. T-111 was found to join well to Hastelloy X and coarse-grained Mar M-247 via inertia welding, but joining to fine-grained Mar M-247 resulted in low joint strength. Magnetic pulse welding (MPW) was only successful in joining T-111 tubing to Hastelloy X bar stock. The joint integrity and reaction layer between the metals were found to be acceptable. This single joining trial, however, caused damage to the electromagnetic concentrators used in this process. Subsequent design efforts to eliminate the problem resulted in a loss of power imparted to the accelerating work piece, and results could not be reproduced. Welding trials of Mar M-247 to T-111 resulted in catastrophic failure of the bar stock, even at lower power. Electro-spark deposition joining of Mo-47Re, in which the deposited material was Hastelloy X, did not have a
Soares, William E; Wilson, Donna; Rathlev, Niels; Lee, Joshua D; Gordon, Michael; Nunes, Edward V; O'Brien, Charles P; Friedmann, Peter D
2018-02-01
Opioid use disorders have reached epidemic proportions, with overdose now the leading cause of accidental death in the United States. Extended release naltrexone (XR-NTX) has emerged as a medication treatment that reduces opioid use and craving. However, the effect of XR-NTX therapy on acute healthcare utilization, including emergency department visits and inpatient hospitalizations, remains uncertain. The objective of the current study is to evaluate hospital-based healthcare resource utilization in adults involved in the criminal justice system with a history of opioid use disorder randomized to XR-NTX therapy compared with treatment as usual (TAU) during a 6-month treatment phase and 12months post-treatment follow up. This retrospective exploratory analysis uses data collected in a published randomized trial. Comparisons of the number of emergency department visits and hospital admissions (for drug detox, psychiatric care and other medical reasons) were performed using chi square tests for any admission and negative binomial models for number of admissions. Of the 308 participants randomized, 96% had utilization data (76% complete 6months, 67% complete follow up). No significant differences were seen in overall healthcare utilization (IRR=0.88, 95%CI 0.63-1.23, p=0.45), or substance use-related drug detox hospitalizations (IRR=0.83, 95%CI 0.32-2.16, p=0.71). Despite having more participants report chronic medical problems at baseline (43% vs. 32%, p=0.05), those receiving XR-NTX generally experienced equivalent or lower rates of healthcare utilization compared to TAU. The XR-NTX group had significantly lower medical/surgical related hospital admissions (IRR=0.55, 95%CI 0.30-1.00, p=0.05) during the course of the entire study. XR-NTX did not significantly increase rates of healthcare utilization compared to TAU. Provider concerns regarding healthcare utilization should not preclude the consideration of XR-NTX as therapy for opioid use disorders. Copyright © 2018
Directory of Open Access Journals (Sweden)
Paulo Antônio de S. Gonçalves
2000-07-01
Full Text Available O objetivo do trabalho foi avaliar a eficiência de diferentes volumes de calda e tipo de bico no controle químico de Thrips tabaci em cebola. Dois experimentos foram conduzidos na EPAGRI, Estação Experimental de Ituporanga, SC, no período de agosto a dezembro de 1996 e 1997. Os tratamentos com bico leque e respectivos níveis de vazão foram XR 110 015 VS® - 236 L/ha, XR 110 02 VS® - 316 L/ha, XR 110 03 VS® - 472 L/ha, XR 110 04 VS® - 632 L/ha, XR 110 05 VS® - 788 L/ha, TJ 60 110 02 VS® - 316 L/ha, TJ 60 110 04 VS® - 632 L/ha; com bico cone foram Conejet TSVS® - 236 L/ha, Conejet TXVK 18® - 472 L/ha, Conejet TXVK 26® - 632 L/ha, D6 Difusor V5® - 600 L/ha, além da testemunha, sem tratamento. O delineamento experimental utilizado foi blocos ao acaso com quatro repetições. O tamanho de parcela foi de 2,8 m x 3,0 m. O inseticida usado foi clorpirifós 0,72 g. i.a./ha. A amostragem de ninfas de T. tabaci foi realizada no campo em cinco plantas escolhidas ao acaso em cada parcela. A redução populacional de tripes foi semelhante entre os diferentes volumes de calda e tipos de bico utilizados. Portanto, os bicos cone e leque aplicando volumes de calda entre 236 a 788 L/ha, apresentaram a mesma eficiência no controle de T. tabaci em cebola.The objective of this work was to evaluate the efficiency of different nozzle types and volume of the insecticide solution in controlling thrips (Thrips tabaci in onions. The work was carried out from August to December, 1996 and 1997. The treatments consisted of different nozzle types (fan and cone and different flow rates. Fan nozzles were XR 110 015 VS® - 236 L/ha, XR 110 02 VS® - 316 L/ha, XR 110 03 VS® - 472 L/ha, XR 110 04 VS® - 632 L/ha, XR 110 05 VS® - 788 L/ha, TJ 60 110 02 VS® - 316 L/ha, TJ 60 110 04 VS - 632 L/ha; and cone nozzles were Conejet TSVS® - 236 L/ha, Conejet TXVK 18® - 472 L/ha, Conejet TXVK 26® - 632 L/ha, D6 Difusor V5® - 600 L/ha. Besides these treatments there
Takeuchi, Chihiro; Yamamichi, Nobutake; Shimamoto, Takeshi; Takahashi, Yu; Mitsushima, Toru; Koike, Kazuhiko
2017-03-01
Double-contrast upper gastrointestinal barium X-ray radiography (UGI-XR) is a method broadly used for gastric cancer screening in Japan. Gastric polyp is one of the most frequent findings detected by UGI-XR, but how to handle it remains controversial. Gastric polyps of the 17,264 generally healthy subjects in Japan who underwent UGI-XR or upper gastrointestinal endoscopy (UGI-ES) in 2010 were analyzed. Of the 6,433 UGI-XR examinees (3,405 men and 3,028 women, 47.4 ± 9.0 years old), gastric polyps were detected in 464 men (13.6 %) and 733 women (24.2 %) and were predominantly developed on the non-atrophic gastric mucosa (p gastric polyps has significant association with lower value of serum anti-Helicobacter pylori IgG titer, female gender, lighter smoking habit, older age, and normal range of body mass index (≥18.5 and gastric cancer occurred in 7 subjects (0.11 %), but none of them had gastric polyps at the beginning of the follow-up period. Of the 2,722 subjects with gastric polyps among the 10,831 UGI-ES examinees in the same period, 2,446 (89.9 %) had fundic, 267 (9.8 %) had hyperplastic, and 9 (0.3 %) had adenomatous/cancerous polyps. Gastric polyps diagnosed by UGI-XR predominantly arise on the Helicobacter pylori-negative gastric mucosa with a low risk of gastric cancer in Japan. In the prospective observation, none of the UGI-XR examinees with gastric polyps developed gastric cancer for at least 3 years subsequently.
Scheduling system for test automation framework
Wahyudi, Djohan
2014-01-01
An Interventional X-ray (iXR) system provides real time X-ray imaging with high image clarity and low X-ray dose. After several years of development, the iXR System has become complex. In order to verify the correct operation of the system, the system integration and test group performs extensive
Advanced heat exchanger development for molten salts
Energy Technology Data Exchange (ETDEWEB)
Sabharwall, Piyush, E-mail: Piyush.Sabharwall@inl.gov [Idaho National Laboratory, Idaho Falls, ID 83415 (United States); Clark, Denis; Glazoff, Michael [Idaho National Laboratory, Idaho Falls, ID 83415 (United States); Zheng, Guiqiu; Sridharan, Kumar; Anderson, Mark [University of Wisconsin, Madison (United States)
2014-12-15
Highlights: • Hastelloy N and 242, shows corrosion resistance to molten salt at nominal operating temperatures. • Both diffusion welds and sheet material in Hastelloy N were corrosion tested in at 650, 700, and 850 °C for 200, 500, and 1000 h. • Thermal gradients and galvanic couples in the molten salts enhance corrosion rates. • Corrosion rates found were typically <10 mils per year. - Abstract: This study addresses present work concerned with advanced heat exchanger development for molten salt in nuclear and non-nuclear thermal systems. The molten salt systems discussed herein use alloys, such as Hastelloy N and 242, that show good corrosion resistance in molten salt at nominal operating temperatures up to 700 °C. These alloys were diffusion welded, and the corresponding information is presented. Test specimens were prepared for exposing diffusion welds to molten salt environments. Hastelloy N and 242 were found to be weldable by diffusion welding, with ultimate tensile strengths about 90% of base metal values. Both diffusion welds and sheet material in Hastelloy N were corrosion tested in 58 mol% KF and 42 mol% ZrF{sub 4} at 650, 700, and 850 °C for 200, 500, and 1000 h. Corrosion rates were similar between welded and nonwelded materials, typically <100 μm per year after 1000 h of corrosion tests. No catastrophic corrosion was observed in the diffusion welded regions. For materials of construction, nickel-based alloys and alloys with dense nickel coatings are effectively inert to corrosion in fluorides, but not so in chlorides. Hence, additional testing of selected alloys for resistance to intergranular corrosion is needed, as is a determination of corrosion rate as a function of the type of salt impurity and alloy composition, with respect to chromium and carbon, to better define the best conditions for corrosion resistance. Also presented is the division of the nuclear reactor and high-temperature components per American Society of Mechanical
Impaired P2X signalling pathways in renal microvascular myocytes in genetic hypertension
Gordienko, Dmitri V.; Povstyan, Oleksandr V.; Sukhanova, Khrystyna Yu; Raphaë l, Maylis; Harhun, Maksym I.; Dyskina, Yulia; Lehen'Kyi, V'Yacheslav; Jama, Abdirahman Mahmoud; Lu, Zhiliang; Skryma, Roman N.; Prevarskaya, Natalia B.
2014-01-01
Aims P2X receptors (P2XRs) mediate sympathetic control and autoregulation of renal circulation triggering preglomerular vasoconstriction, which protects glomeruli from elevated pressures. Although previous studies established a casual link between glomerular susceptibility to hypertensive injury and decreased preglomerular vascular reactivity to P2XR activation, the mechanisms of attenuation of the P2XR signalling in hypertension remained unknown. We aimed to analyse molecular mechanisms of the impairment of P2XR signalling in renal vascular smooth muscle cells (RVSMCs) in genetic hypertension. Methods and results We compared the expression of pertinent genes and P2XR-linked Ca2+ entry and Ca2+ release mechanisms in RVSMCs of spontaneously hypertensive rats (SHRs) and their normotensive controls, Wistar Kyoto (WKY) rats. We found that, in SHR RVSMCs, P2XR-linked Ca2+ entry and Ca2+ release from the sarcoplasmic reticulum (SR) are both significantly reduced. The former is due to down-regulation of the P2X1 subunit. The latter is caused by a decrease of the SR Ca2+ load. The SR Ca2+ load reduction is caused by attenuated Ca2+ uptake via down-regulated sarco-/endoplasmic reticulum Ca2+-ATPase 2b and elevated Ca2+ leak from the SR via ryanodine receptors (RyRs) and inositol 1,4,5-trisphosphate receptors. Spontaneous activity of these Ca2+-release channels is augmented due to up-regulation of RyR type 2 and elevated IP3 production by up-regulated phospholipase C-β1. Conclusions Our study unravels the cellular and molecular mechanisms of attenuation of P2XR-mediated preglomerular vasoconstriction that elevates glomerular susceptibility to harmful hypertensive pressures. This provides an important impetus towards understanding of the pathology of hypertensive renal injury.
Energy Technology Data Exchange (ETDEWEB)
Dietzel, Matthias, E-mail: dietzelmatthias2@hotmail.com [Institute of Diagnostic and Interventional Radiology, Friedrich-Schiller-University Jena, Erlanger Allee 101, D-07740 Jena (Germany); Hopp, Torsten; Ruiter, Nicole [Karlsruhe Institute of Technology (KIT), Institute for Data Processing and Electronics, Postfach 3640, D-76021 Karlsruhe (Germany); Zoubi, Ramy [Institute of Diagnostic and Interventional Radiology, Friedrich-Schiller-University Jena, Erlanger Allee 101, D-07740 Jena (Germany); Runnebaum, Ingo B. [Clinic of Gynecology and Obstetrics, Friedrich-Schiller-University Jena, Bachstrasse 18, D-07743 Jena (Germany); Kaiser, Werner A. [Institute of Diagnostic and Interventional Radiology, Friedrich-Schiller-University Jena, Erlanger Allee 101, D-07740 Jena (Germany); Medical School, University of Harvard, 25 Shattuck Street, Boston, MA 02115 (United States); Baltzer, Pascal A.T. [Institute of Diagnostic and Interventional Radiology, Friedrich-Schiller-University Jena, Erlanger Allee 101, D-07740 Jena (Germany)
2011-08-15
Rationale and objectives: To evaluate the semi-automatic image registration accuracy of X-ray-mammography (XR-M) with high-resolution high-field (3.0 T) MR-mammography (MR-M) in an initial pilot study. Material and methods: MR-M was acquired on a high-field clinical scanner at 3.0 T (T1-weighted 3D VIBE {+-} Gd). XR-M was obtained with state-of-the-art full-field digital systems. Seven patients with clearly delineable mass lesions >10 mm both in XR-M and MR-M were enrolled (exclusion criteria: previous breast surgery; surgical intervention between XR-M and MR-M). XR-M and MR-M were matched using a dedicated image-registration algorithm allowing semi-automatic non-linear deformation of MR-M based on finite-element modeling. To identify registration errors (RE) a virtual craniocaudal 2D mammogram was calculated by the software from MR-M (with and w/o Gadodiamide/Gd) and matched with corresponding XR-M. To quantify REs the geometric center of the lesions in the virtual vs. conventional mammogram were subtracted. The robustness of registration was quantified by registration of X-MRs to both MR-Ms with and w/o Gadodiamide. Results: Image registration was performed successfully for all patients. Overall RE was 8.2 mm (1 min after Gd; confidence interval/CI: 2.0-14.4 mm, standard deviation/SD: 6.7 mm) vs. 8.9 mm (no Gd; CI: 4.0-13.9 mm, SD: 5.4 mm). The mean difference between pre- vs. post-contrast was 0.7 mm (SD: 1.9 mm). Conclusion: Image registration of high-field 3.0 T MR-mammography with X-ray-mammography is feasible. For this study applying a high-resolution protocol at 3.0 T, the registration was robust and the overall registration error was sufficient for clinical application.
Impaired P2X signalling pathways in renal microvascular myocytes in genetic hypertension
Gordienko, Dmitri V.
2014-12-16
Aims P2X receptors (P2XRs) mediate sympathetic control and autoregulation of renal circulation triggering preglomerular vasoconstriction, which protects glomeruli from elevated pressures. Although previous studies established a casual link between glomerular susceptibility to hypertensive injury and decreased preglomerular vascular reactivity to P2XR activation, the mechanisms of attenuation of the P2XR signalling in hypertension remained unknown. We aimed to analyse molecular mechanisms of the impairment of P2XR signalling in renal vascular smooth muscle cells (RVSMCs) in genetic hypertension. Methods and results We compared the expression of pertinent genes and P2XR-linked Ca2+ entry and Ca2+ release mechanisms in RVSMCs of spontaneously hypertensive rats (SHRs) and their normotensive controls, Wistar Kyoto (WKY) rats. We found that, in SHR RVSMCs, P2XR-linked Ca2+ entry and Ca2+ release from the sarcoplasmic reticulum (SR) are both significantly reduced. The former is due to down-regulation of the P2X1 subunit. The latter is caused by a decrease of the SR Ca2+ load. The SR Ca2+ load reduction is caused by attenuated Ca2+ uptake via down-regulated sarco-/endoplasmic reticulum Ca2+-ATPase 2b and elevated Ca2+ leak from the SR via ryanodine receptors (RyRs) and inositol 1,4,5-trisphosphate receptors. Spontaneous activity of these Ca2+-release channels is augmented due to up-regulation of RyR type 2 and elevated IP3 production by up-regulated phospholipase C-β1. Conclusions Our study unravels the cellular and molecular mechanisms of attenuation of P2XR-mediated preglomerular vasoconstriction that elevates glomerular susceptibility to harmful hypertensive pressures. This provides an important impetus towards understanding of the pathology of hypertensive renal injury.
Marcus, Ruthanne; Makarenko, Iuliia; Mazhnaya, Alyona; Zelenev, Alexei; Polonsky, Maxim; Madden, Lynn; Filippovych, Sergii; Dvoriak, Sergii; Springer, Sandra A; Altice, Frederick L
2017-10-01
Scaling up HIV prevention for people who inject drugs (PWID) using opioid agonist therapies (OAT) in Ukraine has been restricted by individual and structural factors. Extended-release naltrexone (XR-NTX), however, provides new opportunities for treating opioid use disorders (OUDs) in this region, where both HIV incidence and mortality continue to increase. Survey results from 1613 randomly selected PWID from 5 regions in Ukraine who were currently, previously or never on OAT were analyzed for their preference of pharmacological therapies for treating OUDs. For those preferring XR-NTX, independent correlates of their willingness to initiate XR-NTX were examined. Among the 1613 PWID, 449 (27.8%) were interested in initiating XR-NTX. Independent correlates associated with interest in XR-NTX included: being from Mykolaiv (AOR=3.7, 95% CI=2.3-6.1) or Dnipro (AOR=1.8, 95% CI=1.1-2.9); never having been on OAT (AOR=3.4, 95% CI=2.1-5.4); shorter-term injectors (AOR=0.9, 95% CI 0.9-0.98); and inversely for both positive (AOR=0.8, CI=0.8-0.9), and negative attitudes toward OAT (AOR=1.3, CI=1.2-1.4), respectively. In the context of Eastern Europe and Central Asia where HIV is concentrated in PWID and where HIV prevention with OAT is under-scaled, new options for treating OUDs are urgently needed. here suggest that XR-NTX could become an option for addiction treatment and HIV prevention especially for PWID who have shorter duration of injection and who harbor negative attitudes to OAT. Decision aids that inform patient preferences with accurate information about the various treatment options are likely to guide patients toward better, patient-centered treatments and improve treatment entry and retention. Copyright © 2017 Elsevier B.V. All rights reserved.
Collins, Susan E; Saxon, Andrew J; Duncan, Mark H; Smart, Brian F; Merrill, Joseph O; Malone, Daniel K; Jackson, T Ron; Clifasefi, Seema L; Joesch, Jutta; Ries, Richard K
2014-07-01
Interventions requiring abstinence from alcohol are neither preferred by nor shown to be highly effective with many homeless individuals with alcohol dependence. It is therefore important to develop lower-threshold, patient-centered interventions for this multimorbid and high-utilizing population. Harm-reduction counseling requires neither abstinence nor use reduction and pairs a compassionate style with patient-driven goal-setting. Extended-release naltrexone (XR-NTX), a monthly injectable formulation of an opioid receptor antagonist, reduces craving and may support achievement of harm-reduction goals. Together, harm-reduction counseling and XR-NTX may support alcohol harm reduction and quality-of-life improvement. Study aims include testing: a) the relative efficacy of XR-NTX and harm-reduction counseling compared to a community-based, supportive-services-as-usual control, b) theory-based mediators of treatment effects, and c) treatment effects on publicly funded service costs. This RCT involves four arms: a) XR-NTX+harm-reduction counseling, b) placebo+harm-reduction counseling, c) harm-reduction counseling only, and d) community-based, supportive-services-as-usual control conditions. Participants are currently/formerly homeless, alcohol dependent individuals (N=300). Outcomes include alcohol variables (i.e., craving, quantity/frequency, problems and biomarkers), health-related quality of life, and publicly funded service utilization and associated costs. Mediators include 10-point motivation rulers and the Penn Alcohol Craving Scale. XR-NTX and harm-reduction counseling are administered every 4weeks over the 12-week treatment course. Follow-up assessments are conducted at weeks 24 and 36. If found efficacious, XR-NTX and harm-reduction counseling will be well-positioned to support reductions in alcohol-related harm, decreases in costs associated with publicly funded service utilization, and increases in quality of life among homeless, alcohol
International Nuclear Information System (INIS)
Dietzel, Matthias; Hopp, Torsten; Ruiter, Nicole; Zoubi, Ramy; Runnebaum, Ingo B.; Kaiser, Werner A.; Baltzer, Pascal A.T.
2011-01-01
Rationale and objectives: To evaluate the semi-automatic image registration accuracy of X-ray-mammography (XR-M) with high-resolution high-field (3.0 T) MR-mammography (MR-M) in an initial pilot study. Material and methods: MR-M was acquired on a high-field clinical scanner at 3.0 T (T1-weighted 3D VIBE ± Gd). XR-M was obtained with state-of-the-art full-field digital systems. Seven patients with clearly delineable mass lesions >10 mm both in XR-M and MR-M were enrolled (exclusion criteria: previous breast surgery; surgical intervention between XR-M and MR-M). XR-M and MR-M were matched using a dedicated image-registration algorithm allowing semi-automatic non-linear deformation of MR-M based on finite-element modeling. To identify registration errors (RE) a virtual craniocaudal 2D mammogram was calculated by the software from MR-M (with and w/o Gadodiamide/Gd) and matched with corresponding XR-M. To quantify REs the geometric center of the lesions in the virtual vs. conventional mammogram were subtracted. The robustness of registration was quantified by registration of X-MRs to both MR-Ms with and w/o Gadodiamide. Results: Image registration was performed successfully for all patients. Overall RE was 8.2 mm (1 min after Gd; confidence interval/CI: 2.0-14.4 mm, standard deviation/SD: 6.7 mm) vs. 8.9 mm (no Gd; CI: 4.0-13.9 mm, SD: 5.4 mm). The mean difference between pre- vs. post-contrast was 0.7 mm (SD: 1.9 mm). Conclusion: Image registration of high-field 3.0 T MR-mammography with X-ray-mammography is feasible. For this study applying a high-resolution protocol at 3.0 T, the registration was robust and the overall registration error was sufficient for clinical application.
Pecknold, J; Luthe, L; Munjack, D; Alexander, P
1994-10-01
This is a double-blind, placebo-controlled, flexible-dose, multicenter, 6-week study comparing regular alprazolam (compressed tablet, CT), given four times per day, and extended release alprazolam (XR), given once in the morning. The aim of the XR preparation is to offer less frequent dosing and to reduce interdose anxiety. Of the intent-to-treat group of 209 patients, 184 completed 3 weeks of medication and were evaluated according to protocol. There was a completer rate for the 6 weeks of 94% (CT), 97% (XR), and 87% (placebo). On global measures, Hamilton Rating Scale for Anxiety, phobia rating, and work disability measures, both active treatment groups were equally effective and significantly more efficacious than the placebo cell on endpoint MANOVA analysis. On analysis of the panic factor with endpoint data, both active treatment groups were equally effective throughout the 6-week trial and significantly more efficacious than the placebo group. Drowsiness occurred more frequently with CT alprazolam (86% of patients) than with the XR preparation (79%) or placebo (49%).
Evidence for multiple repair pathways of double-strand DNA breaks in Chinese hamster cells
International Nuclear Information System (INIS)
Giaccia, A.J.; Weistein, R.; Stamato, T.D.; Roosa, R.
1984-01-01
XR-1 is a mutant of the Chinese hamster cell (CHO-K1) which is abnormally sensitive to killing by gamma rays in G/sub 1/ (D37 = 27 rads vs. 318 for parent) and early S phases of the cell cycle but has near normal resistance in late S and early G/sub 2/ (Somatic Cell Genetics, 9:165-173, 1983). Complementation studies between XR-1 and its parent indicate that this sensitivity to gamma rays is a recessive phenotype. Both the XR-1 and its parent cell are able to repair single strand DNA breaks. However, in comparison to its parental cell, the XR-1 cell is markedly deficient in the repair of double strand DNA breaks introduced by gamma irradiation during the sensitive G/sub 1/-early S period, while in the late S-G/sub 2/ resistant period the repair is similar in both cells. This correlation suggests that an unrepaired double strand DNA break is the lethal lesion and that at least two pathways for the repair of these lesions exist in mammalian cells
Yamamichi, Nobutake; Hirano, Chigaya; Ichinose, Masao; Takahashi, Yu; Minatsuki, Chihiro; Matsuda, Rie; Nakayama, Chiemi; Shimamoto, Takeshi; Kodashima, Shinya; Ono, Satoshi; Tsuji, Yosuke; Niimi, Keiko; Sakaguchi, Yoshiki; Kataoka, Yosuke; Saito, Itaru; Asada-Hirayama, Itsuko; Takeuchi, Chihiro; Yakabi, Seiichi; Kaikimoto, Hikaru; Matsumoto, Yuta; Yamaguchi, Daisuke; Kageyama-Yahara, Natsuko; Fujishiro, Mitsuhiro; Wada, Ryoichi; Mitsushima, Toru; Koike, Kazuhiko
2016-07-01
Double-contrast upper gastrointestinal barium X-ray radiography (UGI-XR) is the standard gastric cancer screening method in Japan. Atrophic gastritis and enlarged gastric folds are considered the two major features of Helicobacter pylori-induced chronic gastritis, but the clinical meaning of evaluating them by UGI-XR has not been elucidated. We analyzed healthy UGI-XR examinees without a history of gastrectomy, previous Helicobacter pylori eradication and usage of gastric acid suppressants. Of the 6433 subjects, 1936 (30.1 %) had atrophic gastritis and 1253 (19.5 %) had enlarged gastric folds. During the 3-year prospective observational follow-up, gastric cancer developed in seven subjects, six of whom (85.7 %) had atrophic gastritis with H. pylori infection and five of whom (71.4 %) had enlarged gastric folds with H. pylori infection. The Kaplan-Meier method with log-rank testing revealed that both UGI-XR-based atrophic gastritis (p = 0.0011) and enlarged gastric folds (p = 0.0003) are significant predictors for future gastric cancer incidence.
International Nuclear Information System (INIS)
Yoshikawa, H.; Gomay, J.; Sugiyama, Y.; Mizuno, M.; Komiya, S.; Tazima, T.
1977-01-01
Outgassing rates of vacuum wall candidate materials; stainless steel SS-304L and YUS-170, Inconel-625 and Hastelloy-X, and first wall materials; molybdenum, pyrolytic graphite and silicon carbide are measured before, during and after a bake-out at 500 0 C. The outgassing rate from the inside wall of the cylinder made of each material is estimated from the pressure difference between before and after a calibrated orifice. The ultimate outgassing rates of SS-304L and pyrolytic graphite, and YUS-170 Inconel-625, Hastelloy-X and molybdenum are the orders of 10 -10 and 10 -11 Pa.l.s -1 cm -2 , respectively
Sannino, Anna; Zeni, Olga; Romeo, Stefania; Massa, Rita; Gialanella, Giancarlo; Grossi, Gianfranco; Manti, Lorenzo; Vijayalaxmi; Scarfì, Maria Rosaria
2014-03-01
The aim of this preliminary investigation was to assess whether human peripheral blood lymphocytes which have been pre-exposed to non-ionizing radiofrequency fields exhibit an adaptive response (AR) by resisting the induction of genetic damage from subsequent exposure to ionizing radiation. Peripheral blood lymphocytes from four healthy donors were stimulated with phytohemagglutinin for 24 h and then exposed for 20 h to 1950 MHz radiofrequency fields (RF, adaptive dose, AD) at an average specific absorption rate of 0.3 W/kg. At 48 h, the cells were subjected to a challenge dose (CD) of 1.0 or 1.5 Gy X-irradiation (XR, challenge dose, CD). After a 72 h total culture period, cells were collected to examine the incidence of micronuclei (MN). There was a significant decrease in the number of MN in lymphocytes exposed to RF + XR (AD + CD) as compared with those subjected to XR alone (CD). These observations thus suggested a RF-induced AR and induction of resistance to subsequent damage from XR. There was variability between the donors in RF-induced AR. The data reported in our earlier investigations also indicated a similar induction of AR in human blood lymphocytes that had been pre-exposed to RF (AD) and subsequently treated with a chemical mutagen, mitomycin C (CD). Since XR and mitomycin-C induce different kinds of lesions in cellular DNA, further studies are required to understand the mechanism(s) involved in the RF-induced adaptive response.
Design and Fabrication Technique of the Key Components for Very High Temperature Reactor
Energy Technology Data Exchange (ETDEWEB)
Lee, Ho Jin; Song, Ki Nam; Kim, Yong Wan
2006-12-15
The gas outlet temperature of Very High Temperature Reactor (VHTR) may be beyond the capability of conventional metallic materials. The requirement of the gas outlet temperature of 950 .deg. C will result in operating temperatures for metallic core components that will approach very high temperature on some cases. The materials that are capable of withstanding this temperature should be prepared, or nonmetallic materials will be required for limited components. The Ni-base alloys such as Alloy 617, Hastelloy X, XR, Incoloy 800H, and Haynes 230 are being investigated to apply them on components operated in high temperature. Currently available national and international codes and procedures are needed reviewed to design the components for HTGR/VHTR. Seven codes and procedures, including five ASME Codes and Code cases, one French code (RCC-MR), and on British Procedure (R5) were reviewed. The scope of the code and code cases needs to be expanded to include the materials with allowable temperatures of 950 .deg. C and higher. The selection of compact heat exchangers technology depends on the operating conditions such as pressure, flow rates, temperature, but also on other parameters such as fouling, corrosion, compactness, weight, maintenance and reliability. Welding, brazing, and diffusion bonding are considered proper joining processes for the heat exchanger operating in the high temperature and high pressure conditions without leakage. Because VHTRs require high temperature operations, various controlled materials, thick vessels, dissimilar metal joints, and precise controls of microstructure in weldment, the more advanced joining processes are needed than PWRs. The improved solid joining techniques are considered for the IHX fabrication. The weldability for Alloy 617 and Haynes 230 using GTAW and SMAW processes was investigated by CEA.
Design and Fabrication Technique of the Key Components for Very High Temperature Reactor
International Nuclear Information System (INIS)
Lee, Ho Jin; Song, Ki Nam; Kim, Yong Wan
2006-12-01
The gas outlet temperature of Very High Temperature Reactor (VHTR) may be beyond the capability of conventional metallic materials. The requirement of the gas outlet temperature of 950 .deg. C will result in operating temperatures for metallic core components that will approach very high temperature on some cases. The materials that are capable of withstanding this temperature should be prepared, or nonmetallic materials will be required for limited components. The Ni-base alloys such as Alloy 617, Hastelloy X, XR, Incoloy 800H, and Haynes 230 are being investigated to apply them on components operated in high temperature. Currently available national and international codes and procedures are needed reviewed to design the components for HTGR/VHTR. Seven codes and procedures, including five ASME Codes and Code cases, one French code (RCC-MR), and on British Procedure (R5) were reviewed. The scope of the code and code cases needs to be expanded to include the materials with allowable temperatures of 950 .deg. C and higher. The selection of compact heat exchangers technology depends on the operating conditions such as pressure, flow rates, temperature, but also on other parameters such as fouling, corrosion, compactness, weight, maintenance and reliability. Welding, brazing, and diffusion bonding are considered proper joining processes for the heat exchanger operating in the high temperature and high pressure conditions without leakage. Because VHTRs require high temperature operations, various controlled materials, thick vessels, dissimilar metal joints, and precise controls of microstructure in weldment, the more advanced joining processes are needed than PWRs. The improved solid joining techniques are considered for the IHX fabrication. The weldability for Alloy 617 and Haynes 230 using GTAW and SMAW processes was investigated by CEA
African Journals Online (AJOL)
Dr Obe
from considering the flux due to a single stator conductor carrying current. 1. INTRODUCTION. A feature of the analysis of segmental rotor reluctance machines is the necessity to determine the magnetic potential as zero, because the rotor, unlike that of the segmental machine is one integral piece. The magnetic potential ...
Marttinen, Aino M; Ruas-Madiedo, Patricia; Hidalgo-Cantabrana, Claudio; Saari, Markku A; Ihalin, Riikka A; Söderling, Eva M
2012-09-01
We studied the effects of xylitol on biofilms containing xylitol-resistant (Xr) and xylitol-sensitive (Xs) Streptococcus mutans, Actinomyces naeslundii and S. sanguinis. The biofilms were grown for 8 and 24 h on hydroxyapatite discs. The viable microorganisms were determined by plate culturing techniques and fluorescence in situ hybridization (FISH) was performed using a S. mutans-specific probe. Extracellular cell-bound polysaccharides (EPS) were determined by spectrofluorometry from single-species S. mutans biofilms. In the presence of 5 % xylitol, the counts of the Xs S. mutans decreased tenfold in the young (8 h) biofilm (p Xr strains, and FISH confirmed these results. No differences were detected in the EPS production of the Xs S. mutans grown with or without xylitol, nor between Xr and Xs S. mutans strains. Thus, it seems that xylitol did not affect the EPS synthesis of the S. mutans strains. Since the Xr S. mutans strains, not inhibited by xylitol, showed no xylitol-induced decrease in the biofilms, we conclude that growth inhibition could be responsible for the decrease of the counts of the Xs S. mutans strains in the clinically relevant young biofilms.
A randomized, double-blind, placebo-controlled trial of antidepressants in Parkinson disease
McDermott, M.P.; Kurlan, R.; Lyness, J.M.; Como, P.G.; Pearson, N.; Factor, S.A.; Juncos, J.; Serrano Ramos, C.; Brodsky, M.; Manning, C.; Marsh, L.; Shulman, L.; Fernandez, H.H.; Black, K.J.; Panisset, M.; Christine, C.W.; Jiang, W.; Singer, C.; Horn, S.; Pfeiffer, R.; Rottenberg, D.; Slevin, J.; Elmer, L.; Press, D.; Hyson, H.C.; McDonald, W.; Richard, Irene; McDonald, William; McDermott, Michael; Como, Peter G.; Kurlan, Roger; Lyness, Jeffrey M.; Pearson, Nancy; Sommerfeld, Barbara; Deeley, Cheryl; de la Torre, Tania; Barnard, Michele; Wilson, April; Lincoln, Maryann; Damgaard, Paula; Gerstenhaber, Melissa; Dustin, Kelly; Zappala, Nancy; Swartz, Camille; Creech, Mary; Shipley, Elda; Blankenship, Samantha; Beland, Monica; Roth, Jessie; Burnette, Heather; Foxworth, Tamara; Quesada, Monica; Lloyd, Mary; Pfeiffer, Brenda; Hansen, Joy; Folie, Joy; Wagner, Renee; Spears, Julia; Taylor, Colleen; Brown, Rachel; Iguchi, Lisa; Lim, Chen; LaDonna, Kori; Megens, Julie; Menza, Matthew; Cummings, Jeffrey; Hamer, Robert; Shannon, Kathleen; Odenkirchen, Joanne; Conwit, Robin; Beck, Christopher; LaDonna, Donna; Bausch, Jan; Kim, Scott; Chismar, Ron; Quinn, Sinead; Bean, Steve; Daigneault, Susan; Lindsay, Patricia; Ross, Tori; Kompoliti, Katie
2012-01-01
Objective: To evaluate the efficacy and safety of a selective serotonin reuptake inhibitor (SSRI) and a serotonin and norepinephrine reuptake inhibitor (SNRI) in the treatment of depression in Parkinson disease (PD). Methods: A total of 115 subjects with PD were enrolled at 20 sites. Subjects were randomized to receive an SSRI (paroxetine; n = 42), an SNRI (venlafaxine extended release [XR]; n = 34), or placebo (n = 39). Subjects met DSM-IV criteria for a depressive disorder, or operationally defined subsyndromal depression, and scored >12 on the first 17 items of the Hamilton Rating Scale for Depression (HAM-D). Subjects were followed for 12 weeks (6-week dosage adjustment, 6-week maintenance). Maximum daily dosages were 40 mg for paroxetine and 225 mg for venlafaxine XR. The primary outcome measure was change in the HAM-D score from baseline to week 12. Results: Treatment effects (relative to placebo), expressed as mean 12-week reductions in HAM-D score, were 6.2 points (97.5% confidence interval [CI] 2.2 to 10.3, p = 0.0007) in the paroxetine group and 4.2 points (97.5% CI 0.1 to 8.4, p = 0.02) in the venlafaxine XR group. No treatment effects were seen on motor function. Conclusions: Both paroxetine and venlafaxine XR significantly improved depression in subjects with PD. Both medications were generally safe and well tolerated and did not worsen motor function. Classification of Evidence: This study provides Class I evidence that paroxetine and venlafaxine XR are effective in treating depression in patients with PD. PMID:22496199
Directory of Open Access Journals (Sweden)
Hahn-Hägerdal Bärbel
2007-02-01
Full Text Available Abstract Background Two heterologous pathways have been used to construct recombinant xylose-fermenting Saccharomyces cerevisiae strains: i the xylose reductase (XR and xylitol dehydrogenase (XDH pathway and ii the xylose isomerase (XI pathway. In the present study, the Pichia stipitis XR-XDH pathway and the Piromyces XI pathway were compared in an isogenic strain background, using a laboratory host strain with genetic modifications known to improve xylose fermentation (overexpressed xylulokinase, overexpressed non-oxidative pentose phosphate pathway and deletion of the aldose reductase gene GRE3. The two isogenic strains and the industrial xylose-fermenting strain TMB 3400 were studied regarding their xylose fermentation capacity in defined mineral medium and in undetoxified lignocellulosic hydrolysate. Results In defined mineral medium, the xylose consumption rate, the specific ethanol productivity, and the final ethanol concentration were significantly higher in the XR- and XDH-carrying strain, whereas the highest ethanol yield was achieved with the strain carrying XI. While the laboratory strains only fermented a minor fraction of glucose in the undetoxified lignocellulose hydrolysate, the industrial strain TMB 3400 fermented nearly all the sugar available. Xylitol was formed by the XR-XDH-carrying strains only in mineral medium, whereas in lignocellulose hydrolysate no xylitol formation was detected. Conclusion Despite by-product formation, the XR-XDH xylose utilization pathway resulted in faster ethanol production than using the best presently reported XI pathway in the strain background investigated. The need for robust industrial yeast strains for fermentation of undetoxified spruce hydrolysates was also confirmed.
Directory of Open Access Journals (Sweden)
Levy Juliana
2010-03-01
Full Text Available Abstract Aims To determine prospectively the efficacy, tolerability and patient satisfaction of an extended release formulation of metformin (metformin XR in hospital based outpatients with type 2 diabetes mellitus currently treated with standard metformin. Methods Patients on immediate release standard metformin either alone or combined with other oral agents were switched to extended release metformin XR 500 mg tablets and titrated to a maximum dose of 2000 mg/day Measurements to include glucose and lipid control, blood pressure, body weight, waist circumference, C-reactive protein, adverse events and patient satisfaction were recorded at baseline, three and six months. Results Complete data were obtained for 35 of the 61 patients enrolled to the study. At three and six months no changes were reported for any of the cardiovascular risk factors except for lipids where there was a modest rise in plasma triglycerides. These effects were achieved with a reduced dose of metformin XR compared to pre-study dosing with standard metformin (1500 mg +/- 402 vs 1861 +/- 711 p = 0.004. A total of 77% of patients were free of gastrointestinal side effects and 83% of patients stated a preference for metformin XR at the end of the study. Ghost tablets were reported in the faeces by the majority of the patients (54.1%. Conclusions Patients switched to extended release metformin XR derived the same clinical and metabolic benefits as for standard metformin but with reduced dosage, fewer gastrointestinal side effects and a greater sense of well being and satisfaction on medication.
Effect of a helium environment on the mechanical properties of HTGR primary system metals
International Nuclear Information System (INIS)
Chow, J.G.Y.; Soo, P.; Sabatini, R.L.
1978-01-01
Creep and high cycle fatigue tests have been carried out on Incoloy 800H and Hastelloy X in a helium environment containing 40 μ atm of H 2 O, 200 μ atm H 2 , 40 μ atm CO, 20 μ atm CH 4 and 10 μ atm CO 2 . The creep behavior of Incoloy 800H does not appear to show significant differences from that measured in air. However, the Hastelloy X at the maximum test temperature studied (871 0 C, 1600 0 F) shows behavior which is inferior. With respect to high cycle fatigue, the Incoloy 800H is weaker in the helium environment at a test temperature of 649 0 C (1200 0 F). At 760 0 C (1400 0 F) the strength in helium is higher but there is a tendency to lose strength more rapidly than for the air tests as the test time increases. Hastelloy X tested at 871 0 C (1600 0 F) also shows higher strength in helium for short test times but for extended tests the strengths in air and helium become similar. Scanning electron microprobe analyses have been carried out to correlate the strength measurements with surface oxidation characteristics and internal structural changes
International Nuclear Information System (INIS)
Smailos, E.; Schwarzkopf, W.; Koester, R.
1986-01-01
In 1983-84 extensive laboratory-scale experiments (immersion tests) to evaluate the long-term corrosion behaviour of selected materials in salt brines and first in situ experiments were performed. In the laboratory experiments the materials Ti 99.8-Pd, Hastelloy C4 and hot-rolled low carbon steel (reference materials in the joint European corrosion programme) as well as cast steel, spheoroidal cast iron, Si-cast iron and the Ni-Resists type D2 and D4 were investigated. The investigated parameters were: temperature (90 0 C; 170 0 C, 200 0 C), gamma-radiation (10 5 rad/h) and different compositions of salt brines. The results obtained show that, in addition to Ti 99.8-Pd, also Hastelloy C4 and unalloyed steels are in principle suitable for being used for long-term stable HLW-containers if the gamma dose rate is reduced by suitable shielding. Furthermore, the susceptibility of Hastelloy C4 to crevice corrosion must be taken into account. Further studies will be necessary to provide final evidence of the suitability of the materials examined. These will mainly involve clarification of questions related to hydrogen embrittlement (Ti 99.8-Pd, unalloyed steels) and to the influence of pressure and saline impurities (e.g. antiJ, antiBr) on corrosion
International Nuclear Information System (INIS)
Solves-Llorens, J. A.; Rupérez, M. J.; Monserrat, C.; Feliu, E.; García, M.; Lloret, M.
2014-01-01
Purpose: This work presents a complete and automatic software application to aid radiologists in breast cancer diagnosis. The application is a fully automated method that performs a complete registration of magnetic resonance (MR) images and x-ray (XR) images in both directions (from MR to XR and from XR to MR) and for both x-ray mammograms, craniocaudal (CC), and mediolateral oblique (MLO). This new approximation allows radiologists to mark points in the MR images and, without any manual intervention, it provides their corresponding points in both types of XR mammograms and vice versa. Methods: The application automatically segments magnetic resonance images and x-ray images using the C-Means method and the Otsu method, respectively. It compresses the magnetic resonance images in both directions, CC and MLO, using a biomechanical model of the breast that distinguishes the specific biomechanical behavior of each one of its three tissues (skin, fat, and glandular tissue) separately. It makes a projection of both compressions and registers them with the original XR images using affine transformations and nonrigid registration methods. Results: The application has been validated by two expert radiologists. This was carried out through a quantitative validation on 14 data sets in which the Euclidean distance between points marked by the radiologists and the corresponding points obtained by the application were measured. The results showed a mean error of 4.2 ± 1.9 mm for the MRI to CC registration, 4.8 ± 1.3 mm for the MRI to MLO registration, and 4.1 ± 1.3 mm for the CC and MLO to MRI registration. Conclusions: A complete software application that automatically registers XR and MR images of the breast has been implemented. The application permits radiologists to estimate the position of a lesion that is suspected of being a tumor in an imaging modality based on its position in another different modality with a clinically acceptable error. The results show that the
Energy Technology Data Exchange (ETDEWEB)
Solves-Llorens, J. A.; Rupérez, M. J., E-mail: mjruperez@labhuman.i3bh.es; Monserrat, C. [LabHuman, Universitat Politècnica de València, Camino de Vera s/n, 46022 Valencia (Spain); Feliu, E.; García, M. [Hospital Clínica Benidorm, Avda. Alfonso Puchades, 8, 03501 Benidorm (Alicante) (Spain); Lloret, M. [Hospital Universitari y Politècnic La Fe, Bulevar Sur, 46026 Valencia (Spain)
2014-08-15
Purpose: This work presents a complete and automatic software application to aid radiologists in breast cancer diagnosis. The application is a fully automated method that performs a complete registration of magnetic resonance (MR) images and x-ray (XR) images in both directions (from MR to XR and from XR to MR) and for both x-ray mammograms, craniocaudal (CC), and mediolateral oblique (MLO). This new approximation allows radiologists to mark points in the MR images and, without any manual intervention, it provides their corresponding points in both types of XR mammograms and vice versa. Methods: The application automatically segments magnetic resonance images and x-ray images using the C-Means method and the Otsu method, respectively. It compresses the magnetic resonance images in both directions, CC and MLO, using a biomechanical model of the breast that distinguishes the specific biomechanical behavior of each one of its three tissues (skin, fat, and glandular tissue) separately. It makes a projection of both compressions and registers them with the original XR images using affine transformations and nonrigid registration methods. Results: The application has been validated by two expert radiologists. This was carried out through a quantitative validation on 14 data sets in which the Euclidean distance between points marked by the radiologists and the corresponding points obtained by the application were measured. The results showed a mean error of 4.2 ± 1.9 mm for the MRI to CC registration, 4.8 ± 1.3 mm for the MRI to MLO registration, and 4.1 ± 1.3 mm for the CC and MLO to MRI registration. Conclusions: A complete software application that automatically registers XR and MR images of the breast has been implemented. The application permits radiologists to estimate the position of a lesion that is suspected of being a tumor in an imaging modality based on its position in another different modality with a clinically acceptable error. The results show that the
Development of Textured Buffer Layer on Metal Tapes for Oxide Superconductors
National Research Council Canada - National Science Library
Bhattacharya, Rabi
2002-01-01
.... UES, in collaboration with Argonne National Laboratory, has developed a multilayer architecture based on in-plane textured MgO film by inclined substrate deposition technique oristatic and moving Hastelloy substrates...
International Nuclear Information System (INIS)
Torelli, S.R.; Rahal, R.S.; Volpi, R.S.; Yamashita, S.; Mamprim, M.J.; Crocci, A.J.
2004-01-01
In the present experimental study we assessed induced osteoarthritis data in rabbits, compared three diagnostic methods, i.e., radiography (XR), computed tomography (CT) and magnetic resonance imaging (MRI), and correlated the imaging findings with those obtained by macroscopic evaluation. Ten young female rabbits of the Norfolk breed were used. Seven rabbits had the right knee immobilized in extension for a period of 12 weeks (immobilized group), and three others did not have a limb immobilized and were maintained under the same conditions (control group). Alterations observed by XR, CT and MRI after the period of immobilization were osteophytes, osteochondral lesions, increase and decrease of joint space, all of them present both in the immobilized and non-immobilized contralateral limbs. However, a significantly higher score was obtained for the immobilized limbs (XT: P = 0.016, CT: P 0.031, MRI: P = 0.0156). All imaging methods were able to detect osteoarthritis changes after the 12 weeks of immobilization. Macroscopic evaluation identified increased thickening of joint capsule, proliferative and connective tissue in the femoropatellar joint, and irregularities of articular cartilage, especially in immobilized knees. The differences among XR, CT and MRI were not statistically significant for the immobilized knees. However, MRI using a 0.5 Tesla scanner was statistically different from CT and XR for the non-immobilized contralateral knees. We conclude that the three methods detected osteoarthritis lesions in rabbit knees, but MRI was less sensitive than XR and CT in detecting lesions compatible with initial osteoarthritis. Since none of the techniques revealed all the lesions, it is important to use all methods to establish an accurate diagnosis. (author)
Degradation modes of nickel-base alternate waste package overpack materials
International Nuclear Information System (INIS)
Pitman, S.G.
1988-07-01
The suitability of Ti Grade 12 for waste package overpacks has been questioned because of its observed susceptibility to crevice corrosion and hydrogen-assisted crack growth. For this reason, materials have been selected for evaluation as alternatives to Ti Grade 12 for use as waste package overpacks. These alternative materials, which are based on the nickel-chromium-molybdenum (Ni-Cr-Mo) alloy system, are Inconel 625, Hastelloy C-276, and Hastelloy C-22. The degradation modes of the Ni-base alternate materials have been examined at Pacific Northwest Laboratory to determine the suitability of these materials for waste package overpack applications in a salt repository. Degradation modes investigated included general corrosion, crevice corrosion, pitting, stress-corrosion cracking, and hydrogen embrittlement
Automated identification of retained surgical items in radiological images
Agam, Gady; Gan, Lin; Moric, Mario; Gluncic, Vicko
2015-03-01
Retained surgical items (RSIs) in patients is a major operating room (OR) patient safety concern. An RSI is any surgical tool, sponge, needle or other item inadvertently left in a patients body during the course of surgery. If left undetected, RSIs may lead to serious negative health consequences such as sepsis, internal bleeding, and even death. To help physicians efficiently and effectively detect RSIs, we are developing computer-aided detection (CADe) software for X-ray (XR) image analysis, utilizing large amounts of currently available image data to produce a clinically effective RSI detection system. Physician analysis of XRs for the purpose of RSI detection is a relatively lengthy process that may take up to 45 minutes to complete. It is also error prone due to the relatively low acuity of the human eye for RSIs in XR images. The system we are developing is based on computer vision and machine learning algorithms. We address the problem of low incidence by proposing synthesis algorithms. The CADe software we are developing may be integrated into a picture archiving and communication system (PACS), be implemented as a stand-alone software application, or be integrated into portable XR machine software through application programming interfaces. Preliminary experimental results on actual XR images demonstrate the effectiveness of the proposed approach.
Role of extended release quetiapine in the management of bipolar disorders
Directory of Open Access Journals (Sweden)
Rayan K Al Jurdi
2010-02-01
Full Text Available Rayan K Al Jurdi1,2, Lena A Dixit1, Martha Sajatovic3 1Baylor College of Medicine, Department of Psychiatry, Houston, Texas, USA; 2South Central Mental Illness Research and Clinical Core, Department of Veterans Affairs, Houston, Texas; 3Department of Psychiatry, Case Western Reserve University School of Medicine, Cleveland, Ohio, USAAbstract: Atypical antipsychotics have become a widely utilized component of the bipolar disorder treatment armamentarium, with approximately 45% of bipolar patients prescribed atypicals. Over the last decade all atypical drugs except for clozapine have received a Food and Drug Administration (FDA bipolar indication. In October 2008, the FDA approved quetiapine XR monotherapy for the treatment of acute depressive episodes of bipolar disorder and acute manic or mixed episodes in bipolar I disorder based on two placebo-control trials. Quetiapine was also approved as adjunct therapy with lithium and divalproex for the treatment of acute manic or mixed episodes as well as maintenance of bipolar I disorder. In contrast to immediate release quetiapine which may require a twice-daily regimen, the XR formulation is intended for once-daily administration. This drug profile of quetiapine XR will address chemistry, pharmacodynamics, pharmacokinetics, metabolism, safety and tolerability and clinical trials in bipolar disorder.Keywords: quetiapine XR, bipolar disorder
Nanostructure analysis of polymer assembly on water surface by X-ray reflectometry
International Nuclear Information System (INIS)
Yamaoka, H.; Matsuoka, H.; Kago, K.; Yoshitome, R.; Mouri, E.
2000-01-01
X-ray reflectivity (XR) is an extremely powerful technique to study the fine structure of surface and interface in the order of angstrom. In this study, we have performed systematic XR measurements for monolayers on water surface. The nanostructures of various monolayers were precisely determined, and their changes by surface pressure and photoisomerization were clearly detected. The structure of lipid monolayer and DNA complex at air-water interface was also evaluated. (author)
Wu, Eric Q; Birnbaum, Howard G; Zhang, Huabin F; Ivanova, Jasmina I; Yang, Elaine; Mallet, David
2007-09-01
Many therapies exist for treating adult attention-deficit/hyperactivity disorder (ADHD), also referred to as attention-deficit disorder (ADD), but there is no research regarding cost differences associated with initiating alternative ADD/ADHD drug therapies in adults. To compare from the perspective of a large self-insured employer the risk-adjusted direct health care costs associated with 3 alternative drug therapies for ADD in newly treated patients: extended-release methylphenidate (osmotic release oral system-MPH), mixed amphetamine salts extended release (MAS-XR), or atomoxetine. We analyzed data from a US claims database of 5 million beneficiaries from 31 large self-insured employers (1999-2004). Analysis was restricted to adults aged 18 to 64 years with at least 1 diagnosis of ADD/ADHD (International Classification of Diseases, Ninth Revision, Clinical Modification [ICD-9-CM] codes 314.0x--attention deficit disorder; 314.00--attention deficit disorder without hyperactivity; or 314.01--attention-deficit disorder with hyperactivity) and at least 1 pharmacy claim for OROS-MPH, MAS-XR, or atomoxetine identified using National Drug Codes. In preliminary analysis, we calculated the duration of index ADHD drug therapy as time from index therapy initiation to a minimum 60-day gap. Because the median duration of index ADHD drug therapy was found to be approximately 90 days, the primary measures were total direct medical plus drug costs and medical-only costs computed over 6 months following therapy initiation. Adults were required to have continuous eligibility 6 months before and 6 months after their latest drug therapy initiation and no ADHD therapy during the previous 6 months. Cost was measured as the payment amount made by the health plan to the provider rather than billed charges, and it excluded patient copayments and deductibles. Medical costs included costs incurred for all-cause inpatient and outpatient/other services. Costs were adjusted for inflation to
Properties of super alloys for high temperature gas cooled reactor
International Nuclear Information System (INIS)
Izaki, Takashi; Nakai, Yasuo; Shimizu, Shigeki; Murakami, Takashi
1975-01-01
The existing data on the properties at high temperature in helium gas of iron base super alloys. Incoloy-800, -802 and -807, nickel base super alloys, Hastelloy-X, Inconel-600, -617 and -625, and a casting alloy HK-40 were collectively evaluated from the viewpoint of the selection of material for HTGRs. These properties include corrosion resistance, strength and toughness, weldability, tube making, formability, radioactivation, etc. Creep strength was specially studied, taking into consideration the data on the creep characteristics in the actual helium gas atmosphere. The necessity of further long run creep data is suggested. Hastelloy-X has completely stable corrosion resistance at high temperature in helium gas. Incoloy 800 and 807 and Inconel 617 are not preferable in view of corrosion resistance. The creep strength of Inconel 617 extraporated to 1,000 deg C for 100,000 hours in air was the greatest rupture strength of 0.6 kg/mm 2 in all above alloys. However, its strength in helium gas began to fall during a relatively short time, so that its creep strength must be re-evaluated in the use for long time. The radioactivation and separation of oxide film in primary construction materials came into question, Inconel 617 and Incoloy 807 showed high induced radioactivity intensity. Generally speaking, in case of nickel base alloys such as Hastelloy-X, oxide film is difficult to break away. (Iwakiri, K.)
Wagner, Katja; Gröger, Michael; McCook, Oscar; Scheuerle, Angelika; Asfar, Pierre; Stahl, Bettina; Huber-Lang, Markus; Ignatius, Anita; Jung, Birgit; Duechs, Matthias; Möller, Peter; Georgieff, Michael; Calzia, Enrico; Radermacher, Peter; Wagner, Florian
2015-01-01
Cigarette smoking (CS) aggravates post-traumatic acute lung injury and increases ventilator-induced lung injury due to more severe tissue inflammation and apoptosis. Hyper-inflammation after chest trauma is due to the physical damage, the drop in alveolar PO2, and the consecutive hypoxemia and tissue hypoxia. Therefore, we tested the hypotheses that 1) CS exposure prior to blunt chest trauma causes more severe post-traumatic inflammation and thereby aggravates lung injury, and that 2) hyperoxia may attenuate this effect. Immediately after blast wave-induced blunt chest trauma, mice (n=32) with or without 3-4 weeks of CS exposure underwent 4 hours of pressure-controlled, thoraco-pulmonary compliance-titrated, lung-protective mechanical ventilation with air or 100% O2. Hemodynamics, lung mechanics, gas exchange, and acid-base status were measured together with blood and tissue cytokine and chemokine concentrations, heme oxygenase-1 (HO-1), activated caspase-3, and hypoxia-inducible factor 1-α (HIF-1α) expression, nuclear factor-κB (NF-κB) activation, nitrotyrosine formation, purinergic receptor 2X4 (P2XR4) and 2X7 (P2XR7) expression, and histological scoring. CS exposure prior to chest trauma lead to higher pulmonary compliance and lower PaO2 and Horovitz-index, associated with increased tissue IL-18 and blood MCP-1 concentrations, a 2-4-fold higher inflammatory cell infiltration, and more pronounced alveolar membrane thickening. This effect coincided with increased activated caspase-3, nitrotyrosine, P2XR4, and P2XR7 expression, NF-κB activation, and reduced HIF-1α expression. Hyperoxia did not further affect lung mechanics, gas exchange, pulmonary and systemic cytokine and chemokine concentrations, or histological scoring, except for some patchy alveolar edema in CS exposed mice. However, hyperoxia attenuated tissue HIF-1α, nitrotyrosine, P2XR7, and P2XR4 expression, while it increased HO-1 formation in CS exposed mice. Overall, CS exposure aggravated post
Murphy, Sean M; Polsky, Daniel; Lee, Joshua D; Friedmann, Peter D; Kinlock, Timothy W; Nunes, Edward V; Bonnie, Richard J; Gordon, Michael; Chen, Donna T; Boney, Tamara Y; O'Brien, Charles P
2017-08-01
Criminal justice-involved individuals are highly susceptible to opioid relapse and overdose-related deaths. In a recent randomized trial, we demonstrated the effectiveness of extended-release naltrexone (XR-NTX; Vivitrol ® ) in preventing opioid relapse among criminal justice-involved US adults with a history of opioid use disorder. The cost of XR-NTX may be a significant barrier to adoption. Thus, it is important to account for improved quality of life and downstream cost-offsets. Our aims were to (1) estimate the incremental cost per quality-adjusted life-year (QALY) gained for XR-NTX versus treatment as usual (TAU) and evaluate it relative to generally accepted value thresholds; and (2) estimate the incremental cost per additional year of opioid abstinence. Economic evaluation of the aforementioned trial from the taxpayer perspective. Participants were randomized to 25 weeks of XR-NTX injections or TAU; follow-up occurred at 52 and 78 weeks. Five study sites in the US Northeast corridor. A total of 308 participants were randomized to XR-NTX (n = 153) or TAU (n = 155). Incremental costs relative to incremental economic and clinical effectiveness measures, QALYs and abstinent years, respectively. The 25-week cost per QALY and abstinent-year figures were $162 150 and $46 329, respectively. The 78-week figures were $76 400/QALY and $16 371/abstinent year. At 25 weeks, we can be 10% certain that XR-NTX is cost-effective at a value threshold of $100 000/QALY and 62% certain at $200 000/QALY. At 78 weeks, the cost-effectiveness probabilities are 59% at $100 000/QALY and 76% at $200 000/QALY. We can be 95% confident that the intervention would be considered 'good value' at $90 000/abstinent year at 25 weeks and $500/abstinent year at 78 weeks. While extended-release naltrexone appears to be effective in increasing both quality-adjusted life-years (QALYs) and abstinence, it does not appear to be cost-effective using generally accepted value
Pumping of drugs by P-glycoprotein
DEFF Research Database (Denmark)
Litman, Thomas; Skovsgaard, Torben; Stein, Wilfred D
2003-01-01
The apparent inhibition constant, Kapp, for the blockade of P-glycoprotein (P-gp) by four drugs, verapamil, cyclosporin A, XR9576 (tariquidar), and vinblastine, was measured by studying their ability to inhibit daunorubicin and calcein-AM efflux from four strains of Ehrlich cells with different...... levels of drug resistance and P-gp content. For daunorubicin as a transport substrate, Kapp was independent of [P-gp] for verapamil but increased strictly linearly with [P-gp] for vinblastine, cyclosporin A, and XR9576. A theoretical analysis of the kinetics of drug pumping and its reversal shows...... but rather, in serial, i.e., a drug that is pumped from the cytoplasmic phase has to pass the preemptive route upon leaving the cell. Our results are consistent with the Sauna-Ambudkar two-step model for pumping by P-gp. We suggest that the vinblastine/cyclosporin A/XR9576-binding site accepts daunorubicin...
Smooth muscle antibodies and type 1 autoimmune hepatitis.
Muratori, Paolo; Muratori, Luigi; Agostinelli, Daniela; Pappas, Georgios; Veronesi, Lorenza; Granito, Alessandro; Cassani, Fabio; Terlizzi, Paolo; Lenzi, Marco; Bianchi, Francesco B
2002-12-01
Smooth muscle antibodies (SMA) characterize type 1 autoimmune hepatitis. Our aim was to evaluate sensitivity and specificity of different immunofluorescence substrates for the detection of SMA. Sera from 55 patients with type 1 AIH 20 with primary biliary cirrhosis, 20 with HCV-related chronic hepatitis and 25 blood donors were studied for SMA and anti-microfilaments reactivity by immunofluorescence on rat tissue sections, cultured fibroblasts and commercially available HEp-2 cells (collectively revealing the so called anti-actin pattern), and for the XR1 system by counterimmunoelectrophoresis. SMA was classified on the basis of its immunofluorescence pattern (V--vessels, G--glomerular, T--tubular). As further control group, we studied 26 patients with a diagnosis other than AIH, selected on the basis of a SMA-non-T/XR1 positivity. In patients with AIH the SMA-T pattern on rodent tissue, and anti-MF on fibroblasts and on HEp-2 cells were present in 80, 82 and 80%, respectively. Five out of 11 SMA-non T positive AIH patients were anti-MF positive. None of the pathological and healthy controls was positive for SMA-T or anti-MF reactivity. XR1 system was present in 84% of AIH patients and in 5% of pathological controls (p = 0.01). Two out of 26 SMA-non-T/XR1 positive sera were positive for anti-MF by fibroblasts and HEp-2 cells. A significant correlation was found between SMA-T pattern and anti-MF reactivity; no correlation was found between XR1 system and SMA-T pattern or anti-MF reactivity. SMA-T pattern is highly sensitive and specific first diagnostic test for type 1 AIH; anti-MF can be used as additional tool for the diagnosis, particularly when, despite the absence of the SMA-T pattern, AIH is strongly suspected.
International Nuclear Information System (INIS)
Nakajima, Tetsuo; Yukawa, Osami; Tsuji, Hideo; Ohyama, Harumi; Wang, Bing; Tatsumi, Kouichi; Hayata, Isamu; Hama-Inaba, Hiroko
2006-01-01
Protein kinase Cδ (PKCδ) has an important role in radiation-induced apoptosis. The expression and function of PKCδ in radiation-induced apoptosis were assessed in a radiation-sensitive mouse thymic lymphoma cell line, 3SBH5, and its radioresistant variant, XR223. Rottlerin, a PKCδ-specific inhibitor, completely abolished radiation-induced apoptosis in 3SBH5. Radiation-induced PKCδ activation correlated with the degradation of PKCδ, indicating that PKCδ activation through degradation is involved in radiation-induced apoptosis in radiosensitive 3SBH5. In radioresistant XR223, radiation-induced PKCδ activation was lower than that in radiosensitive 3SBH5. Cytosol PKCδ levels in 3SBH5 decreased markedly after irradiation, while those in XR223 did not. There was no apparent change after irradiation in the membrane fractions of either cell type. In addition, basal cytosol PKCδ levels in XR223 were higher than those in 3SBH5. These results suggest that the radioresistance in XR223 to radiation-induced apoptosis is due to a difference in the regulation of radiation-induced PKCδ activation compared to that of 3SBH5. On the other hand, Atm -/- mouse thymic lymphoma cells were more radioresistant to radiation-induced apoptosis than wild-type mouse thymic lymphoma cells. Irradiated wild-type cells, but not Atm -/- cells, had decreased PKCδ levels, indicating that the Atm protein is involved in radiation-induced apoptosis through the induction of PKCδ degradation. The decreased Atm protein levels induced by treatment with Atm small interfering RNA had no effect on radiation-induced apoptosis in 3SBH5 cells. These results suggest that the regulation of radiation-induced PKCδ activation, which is distinct from the Atm-mediated cascade, determines radiation sensitivity in radiosensitive 3SBH5 cells
Examination of several pre-oxidation procedures and their effect as hydrogen permeation-barrier
International Nuclear Information System (INIS)
Heimes, E.
1986-03-01
Several pre-oxidation procedures have been tested with respect to their effect as a hydrogen permeation barrier at the high temperature alloys Hastelloy X and Inconel 617. By outside coating of Hastelloy X samples with alumina the determined impeding effects were very low. A surface aluminium enrichment by different procedures were accomplished before selective oxidation. The method of Aluminium-Hot-Dipping generated oxide layers with a four- to fivefold higher impeding effect compared to specimens fabricated by a standard procedure. With the aid of a metallographical follow-up examination it was shown that the higher impeding effects are due to an improved adhesion between the oxide layer and the high temperature material, whereby in the cooling period after manufacturing a smaller amount of oxide cracking is obtainable. (orig./PW) [de
International Nuclear Information System (INIS)
Mullins, Dana; Proulx, Denise; Saoudi, A.; Ng, Cheng E.
2005-01-01
Purpose: Topotecan (TPT), a camptothecin analog, is currently used to treat human ovarian and small-cell lung cancer and is in clinical trials for other tumor sites. However, it is unknown whether chronomodulation of TPT treatment is beneficial. We examined the effects of administering TPT or X-radiation (XR) alone at different times of the day or night. Methods: We treated mice bearing human colorectal tumor xenografts at four different times representing the early rest period (9 AM or 3 HALO [hours after light onset]), late rest period (3 PM or 9 HALO), early active period (9 PM or 15 HALO), and late active period (3 AM or 21 HALO) of the mice. We gave either TPT (12 mg/kg, injected i.p.) or XR (4 Gy, directed to the tumor) twice weekly on Days 0, 4, 7, 10 within 2 weeks. Results: Treatment with either TPT or XR at 3 AM demonstrated the greatest efficacy (measured by a tumor regrowth assay) without significantly increasing acute toxicity (assessed by a decrease in leukocyte counts or body weight). Conversely, treatment at 3 PM, in particular, showed increased toxicity without any enhanced efficacy. Conclusions: Our study provided the first evidence that chronomodulation of TPT treatments, consistent with the findings of other camptothecin analogs, is potentially clinically beneficial. Additionally, our findings suggest that chronomodulation of fractionated XR treatments is also potentially clinically beneficial
Mullins, Dana; Proulx, Denise; Saoudi, A; Ng, Cheng E
2005-05-01
Topotecan (TPT), a camptothecin analog, is currently used to treat human ovarian and small-cell lung cancer and is in clinical trials for other tumor sites. However, it is unknown whether chronomodulation of TPT treatment is beneficial. We examined the effects of administering TPT or X-radiation (XR) alone at different times of the day or night. We treated mice bearing human colorectal tumor xenografts at four different times representing the early rest period (9 am or 3 HALO [hours after light onset]), late rest period (3 pm or 9 HALO), early active period (9 pm or 15 HALO), and late active period (3 am or 21 HALO) of the mice. We gave either TPT (12 mg/kg, injected i.p.) or XR (4 Gy, directed to the tumor) twice weekly on Days 0, 4, 7, 10 within 2 weeks. Treatment with either TPT or XR at 3 am demonstrated the greatest efficacy (measured by a tumor regrowth assay) without significantly increasing acute toxicity (assessed by a decrease in leukocyte counts or body weight). Conversely, treatment at 3 pm, in particular, showed increased toxicity without any enhanced efficacy. Our study provided the first evidence that chronomodulation of TPT treatments, consistent with the findings of other camptothecin analogs, is potentially clinically beneficial. Additionally, our findings suggest that chronomodulation of fractionated XR treatments is also potentially clinically beneficial.
Current status of atypical antipsychotics for the treatment of fibromyalgia.
Rico-Villademoros, F; Calandre, E P; Slim, M
2014-06-01
The treatment of fibromyalgia requires pharmacological and nonpharmacological therapies. The pharmacological treatment of fibromyalgia is limited to a few drugs that have been demonstrated to be moderately effective in some but not all dimensions of the disease. Therefore, the search for new drugs to treat this condition is warranted. Atypical antipsychotics offered an attractive alternative because they had been shown to be active against several key symptoms of fibromyalgia. The results of open-label studies, however, appear to indicate that atypical antipsychotics are poorly tolerated in patients with fibromyalgia, and only quetiapine XR has been studied in randomized controlled trials. Quetiapine XR has demonstrated effectiveness in treating comorbid major depression, anxiety and sleep disturbance. However, in two randomized controlled trials, quetiapine XR was not differentiated from placebo and failed to demonstrate noninferiority to amitriptyline in terms of improving overall symptomatology. The effect of quetiapine XR on pain and its usefulness as part of a combination pharmacological regimen should be further evaluated. Overall, the use of quetiapine (initiated at a low dose and slowly titrated) in fibromyalgia should be limited to patients with comorbid major depression or patients who are currently receiving other treatments and have unresolved and disabling depressive and/or anxiety symptoms. Copyright 2014 Prous Science, S.A.U. or its licensors. All rights reserved.
Application of XR imaging in dentistry
International Nuclear Information System (INIS)
Trendafilova, N.; Gagova, P.
2015-01-01
Full text: For accurate and sure diagnosis in dentistry except anamnestic information (history taking) and clinical examination as an obligatory clinical examination must attend imaging investigation. For diagnosis of diseases of the teeth are used a number of imaging methods. The most widespread of them are segmental roentgenography, ortopamtomography Bitewing, as well as increasingly coming in use dental cone-beam computed tomography (3D CBCT). The aim is to introduce the types of radiographs and their benefits for prompt and proper treatment. Documentary method - a review and analysis of literature and Internet sources are made. Results and comments: Segmented radiography gives us information about the state of the tooth as a whole. Using this method gives an opportunity to visualize the crown, the neck and the root of the tooth. Ortopantomography gives a general view of the state of the maxilla and mandibula, the teeth, part of the maxillary sinuses and temporomandibular joints. Some or extra teeth, are discovered as well as dental disease conditions, bone abnormalities, cysts and others. Bitewing is used when caries is strongly suspected, though not visually, in cases of bone loss and others. The advantage of early and accurate diagnosis is to reduce future complications. Conclusion: good prevention and early detection of dental anomalies and pathologies is performed with the help of X-ray. The selection of the correct method for imaging, the proper use of X-ray machines and placing the required security means reducing the amount of radiation exposure to the patient
International Nuclear Information System (INIS)
Tilborg, P.J. van; Linde, A. van der
1969-10-01
Sheet samples of Inconel-625, Hastelloy-X280 and Incoloy-800 were tested, in the solution annealed and in the solution annealed + 20% cold worked + 800°C tempered condition, in steam with a velocity of 5 m/sec. at 550, 650 and 750°C and in steam with a volocity of 15 and 85 m/sec. at 550°C. At 550°C and 750°C the samples were tested in the heat treated, annealed or tempered and the heat treated + electropolished condition. At 650°C moreover as heat treated + ground and pickled samples were tested. Post-corrosion sample investigations involved measurement of the adherent oxide thickness, the total amount of corroded metal, the metal loss to system, and the metallographic and microprobe investigation of the adherent oxide film and adjacent diffusion disturbed alloy layer. The results obtained up to 6000 hours exposure time showed that the surface treatment has a decisive influence on the corrosion behaviour of all three alloys tested. The differences in the corrosion data for the two heat treatment conditions are small. The influence of the steam velocity, as tested at 550°C, on the initial corrosion rate was surprisingly high, while the long-term linear corrosion rates are only slightly influenced by the gas velocity. In general the linear corrosion rates were low, 1-5 mg/dm 2 month, and not consistently affected by the test-temperature. The metal loss to system values were 2 <15 mg/dm 2 in the low velocity steam at all three test temperatures and <30 mg/dm 2 in the high velocity steam at 550°C. The metallographic and microprobe examinations revealed no remarkable results, as compared with the results of analogous tests reported in literature. (author)
Combined mutagenesis of Rhodosporidium toruloides for improved production of carotenoids and lipids.
Zhang, Chaolei; Shen, Hongwei; Zhang, Xibin; Yu, Xue; Wang, Han; Xiao, Shan; Wang, Jihui; Zhao, Zongbao K
2016-10-01
To improve production of lipids and carotenoids by the oleaginous yeast Rhodosporidium toruloides by screening mutant strains. Upon physical mutagenesis of the haploid strain R. toruloides np11 with an atmospheric and room temperature plasma method followed by chemical mutagenesis with nitrosoguanidine, a mutant strain, R. toruloides XR-2, formed dark-red colonies on a screening plate. When cultivated in nitrogen-limited media, XR-2 cells grew slower but accumulated 0.23 g lipids/g cell dry wt and 0.75 mg carotenoids/g CDW. To improve its production capacity, different amino acids and vitamins were supplemented. p-Aminobenzoic acid and tryptophan had beneficial effects on cell growth. When cultivated in nitrogen-limited media in the presence of selected vitamins, XR-2 accumulated 0.41 g lipids/g CDW and 0.69 mg carotenoids/g CDW. A mutant R. toruloides strain with improved production profiles for lipids and carotenoids was obtained, indicating its potential to use combined mutagenesis for a more productive phenotype.
Model‐Informed Development and Registration of a Once‐Daily Regimen of Extended‐Release Tofacitinib
Lamba, M; Hutmacher, MM; Furst, DE; Dikranian, A; Dowty, ME; Conrado, D; Stock, T; Nduaka, C; Cook, J
2017-01-01
Extended‐release (XR) formulations enable less frequent dosing vs. conventional (e.g., immediate release (IR)) formulations. Regulatory registration of such formulations typically requires pharmacokinetic (PK) and clinical efficacy data. Here we illustrate a model‐informed, exposure–response (E‐R) approach to translate controlled trial data from one formulation to another without a phase III trial, using a tofacitinib case study. Tofacitinib is an oral Janus kinase (JAK) inhibitor for the treatment of rheumatoid arthritis (RA). E‐R analyses were conducted using validated clinical endpoints from phase II dose–response and nonclinical dose fractionation studies of the IR formulation. Consistent with the delay in clinical response dynamics relative to PK, average concentration was established as the relevant PK parameter for tofacitinib efficacy and supported pharmacodynamic similarity. These evaluations, alongside demonstrated equivalence in total systemic exposure between IR and XR formulations, provided the basis for the regulatory approval of tofacitinib XR once daily by the US Food and Drug Administration. PMID:27859030
International Nuclear Information System (INIS)
Sugano, M; Yoshida, Y; Hojo, M; Shikimachi, K; Hirano, N; Nagaya, S
2008-01-01
Tensile fatigue tests were carried out at 77 K for YBCO-coated conductors fabricated by metal-organic chemical vapor deposition (MOCVD). The S-N relationship, variation of critical current (I c ) during cyclic loading and microscopic fatigue damage were investigated. Fatigue strength at 10 6 cycles was evaluated to be σ max = 1300 MPa and 890 MPa under the stress ratios of 0.5 and 0.1. Two different mechanisms of fatigue damage, depending on the number of stress cycles to failure, were observed. In one of the fracture mechanisms, fatigue behavior is characterized by overall fracture which occurs at 10 4 -10 5 cycles. For these specimens, I c after unloading does not degrade before overall fracture. Although only shallow slip bands were found at the Ag surface, fatigue cracks were found on the Hastelloy C-276 surface of the fractured specimen. These results suggest that overall fracture due to cyclic stress was caused by fatigue of the Hastelloy substrate. In the other fracture mechanism, even though overall fracture did not occur at 10 6 cycles, a slight decrease of I c was detected after 10 5 cycles. No fatigue crack was found on the Hastelloy surface, while deep slip bands corresponding to the initial stage of fatigue crack were observed on the Ag surface. From these results, we concluded that I c degradation at a high cycle number is attributed to the fatigue of the Ag stabilizing layer
International Nuclear Information System (INIS)
Wilde, M.H.; Wilde, B.E.
1993-01-01
Potentiostatic anodic polarization studies have been conducted in a J-13 simulated nuclear waste repository environment, which was allowed to evaporate to dryness followed by rehydration prior to polarization. The behavior of Type 316L stainless steel, AISI 1020 carbon steel, Hastelloy C22 and platinum was compared with that noted previously for a non-baked simulate. The anodic dissolution characteristics of Type 316L stainless steel in environments containing 1000X Cl - J-13 depend markedly on whether the solution is merely a mixture of virgin chemicals or a mixture that has been evaporated to dryness, baked and rehydrated to the same volume. In the non-evaporated environment Type 316L stainless steel pitted severely, and in the evaporated/rehydrated environment a non-corroding type of behavior was observed along with the precipitation of a dense scale. Similar behavior was observed for Hastelloy C22. The polarization curves for carbon steel and platinum were the same as those noted for 316L and Hastelloy C22, when conducted in the evaporated/rehydrated environment. X-ray diffraction studies indicated that the scale produced in all tests conducted on evaporated/rehydrated solutions was calcium carbonate. Based on the qualitatively similar polarization characteristics of materials having such widely differing corrosion properties, it is concluded that the major factor controlling the anodic charge transfer reaction under these conditions is the formation of a calcium carbonate scale. (Author)
Faisal, M.
2018-03-01
In order to understand the influence of reactor materials on the catalytic effect for a particular reaction, the decomposition of cysteic acid from Ni/Fe-based alloy reactors under subcritical water conditions was examined. Experiments were carried out in three batch reactors made of Inconel 625, Hastelloy C-22 and SUS 316 over temperatures of 200 to 300 °C. The highest amount of eluted metals was found for SUS 316. The results demonstrated that reactor materials contribute to the resulting product. Under the tested conditions, cysteic acid decomposes readily with SUS 316. However, the Ni-based materials (Inconel 625 and Hastelloy C-22) show better resistance to metal elution. It was found that among the materials used in this work, SUS 316 gave the highest reaction rate constant of 0.1934 s‑1. The same results were obtained at temperatures of 260 and 300 °C. Investigation of the Arrhenius activation energy revealed that the highest activation energy was for Hastelloy C-22 (109 kJ/mol), followed by Inconel 625 (90 kJ/mol) and SUS 316 (70 kJ/mol). The decomposition rate of cysteic acid was found to follow the results for the trend of the eluted metals. Therefore, it can be concluded that the decomposition of cysteic acid was catalyzed by the elution of heavy metals from the surface of the reactor. The highest amount of taurine from the decarboxylation of cysteic acid was obtained from SUS 316.
International Nuclear Information System (INIS)
Smailos, E.; Schwarzkopf, W.; Koester, R.
1988-07-01
Corrosion studies performed until now on a number of materials have shown that unalloyed steels, Hastelloy C4 and Ti 99.8-Pd are the most promising materials for a long-term resistant packaging to be used in high-level waste (HLW) canister disposal in rock salt formations. To characterize their corrosion behaviour in more detail, additional studies have been performed. The influence has been examined which is exerted by the gamma dose rate (1 Gy/h to 100 Gy/h) on the corrosion of three preselected steels and Hastelloy C4 at 90 0 C in a salt brine (Q-brine) rich in MgCl 2 , i.e., conditions relevant to accident scenarios in a repository. In addition, in-situ corrosion experiments have been carried out in the Asse salt mine at elevated temperatures (120 0 C to 210 0 C) in the absence and in the presence of a gamma radiation field of 3 x 10 2 Gy/h, within the framework of the German/US Brine Migration Test. Under the test conditions the gamma radiation did not exert a significant influence on the corrosion of the steels investigated, whereas Hastelloy C4, exposed to dose rates of 10 Gy/h and 100 Gy/h, underwent pitting and crevice corrosion (20 μm/a at the maximum).The low amounts of migrated salt brine (140 ml after 900 days) in the in-situ- experiment did not produce noticeable corrosion of the materials. (orig./RB) [de
United States Air Force Graduate Student Research Program. 1989 Program Technical Report. Volume 3
1989-12-01
Dyca-l and :,W -sment iFME <Qt~c-Sn aop4 ica and txo glass Wh~omer L~rir-c cements: Shofu liin cement and XR iwncmqr lint rnM.7. 7i meL-in Vi traond...untiring efforts were greatly appreciated. 104-3 INTRODUCT IN: Pism 0_C Cval (Caulkli Cavalite (Kerr), (ES Ketac-bond applicap, Shofu lining cement, XR ...release of fluoride from the restored portions of the tooth to surrounding tooth structure. Teet- normally consist of hydroxyapatite c-ystals, After a
Creep properties of heat-resistant superalloys for nuclear plants in helium
International Nuclear Information System (INIS)
Shimizu, Shigeki; Satoh, Keisuke; Honda, Yoshio; Matsuda, Shozo; Murase, Hirokazu
1979-01-01
Creep properties of candidate superalloys for VHTR components in a helium environment at both temperatures of 800 0 C and 900 0 C were compared with those of the same alloys in the atmospheric condition, and the superalloys were contrasted with each other from the viewpoint of high temperature structural design. At 800 0 C, no significant effect of a helium environment on creep properties of the superalloys is observed. At 900 0 C, however, creep strength of Inconel 617, Incoloy 800 and Incoloy 807 in the helium environment decrease more than in the atmospheric environment. In Hastelloy X and Inconel 625, there is no significant difference between creep strengths in helium and those in the atmospheric condition. Concerning So and St values in helium at 900 0 C, Inconel 617 and Hastelloy X are clearly superior to other superalloys. (author)
International Nuclear Information System (INIS)
Udoguchi, T.; Nakanishi, T.
1981-01-01
Steady and cyclic creep tests with internal pressure were performed at temperatures of 800 to 1000 0 C on Hastelloy X cylinders with and without a circumferential Tungsten Inert Gas (TIG) welding technique. The creep rupture strength of the TIG welded cylinders was much lower than that of the non-welded cylinders whilst creep rupture strength reduction by the TIG technique was not observed in uniaxial creep tests. The reason for the low creep strength of welded cylinders is discussed and it is noted that the creep ductility of weld metal plays an essentially important role. In order to improve the creep strength of the TIG welded cylinder, various welding procedures with assorted weld metals were investigated. Some improvements were obtained by using welding techniques which had either Incoloy 800 or a modified Hastelloy X material as the filler metal. (U.K.)
Ma, Da-Nian; Zhang, Xia-Qi; Ying, Jie; Chen, Zhong-Jun; Li, Li-Xin
2017-11-01
This network meta-analysis aims to compare the efficacy and safety of 9 nonoperative regimens (placebo, pregabalin, GM-1 ganglioside, venlafaxine extended-release [venlafaxine XR], fampridine, conventional over-ground training [OT], body-weight-supported treadmill training [BWSTT], robotic-assisted gait training [RAGT] + OT and body-weight-supported over-ground training [BWSOT]) in treating spinal cord injury (SCI). Clinical controlled trials of 9 nonoperative regimens for SCI were retrieved in the electronic database. Traditional pairwise and Bayesian network meta-analyses were performed to compare the efficacy and safety of 9 nonoperative regimens for the treatment of SCI. Weighted mean difference (WMD), odds ratios (OR), and surface under the cumulative ranking curve (SUCRA) were calculated using the Markov Chain Monte Carlo engine Open BUGS (V.3.4.0) and R (V.3.2.1) package gemtc (V.0.6). A total of 9 clinical controlled trials meeting the inclusion criteria were selected in this meta-analysis. On the aspect of efficacy, the results of pairwise meta-analysis indicated that the RAGT + OT and BWSOT might have the best efficacy in SCI patients in terms of a lower extremity motor score (LEMS) compared with conventional OT; the efficacy of RAGT + OT on SCI patients was relatively better than that of conventional OT in terms of walking index for spinal cord injury (WISCI). With the aspect of safety, the constipation rate of placebo on SCI patients was relatively higher than that of venlafaxine XR; however, with respect to headache and urinary tract infection, there was no significant difference in the safety of placebo, pregabalin, GM-1 ganglioside, venlafaxine XR, and fampridine on SCI patients. The results of SUCRA values suggested that BWSOT had the highest SUCRA value (75.25%) of LEMS; RAGT + OT had the highest SUCRA value (88.50%) of WISCI; venlafaxine XR had the highest SUCRA value (94.00%) of constipation; venlafaxine XR had the highest SUCRA
Directory of Open Access Journals (Sweden)
Xianchen Liu
2011-03-01
Full Text Available Xianchen Liu1,2, Yi Chen3, Douglas E Faries31Former employee, Eli Lilly and Company, Indianapolis, Indiana, USA; 2Indiana University Department of Psychiatry, Indianapolis, Indiana, USA; 3Eli Lilly and Company, Indianapolis, Indiana, USAObjective: This study compared adherence and persistence of three branded antidepressants: the serotonin and norepinephrine reuptake inhibitors (SNRIs duloxetine and venlafaxine XR, and the selective serotonin reuptake inhibitor (SSRI escitalopram; and generic selective SSRIs, and examined demographic and clinical predictors of adherence and persistence in patients with major depressive disorder in usual care settings.Method: A total of 44,026 patients (18 to 64 years from a large commercial administrative claims database were classified as initiators of duloxetine (n = 7,567, venlafaxine XR (n = 6,106, escitalopram (n = 10,239, or generic SSRIs (n = 20,114 during 2006. Adherence was defined as the medication possession ratio of ≥ 0.8 and persistence as the length of therapy without exceeding a 15-day gap. Pairwise comparisons from multivariate logistic regression and Cox proportional hazards models were performed to examine predictors of adherence and persistence.Results: Adherence rate after one year was significantly higher in duloxetine recipients (38.1% than patients treated with venlafaxine XR (34.0%, escitalopram (25.4%, or generic SSRIs (25.5% (all P < 0.01. Duloxetine recipients stayed on medication longer (158.5 days than those receiving venlafaxine XR (149.6 days, escitalopram (129.1 days, or generic SSRIs (130.2 days (all P < 0.001. Compared with patients treated with escitalopram or generic SSRIs, venlafaxine XR recipients had better adherence and longer persistence (P < 0.001. In addition, being aged 36 years or more, hypersomnia, anxiety disorders, and prior use of antidepressants were associated with increased adherence and persistence, while the opposite was true for comorbid chronic pain
Directory of Open Access Journals (Sweden)
Katja Wagner
Full Text Available Cigarette smoking (CS aggravates post-traumatic acute lung injury and increases ventilator-induced lung injury due to more severe tissue inflammation and apoptosis. Hyper-inflammation after chest trauma is due to the physical damage, the drop in alveolar PO2, and the consecutive hypoxemia and tissue hypoxia. Therefore, we tested the hypotheses that 1 CS exposure prior to blunt chest trauma causes more severe post-traumatic inflammation and thereby aggravates lung injury, and that 2 hyperoxia may attenuate this effect. Immediately after blast wave-induced blunt chest trauma, mice (n=32 with or without 3-4 weeks of CS exposure underwent 4 hours of pressure-controlled, thoraco-pulmonary compliance-titrated, lung-protective mechanical ventilation with air or 100% O2. Hemodynamics, lung mechanics, gas exchange, and acid-base status were measured together with blood and tissue cytokine and chemokine concentrations, heme oxygenase-1 (HO-1, activated caspase-3, and hypoxia-inducible factor 1-α (HIF-1α expression, nuclear factor-κB (NF-κB activation, nitrotyrosine formation, purinergic receptor 2X4 (P2XR4 and 2X7 (P2XR7 expression, and histological scoring. CS exposure prior to chest trauma lead to higher pulmonary compliance and lower PaO2 and Horovitz-index, associated with increased tissue IL-18 and blood MCP-1 concentrations, a 2-4-fold higher inflammatory cell infiltration, and more pronounced alveolar membrane thickening. This effect coincided with increased activated caspase-3, nitrotyrosine, P2XR4, and P2XR7 expression, NF-κB activation, and reduced HIF-1α expression. Hyperoxia did not further affect lung mechanics, gas exchange, pulmonary and systemic cytokine and chemokine concentrations, or histological scoring, except for some patchy alveolar edema in CS exposed mice. However, hyperoxia attenuated tissue HIF-1α, nitrotyrosine, P2XR7, and P2XR4 expression, while it increased HO-1 formation in CS exposed mice. Overall, CS exposure
Redox balancing in recombinant strains of Saccharomyces cerevisiae
Energy Technology Data Exchange (ETDEWEB)
Anderlund, M
1998-09-01
In metabolically engineered Saccharomyces cerevisiae expressing Pichia stipitis XYL1 and XYL2 genes, encoding xylose reductase (XR) and xylitol dehydrogenase (XDH), respectively, xylitol is excreted as the major product during anaerobic xylose fermentation and only low yields of ethanol are produced. This has been interpreted as a result of the dual cofactor dependence of XR and the exclusive use of NAD{sup +} by XDH. The excretion of xylitol was completely stopped and the formation of glycerol and acetic acid were reduced in xylose utilising S. cerevisiae strains cultivated in oxygen-limited conditions by expressing lower levels of XR than of XDH. The expression level of XYL1 and XYL2 were controlled by changing the promoters and transcription directions of the genes. A new functional metabolic pathway was established when Thermus thermophilus xylA gene was expressed in S. cerevisiae. The recombinant strain was able to ferment xylose to ethanol when cultivated on a minimal medium containing xylose as only carbon source. In order to create a channeled metabolic transfer in the two first steps of the xylose metabolism, XYL1 and XYL2 were fused in-frame and expressed in S. cerevisiae. When the fusion protein, containing a linker of three amino acids, was co expressed together with native XR and XDH monomers, enzyme complexes consisting of chimeric and native subunits were formed. The total activity of these complexes exhibited 10 and 9 times higher XR and XDH activity, respectively, than the original conjugates, consisting of only chimeric subunits. This strain produced less xylitol and the xylitol yield was lower than with strains only expressing native XR and XDH monomers. In addition, more ethanol and less acetic acid were formed. A new gene encoding the cytoplasmic transhydrogenase from Azotobacter vinelandii was cloned. The enzyme showed high similarity to the family of pyridine nucleotide-disulphide oxidoreductase. To analyse the physiological effect of
Directory of Open Access Journals (Sweden)
Maneeton N
2016-01-01
Full Text Available Narong Maneeton,1 Benchalak Maneeton,1 Pakapan Woottiluk,2 Surinporn Likhitsathian,1 Sirijit Suttajit,1 Vudhichai Boonyanaruthee,1 Manit Srisurapanont1 1Department of Psychiatry, Faculty of Medicine, Chiang Mai University, Chiang Mai, Thailand; 2Psychiatric Nursing Division, Faculty of Nursing, Chiang Mai University, Chiang Mai, Thailand Background: Some studies have indicated the efficacy of quetiapine in the treatment of generalized anxiety disorder (GAD.Objective: The purpose of this study was to systematically review the efficacy, acceptability, and tolerability of quetiapine in adult patients with GAD.Methods: The SCOPUS, MEDLINE, CINAHL, Cochrane Central Register of Controlled Trials, and ClinicalTrials.gov databases were searched in April 2015. All randomized controlled trials (RCTs of GAD were considered to be included in this meta-analysis. All RCTs of quetiapine in GAD patients providing endpoint outcomes relevant to severity of anxiety, response rate, remission rate, overall discontinuation rate, or discontinuation rate due to adverse events were included. The version reports from suitable clinical studies were explored, and the important data were extracted. Measurement for efficacy outcomes consisted of the mean-changed scores of the rating scales for anxiety, and response rate.Results: A total of 2,248 randomized participants in three RCTs were included. The pooled mean-changed score of the quetiapine-treated group was greater than that of the placebo-treated group and comparable to selective serotonin reuptake inhibitors (SSRIs. Unfortunately, the response and the remission rates in only 50 and 150 mg/day of quetiapine-XR (extended-release were better than those of the placebo. Their response and remission rates were comparable to SSRIs. The rates of pooled overall discontinuation and discontinuation due to adverse events of quetiapine-XR were greater than placebo. Only the overall discontinuation rate of quetiapine-XR at 50 and
Chenu, Franck; Batten, Lisa A; Zernig, Gerald; Ladstaetter, Elisabeth; Hébert, Chantal; Blier, Pierre
2009-07-01
Generic drugs are lower-cost versions of patent-expired brand-name medications. Bioequivalence is decreed when the 90% confidence intervals for the ratios of the generic to the reference compound for the area under the curve and maximum plasma concentration (C(max)) fall within a 0.80 to 1.25 range. The aim of the present pilot study was to compare the pharmacokinetic profiles of brand-name and generic formulations of citalopram and extended-release venlafaxine. Effexor XR/Novo-venlafaxine XR 75 mg and Celexa/Gen-citalopram 40 mg were studied in a randomized crossover design. Healthy male volunteers took either Effexor XR or Novo-venlafaxine XR for 4 days, a 4-day washout was allowed, and then participants took the other venlafaxine formulation for 4 days. This was followed by a washout of at least 7 days. The participants then took Celexa or Gen-citalopram for 8 days, a 14-day washout was allowed, and then participants took the other citalopram formulation for 8 days. In each of the study phases, the sequence of treatment (brand-name x generic) was randomly assigned. Plasma levels of drugs were measured at fixed intervals after participants took the drugs and at steady state. The study was conducted from November 2007 through July 2008. Twelve participants completed the venlafaxine study. Nine of the participants, plus 3 new participants, were then enrolled in the citalopram study, to maintain a total of 12. The plasma levels of citalopram were similar after ingestion of the brand-name and generic drugs. After ingestion of venlafaxine, the C(max) values were 36 +/- 6 ng/mL and 52 +/- 8 ng/mL in the brand-name and generic groups, respectively. The ratio of the log-transformed values of C(max) was 150% and, therefore, not within the acceptable 80% to 125% range. The concentration of the active metabolite of venlafaxine (O-desmethyl-venlafaxine [ODV]) was also significantly increased in the generic group (+43% higher in the generic group at 3 h; +48% higher at 5 h; p
Wilson, Darrell M; Abrams, Stephanie H; Aye, Tandy; Lee, Phillip D K; Lenders, Carine; Lustig, Robert H; Osganian, Stavroula V; Feldman, Henry A
2010-02-01
Metformin has been proffered as a therapy for adolescent obesity, although long-term controlled studies have not been reported. To test the hypothesis that 48 weeks of daily metformin hydrochloride extended release (XR) therapy will reduce body mass index (BMI) in obese adolescents, as compared with placebo. Multicenter, randomized, double-blind, placebo-controlled clinical trial. The 6 centers of the Glaser Pediatric Research Network from October 2003 to August 2007. Obese (BMI > or = 95th percentile) adolescents (aged 13-18 years) were randomly assigned to the intervention (n = 39) or placebo groups. Intervention Following a 1-month run-in period, subjects following a lifestyle intervention program were randomized 1:1 to 48 weeks' treatment with metformin hydrochloride XR, 2000 mg once daily, or an identical placebo. Subjects were monitored for an additional 48 weeks. Main Outcome Measure Change in BMI, adjusted for site, sex, race, ethnicity, and age and metformin vs placebo. After 48 weeks, mean (SE) adjusted BMI increased 0.2 (0.5) in the placebo group and decreased 0.9 (0.5) in the metformin XR group (P = .03). This difference persisted for 12 to 24 weeks after cessation of treatment. No significant effects of metformin on body composition, abdominal fat, or insulin indices were observed. Metformin XR caused a small but statistically significant decrease in BMI when added to a lifestyle intervention program. clinicaltrials.gov Identifiers: NCT00209482 and NCT00120146.
Levin, Frances R.; Mariani, John; Brooks, Daniel J.; Pavlicova, Martina; Nunes, Edward V.; Agosti, Vito; Bisaga, Adam; Sullivan, Maria A.; Carpenter, Kenneth M.
2013-01-01
Aim To evaluate whether venlafaxine-extended release (VEN-XR) is an effective treatment for cannabis dependence with concurrent depressive disorders. Design This was a randomized, 12 week, double-blind, placebo-controlled trial of outpatients (n = 103) with DSM-IV cannabis dependence and major depressive disorder or dysthymia. Participants received up to 375 mg VEN-XR on a fixed-flexible schedule or placebo. All patients received weekly individual cognitive-behavioral psychotherapy that primarily targeted marijuana use. Settings The trial was conducted at two university research centers in the United States. Participants One hundred and three cannabis dependent adults participated in the trial. Measurements The primary outcome measures were 1) abstinence from marijuana defined as at least two consecutive urine-confirmed abstinent weeks and 2) improvement in depressive symptoms based on the Hamilton Depression Rating Scale. Findings The proportion of patients achieving a clinically significant mood improvement [50% decrease in Hamilton Depression score from baseline] was high and did not differ between groups receiving VEN-XR (63%) and placebo (69%) (X12=0.48, p-value= 0.49). The proportion of patients achieving abstinence was low overall, but was significantly worse on VEN-XR (11.8%) compared to placebo (36.5%) (X12=7.46, p-valuemarijuana use in the placebo group (F1,179=30.49, p-valuedepressed, cannabis-dependent patients, venlafaxine-extended release does not appear to be effective at reducing depression and may lead to an increase in cannabis use. PMID:23297841
Energy Technology Data Exchange (ETDEWEB)
Hada, Kazuhiko; Fujisaki, Katsuo; Shibata, Taijyu; Inagaki, Yoshiyuki; Hino, Ryutaro [Japan Atomic Energy Research Inst., Oarai, Ibaraki (Japan). Oarai Research Establishment; Koiso, Hiroshi
1997-02-01
The Japanese safety regulation generally requires to set an isolation valve at the penetration of the reactor containment vessel on the secondary helium piping system which connects a steam reforming hydrogen production system, located outside the reactor building, to an intermediate heat exchanger (IHX) in the HTTR reactor system. The hot secondary helium which is heated up to the high temperature of 905degC and at the high pressure of 4.1MPa is passing through the isolation valve. So far, such a hot isolation valve has not been industrialized. The present report presents a proposal of a structural design concept of an angle valve as a promising candidate of the hot isolation valve, and a proposal on a test program for demonstrating the technological feasibility of the concept at an out-of-pile test facility before installing at the HTTR. A closing time and a leak rate at a valve seat are the key design parameters for developing the design concept. To set a reasonable value to each parameter, safety requirements on the isolation valve were discussed at first. The target closing time and the acceptable design limit of leak rate at the valve seat for meeting the requirements were specified 30 seconds and 10 STP cm{sup 3}/s, respectively. A nickel-base superalloy Hastelloy XR is feasible as such a valve seat material as to withstand the internal/external pressure of 4.1MPa at the high temperature of 905degC, the severest loading conditions of the valve seat at the accident of secondary helium pipe rupture. Correlation of leak rate at the ambient temperature to that at an operating temperature (900degC) is one of key test subjects of test program at an out-of-pile test facility. Leak rate at the operating temperature is the real parameter to be checked but only the leak rate at the ambient temperature is measured at regulatory examination in service. A test method to develop such correlation was proposed. (author)
International Nuclear Information System (INIS)
Hameed, M.; Khan, K.; Salman, S.; Mehmood, N.
2017-01-01
Diabetes Mellitus type 2 is very common worldwide, with majority of cases in Asia Pacific region. Metformin is the first line therapy, along with lifestyle modification for all type 2 diabetics as recommended by ADA. Metformin is available as conventional Metformin Immediate Release (MIR) and Metformin Extended Release (MXR). Metformin XR has better gastrointestinal tolerability and fewer side effects as compared to Metformin IR, with similar efficacy regarding anti-hyperglycaemic effects. The objective of this study was to determine whether metformin XR is as effective as Metformin IR in maintaining glycaemic control at equivalent doses or even at reduced doses; and to compare the side effect profile of the two preparations. Methods: This randomized control trial was conducted at Medical and Endocrinology OPD of Jinnah Hospital Lahore A total of 90 type 2 diabetics of both genders were recruited using nonprobability purposive sampling. Patients were randomized into 3 groups; 30 in each group. Group 1 received Metformin IR 1000 mg twice daily; group 2 received metformin XR 1000mg twice daily; and group 3 received metformin XR 500 mg twice daily, for a period of three months. HbA1c was done at baseline and after three months of therapy along with fasting blood sugars and random blood sugars weekly. Results: The mean age of patients was 46+-9 years, with 54% being males and 46% being females. There was a 1% reduction in HbA1c in group 1, 0.7% reduction in group 2 and only 0.4% reduction in group 3. Similarly, all three therapies were equally effective in reducing blood sugar fasting and blood sugar random at three months. Side effects namely diarrhoea, dyspepsia and flatulence were greatest with Metformin IR (40%) but less than half with Metformin XR at equivalent dose and negligible at half the dose. Conclusions: All three Metformin groups were effective in reduction of HbA1C and glycaemic control clinically and there is no statistical difference in HbA1c reduction
Fabrication of three 2500-watt (thermal) strontium-90 heat sources
International Nuclear Information System (INIS)
DeVore, J.R.; Haff, K.W.; Tompkins, J.A.
1986-08-01
Three 2500-watt (thermal) heat sources were fabricated by the Oak Ridge National Laboratory (ORNL) for the purpose of fueling a 500-watt (electric) thermoelectric generator as part of the US Department of Energy's Byproducts Utilization Program (BUP). Each of the sources, which are the largest ever assembled, consist of hot-pressed pellets of 90 Sr fluoride, doubly encapsulated in three Haynes-25 inner capsules and in a Hastelloy-S outer capsule. The total 90 Sr inventory of all three sources is 1.12 million curies. The sources were fabricated at the ORNL Fission Product Development Laboratory (FPDL), which is a facility that is capable of processing multi-megacurie quantities of radioactive materials, chiefly 137 Cs and 90 Sr. The source was tested to determine compliance with all of the IAEA Safety Series No. 33 requirements. The source fabrication, assembly, and testing are described in the presentation
Neutronics analysis for HYLIFE-II
International Nuclear Information System (INIS)
Tobin, M.T.
1990-01-01
A preliminary neutronics analysis of the HYLIFE-2 reactor concept gives a tritium breeding ratio of 1.17 and a system energy multiplication factor of 1.14. Modified SS-316 (in which Mn is substituted for Ni) is superior to Hastelloy X and Hastelloy N as a firstwall material considering He generation, dpa-limited lifetime, and shallow-burial index. Since Flibe is corrosive to Mn metals, however, a favorable first-wall material is yet to be decided on. Flibe impurities considered (e.g., inherent impurities and those arising from wall erosion or secondary-coolant leakage) do not increase the hazard to the public over that of pure Flibe. The main issues for HYLIFE-2 are the high shallow-burial index (106) and the requirement to contain some 99.7% of the 18 F inventory to prevent its release to the public 18 refs., 3 figs., 9 tabs
जलीय पर्यावरण पर पॊलिविनाइल क्लोराइड प्लास्टिक के प्रभाव
Digital Repository Service at National Institute of Oceanography (India)
Sarkar, A; Vashistha, D.
°{b{dZmBb ŠbmoamBS> ßbmpñQ>H$ Ho$ à^md E AZwn‘ gaH$ma E Xr{á d{eð> nm°{b{dZmBb ŠbmoamBS> (PVC) Am‘ Vm¡a na nrdrgr `m {g’©$ {dZmB©b (vinyl) Ho$ ê$n ‘| OmZm OmVm h¡& dmñVd ‘§o ‘Ü` 20 dt gXr Ho$ ~mX `h nrdrgr ì`mnH$ ê$n go Xw{Z`m ^a...JZëQ> Am¡a ~mX ‘| gZ² 1872 ‘| ¶yOZ ~mC‘¡Z Zo BgH$m Am{dîH$ma {H$`m& BZ XmoZm| Adgam| na ~hþbH$ {dZmBb ŠbmoamBS> EH$ g’o$X R>mog Ho$ ê$n ‘| ~moVb Ho$ A§Xa àH$Q> hþAm Omo {H$ Yyn Ho$ g§nH©$ ‘| N>mo‹S> {X`m J`m Wm & ~rgdt gXr ‘| ê$gr agm`Zk BdmZ Amoñ...
Evaluation of a compact portable DEXA unit for wrist densitometry
Energy Technology Data Exchange (ETDEWEB)
Mares, T.; Bonovas, G.; Larcos, G. [Westmead Hospital, Sydney, NSW (Australia). Department of Nuclear Medicine
1998-06-01
Full text: Recently, a number of manufacturers have introduced compact, portable DEXA units in order to facilitate osteoporosis screening in remote communities and on an in-office basis. The purposes of this study were to evaluate the accuracy and reproducibility of the Norland-Stratec (pDEXA) compared to measurements obtained using a conventional densitometer (Norland XR-36). We recruited 61 adults (3 men, 58 women) with mean age 54 years (range: 19-76) referred for clinical assessment of BMD. Most patients had medications (n=39; 64%) or disorders (n=48;79%) known to interfere with bone mineral metabolism. Subjects underwent bone densitometry of the lumbar spine, (AP; L2-4) femoral neck and distal radius/ulna of the nondominant forearm using the Norland XR-36, with the wrist subsequently re-scanned on pDEXA. Four subjects also underwent 5 scans each on the pDEXA. Mean BMD for the distal radius/ulna was 0.30g/cm2 (range: 0.17 - 0.539/cm2; XR-36) vs 0.319/cm2 (range: 0.18-0.56 g/cm2; pDEXA), r = 0.98 (SEE = 0.07). Mean BMC for the distal radius/ulna was 1.229 (range: 0.67-2.59; XR-36) vs 1.289 (range:0.74-2.69; pDEXA), r = 0.97 (SEE= 0.08). The CV for pDEXA was 0.8% (BMD) and 2.5% (BMC). Thus, we conclude that pDEXA has excellent in-vivo reproducibility, with good correlation of BMD and BMC with standard densitometers
Levin, Frances R; Mariani, John; Brooks, Daniel J; Pavlicova, Martina; Nunes, Edward V; Agosti, Vito; Bisaga, Adam; Sullivan, Maria A; Carpenter, Kenneth M
2013-06-01
To evaluate whether venlafaxine-extended release (VEN-XR) is an effective treatment for cannabis dependence with concurrent depressive disorders. This was a randomized, 12-week, double-blind, placebo-controlled trial of out-patients (n = 103) with DSM-IV cannabis dependence and major depressive disorder or dysthymia. Participants received up to 375 mg VEN-XR on a fixed-flexible schedule or placebo. All patients received weekly individual cognitive-behavioral psychotherapy that primarily targeted marijuana use. The trial was conducted at two university research centers in the United States. One hundred and three cannabis-dependent adults participated in the trial. The primary outcome measures were (i) abstinence from marijuana defined as at least two consecutive urine-confirmed abstinent weeks and (ii) improvement in depressive symptoms based on the Hamilton Depression Rating Scale. The proportion of patients achieving a clinically significant mood improvement (50% decrease in Hamilton Depression score from baseline) was high and did not differ between groups receiving VEN-XR (63%) and placebo (69%) (χ1 (2) = 0.48, P = 0.49). The proportion of patients achieving abstinence was low overall, but was significantly worse on VEN-XR (11.8%) compared to placebo (36.5%) (χ1 (2) = 7.46, P marijuana use in the placebo group (F1,179 = 30.49, P depressed, cannabis-dependent patients, venlafaxine-extended release does not appear to be effective at reducing depression and may lead to an increase in cannabis use. © 2013 Society for the Study of Addiction.
Synthesis of Novel Amphiphilic Azobenzenes and X-ray Scattering Studies of Their Langmuir Monolayers
DEFF Research Database (Denmark)
Sørensen, Thomas Just; Kjær, Kristian; Breiby, Dag Werner
2008-01-01
. At the air-water interface, the amphiphilic azobenzenes form noncrystalline but stable Langmuir films that display an unusual reversible monolayer collapse close to 35 mN/m. The structures and phase transitions were studied by X-ray reflectivity (XR) and grazing-incidence X-ray diffraction, both utilizing...... synchrotron radiation. Compression beyond the collapse point does not change the XR data, showing that the film is unchanged at the molecular level, even at areas less than half of that of the collapse. This leads to the conclusion that few macroscopic collapse sites are responsible for reversibly removing...
Body composition analysis by DEXA by using dynamically changing samarium filtration
DEFF Research Database (Denmark)
Gotfredsen, Arne; Baeksgaard, L; Hilsted, J
1997-01-01
Dual-energy X-ray absorptiometry (DEXA) has a high accuracy for body composition analysis but is influenced by beam hardening and other error sources in the extremes of measurement. To compensate for beam hardening, the Norland XR-36 introduces a dynamically changing samarium filtration system......). Scans of six healthy volunteers covered with combinations of beef and lard (approximately 5-15 kg) showed a good agreement (r = 0.99) between reference and DEXA values of added soft tissue mass and fat percentage. We conclude that the DEXA method (and, in particular, the Norland XR-36 using dynamic...
Noncontaminating technique for making holes in existing process systems
Hecker, T. P.; Czapor, H. P.; Giordano, S. M.
1972-01-01
Technique is developed for making cleanly-contoured holes in assembled process systems without introducing chips or other contaminants into system. Technique uses portable equipment and does not require dismantling of system. Method was tested on Inconel, stainless steel, ASTMA-53, and Hastelloy X in all positions.
Directory of Open Access Journals (Sweden)
Altin Abdullah
2017-01-01
Full Text Available The effects of cutting tool coating material and cutting speed on cutting forces and surface roughness were investigated by Taguchi experimental design. Main cutting force, Fz is considered as a criterion. The effects of machining parameters were investigated using Taguchi L18 orthogonal array. Optimal cutting conditions were determined using the signal-to-noise (S/N ratio which is calculated for average surface roughness and cutting force according to the “the smaller is better” approach. Using results of analysis of variance (ANOVA and signal-to-noise (S/N ratio, effects of parameters on both average surface roughness and cutting forces were statistically investigated. It was observed that feed rate and cutting speed had higher effect on cutting force in Hastelloy X, while the feed rate and cutting tool had higher effect on cutting force in Inconel 625. According to average surface roughness the cutting tool and feed rate had higher effect in Hastelloy X and Inconel 625.
Bovard, Francine S.; Cieslak, Wendy R.
1987-09-01
The corrosion susceptibilities of eight alternate battery pin material candidates for ALTC (Active Lithium/Thionyl Chloride) batteries in 1.5M LiAlCl4/SOCl2 electrolyte have been investigated using ampule exposure and electrochemical tests. The thermal expansion coefficients of these candidate materials are expected to match Sandia-developed Li-corrosion resistant glasses. The corrosion resistances of the candidate materials, which included three stainless steels (15-5 PH, 17-4 PH, and 446), three Fe-Ni glass sealing alloys (Kovar, Alloy 52, and Niromet 426), a Ni-based alloy (Hastelloy B-2) and a zirconium-based alloy (Zircaloy), were compared to the reference materials Ni and 316L SS. All of the candidate materials showed some evidence of corrosion and, therefore, did not perform as well as the reference materials. The Hastelloy B-2 and Zircaloy are clearly unacceptable materials for this application. Of the remaining alternate materials, the 446 SS and Alloy 52 are the most promising candidates.
Energy Technology Data Exchange (ETDEWEB)
Bovard, F.S.; Cieslak, W.R.
1987-09-01
(ALTC = active lithium/thionyl chloride.) We have investigated the corrosion susceptibilities of eight alternate battery pin materials in 1.5M LiAlCl/sub 4//SOCl/sub 2/ electrolyte using ampule exposure and electrochemical tests. The thermal expansion coefficients of these candidate materials are expected to match Sandia-developed Li-corrosion resistant glasses. The corrosion resistances of the candidate materials, which included three stainless steels (15-5 PH, 17-4 PH, and 446), three Fe-Ni glass sealing alloys (Kovar, Alloy 52, and Niromet 426), a Ni-based alloy (Hastelloy B-2) and a zirconium-based alloy (Zircaloy), were compared to the reference materials Ni and 316L SS. All of the candidate materials showed some evidence of corrosion and, therefore, did not perform as well as the reference materials. The Hastelloy B-2 and Zircaloy are clearly unacceptable materials for this application. Of the remaining alternate materials, the 446 SS and Alloy 52 are the most promising candidates.
Materials performance in off-gas systems containing iodine
International Nuclear Information System (INIS)
Beavers, J.A.; Berry, W.E.; Griess, J.C.
1981-11-01
During the reprocessing of spent reactor fuel elements, iodine is released to gas streams from which it is ultimately removed by conversion to nonvolatile iodic acid. Under some conditions iodine can produce severe corrosion in off-gas lines; in this study these conditions were established. Iron- and nickel-based alloys containing more than 6% molybdenum, such as Hastelloy G (7%), Inconel 625 (9%), and Hastelloy C-276 (16%), as well as titanium and zirconium, remained free of attack under all conditions tested. When the other materials, notably the austenitic stainless steels, were exposed to gas streams containing even only low concentrations of iodine and water vapors at 25 and 40 0 C, a highly corrosive, brownish-green liquid formed on their surfaces. In the complete absence of water vapor, the iodine-containing liquid did not form and all materials remained unaffected. The liquid that formed had a low pH (usually 2 inhibited attack
ORF Alignment: NC_004603 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available xR ... [Vibrio parahaemolyticus RIMD 2210633] ... Length = 225 ... Query: 4 ... ILLIDDDIELTSLLKEVLS...FEGFEVSEANDGEAGLAAINSDIDLILLDVMMPKLNGMETL 63 ... ILLIDDDIELTSLLKEVLSFEGFEV...SEANDGEAGLAAINSDIDLILLDVMMPKLNGMETL Sbjct: 1 ... ILLIDDDIELTSLLKEVLSFEGFEVSEANDGEAGLAAINSDIDLILLDVMMPKLNGMETL
Plant insecticide L-canavanine repels Drosophila via the insect orphan GPCR DmX.
Directory of Open Access Journals (Sweden)
Christian Mitri
2009-06-01
Full Text Available For all animals, the taste sense is crucial to detect and avoid ingesting toxic molecules. Many toxins are synthesized by plants as a defense mechanism against insect predation. One example of such a natural toxic molecule is L-canavanine, a nonprotein amino acid found in the seeds of many legumes. Whether and how insects are informed that some plants contain L-canavanine remains to be elucidated. In insects, the taste sense relies on gustatory receptors forming the gustatory receptor (Gr family. Gr proteins display highly divergent sequences, suggesting that they could cover the entire range of tastants. However, one cannot exclude the possibility of evolutionarily independent taste receptors. Here, we show that L-canavanine is not only toxic, but is also a repellent for Drosophila. Using a pharmacogenetic approach, we find that flies sense food containing this poison by the DmX receptor. DmXR is an insect orphan G-protein-coupled receptor that has partially diverged in its ligand binding pocket from the metabotropic glutamate receptor family. Blockade of DmXR function with an antagonist lowers the repulsive effect of L-canavanine. In addition, disruption of the DmXR encoding gene, called mangetout (mtt, suppresses the L-canavanine repellent effect. To avoid the ingestion of L-canavanine, DmXR expression is required in bitter-sensitive gustatory receptor neurons, where it triggers the premature retraction of the proboscis, thus leading to the end of food searching. These findings show that the DmX receptor, which does not belong to the Gr family, fulfills a gustatory function necessary to avoid eating a natural toxin.
Guo, Jian; Huang, Siyao; Chen, Yefu; Guo, Xuewu; Xiao, Dongguang
2018-04-30
Aureobasidium pullulans is a yeast-like fungus that can ferment xylose to generate high-value-added products, such as pullulan, heavy oil, and melanin. The combinatorial expression of two xylose reductase (XR) genes and two xylitol dehydrogenase (XDH) genes from Spathaspora passalidarum and the heterologous expression of the Piromyces sp. xylose isomerase (XI) gene were induced in A. pullulans to increase the consumption capability of A. pullulans on xylose. The overexpression of XYL1.2 (encoding XR) and XYL2.2 (encoding XDH) was the most beneficial for xylose utilization, resulting in a 17.76% increase in consumed xylose compared with the parent strain, whereas the introduction of the Piromyces sp. XI pathway failed to enhance xylose utilization efficiency. Mutants with superior xylose fermentation performance exhibited increased intracellular reducing equivalents. The fermentation performance of all recombinant strains was not affected when glucose or sucrose was utilized as the carbon source. The strain with overexpression of XYL1.2 and XYL2.2 exhibited excellent fermentation performance with mimicked hydrolysate, and pullulan production increased by 97.72% compared with that of the parent strain. The present work indicates that the P4 mutant (using the XR/XDH pathway) with overexpressed XYL1.2 and XYL2.2 exhibited the best xylose fermentation performance. The P4 strain showed the highest intracellular reducing equivalents and XR and XDH activity, with consequently improved pullulan productivity and reduced melanin production. This valuable development in aerobic fermentation by the P4 strain may provide guidance for the biotransformation of xylose to high-value products by A. pullulans through genetic approach.
Jo, Jung-Hyun; Oh, Sun-Young; Lee, Hyeun-Soo; Park, Yong-Cheol; Seo, Jin-Ho
2015-12-01
Xylitol, a natural sweetener, can be produced by hydrogenation of xylose in hemicelluloses. In microbial processes, utilization of only NADPH cofactor limited commercialization of xylitol biosynthesis. To overcome this drawback, Saccharomyces cerevisiae D452-2 was engineered to express two types of xylose reductase (XR) with either NADPH-dependence or NADH-preference. Engineered S. cerevisiae DWM expressing both the XRs exhibited higher xylitol productivity than the yeast strain expressing NADPH-dependent XR only (DWW) in both batch and glucose-limited fed-batch cultures. Furthermore, the coexpression of S. cerevisiae ZWF1 and ACS1 genes in the DWM strain increased intracellular concentrations of NADPH and NADH and improved maximum xylitol productivity by 17%, relative to that for the DWM strain. Finally, the optimized fed-batch fermentation of S. cerevisiae DWM-ZWF1-ACS1 resulted in 196.2 g/L xylitol concentration, 4.27 g/L h productivity and almost the theoretical yield. Expression of the two types of XR utilizing both NADPH and NADH is a promising strategy to meet the industrial demands for microbial xylitol production. Copyright © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
International Nuclear Information System (INIS)
Liu, Guoliang; Zhang, Feng; Hao, Lizhen
2012-01-01
We previously introduced a time record model for use in studying the duration of sand–dust storms. In the model, X is the normalized wind speed and Xr is the normalized wind speed threshold for the sand–dust storm. X is represented by a random signal with a normal Gaussian distribution. The storms occur when X ≥ Xr. From this model, the time interval distribution of N = Aexp(−bt) can be deduced, wherein N is the number of time intervals with length greater than t, A and b are constants, and b is related to Xr. In this study, sand–dust storm data recorded in spring at the Yanchi meteorological station in China were analysed to verify whether the time interval distribution of the sand–dust storms agrees with the above time interval distribution. We found that the distribution of the time interval between successive sand–dust storms in April agrees well with the above exponential equation. However, the interval distribution for the sand–dust storm data for the entire spring period displayed a better fit to the Weibull equation and depended on the variation of the sand–dust storm threshold wind speed. (paper)
Bukharin, D G; Velichko, S A; Slonimskaia, E M; Frolova, I G; Luneva, S V; Garbukov, E Iu; Doroshenko, A V
2011-01-01
All complications diagnosed at early stages of breast cancer were associated with small tumors, especially with those arising in the aftermath of fibrocystic disease. Hence, our task was to study the XR-semiotics of lesions of less than 15 mm in diameter and of the same origin. 100 mammograms of breast cancer patients with benign disease of the breast were studied. The presence of moderate-to-severe fibrocystic disease significantly affected the visualization of lesions of less than 10 mm in diameter. Since the XR-semiotics of small tumors failed to reveal malignancy features, all lesions visualized by mammography required additional diagnostic procedures using ultrasound and invasive radiology.
Structure of the Buried Metal-Molecule Interface in Organic Thin Film Devices
DEFF Research Database (Denmark)
Hansen, Christian Rein; Sørensen, Thomas Just; Glyvradal, Magni
2009-01-01
By use of specular X-ray reflectivity (XR) the structure of a metal-covered organic thin film device is measured with angstrom resolution. The model system is a Langmuir-Blodgett (LB) film, sandwiched between a silicon substrate and a top electrode consisting of 25 Å titanium and 100 Å aluminum....... By comparison of XR data for the five-layer Pb2+ arachidate LB film before and after vapor deposition of the Ti/Al top electrode, a detailed account of the structural damage to the organic film at the buried metal-molecule interface is obtained. We find that the organized structure of the two topmost LB layers...
78 FR 12763 - Pediatric Advisory Committee; Notice of Meeting
2013-02-25
... (esomeprazole sodium), UROXATRAL (alfuzosin hydrochloride), and ZENPEP (pancrelipase). Also, there will be an... (albumin human), KYTRIL Injection (granisetron hydrochloride), LAMICTAL XR (lamotrigine), MENACTRA...
Heat-source specification 500 watt(e) RTG
International Nuclear Information System (INIS)
1983-02-01
This specification establishes the requirements for a 90 SrF 2 heat source and its fuel capsule for application in a 500 W(e) thermoelectric generator. The specification covers: fuel composition and quantity; the Hastelloy S fuel capsule material and fabrication; and the quality assurance requirements for the assembled heat source
Gene : CBRC-RNOR-07-0266 [SEVENS
Lifescience Database Archive (English)
Full Text Available 5 (LOC685755), mRNA /gb=XR_006286 /gi=109471595 /ug=Rn.197700 /len=1496 4e-65 64% MNGKKIIKLRAEINRNNNNNSSSSNSNNSSSSSNNNNSSSNSNNNSS...SNSNNNSSSSNSNNNSNNNSNSSNNSSSNNNSSSSNSNNSSNSNNSNNNSNSSNNNSNNSSSNSNNSNNNSS...SNSNNSNNNSNSNNSNSSNNNSNNNNSSSNSNNNNNNNSSNNNSSNNNNNSNNIKTTAATTTTATTTTAANAIIETKSWFLEKISKIDKPLFNIKVERKLNQINQPRKERRGV ...
Detection ability of FDG-PET/CT comparing with other imaging modalities in multiple myeloma patients
International Nuclear Information System (INIS)
Chae, Min Jeong; Lee, Tae Hyun; Pai, Moon Sun; Cheon, Gi Jeong; Choi, Chang Woon; Lim, Sang Moo
2007-01-01
Multiple myeloma (MM) is characterized by bone marrow infiltration with malignant plasma cells. It is important to detect involving bone for diagnosis and management of MM. The aim of this study was to evaluate the diagnostic ability and limitation of 18F-FDG-PET/CT (PET/CT) comparing other imaging modalities (separated PET and CT, whole body plain X-ray (XR), bone scintigraphy (BS), and MRI) in MM. Twenty PET/CT scans were performed in 16 patients (M: F=6: 10, median age=59 y). PET/CT findings were compared with available other images (n of CT=21, XR=21, BS=8, and MRI=5). Concordance with more than 2 image modalities, laboratory data, symptom, and biopsies were used for diagnosis of detected lesions. PET/CT revealed 256 of total 287 sites (sensitivity, 89.2%; accuracy, 84.8%). The sensitivity and accuracy of separating PET, CT, and XR were 86.3%, 70.4%; 47.4%, 50.3%; and 72.8%, 72.4%, respectively. Available BS identified 67 of 202 sites (sensitivity, 33.2%; accuracy, 44.0%). MRI detected 20 of 24 sites (sensitivity, 83.3%; accuracy, 36.3%). False positive rate (FP) of PET, XR, and MRI was as high as 87.8%, 95.1%, and 100%. PET for rib lesion identified 9 of 10 patients (90.0%) but for skull lesion only 4 of 7 patients (57.2%) with underestimation. 5 patients in MRI showed diffuse marrow signal change but only 3 had marrow involvement. But PET/CT showed higher accuracy than MRI. PET/CT was the most useful tool for detecting involving bone of MM comparing with other imaging modalities. Moreover, PET/CT is expected to overcome the limitations for the small osteolytic bone lesions with diffuse FDG uptake on PET
Studies on The Synergistic Effect of Some Irradiated Essential Oils in Some Food Products
International Nuclear Information System (INIS)
Hanafy, M.A.A.
2013-01-01
Cumin, rosemary and thyme essential oils were gamma irradiated. Then, antibacterial and antioxidant activities were studied to measure the synergistic effect of their essential oils mixtures. 4, 6 and 4 kGy were the recommended doses for cumin, rosemary and thyme, respectively according to antimicrobial activity (agar well-diffusion) against S. typhimurium, S. aureus, B. cereus and E. coli. There were no changes in the physiochemical properties due to irradiation but, some changes occurred in the GC/MS analysis where, the amount of oxygenated compounds increased in cumin and thyme essential oils while, the oxygenated compounds decreased in rosemary essential oil. The mixture made from non-irradiated cumin (C 0 ) and rosemary (R 0 ) essential oils were showed the highest antimicrobial activity against E. coil and B. cereus at 50 μl. Mixtures made from non-irradiated cumin and thyme (T 0 ) essential oils showed the highest antimicrobial activity against B. cereus. Mixtures made form irradiated cumin at dose 4 kGy (C 4 ) and rosemary at dose 6 kGy (R 6 ) essential oils introduced promising antimicrobial activity as well as C 0 XR 0 mixture. Fraction inhibitory concentrations (FIC) were studied against selected four bacterial strains for measuring synergistic activity however, (FIC) represented indifference in all essential oils mixtures but, the C 0 X R 0 mixture against B. cereus (0.375) and E. coli (0.375) was synergy (below 0.5). Furthermore, the FIC shows addition in case of R 0 XT 0 , C 2 XR 6 , C 4 XR 6 and R 6 XT 4 against B. cereus. And in case of C 4 XR 6 against S. typhimurium. Preliminary experiment represented that 0.2, 0.4 and 0.1% were the acceptable odor in sunflower oil supplemented with rosemary, cumin and thyme essential oils, respectively.
Radiopotentiation by the oral platinum agent, JM216: role of repair inhibition
International Nuclear Information System (INIS)
Amorino, George P.; Freeman, Michael L.; Carbone, David P.; Lebwohl, David E.; Choy, Hak
1999-01-01
Purpose: To test for in vitro radiopotentiation by the orally-administered platinum (IV) complex, JM216; to compare these results to cisplatin and carboplatin; and to investigate whether the mechanism of radiopotentiation involves repair inhibition of radiation-induced DNA damage. Methods and Materials: H460 human lung carcinoma cells were incubated with the drugs for 1 h at 37 deg. C, irradiated at room temperature, and returned to 37 deg. C for 20 min. Cells were then rinsed and colony forming ability was assessed. Wild-type V79 Chinese hamster cells and radiosensitive, DNA repair-deficient mutant cells (XR-V15B) were also studied along with H460 cells. Ku86 cDNA, which encodes part of a protein involved in DNA repair, was transfected into XR-V15B cells as previously described. The effect of JM216 on sublethal damage repair (SLDR) was also assessed using split-dose recovery. Results: Using equally cytotoxic doses of JM216, cisplatin, and carboplatin, the radiation dose enhancement ratios (DER) were 1.39, 1.31, and 1.20, respectively; the DER with 20 μM JM216 was 1.57. JM216 (20 μM) did not significantly change the final slope of radiation survival curves, but greatly reduced the survival curve shoulder. V79 cells also showed radioenhancement using 20 μM JM216, but no enhancement occurred using XR-V15B cells. Transfection of Ku86 cDNA into XR-V15B cells restored radiopotentiation by JM216 to wild-type V79 levels. In addition, 20 μM JM216 completely inhibited sublethal damage repair in H460 cells. Conclusion: Our results show that JM216 can potentiate the effects of radiation in human lung cancer cells, and that the mechanism of this effect is probably inhibition of DNA repair by JM216
Directory of Open Access Journals (Sweden)
Gislene Auxiliadora Ferreira
2007-09-01
Full Text Available
The experiment was carried out in 1998, at experimental field of Federal University of Goiás – Brazil with the purpose of studying the drop penetration of glyphosate in the millet crop to weed control, using the nozzles XR 1102, XR 11003 and X-3. The effect of drops density was evaluated at three heigths in the row and between row. The results obtained in this experiment showed that X-3 nozzle as the best applicated at apical level of millet plants in the two position evaluated.
KEY-WORDS: Nozzles; glyphosate; density drops.
O experimento foi conduzido no ano agrícola de 1998, na área experimental da Escola de Agronomia da Universidade Federal de Goiás, em Goiânia (GO. Objetivou-se estudar a penetração de glyphosate aplicado com os bicos tipo XR 11002, XR 11003 e X-3 na cultura do milheto, para controle de plantas daninhas e para análise dos efeitos da densidade de gotas dessas aplicações, avaliadas em três alturas nas linhas e entre linhas. Os melhores resultados foram obtidos com o bico X-3, utilizado na altura apical do milheto nas duas posições avaliadas.
PALAVRAS-CHAVE: Bicos de pulverização; densidade de gotas.
Directory of Open Access Journals (Sweden)
Egger Sigrid
2008-12-01
Full Text Available Abstract Background Whole cell-catalyzed biotransformation is a clear process option for the production of chiral alcohols via enantioselective reduction of precursor ketones. A wide variety of synthetically useful reductases are expressed heterologously in Escherichia coli to a high level of activity. Therefore, this microbe has become a prime system for carrying out whole-cell bioreductions at different scales. The limited capacity of central metabolic pathways in E. coli usually requires that reductase coenzyme in the form of NADPH or NADH be regenerated through a suitable oxidation reaction catalyzed by a second NADP+ or NAD+ dependent dehydrogenase that is co-expressed. Candida tenuis xylose reductase (CtXR was previously shown to promote NADH dependent reduction of aromatic α-keto esters with high Prelog-type stereoselectivity. We describe here the development of a new whole-cell biocatalyst that is based on an E. coli strain co-expressing CtXR and formate dehydrogenase from Candida boidinii (CbFDH. The bacterial system was evaluated for the synthesis of ethyl R-4-cyanomandelate under different process conditions and benchmarked against a previously described catalyst derived from Saccharomyces cerevisiae expressing CtXR. Results Gene co-expression from a pETDuet-1 vector yielded about 260 and 90 units of intracellular CtXR and CbFDH activity per gram of dry E. coli cell mass (gCDW. The maximum conversion rate (rS for ethyl 4-cyanobenzoylformate by intact or polymyxin B sulphate-permeabilized cells was similar (2 mmol/gCDWh, suggesting that the activity of CbFDH was partly rate-limiting overall. Uncatalyzed ester hydrolysis in substrate as well as inactivation of CtXR and CbFDH in the presence of the α-keto ester constituted major restrictions to the yield of alcohol product. Using optimized reaction conditions (100 mM substrate; 40 gCDW/L, we obtained ethyl R-4-cyanomandelate with an enantiomeric excess (e.e. of 97.2% in a yield of 82
Review of contemporary neutron radiography in Europe and in the U.S.A
International Nuclear Information System (INIS)
Heiberg, E.
1990-01-01
This paper discusses how neutron radiography (NR) has evolved into a mature NDT/E technology, essentially supplementing information obtainable from that of x-ray radiography (XR). Unique capabilities, however, are the abilities to radiograph radioactive material like nuclear fuel, and to differentiate between isotopes of the same element such as those found in such fuel. Other applications are the detection of inherent hydrogen in corrosion compounds and explosives, and the inspection of the proper location of O-rings in metallic casings. X-ray emulsion film is most commonly employed for the neutron imaging, but track etch offers the superior resolution. Just as for XR, electronic (real time) imaging has great potentially for NR
Development of the Sixty Watt Heat-Source hardware components
International Nuclear Information System (INIS)
McNeil, D.C.; Wyder, W.C.
1995-01-01
The Sixty Watt Heat Source is a nonvented heat source designed to provide 60 thermal watts of power. The unit incorporates a plutonium-238 fuel pellet encapsulated in a hot isostatically pressed General Purpose Heat Source (GPHS) iridium clad vent set. A molybdenum liner sleeve and support components isolate the fueled iridium clad from the T-111 strength member. This strength member serves as the pressure vessel and fulfills the impact and hydrostatic strength requirements. The shell is manufactured from Hastelloy S which prevents the internal components from being oxidized. Conventional drawing operations were used to simplify processing and utilize existing equipment. The deep drawing reqirements for the molybdenum, T-111, and Hastelloy S were developed from past heat source hardware fabrication experiences. This resulted in multiple step drawing processes with intermediate heat treatments between forming steps. The molybdenum processing included warm forming operations. This paper describes the fabrication of these components and the multiple draw tooling developed to produce hardware to the desired specifications. copyright 1995 American Institute of Physics
International Nuclear Information System (INIS)
Shindo, Masami; Kondo, Tatsuo
1976-01-01
A comparative evaluation was made on three commercial nickel-base heat resistant alloys exposed to helium-base atmosphere at 1000 0 C, which contained several impurities in simulating the helium cooled very high temperature nuclear reactor (VHTR) environment. The choice of alloys was made so that the effect of elements commonly found in commercial alloys were typically examined. The corrosion in helium at 1000 0 C was characterized by the sharp selection of thermodynamically unstable elements in the oxidizing process and the resultant intergranular penetration and internal oxidation. Ni-Cr-Mo-W type solution hardened alloy such as Hastelloy-X showed comparatively good resistance. The alloy containing Al and Ti such as Inconel-617 suffered adverse effect in contrast to its good resistance to air oxidation. The alloy nominally composed only of noble elements, Ni, Fe and Mo, such as Hastelloy-B showed least apparent corrosion, while suffered internal oxidation due to small amount of active impurities commonly existing in commercial heats. The results were discussed in terms of selection and improvement of alloys for uses in VHTR and the similar systems. (auth.)
International Nuclear Information System (INIS)
Smailos, E.; Schwarzkopf, W.; Koester, R.
1988-01-01
In order to qualify corrosion resistant materials for high level waste (HLW) packagings acting as a long-term barrier in a rock salt repository, the corrosion behavior of preselected materials is being investigated in laboratory-scale and in-situ experiments. This work reports about in-situ corrosion experiments on unalloyed steels, Ti 99.8-Pd, Hastelloy C4, and iron-base alloys, as nodular cast iron, Ni-Resist D4 and Si-cast iron, under simulated disposal conditions. The results of the investigations can be summarized as follows: (1) all materials investigated exhibited high resistance to corrosion under the conditions prevailing in the Brine Migration Test; (2) all materials and above all the materials with passivating oxide layers such as Ti 99.8-Pd and Hastelloy C4 which may corrode selectively already in the presence of minor amounts of brine had been resistant with respect to any type of local corrosion attack; the gamma-radiation of 3 · 10 2 Gy/h did not exert an influence on the corrosion behavior of the materials
Preparation of YBaCuO superconducting tape by RF magnetron sputtering
Energy Technology Data Exchange (ETDEWEB)
Fukutomi, Masao; Akutsu, Nakao; Tanaka, Yoshiaki; Asano, Toshihisa; Maeda, Hiroshi (National Research Inst. for Metals, Tsukuba (Japan); Mitsui Mining and Smelting Co., Ltd., Tokyo (Japan))
1989-04-01
The effect of buffer layers, conditions of film preparation, and the relation between superconducting characteristics and bombardment of high energy ions on films were discussed in an attempt to fabricate YBaCuO films on metallic substrates by sputtering. Hastelloy-X tapes and Chromel (Ni-10Cr) fine wires were used as metallic substrates, and MgO films as buffer layers, which were provided by sputtering a MgO sintered target and annealing. As a result, superconducting films were favorably obtained on the Hastelloy tapes with the MgO buffer layers, however, counter diffusion at the interface of the film and layer was unavoidable in annealing. C axis-highly oriented film with high zero resistance Tc was obtained in such an arrangement of the target and substrate as to lower the effect of 0{sup {minus}} ion resputtering, resulting in the most favorable Tc=80.4K. YBaCuO superconducting films could be also deposited on a bundle of Chromel fine wires preliminarily. 11 refs., 7 figs.
Molten salt reactors: chemistry
International Nuclear Information System (INIS)
1983-01-01
This work is a critical analysis of the 1000 MW MSBR project. Behavior of rare gases in the primary coolant circuit, their extraction from helium. Coating of graphite by molybdenum, chemistry of protactinium and niobium produced in the molten salt, continuous reprocessing of the fuel salt and use of stainless steel instead of hastelloy are reviewed [fr
Directory of Open Access Journals (Sweden)
A.C.P. Rodrigues-Costa
2010-01-01
Full Text Available Objetivou-se com este trabalho avaliar a ponta XR na deposição da calda de pulverização com diferentes combinações de plantas de feijão, Brachiaria plantaginea e Bidens pilosa, em dois volumes de aplicação, com e sem a adição de surfatante Silwet. Foi utilizado como traçador o corante Azul Brilhante FDC -1 na concentração de 500 ppm para quantificar a deposição. Os tratamentos constituíram-se de sete combinações de plantas: (feijão, (B. plantaginea, (B. pilosa, (feijão + B. plantaginea, (feijão + B. pilosa, (B. plantaginea + B. pilosa e (feijão + B. plantaginea + B. pilosa. O delineamento experimental foi o inteiramente casualizado. Foram avaliadas as pontas de jato plano XR 110015 VS e XR 11002 VS com volumes de aplicação de 150 e 200 L ha-1, respectivamente, com e sem a presença do Silwet a 0,05% v v-1. Após a aplicação, as plantas foram imediatamente coletadas e, em seguida, lavadas em 100 mL de água destilada, para posterior quantificação do traçador em espectrofotômetro. As pontas XR apresentaram comportamento distinto na deposição das gotas de pulverização nas espécies estudadas; a adição de um surfatante à calda de pulverização aumentou a uniformidade da deposição nos alvos e contribuiu para a redução do volume de aplicação.The objective of this study was to evaluate flat fan nozzle spray deposition on different combinations of the common bean plants, Brachiaria plantaginea and Bidens pilosa, in two volumes of application, with and without the addition of surfactant. Brilliant blue FDC -1 was used as tracer solution at the concentration of 500 ppm to evaluate the deposition. The treatments consisted of 7 combinations of plants: (common bean; (B. plantaginea; (B. pilosa; (common bean + B. plantaginea; (common bean + B. pilosa; (B. plantaginea + B. pilosa and (common bean + B. plantaginea + B. pilosa. The experiment was arranged in a randomized block design. The flat fan nozzles XR 110015 VS
International Nuclear Information System (INIS)
Crannell, C.J.; Dennis, B.R.; Dolan, J.F.; Frost, K.J.; Orwig, L.E.; Maurer, G.S.
1977-01-01
High-energy x-ray spectra of the Crab Nebula, Cyg XR-1, and Cen A have been determined from observations with the scintillation spectrometer on board the OSO-8 satellite, launched in June, 1975. Each of these sources was observed over two periods of 8 days or more, enabling a search for day-to-day and year-to-year variations in the spectral and temporal characteristics of the x-ray emission. No variation in the light curve of the Crab pulsar has been found from observations which span a 15-day period in March 1976, with demonstrable phase stability. Transitions associated with the binary phase of Cyg XR-1 and a large change in the emission from Cen A are reported
Gene : CBRC-RNOR-01-0770 [SEVENS
Lifescience Database Archive (English)
Full Text Available pothetical protein LOC685755 (LOC685755), mRNA /gb=XR_006286 /gi=109471595 /ug=Rn.197700 /len=1496 6e-64 70% MFKPQYNYNNNSS...SSNNYNSNNNNSNSSSNNNSNSSSSNNNSNSSNNNSNSNNSNNSNNNSNSSSNNNSNSSNSNSSSNNNSNSSNNYNSNNNSSSSNSS...SNNSNNNNNNSNNNNSNNNSSNSSNSSSNNNSNSSNNNSSNNNSNSNSSNSNSNSSNSNSSSNNSNNNNSNSSNNNNNSSSNNSNNNNSSSNNNNSNSSNNNNNSS...SNNSNNNNNSNNNSNSSNSNSSSNNNNSNSSSNNSNNNNNSNSNSSNSNNNNSNNSNSNSSNNNSNNNNNSNSSNNNSNSNNSNSSNSSSNNSNSSSNNSNNNNNSNNSNSNSS...NSNNNNNSNNSNSNSSNSNSSNNNSNNNNSNSSNSNNNNSNSSNSNSNNSNSNSSNSNSNNSNNSSNSSSSNNNSNSNSS
Energy Technology Data Exchange (ETDEWEB)
Fontainha, C.C.P.; Nolasco, A.V. [Depto. de Engenharia Nuclear - DEN / UFMG - MG, Av. Antonio Carlos 6627, 31270-970 Belo Horizonte, MG (Brazil); Santos, A.P.; Faria, L.O. [Centro de Desenvolvimento da Tecnologia Nuclear, Av. Antonio Carlos 6627, C.P. 941, 30270-901, Belo Horizonte, MG (Brazil)
2015-07-01
Radiation dosimetry is commonly used to prevent deterministic radiation effects in high dose medical procedures. Radiochromic films find nowadays widely application in radiotherapy, interventional procedures and CT exams for isodose and maximum skin dose measurements. Moreover the size of the irradiated area and its distribution can be performed through the reading of the individual components in the RGB-spectrum. Particularly, radiochromic film has multiple advantages over alternative dosimeters for low-kV X-rays dosimetry. Concerned to spatial resolution it is far superior to that of ionization chambers and thermoluminescent dosimeters. For high energy photon fields (keV to MeV) the most used radiochromic film commercially available belongs to the EBT Gafchromic{sup R} series. On the other hand, for low energy photon fields in the x-ray range (20 kVp to 200 kVp) the best choice belongs to the XR-QA Gafchromic{sup R} film series. In this work we demonstrate the possibility of generating 2D images of thin polymeric composites films using EBT3 and XR-QA2 Gafchromic{sup R} films exposed to 6 MeV and 40 keV x-ray photons, respectively, using the digital filtering tools of the ImageJ{sup R} free software. In this context, EBT3 films were placed on the surface of a rigid anthropomorphic phantom. Then, they were covered with a thermoplastic mask made of PCL polymer. This setup was then exposed to 2.0 Gy absorbed dose in the Linear Accelerator beam. The EBT3 films were then scanned in the high resolution mode in a commercial scanner and the images subsequently treated with digital filters. It is somehow possible to see the image of the thermoplastic mask in the scanned image. However, in the treated image it is easy to observe the mask arrangement. The unexpected phenomenon here is the EB3 film ability to detect the attenuation of high energy photons by a plastic material, which in turn has a very low mass-energy attenuation coefficient, producing a very clear 2D image
76 FR 18189 - Procurement List; Additions
2011-04-01
...: Professional Contract Services, Inc., Austin, TX. Contracting Activity: Dept of the Army, XR W40M Natl Region Contract OFC, Washington, DC. Service Type/Location: Prime Vendor Support for Foreign Military Sales...
Energy Technology Data Exchange (ETDEWEB)
Nordeck, Shaun M. [University of Texas Southwestern Medical College, Dallas, TX (United States); University of Texas Southwestern Medical Center, Musculoskeletal Radiology, Dallas, TX (United States); Koerper, Conrad E.; Adler, Aaron [University of Texas Southwestern Medical College, Dallas, TX (United States); Malhotra, Vidur; Xi, Yin [University of Texas Southwestern Medical Center, Musculoskeletal Radiology, Dallas, TX (United States); Liu, George T. [University of Texas Southwestern Medical Center, Orthopaedic Surgery, Dallas, TX (United States); Chhabra, Avneesh [University of Texas Southwestern Medical Center, Musculoskeletal Radiology, Dallas, TX (United States); University of Texas Southwestern Medical Center, Orthopaedic Surgery, Dallas, TX (United States)
2017-05-15
The purpose of this work is to simulate radiographs from isotropic 3D MRI data, compare relationship of angle and joint space measurements on simulated radiographs with corresponding 2D MRIs and real radiographs (XR), and compare measurement times among the three modalities. Twenty-four consecutive ankles were included, eight males and 16 females, with a mean age of 46 years. Segmented joint models simulating radiographs were created from 3D MRI data sets. Three readers independently performed blinded angle and joint space measurements on the models, corresponding 2D MRIs, and XRs at two time points. Linear mixed models and the intraclass correlation coefficient (ICC) was ascertained, with p values less than 0.05 considered significant. Simulated radiograph models were successfully created in all cases. Good agreement (ICC > 0.65) was noted among all readers across all modalities and among most measurements. Absolute measurement values differed between modalities. Measurement time was significantly greater (p < 0.05) on 2D versus simulated radiographs for most measurements and on XR versus simulated radiographs (p < 0.05) for nearly half the measurements. Simulated radiographs can be successfully generated from 3D MRI data; however, measurements differ. Good inter-reader and moderate-to-good intra-reader reliability was observed and measurements obtained on simulated radiograph models took significantly less time compared to measurements with 2D and generally less time than XR. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Matsushika, Akinori; Inoue, Hiroyuki; Murakami, Katsuji; Takimura, Osamu; Sawayama, Shigeki [National Institute of Advanced Industrial Science and Technology, Hiroshima (Japan). Biomass Technology Research Center; Watanabe, Seiya; Kodaki, Tsutomu; Makino, Keisuke [Kyoto Univ. (Japan). Inst. of Advanced Energy
2008-11-15
A recombinant Saccharomyces cerevisiae strain transformed with xylose reductase (XR) and xylitol dehydrogenase (XDH) genes from Pichia stipitis has the ability to convert xylose to ethanol together with the unfavorable excretion of xylitol, which may be due to cofactor imbalance between NADPH-preferring XR and NAD{sup +}-dependent XDH. To reduce xylitol formation, we have already generated several XDH mutants with a reversal of coenzyme specificity toward NADP{sup +}. In this study, we constructed a set of recombinant S. cerevisiae strains with xylose-fermenting ability, including protein-engineered NADP{sup +}-dependent XDH-expressing strains. The most positive effect on xylose-to-ethanol fermentation was found by using a strain named MA-N5, constructed by chromosomal integration of the gene for NADP{sup +}-dependent XDH along with XR and endogenous xylulokinase genes. The MA-N5 strain had an increase in ethanol production and decrease in xylitol excretion compared with the reference strain expressing wild-type XDH when fermenting not only xylose but also mixed sugars containing glucose and xylose. Furthermore, the MA-N5 strain produced ethanol with a high yield of 0.49 g of ethanol/g of total consumed sugars in the nonsulfuric acid hydrolysate of wood chips. The results demonstrate that glucose and xylose present in the lignocellulosic hydrolysate can be efficiently fermented by this redox-engineered strain. (orig.)
Effect of high ionic strength on the extraction of uranium(VI ions
Directory of Open Access Journals (Sweden)
M.K. Nazal
2014-01-01
Full Text Available Preparation and characterization of didodecylphosphoric acid (HDDPA as an extractant in toluene was carried. Mass spectroscopy showed that the monomer peak at 457.4 amu [M–Na+] is double that of the dimer at 891.9 amu [M–M–Na+] and the monomer molecules concentration dominate the dimer molecules in toluene. HDDPA was used as an extractant for the extraction of U(VI ion from perchlorate and nitrate media that have ionic strength (1.00, 3.00, 5.00, 7.00 M. The effect of HDDPA concentration, pcH, ionic strength of supporting electrolytes, and temperature in the range 15–45 °C on the extraction process have been studied. The stoichiometry of the extraction of U(VI ion, the free energy change (ΔG, the enthalpy change (ΔH, the entropy change (ΔS, and Kex at different ionic strength have been calculated. The formula of the complexes, which were formed has been established to be UO2(X(R2(HR2 at pcH equal 2.00 and UO2(X(R2(HR2 and UO2(X(R2 at pcH = 1.00, where (X isClO4- orNO3- and (HR2 is didodecylphosphoric acid monomer, (R2 is the deprotonated didodecylphosphoric acid, where R is the dodecyl group.
Dilauro, Marc; Thornhill, Rebecca; Fasih, Najla
2016-11-01
Preservation of patient privacy and dignity are basic requirements for all patients visiting a hospital. The purpose of this study was to perform an audit of patients' satisfaction with privacy whilst in the Department of Medical Imaging (MI) at the Civic Campus of the Ottawa Hospital. Outpatients who underwent magnetic resonance imaging (MRI), computed tomography (CT), ultrasonography (US), and plain film (XR) examinations were provided with a survey on patient privacy. The survey asked participants to rank (on a 6-point scale ranging from 6 = excellent to 1 = no privacy) whether their privacy was respected in 5 key locations within the Department of MI. The survey was conducted over a consecutive 5-day period. A total of 502 surveys were completed. The survey response rate for each imaging modality was: 55% MRI, 42% CT, 45% US, and 47% XR. For each imaging modality, the total percentage of privacy scores greater than or equal to 5 were: 98% MRI, 96% CT, 94% US, and 92% XR. Privacy ratings for the MRI reception and waiting room areas were significantly higher in comparison to the other imaging modalities (P = .0025 and P = .0227, respectively). Overall, patient privacy was well respected within the Department of MI. Copyright © 2016 Canadian Association of Radiologists. Published by Elsevier Inc. All rights reserved.
75 FR 58367 - Procurement List; Proposed Additions
2010-09-24
...: Services Service Type/Location: Custodial Service, USARC Young Hall, 120 Mini Drive, Vallejo, CA. NPA: Solano Diversified Services, Vallejo, CA. Contracting Activity: Dept of the Army, XR W6BB ACA Presidio of...
Childress, Ann; Newcorn, Jeffrey; Stark, Jeffrey G; McMahen, Russ; Tengler, Mark; Sikes, Carolyn
2016-08-01
To determine the pharmacokinetic (PK) profile of a proprietary formulation of methylphenidate (MPH) in children and adolescents with attention-deficit/hyperactivity disorder (ADHD) in a phase 1 study. Methylphenidate extended-release orally disintegrating tablets (MPH XR-ODTs) combine two technologies in a single-tablet formulation-an extended-release profile that was designed for once-daily dosing in an ODT that does not require water or chewing for ingestion. This was a single-dose, open-label, single-period, single-treatment study, in which 32 children with ADHD who were receiving MPH in doses of 40 or 60 mg before beginning the study each received a 60-mg dose (2 × 30 mg) of MPH XR-ODT. The following plasma PK parameters of MPH were determined for participants grouped by age (6-7, 8-9, 10-12, and 13-17 years old): maximum concentration (Cmax), time to maximum concentration (Tmax), elimination half-life (T½), area under the curve from 0 hours to infinity (AUCinf), oral clearance (CL/F), and volume of distribution in the terminal phase (Vz/F). Safety and tolerability were also assessed. A total of 32 participants received the study drug. For all participants, plasma concentration-time profiles of MPH exhibited a broad peak after administration of MPH XR-ODT through ∼8 hours, indicating extended release from the formulation, followed by an apparent first-order elimination phase. As age increased, MPH exposure decreased and mean estimates of CL/F increased; however, weight-normalized CL/F values were comparable across age groups. Similarly, mean estimates of Vz/F increased with age, but weight-normalization decreased differences across age groups, with the exception of the youngest age group, which had higher values. All adverse events (AEs) were mild. This XR-ODT formulation of MPH demonstrated weight-normalized clearance rates that were consistent across all age groups, a PK profile consistent with once-daily dosing, and an AE profile consistent with
... class of medications called central nervous system (CNS) stimulants. It works by changing the amounts of certain ... a day in the morning with or without food. The long-acting suspension (Quillivant XR) will begin ...
1993-01-01
Order Polynoonlial 900 0 700-. Xr ’A S600.E:’ 500’. -400± w-i... -- 200j -: 0 0’.5 1 1.5 2 2.5 3 Equivalence Ratio (1.0 = Stoichlometric) Figure 8...0_< X < Xr Z(z,s)= eAxZ(O s) +AeA(x-xI)B C’idV-) < X2El ’Z~~2(1 e AZ(0, s) + AleA(x-x’) - eA(x-x’)]Bc’"(’), Z2 < Z ə 12- 6 The matrix exponential...H,0 is applicable to bone mineral as a whole, and (b) that bone contains 70% mineral, all in the form of hydroxyapatite , Ca, 0 (PO,)(OH),." They
International Nuclear Information System (INIS)
Akiyama, Benjamin M.; Laurence, Hannah M.; University of Colorado, Aurora, CO; University of California, Davis, CA; Massey, Aaron R.
2016-01-01
The outbreak of Zika virus (ZIKV) and associated fetal microcephaly mandates efforts to understand the molecular processes of infection. Related flaviviruses produce noncoding subgenomic flaviviral RNAs (sfRNAs) that are linked to pathogenicity in fetal mice. These viruses make sfRNAs by co-opting a cellular exonuclease via structured RNAs called xrRNAs. We found that ZIKV-infected monkey and human epithelial cells, mouse neurons, and mosquito cells produce sfRNAs. The RNA structure that is responsible for ZIKV sfRNA production forms a complex fold that is likely found in many pathogenic flaviviruses. Mutations that disrupt the structure affect exonuclease resistance in vitro and sfRNA formation during infection. The complete ZIKV xrRNA structure clarifies the mechanism of exonuclease resistance and identifies features that may modulate function in diverse flaviviruses.
Materials for advanced high temperature reactors
International Nuclear Information System (INIS)
Graham, L.W.
1977-01-01
Materials are studied in advanced applications of high temperature reactors: helium gas turbine and process heat. Long term creep behavior and corrosion tests are conducted in simulated HTR helium up to 1000 deg C with impurities additions in the furnace atmosphere. Corrosion studies on AISI 321 steels at 800-1000 deg C have shown that the O 2 partial pressure is as low as 10 -24+-3 atm, Ni and Fe cannot be oxidised above about 500 and 600 deg C, Cr cease to oxidise at 800 to 900 deg C and Ti at 900 to 1000 deg C depending on alloy composition γ' strengthened superalloys must depend on a protective corrosion mechanism assisted by the presence of Ti and possibly Cr. Carburisation has been identified metallographically in several high temperature materials: Hastelloy X and M21Z. Alloy TZM appears to be inert in HTR Helium at 900 and 1000 deg C. In alloy 800 and Inconel 625 surface cracks initiation is suppressed but crack propagation is accelerated but this was not apparent in AISI steels, Hastelloy X or fine grain Inconel at 750 deg C
Elvitegravir, Cobicistat, Emtricitabine, and Tenofovir
... so that the medication will have a greater effect. Although the combination of elvitegravir, cobicistat, emtricitabine and ... Gengraf, Neoral, Sandimmune), sirolimus (Rapamune), and tacrolimus (Prograf); oxcarbazepine (Oxtellar XR, Trileptal); perphenazine; quetiapine (Seroquel); phosphodiesterase (PDE5) ...
Compatibility tests between molten salts and metal materials (2)
International Nuclear Information System (INIS)
Shiina, Yasuaki
2003-08-01
Latent heat storage technology using molten salts can reduce temperature fluctuations of heat transfer fluid by latent heat for middle and high temperature regions. This enables us to operate several heat utilization systems in cascade connected to High Temperature Gas Cooled Reactors (HTGRs) from high to low temperature range by setting the latent heat storage system after a heat utilization system to reduce thermal load after the heat utilization systems. This latent heat technology is expected to be used for effective use of heat such as equalization of electric load between night and daytime. In the application of the latent heat technology, compatibility between molten salts and metal materials is very important because molten salts are corrosive, and heat transfer pipes and vessels will contact with the molten salts. It will be necessary to prevail the latent heat storage technique that normal metal materials can be used for the pipes and vessels. However, a few studies have been reported of compatibility between molten salts and metals in middle and high temperature ranges. In this study, four molten salts, range of the melting temperature from 490degC to 800degC, are selected and five metals, high temperature and corrosion resistance steels of Alloy600, HastelloyB2, HastelloyC276, SUS310S and pure Nickel are selected for the test with the consideration of metal composition. Test was performed in an electric furnace by setting the molten salts and the metals in melting pots in an atmosphere of nitrogen. Results revealed excellent corrosion resistance of pure Nickel and comparatively low corrosion resistance of nickel base alloys such as Alloy600 and Hastelloys against Li 2 CO 3 . Corrosion resistance of SUS310S was about same as nickel based alloys. Therefore, if some amount of corrosion is permitted, SUS310S would be one of the candidate alloys for structure materials. These results will be used as reference data to select metals in latent heat technology
Korralikud töövahendid või tavalised savikettad? / Kyösti Isosaari, Marko Toivonen
Isosaari, Kyösti
2017-01-01
Testis 125 x 2 mm lõikekettad süsinikterasele: Exper 14818, IMA Gold, 3M High Perfomance, Mirka M-Cut, Pferd SG-Elastic, Pureva XR3, Rhodius Proline FT33, Rottluff Premiumflex, Tyrolit Premium Long Life
75 FR 34703 - Procurement List; Additions and Deletions
2010-06-18
.... Contracting Activity: DEPT OF THE ARMY, XR W2DF RDECOM ACQ CTR NATICK, NATICK, MA. Service Type/Location: Car Wash Service, Customs and Border Protection/Indio Border Station, 83-801 Vin Deo Circle, Indio, CA. NPA...
Directory of Open Access Journals (Sweden)
Carol M Ulloa
2009-09-01
Full Text Available Carol M Ulloa, Allen Towfigh, Joseph SafdiehDepartment of Neurology and Neuroscience, Weill Medical College of Cornell University, New York, NY, USAAbstract: Levetiracetam is a second-generation antiepileptic drug (AED with a unique chemical structure and mechanism of action. The extended release formulation of levetiracetam (Keppra XR™; UCB Pharma was recently approved by the Food and Drug Administration for adjunctive therapy in the treatment of partial-onset seizures in patients 16 years of age and older with epilepsy. This approval is based on a double-blind, randomized, placebo-controlled, multicenter, multinational trial. Levetiracetam XR allows for once-daily dosing, which may increase compliance and, given the relatively constant plasma concentrations, may minimize concentration-related adverse effects. Levetiracetam’s mode of action is not fully elucidated, but it has been found to target high-voltage, N-type calcium channels as well as the synaptic vesicle protein 2A (SV2A. Levetiracetam has nearly ideal pharmacokinetics. It is rapidly and almost completely absorbed after oral ingestion, is ‹10% protein-bound, demonstrates linear kinetics, is minimally metabolized through a pathway independent of the cytochrome P450 system, has no significant drug–drug interactions, and has a wide therapeutic index. The most common reported adverse events with levetiracetam XR were somnolence, irritability, dizziness, nausea, influenza, and nasopharyngitis. Levetiracetam XR provides an efficacious and well-tolerated treatment option for adjunctive therapy in the treatment of partial-onset seizures.Keywords: levetiracetam, partial-onset seizures, antiepileptic drugs
Gordon, Michael S.; Vocci, Frank J.; Fitzgerald, Terrence T.; O'Grady, Kevin E.; O'Brien, Charles P.
2017-01-01
Background Extended-release naltrexone (XR-NTX), is an effective treatment for opioid use disorder but is rarely initiated in US prisons or with criminal justice populations. Mobile treatment for chronic diseases have been implemented in a variety of settings. Mobile treatment may provide an opportunity to expand outreach to parolees to surmount barriers to traditional clinic treatment. Methods Male and female prisoners (240) with pre-incarceration histories of opioid use disorder who are within one month of release from prison will be enrolled in this randomized clinical trial. Participants are randomized to one of two study arms: 1) [XR-NTX-OTx] One injection of long-acting naltrexone in prison, followed by 6 monthly injections post-release at a community opioid treatment program; or 2) [XR-NTX+ MMTx] One injection of long-acting naltrexone in prison followed by 6 monthly injections post-release at the patient's place of residence utilizing mobile medical treatment. The primary outcomes are: treatment adherence; opioid use; criminal activity; re-arrest; reincarceration; and HIV risk-behaviors. Results We describe the background and rationale for the study, its aims, hypotheses, and study design. Conclusions The use of long-acting injectable naltrexone may be a promising form of treatment for pre-release prisoners. Finally, as many individuals in the criminal justice system drop out of treatment, this study will assess whether treatment at their place of residence will improve adherence and positively affect treatment outcomes. PMID:28011389
Gordon, Michael S; Vocci, Frank J; Fitzgerald, Terrence T; O'Grady, Kevin E; O'Brien, Charles P
2017-02-01
Extended-release naltrexone (XR-NTX), is an effective treatment for opioid use disorder but is rarely initiated in US prisons or with criminal justice populations. Mobile treatment for chronic diseases has been implemented in a variety of settings. Mobile treatment may provide an opportunity to expand outreach to parolees to surmount barriers to traditional clinic treatment. Male and female prisoners (240) with pre-incarceration histories of opioid use disorder who are within one month of release from prison will be enrolled in this randomized clinical trial. Participants are randomized to one of two study arms: 1) [XR-NTX-OTx] One injection of long-acting naltrexone in prison, followed by 6 monthly injections post-release at a community opioid treatment program; or 2) [XR-NTX+ MMTx] One injection of long-acting naltrexone in prison followed by 6 monthly injections post-release at the patient's place of residence utilizing mobile medical treatment. The primary outcomes are: treatment adherence; opioid use; criminal activity; re-arrest; reincarceration; and HIV risk-behaviors. We describe the background and rationale for the study, its aims, hypotheses, and study design. The use of long-acting injectable naltrexone may be a promising form of treatment for pre-release prisoners. Finally, as many individuals in the criminal justice system drop out of treatment, this study will assess whether treatment at their place of residence will improve adherence and positively affect treatment outcomes. ClinicalTrials.gov: NCT02867124. Copyright © 2016 Elsevier Inc. All rights reserved.
Symmetries, causality problems and neutrino fields in antipode universes
International Nuclear Information System (INIS)
Sasse, F.D.
1986-01-01
The S 3 xR and H 3 xR Lie groups are characterized, and using continuous deformations of S 3 and H 3 subgroups algebra, Lorentz space-time metrics with g E left invariance and g D right invariance are introduced. The topology of sections of these space-time is investigated and its relation with global causality problems is shown. In the search of g E and g D isometries, it is shown that in the class of metrics associated to H 3 xR topology, there is a particular case which accepts a G 7 group of isometries. It is shown that the g E and g D metrics characterize universes which vortices of cosmological fluid (when it is present), in relation to the inertial compass, are opposite. In the particular coordinate system, that is used, these metrics differs only by a coordinate inversion transformation. Neutrinos interacting with the geometry of these spaces times is considered. It is shown that the physical transformation which consists in to reverse the universe rotation and to reverse a determined component of neutrino momentum, leads the universe with g E (g D ) metric containing neutrinos, with determined helicity, to another one with g D (g E )metric containing neutrinos, with opposite helicity from the original. Thus, neutrinos can be used to distinguish physically these two universes, supposing that in a given universe neutrinos there is always a type of helicity. (M.C.K.) [pt
Arsenic bioleaching in medical realgar ore and arsenic- bearing ...
African Journals Online (AJOL)
Oxidation of these two ores by sulfuric acid was insignificant, as maximum arsenic leaching ratios ... Poor water solubility and weak gastrointestinal absorption of coarse ..... Wu XH, Sun DH, Zhuang ZX, Wang XR, Gong HF, Hong. JX, Lee FSC.
Czech Academy of Sciences Publication Activity Database
Kašparová, M.; Zahálka, F.; Houdková, Š.; Ctibor, Pavel
2010-01-01
Roč. 48, č. 1 (2010), s. 75-85 ISSN 0023-432X R&D Projects: GA AV ČR 1QS200430560 Institutional research plan: CEZ:AV0Z20430508 Keywords : WC-Hastelloy * abrasive wear * Al2O3 sand * SiO2 sand * braun size * abrasive efficiency Subject RIV: JG - Metallurgy Impact factor: 0.471, year: 2010 http://kovmat.sav.sk/abstract.php?rr=48&cc=1&ss=73
Freeform optics applications in photovoltaic concentration
Miñano Dominguez, Juan Carlos; Benitez Gimenez, Pablo; Zamora Herranz, Pablo; Mendes Lopes, Joao; Buljan, Marina; Santamaria Galdon, Maria Asuncion
2012-01-01
Freeform surfaces are the key of the state-of-the-art nonimaging optics to solve the challenges in concentration photovoltaics. Different families (FK, XR, FRXI) will be presented, based on the SMS 3D design method and Köhler homogenization.
Freeform optics for photovoltaic concentration
Benitez Gimenez, Pablo; Miñano Dominguez, Juan Carlos
2012-01-01
Freeform surfaces are the key of the state-of-the-art nonimaging optics to solve the challenges in concentration photovoltaics. Different families (FK, XR, FRXI) will be presented, based on the SMS 3D design method and Köhler homogenization.
2011-06-17
... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XR75 Essential Fish Habitat (EFH) Components of Fishery Management Plans (Northeast Multispecies, Atlantic Sea Scallop...: E-mail: Habitat[email protected] . Mail: Paul J. Howard, Executive Director, New England Fishery...
Energy Technology Data Exchange (ETDEWEB)
Rolle, D [Didier Saeurebau GmbH, Koenigswinter (Germany); Buehler, H E [Didier-Werke AG, Anlagentechnik, Wiesbaden (Germany); Kalfa, H
1993-01-01
Laboratory tests with synthetic gas waters containing the gases ammonia, carbon dioxide, hydrogen sulphide and hydrogen cyanide were carried out in order to examine the influence of medium components on the corrosion of material No. 1.4539 and nickel based alloys Hastelloy C-4, C-22 and C-276. Hydrogen sulfide was identified as the decisive component for corrosion. For stainless steel corrosion rates of about 2 mm.a[sup -1] were already found at 50deg C in a critical pH-range with sulfide concentrations > 2%. As cyanide stimulates corrosion by dissolving sulfide surface layers by complexation of the iron ions, an increased material loss rate per unit area was found in the critical range with increasing cyanide concentration. The much more stable nickel based alloys only revealed considerable weight losses after being exposed in the autoclave at 100deg C. The graduation of the loss rates C-22 > C-4 > C-276 can be explained by the different contents of high grade alloy elements. The testing of nickel based alloys of the Hastelloy type and of material No. 1.4539 and 1.4571 by means of the dynamic tensile test (CERT-method) revealed no risks of stress corrosion cracking in the tested media. (orig.).
Energy Technology Data Exchange (ETDEWEB)
Suzuki, T. [Ajinomoto Co. Inc., Tokyo (Japan); Ishikawa, K. [Tokyo Metallikon Co. Ltd., Tokyo (Japan); Kitamura, Y. [Kitamura Technical Consultant Office, Kanagawa (Japan)
1994-12-15
With an objective to develop a thermal sprayed coating of environment interruption type that can be sprayed at sites, electrochemical discussions, SEM observation, and EPMA surface analysis were performed on corrosion characteristics in chloride solution of coatings of SUS 304, 316 and Hastelloy C thermally sprayed onto test pieces made of structural steel SS400, as well as the effect of improvement in corrosion resistance by means of a coating reforming treatment. The following conclusions were obtained: the degradation in corrosion resistance of the coatings is attributable to increase in anodic solubility due to appearance of innumerable crevices as a result of deposited particles forming porous structure and due to drop of Cr content in the matrix caused by generation of oxides on the surface of the crevices, by which the corrosion progresses in the form of crevice corrosion; and denseness of the passive coating is lost on the surface of the deposited particles, accelerating the cathodic reaction. A suitable means that could be used practically in chloride solution would be a method to use a material with less crevice susceptibility such as Hastelloy C as a base material, and seal the crevice structure with epoxy resin, etc. 7 refs., 10 figs., 3 tabs.
Immobilization of dendrimers on Si-C linked carboxylic acid-terminated monolayers on silicon(111)
International Nuclear Information System (INIS)
Boecking, Till; Wong, Elicia L.S.; James, Michael; Watson, Jolanta A.; Brown, Christopher L.; Chilcott, Terry C.; Barrow, Kevin D.; Coster, Hans G.L.
2006-01-01
Poly(amidoamine) dendrimers were attached to activated undecanoic acid monolayers, covalently linked to smooth silicon surfaces via Si-C bonds. The resulting ultra-thin dendrimer films were characterized by X-ray photoelectron spectroscopy (XPS), X-ray reflectometry (XR) and atomic force microscopy (AFM). XPS results suggested amide bond formation between the dendrimer and the surface carboxylic acid groups. XR yielded thicknesses of 10 A for the alkyl region of the undecanoic acid monolayer and 12 A for the dendrimer layer, considerably smaller than the diameter of these spherical macromolecules in solution. This was consistent with AFM images showing collapsed dendrimers on the surface. It was concluded that the deformation arose from a large number of amine groups on the surface of each dendrimer reacting efficiently with the activated surface, whereby the dendrimers can deform to fill voids while spreading over the activated surface to form a homogeneous macromolecular layer
International Nuclear Information System (INIS)
Cabello, Adan
2003-01-01
Vaidman described how a team of three players, each of them isolated in a remote booth, could use a three-qubit Greenberger-Horne-Zeilinger state to always win a game which would be impossible to always win without quantum resources. However, Vaidman's method requires all three players to share a common reference frame; it does not work if the adversary is allowed to disorientate one player. Here we show how to always win the game, even if the players do not share any reference frame. The introduced method uses a 12-qubit state which is invariant under any transformation R a xR b xR c (where R a =U a xU a xU a xU a , where U j is a unitary operation on a single qubit) and requires only single-qubit measurements. A number of further applications of this 12-qubit state are described
RBAC-Matrix-based EMR right management system to improve HIPAA compliance.
Lee, Hung-Chang; Chang, Shih-Hsin
2012-10-01
Security control of Electronic Medical Record (EMR) is a mechanism used to manage electronic medical records files and protect sensitive medical records document from information leakage. Researches proposed the Role-Based Access Control(RBAC). However, with the increasing scale of medical institutions, the access control behavior is difficult to have a detailed declaration among roles in RBAC. Furthermore, with the stringent specifications such as the U.S. HIPAA and Canada PIPEDA etc., patients are encouraged to have the right in regulating the access control of his EMR. In response to these problems, we propose an EMR digital rights management system, which is a RBAC-based extension to a matrix organization of medical institutions, known as RBAC-Matrix. With the aim of authorizing the EMR among roles in the organization, RBAC-Matrix also allow patients to be involved in defining access rights of his records. RBAC-Matrix authorizes access control declaration among matrix organizations of medical institutions by using XrML file in association with each EMR. It processes XrML rights declaration file-based authorization of behavior in the two-stage design, called master & servant stage, thus makes the associated EMR to be better protected. RBAC-Matrix will also make medical record file and its associated XrML declaration to two different EMRA(EMR Authorization)roles, namely, the medical records Document Creator (DC) and the medical records Document Right Setting (DRS). Access right setting, determined by the DRS, is cosigned by the patient, thus make the declaration of rights and the use of EMR to comply with HIPAA specifications.
International Nuclear Information System (INIS)
Qing, Yi; Wang, Ge; Wang, Dong; Yang, Xue-Qin; Zhong, Zhao-Yang; Lei, Xin; Xie, Jia-Yin; Li, Meng-Xia; Xiang, De-Bing; Li, Zeng-Peng; Yang, Zhen-Zhou
2010-01-01
The aim of the study was to obtain stable radioresistant sub-lines from the human cervical cancer cell line HeLa by prolonged exposure to 252 Cf neutron and X-rays. Radioresistance mechanisms were investigated in the resulting cells using microarray analysis of DNA damage repair genes. HeLa cells were treated with fractionated 252 Cf neutron and X-rays, with a cumulative dose of 75 Gy each, over 8 months, yielding the sub-lines HeLaNR and HeLaXR. Radioresistant characteristics were detected by clone formation assay, ultrastructural observations, cell doubling time, cell cycle distribution, and apoptosis assay. Gene expression patterns of the radioresistant sub-lines were studied through microarray analysis and verified by Western blotting and real-time PCR. The radioresistant sub-lines HeLaNR and HeLaXR were more radioresisitant to 252 Cf neutron and X-rays than parental HeLa cells by detecting their radioresistant characteristics, respectively. Compared to HeLa cells, the expression of 24 genes was significantly altered by at least 2-fold in HeLaNR cells. Of these, 19 genes were up-regulated and 5 down-regulated. In HeLaXR cells, 41 genes were significantly altered by at least 2-fold; 38 genes were up-regulated and 3 down-regulated. Chronic exposure of cells to ionizing radiation induces adaptive responses that enhance tolerance of ionizing radiation and allow investigations of cellular radioresistance mechanisms. The insights gained into the molecular mechanisms activated by these 'radioresistance' genes will lead to new therapeutic targets for cervical cancer
Czech Academy of Sciences Publication Activity Database
Kovářík, O.; Haušild, P.; Čapek, J.; Medřický, Jan; Siegl, J.; Mušálek, Radek; Pala, Zdeněk; Curry, N.; Bjorklund, S.
2016-01-01
Roč. 82, January (2016), s. 300-309 ISSN 0142-1123. [International Conference on Fatigue Damage of Structural Materials Conference/10./. Massachusetts, 21.09.2014-26.09.2014] R&D Projects: GA ČR GB14-36566G Institutional support: RVO:61389021 Keywords : Crack detection * Damping * Fatigue * Hastelloy-X * Nondestructive test ing Subject RIV: JK - Corrosion ; Surface Treatment of Materials Impact factor: 2.899, year: 2016 http://www.sciencedirect.com/science/article/pii/S0142112315002443
Czech Academy of Sciences Publication Activity Database
Kovářík, O.; Haušild, P.; Čapek, J.; Medřický, Jan; Siegl, J.; Mušálek, Radek; Pala, Zdeněk; Curry, N.; Bjorklund, S.
2016-01-01
Roč. 82, January (2016), s. 300-309 ISSN 0142-1123. [International Conference on Fatigue Damage of Structural Materials Conference/10./. Massachusetts, 21.09.2014-26.09.2014] R&D Projects: GA ČR GB14-36566G Institutional support: RVO:61389021 Keywords : Crack detection * Damping * Fatigue * Hastelloy-X * Nondestructive testing Subject RIV: JK - Corrosion ; Surface Treatment of Materials Impact factor: 2.899, year: 2016 http://www.sciencedirect.com/science/article/pii/S0142112315002443
Journal of Biosciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Given the potential application of xylose reductase enzymes that preferentially utilize the reduced form of nicotinamide adenine dinucleotide (NADH) rather than NADPH in the fermentation of five carbon sugars by genetically engineered microorganisms, the coenzyme selectivity of TeXR was altered by site-directed ...
Fourth Power Diophantine Equations in Gaussian Integers
Indian Academy of Sciences (India)
25
The method of Yasutaka Suzuki [9] determined all solutions of the equation. 2aXr +2bY s = 2cZt in ... Department of Pure Mathematics, Faculty of Science, Urmia University, Urmia 165-57153,. Iran. E-mail: ..... Japan Acad., 72,. Ser A, (1996). 9.
African Journal of Biotechnology - Vol 14, No 12 (2015)
African Journals Online (AJOL)
Effects of temperature, light, desiccation and cold storage on germination of Sophora tonkinensis (Leguminosae) seeds · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. X Pu, YF Huang, CL Pan, L Yao, XR Ai, ZJ Deng, 1015-1019 ...
Planck 2013 results. XXVI. Background geometry and topology of the Universe
DEFF Research Database (Denmark)
Planck Collaboration,; Ade, P. A. R.; Aghanim, N.
2013-01-01
Planck CMB temperature maps allow us to detect departures from homogeneity and isotropy on the largest scales. We search for topology with a fundamental domain (nearly) intersecting the last scattering surface (comoving distance X_r). For most topologies studied the likelihood maximized over the ...
2003-01-01
Authenticat’n (XCBF) Authorizat’n (XACML) (SAML) Privacy (P3P) Digital Rights Management (XrML) Content Mngmnt (DASL) (WebDAV) Content Syndicat’n...Registry/ Repository BPSS eCommerce XML/EDI Universal Business Language (UBL) Internet & Computing Human Resources (HR-XML) Semantic KEY XML SPECIFICATIONS
Abiotic nitrate and sulphate reduction by hydrogen: a comparative experimental study
International Nuclear Information System (INIS)
Truche, L.; Berger, G.; Albrecht, A.; Giffaut, E.
2010-01-01
Document available in extended abstract form only. The bituminous waste which is part of the intermediate level, long-lived waste (MAVL) is characterised, amongst others, by the coexistence of nitrates, sulphates, organic matter, native metals and hydrogen gas in the waste mixture and package. It can be considered as the most complex example that will be used to discuss redox reactions occurring in such waste mixtures. The evaluation of the redox conditions requires quantification of the amount of electron acceptors and donors and definition of the kinetics of redox reaction. The objectives of an experimental study to unravel some of these reaction complexities are: - to investigate nature and rate of sulphate and nitrate reduction by hydrogen in the presence of different catalysts (stainless steel, hastelloy, magnetite and argillite); - to compare sulphate and nitrate as electron acceptors; - to provide a mechanistic model of these reactions. It is well known that reduction of sulphate and nitrate requires high activation energies, usually supplied either by thermal processes or via bacterial and surface catalysis, of which the latter has been investigated in this study. Preliminary experiments performed at 150 deg. C and under H 2 pressure show that sulphate reduction is enhanced in the presence of magnetite, but essentially under the restricted condition of low sulphate concentration and at a pH below the Point of Zero Charge of magnetite. This suggests that sorption of sulphate contributes to the catalysed reaction (at low pH) but provided that the magnetite surface sites are not saturated with respect to aqueous sulphate (low concentration). On the contrary, nitrate reduction is observed whatever the pH and the nitrate concentration in the presence of both magnetite and hastelloy C276 (Ni, Cr, Mo, W, Fe alloy). The effect of temperature on the rate of nitrate reduction (500 ppm KNO 3 solution) is shown by comparing three different experiments conducted in
Kay, Gary G.; Michaels, M. Alex; Pakull, Barton
2009-01-01
Background: Psychostimulant treatment may improve simulated driving performance in young adults with attention-deficit/hyperactivity disorder (ADHD). Method: This was a randomized, double-blind, placebo-controlled, crossover study of simulated driving performance with mixed amphetamine salts--extended release (MAS XR) 50 mg/day (Cohort 1) and…
C2 Product-Centric Approach to Transforming Current C4ISR Information Architectures
2004-06-01
SAML) Privacy (P3P) Digital Rights Management (XrML) Content Mngmnt (DASL) (WebDAV) Content Syndicat’n (ICE) (RSS) Ontology (OML) (OWL) Resource...RNIF Registry/ Repository BPSS eCommerce XML/EDI Universal Business Language (UBL) Internet & Computing Human Resources (HR-XML) Semantic C2RM
The yeast Scheffersomyces amazonensis is an efficient xylitol producer.
Cadete, Raquel M; Melo-Cheab, Monaliza A; Viana, Adriana L; Oliveira, Evelyn S; Fonseca, César; Rosa, Carlos A
2016-12-01
This study assessed the efficiency of Scheffersomyces amazonensis UFMG-CM-Y493 T , cultured in xylose-supplemented medium (YPX) and rice hull hydrolysate (RHH), to convert xylose to xylitol under moderate and severe oxygen limitation. The highest xylitol yields of 0.75 and 1.04 g g -1 in YPX and RHH, respectively, were obtained under severe oxygen limitation. However, volumetric productivity in RHH was ninefold decrease than that in YPX medium. The xylose reductase (XR) and xylitol dehydrogenase (XDH) activities in the YPX cultures were strictly dependent on NADPH and NAD + respectively, and were approximately 10% higher under severe oxygen limitation than under moderate oxygen limitation. This higher xylitol production observed under severe oxygen limitation can be attributed to the higher XR activity and shortage of the NAD + needed by XDH. These results suggest that Sc. amazonensis UFMG-CM-Y493 T is one of the greatest xylitol producers described to date and reveal its potential use in the biotechnological production of xylitol.
77 FR 14445 - Application for a License To Export Steel Forging
2012-03-09
... NUCLEAR REGULATORY COMMISSION Application for a License To Export Steel Forging Pursuant to 10 CFR 110.70(b) ``Public Notice of Receipt of an Application,'' please take notice that the Nuclear... head steel February 7, 2012 forging. forging will be XR175 machined into the 11005983 finished vessel...
Hamed, Rania; AlJanabi, Reem; Sunoqrot, Suhair; Abbas, Aiman
2017-08-01
The objective of this study was to investigate the effect of the different physiological parameters of the gastrointestinal (GI) fluid (pH, buffer capacity, and ionic strength) on the in vitro release of the weakly basic BCS class II drug quetiapine fumarate (QF) from two once-a-day matrix tablet formulations (F1 and F2) developed as potential generic equivalents to Seroquel ® XR. F1 tablets were prepared using blends of high and low viscosity grades of hydroxypropyl methylcellulose (HPMC K4M and K100LV, respectively), while F2 tablets were prepared from HPMC K4M and PEGylated glyceryl behenate (Compritol ® HD5 ATO). The two formulations attained release profiles of QF over 24 h similar to that of Seroquel ® XR using the dissolution medium published by the Food and Drug Administration (FDA). A series of solubility and in vitro dissolution studies was then carried out using media that simulate the gastric and intestinal fluids and cover the physiological pH, buffer capacity and ionic strength range of the GIT. Solubility studies revealed that QF exhibits a typical weak base pH-dependent solubility profile and that the solubility of QF increases with increasing the buffer capacity and ionic strength of the media. The release profiles of QF from F1, F2 and Seroquel ® XR tablets were found to be influenced by the pH, buffer capacity and ionic strength of the dissolution media to varying degrees. Results highlight the importance of studying the physiological variables along the GIT in designing controlled release formulations for more predictive in vitro-in vivo correlations.
Testing and analyses of a high temperature duct for gas-cooled reactors
International Nuclear Information System (INIS)
Black, W.E.; Roberge, A.; Felten, P.; Bastien, R.
1979-01-01
A 0.6 scale model of a steam cycle gas-cooled reactor high temperature duct was tested in a closed loop helium facility. The object of the test series was to determine: 1) the thermal effects of gas permeation within the thermal barrier, 2) the plastic deformation of the metallic components, and 3) the thermal performance of the fibrous insulation. A series of tests was performed with thermal cyclings from 100 0 C to 760 0 C at 50 atmospheres until the system thermal performance had stabilized hence enabling predictions for the reactor life. Additional tests were made to assess permeation by deliberately simulating sealing weld failures thereby allowing gas flow by-pass within the primary thermal barrier. After 100 cycles the entire primary structure was found to have performed without structural failure. Due to high pressures exerted by the insulation on the cover plates and a design oversight, the thin seal sheets were unable to expand in an anticipated manner. Local buckling resulted. Pre and post test metallurgical analyses were conducted on the Hastelloy-X structures and reference specimens. The results gave evidence of aging in the form of noticeable changes in room temperature tensile and reduction in area parameters. The Hastelloy-X welds exhibited greater changes in properties due to thermal aging. The antifriction coating (Cr 3 C 2 ) performed well without spallation or excessive wear. (orig.)
Directory of Open Access Journals (Sweden)
Hawkins Gary M
2011-11-01
Full Text Available Abstract Background Softwoods are the dominant source of lignocellulosic biomass in the northern hemisphere, and have been investigated worldwide as a renewable substrate for cellulosic ethanol production. One challenge to using softwoods, which is particularly acute with pine, is that the pretreatment process produces inhibitory compounds detrimental to the growth and metabolic activity of fermenting organisms. To overcome the challenge of bioconversion in the presence of inhibitory compounds, especially at high solids loading, a strain of Saccharomyces cerevisiae was subjected to evolutionary engineering and adaptation for fermentation of pretreated pine wood (Pinus taeda. Results An industrial strain of Saccharomyces, XR122N, was evolved using pretreated pine; the resulting daughter strain, AJP50, produced ethanol much more rapidly than its parent in fermentations of pretreated pine. Adaptation, by preculturing of the industrial yeast XR122N and the evolved strains in 7% dry weight per volume (w/v pretreated pine solids prior to inoculation into higher solids concentrations, improved fermentation performance of all strains compared with direct inoculation into high solids. Growth comparisons between XR122N and AJP50 in model hydrolysate media containing inhibitory compounds found in pretreated biomass showed that AJP50 exited lag phase faster under all conditions tested. This was due, in part, to the ability of AJP50 to rapidly convert furfural and hydroxymethylfurfural to their less toxic alcohol derivatives, and to recover from reactive oxygen species damage more quickly than XR122N. Under industrially relevant conditions of 17.5% w/v pretreated pine solids loading, additional evolutionary engineering was required to decrease the pronounced lag phase. Using a combination of adaptation by inoculation first into a solids loading of 7% w/v for 24 hours, followed by a 10% v/v inoculum (approximately equivalent to 1 g/L dry cell weight into 17
Bond, GR; Steele, PE; Uges, DRA
2003-01-01
Case report: A 13-yr-old girl overdosed on 48 x 150 mg venlafaxine (Effexor XR(R)). She was taking venlafaxine regularly for depression. Her only other medications included topical Benzamycin and pyridoxine 50 mg daily for acne. The Abbott AxSYM(R) assay was positive only for phencyclidine, but
Ehsan Bari; Reza Oladi; Olaf Schmidt; Carol A. Clausen; Katie Ohno; Darrel D. Nicholas; Mehrdad Ghodskhah Daryaei; Maryam Karim
2015-01-01
The scope of this research was to evaluate the influence of xylem ray (XR) and degree of polymerization (DP) of holocellulose in Oriental beech wood (Fagus orientalis Lipsky.) on impact bending strength against two white-rot fungi. Beech wood specimens, exposed to Pleurotus ostreatus and Trametes versicolor, were evaluated for...
DEFF Research Database (Denmark)
Einholm, Anja P; Pedersen, Katrine E; Wind, Troels
2003-01-01
-inactivated PAI-1 is inert to reaction with its target proteases and has a decreased susceptibility to non-target proteases, in spite of a generally increased proteolytic susceptibility of specific peptide bonds elsewhere in PAI-1. The properties of XR5118-inactivated PAI-1 were different from those of the so...
Recycling carbon dioxide during xylose fermentation by engineered Saccharomyces cerevisiae
In this study, we introduced the ribulose-1,5-bisphosphate carboxylase/oxygenase (RuBisCO) and phosphoribulokinase (PRK) into an engineered S. cerevisiae (SR8) harboring the XR/XDH pathway and up-regulated PPP 10, to enable CO2 recycling through a synthetic rPPP during xylose fermentation (Fig. 1). ...
2011-12-09
...-XR52 Marine Mammals AGENCY: National Marine Fisheries Service (NMFS), National Oceanic and Atmospheric.... 14534 is requested under the authority of the Marine Mammal Protection Act of 1972, as amended (16 U.S.C. 1361 et seq.), the regulations governing the taking and importing of marine mammals (50 CFR part 216...
Directory of Open Access Journals (Sweden)
Cleber D. de G. Maciel
2007-01-01
Full Text Available O trabalho teve como objetivo estudar o desempenho de pontas de pulverização na deposição da calda inseticida para o controle de ninfas de cigarrinhas das pastagens em Brachiaria brizantha cv. MG-4. Doze tratamentos foram estudados em esquema fatorial 6x2, constituídos pelo contraste de seis pontas de pulverização e pressões de 196 e 392 kPa: TF-VP2 (336 L ha-1 e 467 L ha-1; AI11002-VS (184 L ha-1 e 200 L ha-1; XR11002-VS (200 L ha-1 e 280 L ha-1; TT11002-VP (200 L ha-1 e 280 L ha-1; TJ60-11002VS (208 L ha-1 e 280 L ha-1 e TX-VK4 (72 L ha-1 e 97 L ha-1. Para monitorar a deposição das caldas de pulverização, utilizaram-se os traçadores Azul Brilhante FD&C-1 (0,3% p/v e Amarelo de Tartrasina FD&C-5 (0,6% p/v. Alvos artificiais, constituídos de lâminas de vidro, foram posicionados na base das plantas, próximos à superfície do solo, e os depósitos por unidade de área das soluções pulverizadas foram quantificados por espectrofotometria. As pontas TF-VP2, XR11002-VS e AI11002-VS, nas pressões de 196 e 392 kPa, proporcionam as maiores deposições da calda de pulverização na região das espumas das cigarrinhas das pastagens, apesar de apresentarem menor uniformidade na distribuição dos depósitos em relação a TX-VK4, XR110.02-VS e TJ110.02-VS. O aumento da pressão de 196 para 392 kPa promoveu aumento na deposição da calda de pulverização sobre a Brachiaria brizantha e na região onde se encontram as espumas das cigarrinhas para todos os tipos de pontas estudadas.The work aimed to study spray nozzles performance in pesticide sprayer deposition for controlling pastures spittlebugs nymphs in Brachiaria brizantha cv. MG-4 pasture. Twelve treatments were studied in factorial scheme 6x2, constituted by the contrast of six spray nozzles and 196 and 392 kPa work pressures: TF-VP2 (336 L ha-1 and 467 L ha-1; AI11002-VS (184 L ha-1 and 200 L ha-1; XR11002-VS (200 L ha-1 and 280 L ha-1; TT11002-VP (200 L ha-1 and 280 L ha¹; TJ60
International Nuclear Information System (INIS)
Smailos, E.; Schwarzkopf, W.; Koester, R.
1987-05-01
Extensive laboratory-scale experiments to evaluate the long-term corrosion behaviour of selected materials in brines and first in situ experiments were performed. In the laboratory experiments the materials Ti 99.8-Pd, Hastelloy C4 and hot-rolled low carbon steel as well cast steel, spheroidal cast iron, Si-cast iron and the Ni-Resists type D2 and D4 were investigated. The investigated parameters were: temperature, gamma-radiation and different compositions of salt brines. (orig./PW) [de
Fatigue performance of TBCs on Hastelloy X substrate during cyclic bending
Czech Academy of Sciences Publication Activity Database
Mušálek, Radek; Kovářík, O.; Tomek, L.; Medřický, Jan; Pala, Zdeněk; Haušild, P.; Čapek, J.; Kolařík, K.; Curry, N.; Bjorklund, S.
2016-01-01
Roč. 25, 1-2 (2016), s. 231-243 ISSN 1059-9630. [ITSC 2015: International Thermal Spray Conference and Exposition. Long Beach, California, 11.05.2015-14.05.2015] R&D Projects: GA ČR GB14-36566G Institutional support: RVO:61389021 Keywords : atmospheric plasma spray * failure mechanism * fatigue * HVAF * NiCoCrAlY * thermal barrier coatings * yttria-stabilized zirconia Subject RIV: JK - Corrosion ; Surface Treatment of Materials Impact factor: 1.488, year: 2016 http://link.springer.com/article/10.1007%2Fs11666-015-0321-4
Bergen, A. A.; Wapenaar, M. C.; Schuurman, E. J.; Diergaarde, P. J.; Lerach, H.; Monaco, A. P.; Bakker, E.; Bleeker-Wagemakers, E. M.; van Ommen, G. J.
1993-01-01
Differential Alu PCR fingerprint cloning was used to isolate a DNA probe from the Xp11.4-->p11.21 region of the human X chromosome. This novel sequence, cpXr318 (DXS742), detects a new submicroscopic deletion interval at the Norrie disease locus (NDP). Combining our data with the consensus genetic
Abstracts, 21st Annual Meeting Society of Engineering Science, Inc., October 15, 16 and 17, 1984.
1984-01-01
and hydroxyapatite (HAP) crystal is expected to offer an explation for mineralization alongwith suggestion to design new composite materials (1). In the...the contribution to the presbure field and the deformation of the free surface is zero. The velocity field assumes the form ro l ( Xr ) i t r0 I 1 (-r
75 FR 18164 - Procurement List: Proposed Additions and Deletions
2010-04-09
... . SUPPLEMENTARY INFORMATION: This notice is published pursuant to 41 U.S.C. 47(a)(2) and 41 CFR 51-2.3. Its.../Location: Janitorial Services, Corp of Engineers Buildings, Elmendorf AFB, AK, Corp of Engineers Buildings, Fort Richardson, AK. NPA: MQC Enterprises, Inc., Anchorage, AK. Contracting Activity: XR W2SN ENDIST...
Jain, Rakesh; Segal, Scott; Kollins, Scott H.; Khayrallah, Moise
2011-01-01
Objective: This study examined the efficacy and safety of clonidine hydrochloride extended-release tablets (CLON-XR) in children and adolescents with attention-deficit/hyperactivity disorder (ADHD). Method: This 8-week, placebo-controlled, fixed-dose trial, including 3 weeks of dose escalation, of patients 6 to 17 years old with ADHD evaluated the…
Energy Technology Data Exchange (ETDEWEB)
Fontainha, C. C. P. [Universidade Federal de Minas Gerais, Departamento de Engenharia Nuclear, Av. Pte. Antonio Carlos 6627, 31270-901 Belo Horizonte, Minas Gerais (Brazil); Baptista N, A. T.; Faria, L. O., E-mail: crissia@gmail.com [Centro de Desenvolvimento da Tecnologia Nuclear / CNEN, Av. Pte. Antonio Carlos 6627, 31270-901 Belo Horizonte, Minas Gerais (Brazil)
2015-10-15
Full text: Medical radiology offers great benefit to patients. However, although specifics procedures of high dose, as fluoroscopy, Interventional Radiology, Computed Tomography (CT) make up a small percent of the imaging procedures, they contribute to significantly increase dose to population. The patients may suffer tissue damage. The probability of deterministic effects incidence depends on the type of procedure performed, exposure time, and the amount of applied dose at the irradiated area. Calibrated radiochromic films can identify size and distribution of the radiated fields and measure intensities of doses. Radiochromic films are sensitive for doses ranging from 0.1 to 20 c Gy and they have the same response for X-rays effective energies ranging from 20 to 100 keV. New radiation attenuators materials have been widely investigated resulting in dose reduction entrance skin dose. In this work, Bi{sub 2}O{sub 3} and ZrO{sub 2}:8 % Y{sub 2}O{sub 3} composites were obtained by mixing them with P(VDF-Tr Fe) copolymers matrix from casting method and then characterized by Ftir. Dosimetric measurements were obtained with Xr-Q A2 Gafchromic radiochromic films. In this setup, one radiochromic film is directly exposed to the X-rays beam and another one measures the attenuated beam were exposed to an absorbed dose of 10 mGy of RQR5 beam quality (70 kV X-ray beam). Under the same conditions, irradiated Xr-Q A2 films were stored and scanned measurement in order to obtain a more reliable result. The attenuation factors, evaluated by Xr-Q A2 radiochromic films, indicate that both composites are good candidates for use as patient radiation shielding in high dose medical procedures. (Author)
Design, Build and Test of an Axial Flow Hydrokinetic Turbine with Fatigue Analysis
2010-06-01
hord, Radius, Pitch, etc. I.*CL/CLI,RG,’pchip’,’ extrap ’); % Nose-tail pitch angle, ; % Pitch / propeller diameter, [ ] section chord at the...thick % CoD = interp1(RC,CoD,RG,’pchip’,’ extrap ’); CoD = pchip(XR,XCoD,RG); % Thesis4: thickness profile TTRF = 0.5
Strings as multi-particle states of quantum sigma-models
International Nuclear Information System (INIS)
Gromov, Nikolay; Kazakov, Vladimir; Sakai, Kazuhiro; Vieira, Pedro
2007-01-01
We study the quantum Bethe ansatz equations in the O(2n) sigma-model for physical particles on a circle, with the interaction given by the Zamolodchikovs'S-matrix, in view of its application to quantization of the string on the S 2n-1 xR t space. For a finite number of particles, the system looks like an inhomogeneous integrable O(2n) spin chain. Similarly to OSp(2m+n|2m) conformal sigma-model considered by Mann and Polchinski, we reproduce in the limit of large density of particles the finite gap Kazakov-Marshakov-Minahan-Zarembo solution for the classical string and its generalization to the S 5 xR t sector of the Green-Schwarz-Metsaev-Tseytlin superstring. We also reproduce some quantum effects: the BMN limit and the quantum homogeneous spin chain similar to the one describing the bosonic sector of the one-loop N=4 super-Yang-Mills theory. We discuss the prospects of generalization of these Bethe equations to the full superstring sigma-model
Inoue, Hiroyuki; Hashimoto, Seitaro; Matsushika, Akinori; Watanabe, Seiya; Sawayama, Shigeki
2014-12-01
The industrial Saccharomyces cerevisiae IR-2 is a promising host strain to genetically engineer xylose-utilizing yeasts for ethanol fermentation from lignocellulosic hydrolysates. Two IR-2-based haploid strains were selected based upon the rate of xylulose fermentation, and hybrids were obtained by mating recombinant haploid strains harboring heterogeneous xylose dehydrogenase (XDH) (wild-type NAD(+)-dependent XDH or engineered NADP(+)-dependent XDH, ARSdR), xylose reductase (XR) and xylulose kinase (XK) genes. ARSdR in the hybrids selected for growth rates on yeast extract-peptone-dextrose (YPD) agar and YP-xylose agar plates typically had a higher activity than NAD(+)-dependent XDH. Furthermore, the xylose-fermenting performance of the hybrid strain SE12 with the same level of heterogeneous XDH activity was similar to that of a recombinant strain of IR-2 harboring a single set of genes, XR/ARSdR/XK. These results suggest not only that the recombinant haploid strains retain the appropriate genetic background of IR-2 for ethanol production from xylose but also that ARSdR is preferable for xylose fermentation.
Scaling Laws of Nitrogen Soft X-Ray Yields from 1 to 200 kJ Plasma Focus
International Nuclear Information System (INIS)
Akel, M.; Lee, S.
2013-01-01
Numerical experiments are carried out systematically to determine the nitrogen soft x-ray yield for optimized nitrogen plasma focus with storage energy E 0 from 1 kJ to 200 kJ. Scaling laws on nitrogen soft x-ray yield, in terms of storage energies E 0 , peak discharge current I p eak and focus pinch current I p inch were found. It was found that the nitrogen x-ray yields scales on average with y s xr, N= 1.93xE o 1 .21 J (E 0 in kJ) with the scaling showing gradual deterioration as E 0 rises over the range. A more robust scaling is y s xr = 8x10 - 8I 0 3.38 p inch . The optimum nitrogen soft x-ray yield emitted from plasma focus is found to be about 1 kJ for storage energy of 200 kJ. This indicates that nitrogen plasma focus is a good water-window soft x-ray source when properly designed. (author)
Definition of the size of nanoclusters of silver and palladium in carbon fiber
International Nuclear Information System (INIS)
Volobuev, V.S.; Bashmakov, I.A.; Lukashevich, S.M.; Tolkacheva, E.A.; Tikhonova, T.F.; Lukashevich, M.G.; Kaputskij, F.N.
2008-01-01
Size of palladium and silver nanoclusters is carbon matrix prepared by heart treatment of metal-polymer precursor has been determined by means of XR diffractions study. It was shown that the cluster size increases with increasing annealing temperature from 700 to 900 degree Celsius by factor two. No structuring of carbon matrix was observed under clusters forming. (authors)
Tactical Planning Workstation Software Description
1990-09-01
menus an application wishes to use. It is only concerned with the location of the physically displayed objects within a form. The valid form fields...WAR COLLGE Numeric 4 N 16 ASG_FULDA Logical 1 N 17 XR_FULDA Logical 1 N 18 CMP COURSE Logical 1 N 19 MINIFREQ Character 1 N 20 WORKFREQ Character 1 N
Birkhoff's theorem for three-dimensional AdS gravity
International Nuclear Information System (INIS)
Ayon-Beato, Eloy; Martinez, Cristian; Zanelli, Jorge
2004-01-01
All three-dimensional matter-free space-times with negative cosmological constant, compatible with cyclic symmetry, are identified. The only cyclic solutions are the 2+1 (BTZ) black hole with SO(2)xR isometry, and the self-dual Coussaert-Henneaux space-times, with isometry groups SO(2)xSO(2,1) or SO(2)xSO(2)
An Annotated Bibliography of Patents Related to Coastal Engineering. Volume II. 1971-1973. Appendix.
1979-11-01
implosive acoustic (,enerake Do Geophysique . Paris, Framn transmitter Filed July 31. 1970. Sir. No. S9.983 Claims priority. appicatioa Frame. Aug. i... Geophysique , Paris, France Filed Jan. 23, 1969, Ser. No. 793,41$ U.S. Cl. X.R. 116-137R; 3407; 340-17 Int. CL GOIv 1102 U.S. CL. 181--.5 H 7 Claims A
Torsion zero-cycles and the Abel-Jacobi map over the real numbers
Hamel, J. van
1999-01-01
This is a study of the torsion in the Chow group of zero-cycles on a variety over the real numbers. The first section recalls important results from the literature. The rest of the paper is devoted to the study of the AbelJacobi map a: A0XAlbXR restricted to torsion subgroups. Using Roitmans
Yong-Su Jin; Thomas W. Jeffries
2003-01-01
We changed the fluxes of xylose metabolites in recombinant Saccharomyces cerevisiae by manipulating expression of Pichia stipitis genes(XYL1 and XYL2) coding for xylose reductase (XR) and xylitol dehydrogenase (XDH), respectively. XYL1 copy number was kept constant by integrating it into the chromosome. Copy numbers of XYL2 were varied either by integrating XYL2 into...
Modifier constraints in alkali ultraphosphate glasses
DEFF Research Database (Denmark)
Rodrigues, B.P.; Mauro, J.C.; Yue, Yuanzheng
2014-01-01
In applying the recently introduced concept of cationic constraint strength [J. Chem. Phys. 140, 214501 (2014)] to bond constraint theory (BCT) of binary phosphate glasses in the ultraphosphate region of xR2O-(1-x)P2O5 (with x ≤ 0.5 and R = {Li, Na, Cs}), we demonstrate that a fundamental limitat...
International Nuclear Information System (INIS)
Tallant, David Robert; Garcia, Manuel Joseph; Majewski, Jaroslaw; Kent, Michael Stuart; Yim, Hyun
2005-01-01
Thin films of organosilanes have great technological importance in the areas of adhesion promotion, durability, and corrosion resistance. However, it is well-known that water can degrade organosilane films, particularly at elevated temperatures. In this work, X-ray and neutron reflectivity (XR and NR) were combined with attenuated total reflection infrared (ATR-IR) spectroscopy to study the chemical and structural changes within thin films of (3-glycidoxypropyl)trimethoxysilane (GPS) after exposure for various periods of time to air saturated with either D 2 O or H 2 O at 80 C. For NR and XR, ultrathin (∼100 (angstrom)) films were prepared by spin-coating. Both D 2 O and H 2 O provide neutron scattering contrast with GPS. Variations in the neutron scattering length density (SLD) profiles (a function of mass density and atomic composition) with conditioning time were measured after drying the samples out and also swelled with H 2 O or D 2 O vapor at room temperature. For samples that were dried out prior to measurement, little or no change was observed for H 2 O conditioning up to 3.5 days, but large changes were observed after 30 days of conditioning. The range of conditioning time for this structural change was narrowed to between 4 and 10 days with XR. The SLD profiles indicated that the top portion of the GPS film was transformed into a thick low-density layer after conditioning, but the bottom portion showed little structural change. A previous NR study of as-prepared GPS films involving swelling with deuterated nitrobenzene showed that the central portion of the film has much lower cross-link density than the region nearest the substrate. The present data show that the central portion also swells to a much greater extent with water and hydrolyzes more rapidly. The chemical degradation mechanism was identified by IR as hydrolysis of siloxane bonds. For ATR-IR, GPS films were prepared by dip-coating, which resulted in a greater and more variable thickness than
Studies on neutron irradiation effects of iron alloys and nickel-base heat resistant alloys
International Nuclear Information System (INIS)
Watanabe, Katsutoshi
1987-09-01
The present paper describes the results of neutron irradiation effects on iron alloys and nickel-base heat resistant alloys. As for the iron alloys, irradiation hardening and embrittlement were investigated using internal friction measurement, electron microscopy and tensile testings. The role of alloying elements was also investigated to understand the irradiation behavior of iron alloys. The essential factors affecting irradiation hardening and embrittlement were thus clarified. On the other hand, postirradiation tensile and creep properties were measured of Hastelloy X alloy. Irradiation behavior at elevated temperatures is discussed. (author)
International Nuclear Information System (INIS)
Roshchupkin, V.V.; Pokrasin, M.A.; Chernov, A.I.; Semashko, N.A.; Filonenko, S.F.
1999-01-01
The purpose of the study consists in determination of the sound velocity temperature dependence in structural materials for nuclear power engineering. In particular, the Zr-2.5%Nb, Hastelloys-H alloys and X2.5M steel are studied. The facility for studying acoustic parameters of metals and alloys is described. The software makes it possible to obtain the results in various forms with the data stored in the memory for further analysis. The data on the above alloys obtained by use of various methods are presented and analyzed [ru
The Functions of BRCA2 in Homologous Recombinational Repair
2004-07-01
chromatography with hydroxyapatite , Q-Sepharose, heparin affinity and MonoQ column (Fig. 4.). We have been able to obtain about 10 mg of the purified Rad51...and DNA- PKcs (the XR -1, xrs5/6, and V3 cell lines, respectively) are highly sensitive to IR in G1 and early S phases, compared to the wild-type, but
On the Fresnel sine integral and the convolution
Directory of Open Access Journals (Sweden)
Adem Kılıçman
2003-01-01
Full Text Available The Fresnel sine integral S(x, the Fresnel cosine integral C(x, and the associated functions S+(x, S−(x, C+(x, and C−(x are defined as locally summable functions on the real line. Some convolutions and neutrix convolutions of the Fresnel sine integral and its associated functions with x+r, xr are evaluated.
Absorption of molten fluoride salts in glassy carbon, pyrographite and Hastelloy B
Czech Academy of Sciences Publication Activity Database
Vacík, Jiří; Naramoto, H.; Červená, Jarmila; Hnatowicz, Vladimír; Peka, I.; Fink, D.
2001-01-01
Roč. 289, č. 3 (2001), s. 308-314 ISSN 0022-3115 R&D Projects: GA ČR GA202/96/0077; GA ČR GV202/97/K038; GA AV ČR KSK1010104 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.366, year: 2001
Mfd translocase is necessary and sufficient for transcription-coupled repair in Escherichia coli.
Adebali, Ogun; Sancar, Aziz; Selby, Christopher P
2017-11-10
Nucleotide excision repair in Escherichia coli is stimulated by transcription, specifically in the transcribed strand. Previously, it was shown that this transcription-coupled repair (TCR) is mediated by the Mfd translocase. Recently, it was proposed that in fact the majority of TCR in E. coli is catalyzed by a second pathway ("backtracking-mediated TCR") that is dependent on the UvrD helicase and the guanosine pentaphosphate (ppGpp) alarmone/stringent response regulator. Recently, we reported that as measured by the excision repair-sequencing (XR-seq), UvrD plays no role in TCR genome-wide. Here, we tested the role of ppGpp and UvrD in TCR genome-wide and in the lacZ operon using the XR-seq method, which directly measures repair. We found that the mfd mutation abolishes TCR genome-wide and in the lacZ operon. In contrast, the relA - spoT - mutant deficient in ppGpp synthesis carries out normal TCR. We conclude that UvrD and ppGpp play no role in TCR in E. coli . © 2017 by The American Society for Biochemistry and Molecular Biology, Inc.
Lv, Zijian; Zhong, Qin; Bu, Yunfei
2018-05-01
Owing to the metalloid characteristic and superior electrical conductivity, the metal phosphides have received increasing interests in energy storage systems. Here, xrGO/Ni2P composites are successfully synthesized via an In-situ phosphorization process with GO/Ni-MOF as precursors. Compared to pure Ni2P, the xrGO/Ni2P composites appear enhanced electrochemical properties in terms of the specific capacitance and cycling performance as electrodes for supercapacitors. Especially, the 2rGO/Ni2P electrode shows a highest specific capacitance of 890 F g-1 at 1 A g-1 among the obtained composites. The enhancement can be attributed to the inherited structure from Ni-MOF and the well assembled of rGO and Ni2P through the In-situ conversion process. Moreover, when applied as positive electrode in a hybrid supercapacitor, an energy density of 35.9 W h kg-1 at a power density of 752 W kg-1 has been achieved. This work provides an In-situ conversion strategy for the synthesis of rGO/Ni2P composite which might be a promising electrode material for SCs.
Generalized Fractional Integral Operators on Generalized Local Morrey Spaces
Directory of Open Access Journals (Sweden)
V. S. Guliyev
2015-01-01
Full Text Available We study the continuity properties of the generalized fractional integral operator Iρ on the generalized local Morrey spaces LMp,φ{x0} and generalized Morrey spaces Mp,φ. We find conditions on the triple (φ1,φ2,ρ which ensure the Spanne-type boundedness of Iρ from one generalized local Morrey space LMp,φ1{x0} to another LMq,φ2{x0}, 1
x,r, φ2(x,r, and φ(x,r in r.
Use of reference samples for more accurate RBS analyses
International Nuclear Information System (INIS)
Lanford, W.A.; Pelicon, P.; Zorko, B.; Budnar, M.
2002-01-01
While one of the primary assets of RBS analysis is that it is quantitative without use of reference samples, for certain types of analyses the precision of the method can be improved by measuring RBS spectra of unknowns relative to the RBS spectra of a similar known sample. The advantage of such an approach is that one can reduce (or eliminate) the uncertainties that arise from error in the detector solid angle, beam current integration efficiency, scattering cross-section, and stopping powers. We have used this approach extensively to determine the composition (x) of homogeneous thin films of TaN x using as reference samples films of pure Ta. Our approach is to measure R=(Ta count) unknown /(Ta count) standard and use RUMP to determine the function x(R). Once the function x(R) has been determined, this approach makes it easy to analyze many samples quickly. Other analyses for which this approach has proved useful are determination of the composition (x) of WN x , SiO x H y and SiN x H y , using W, SiO 2 and amorphous Si as reference samples, respectively
Directory of Open Access Journals (Sweden)
Ping Xu
2011-01-01
Full Text Available Two novel endophytic yeast strains, WP1 and PTD3, isolated from within the stems of poplar (Populus trees, were genetically characterized with respect to their xylose metabolism genes. These two strains, belonging to the species Rhodotorula graminis and R. mucilaginosa, respectively, utilize both hexose and pentose sugars, including the common plant pentose sugar, D-xylose. The xylose reductase (XYL1 and xylitol dehydrogenase (XYL2 genes were cloned and characterized. The derived amino acid sequences of xylose reductase (XR and xylose dehydrogenase (XDH were 32%~41% homologous to those of Pichia stipitis and Candida. spp., two species known to utilize xylose. The derived XR and XDH sequences of WP1 and PTD3 had higher homology (73% and 69% identity with each other. WP1 and PTD3 were grown in single sugar and mixed sugar media to analyze the XYL1 and XYL2 gene regulation mechanisms. Our results revealed that for both strains, the gene expression is induced by D-xylose, and that in PTD3 the expression was not repressed by glucose in the presence of xylose.
Stress-dislocation interaction mechanism in low-temperature thermo-compression sintering of Ag NPs
Wang, Fuliang; Tang, Zikai; He, Hu
2018-04-01
The sintering of metal nanoparticles (NPs) has been widely studied in the field of nanotechnology, and low-temperature sintering has become the industry standard. In this study, a molecular dynamics (MD) model was established to study the sintering behaviour of silver NPs during low-temperature thermo-compression. Primarily, we studied the sintering process, in which the ratio of neck radius to particle radius (x/r) changes. Under a uniaxial pressure, the maximum ratio in the temperature range 420-425 K was 1. According to the change of x/r, the process can be broken down into three stages: the neck-formation stage, neck-growth stage, and neck-stability stage. In addition, the relationship between potential energy, internal stress, and dislocation density during sintering is discussed. The results showed that cycling internal stress played an important role in sintering. Under the uniaxial pressure, the stress-dislocation interaction was found to be the major mechanism for thermo-compression sintering because the plastic deformation product dislocation intensified the diffusion of atoms. Also, the displacement vector, the mean square displacement, and the changing crystal structure during sintering were studied.
Flexural Free Vibrations of Multistep Nonuniform Beams
Directory of Open Access Journals (Sweden)
Guojin Tan
2016-01-01
Full Text Available This paper presents an exact approach to investigate the flexural free vibrations of multistep nonuniform beams. Firstly, one-step beam with moment of inertia and mass per unit length varying as I(x=α11+βxr+4 and m(x=α21+βxr was studied. By using appropriate transformations, the differential equation for flexural free vibration of one-step beam with variable cross section is reduced to a four-order differential equation with constant coefficients. According to different types of roots for the characteristic equation of four-order differential equation with constant coefficients, two kinds of modal shape functions are obtained, and the general solutions for flexural free vibration of one-step beam with variable cross section are presented. An exact approach to solve the natural frequencies and modal shapes of multistep beam with variable cross section is presented by using transfer matrix method, the exact general solutions of one-step beam, and iterative method. Numerical examples reveal that the calculated frequencies and modal shapes are in good agreement with the finite element method (FEM, which demonstrates the solutions of present method are exact ones.
Role of DNA damage repair capacity in radiation induced adaptive response
International Nuclear Information System (INIS)
Yuan Dexiao; Pan Yan; Zhao Meijia; Chen Honghong; Shao Cunlin
2009-01-01
This work was to explore γ-ray induced radioadaptive response (RAR) in Chinese hamster ovary(CHO) cell lines of different DNA damage repair capacities. CHO-9 cells and the two repair-deficient strains, EM-C11(DNA single strand break repair deficient) and XR-C1(DNA double strand break repair deficient), were irradiated with a priming dose of 0.08 Gy or 0.016 Gy. After 4 or 7 hours, they were irradiated again with a challenging dose of 1 Gy. The micronucleus induction and plating efficiency of the cells were assayed. Under 0.08 Gy priming dose and 4-h interval, just the CHO-9 cells showed RAR, while with the 7-h interval the CHO-9 and EM-C11 showed RAR, but XR-C1 did not. When the cells were pretreated with a lower priming dose of 0.016 Gy in a 4-h time interval, all the three cell lines showed RAR to subsequent 1 Gy irradiation. It can be concluded that RAR is not only related to the priming dose and time interval, but also has close dependence on the ability of DNA damage repair. (authors)
Stress-dislocation interaction mechanism in low-temperature thermo-compression sintering of Ag NPs
Directory of Open Access Journals (Sweden)
Fuliang Wang
2018-04-01
Full Text Available The sintering of metal nanoparticles (NPs has been widely studied in the field of nanotechnology, and low-temperature sintering has become the industry standard. In this study, a molecular dynamics (MD model was established to study the sintering behaviour of silver NPs during low-temperature thermo-compression. Primarily, we studied the sintering process, in which the ratio of neck radius to particle radius (x/r changes. Under a uniaxial pressure, the maximum ratio in the temperature range 420–425 K was 1. According to the change of x/r, the process can be broken down into three stages: the neck-formation stage, neck-growth stage, and neck-stability stage. In addition, the relationship between potential energy, internal stress, and dislocation density during sintering is discussed. The results showed that cycling internal stress played an important role in sintering. Under the uniaxial pressure, the stress-dislocation interaction was found to be the major mechanism for thermo-compression sintering because the plastic deformation product dislocation intensified the diffusion of atoms. Also, the displacement vector, the mean square displacement, and the changing crystal structure during sintering were studied.
International Nuclear Information System (INIS)
1977-01-01
This document is one of the three parts of a first volume devoted to the compilations of American data on the molten salt reactor concept. This part 'CIRCUITS' regroups under a condensed form - in French and using international units - the essential information contained in both basic documents of the American project for a molten-salt breeder power plant. This part is only dealing with things relating to the CEA-EDF workshop 'CIRCUITS'. It is not concerned with information on: the reactor and the moderator replacement, the primary and secondary salts, and the fuel salt reprocessing, that are dealt with in parts 'CORE' and 'CHEMISTRY' respectively. The possible evolutions in the data - and solutions - taken by the American designers for their successive projects (1970 to 1972) are shown. The MSBR power plant comprises three successive heat transfer circuits. The primary circuit (Hastelloy N), radioactive and polluted, containing the fuel salt, includes the reactor, pumps and exchangers. The secondary circuit (pipings made of modified Hastelloy N) contaminated in the exchanger, ensures the separation between the fuel and the fluid operating the turbo-alternator. The water-steam circuit feeds the turbine with steam. This steam is produced in the steam generator flowed by the secondary fluid. Some subsidiary circuits (discharge and storage of the primary and secondary salts, ventilation of the primary circuit ...) complete the three principal circuits which are briefly described. All circuits are enclosed inside the controlled-atmosphere building of the nuclear boiler. This building also ensures the biological protection and the mechanical protection against outer aggressions [fr
Energy Technology Data Exchange (ETDEWEB)
Nickelsen, Simin; Moghadam, Afsaneh Dorri, E-mail: afsaneh@uwm.edu; Ferguson, J.B.; Rohatgi, Pradeep
2015-10-30
Graphical abstract: - Highlights: • Wetting behavior of four metallic materials as a function of surface roughness has been studied. • A model to predict the abrasive particle size and water/oil contact angles relationship is proposed. • Active wetting regime is determined in different materials using the proposed model. - Abstract: In the present study, the wetting behavior of surfaces of various common metallic materials used in the water industry including C84400 brass, commercially pure aluminum (99.0% pure), Nickle–Molybdenum alloy (Hastelloy C22), and 316 Stainless Steel prepared by mechanical abrasion and contact angles of several materials after mechanical abrasion were measured. A model to estimate roughness factor, R{sub f}, and fraction of solid/oil interface, ƒ{sub so}, for surfaces prepared by mechanical abrasion is proposed based on the assumption that abrasive particles acting on a metallic surface would result in scratches parallel to each other and each scratch would have a semi-round cross-section. The model geometrically describes the relation between sandpaper particle size and water/oil contact angle predicted by both the Wenzel and Cassie–Baxter contact type, which can then be used for comparison with experimental data to find which regime is active. Results show that brass and Hastelloy followed Cassie–Baxter behavior, aluminum followed Wenzel behavior and stainless steel exhibited a transition from Wenzel to Cassie–Baxter. Microstructural studies have also been done to rule out effects beyond the Wenzel and Cassie–Baxter theories such as size of structural details.
Parametric Variation for Detailed Model of External Grid in Offshore Wind Power Plants
DEFF Research Database (Denmark)
Myagkov, Vladimir; Petersen, Lennart; Laza, Burutxaga
2014-01-01
The representation of the external grid impedance is a key element in harmonic studies for offshore wind farms. The external grid impedance is here represented by two different approaches: by a simplified impedance model, based on values for short-circuit power and XR-ratio and by locus diagrams...... for defining a procedure for conducting harmonic studies in wind farms that can be used in commercial project developments....
A comparative study of hydroxyapatite nanoparticles synthesized by different routes
Paz, Adrian; Guadarrama, Dainelys; López, Mónica; E. González, Jesús; Brizuela, Nayrim; Aragón, Javier
2012-01-01
In this study, bioactive hydroxyapatite nanoparticles were prepared by two different methods: wet chemical precipitation and biomimetic precipitation. The aim was to evaluate the morphology, particle-size, crystallinity and phases of the powders obtained by traditional wet chemical precipitation and the novel biomimetic precipitation using a supersaturated calcium solution. The nanoparticles were investigated by transmission electron microscopy, Fourier transform infrared spectroscopy and X-r...
Methods study of homogeneity and stability test from cerium oxide CRM candidate
International Nuclear Information System (INIS)
Samin; Susanna TS
2016-01-01
The methods study of homogeneity and stability test from cerium oxide CRM candidate has been studied based on ISO 13258 and KAN DP. 01. 34. The purpose of this study was to select the test method homogeneity and stability tough on making CRM cerium oxide. Prepared 10 sub samples of cerium oxide randomly selected types of analytes which represent two compounds, namely CeO_2 and La_2O_3. At 10 sub sample is analyzed CeO_2 and La_2O_3 contents in duplicate with the same analytical methods, by the same analyst, and in the same laboratory. Data analysis results calculated statistically based on ISO 13528 and KAN DP.01.34. According to ISO 13528 Cerium Oxide samples said to be homogeneous if Ss ≤ 0.3 σ and is stable if | Xr – Yr | ≤ 0.3 σ. In this study, the data of homogeneity test obtained CeO_2 is Ss = 2.073 x 10-4 smaller than 0.3 σ (0.5476) and the stability test obtained | Xr - Yr | = 0.225 and the price is < 0.3 σ. Whereas for La_2O_3, the price for homogeneity test obtained Ss = 1.649 x 10-4 smaller than 0.3 σ (0.4865) and test the stability of the price obtained | Xr - Yr | = 0.2185 where the price is < 0.3 σ. Compared with the method from KAN, a sample of cerium oxide has also been homogenized for Fcalc < Ftable and stable, because | Xi - Xhm | < 0.3 x n IQR. Provided that the results of the evaluation homogeneity and stability test from CeO_2 CRM candidate test data were processed using statistical methods ISO 13528 is not significantly different with statistical methods from KAN DP.01.34, which together meet the requirements of a homogeneous and stable. So the test method homogeneity and stability test based on ISO 13528 can be used to make CRM cerium oxide. (author)
Park, Sang-In; Lee, Howard; Oh, Jaeseong; Lim, Kyoung Soo; Jang, In-Jin; Kim, Jeong-Ae; Jung, Jong Hyuk; Yu, Kyung-Sang
2015-01-01
In type 2 diabetes mellitus, fixed-dose combination (FDC) can provide the complementary benefits of correction of multiple pathophysiologic defects such as dysfunctions in glycemic or metabolic control while improving compliance compared with separate tablets taken together. The objective of the study reported here was to compare the pharmacodynamic (PD), pharmacokinetic (PK), and tolerability profiles of gemigliptin and extended-release metformin (metformin XR) between FDC and separate tablets. A randomized, open-label, single-dose, two-way, two-period, crossover study was conducted in 28 healthy male volunteers. Two FDC tablets of gemigliptin/metformin 25/500 mg or separate tablets of gemigliptin (50 mg ×1) and metformin XR (500 mg ×2) were orally administered in each period. Serial blood samples were collected up to 48 hours post-dose to determine dipeptidyl peptidase 4 (DPP-4) activity using spectrophotometric assay and concentrations of gemigliptin and metformin using tandem mass spectrometry. Geometric mean ratios (GMRs) of FDC to separate tablet formulations and their 90% confidence intervals (CIs) were calculated to compare the PD and PK parameters between the two formulations. Tolerability was assessed throughout the study. The plasma DPP-4 activity-time curves of the FDC and the separate tablets almost overlapped, leading to a GMR (90% CI) of the FDC to separate tablets for the plasma DPP-4 activity and its maximum inhibition of 1.00 (0.97-1.04) and 0.92 (0.82-1.05), respectively. Likewise, all of the GMRs (90% CIs) of FDC to separate tablets for the area under the plasma concentration-time curve and maximum plasma concentration of gemigliptin and metformin fell entirely within the conventional bioequivalence range of 0.80-1.25. Both the FDC and separate tablets were well tolerated. The PD, PK, and tolerability profiles of gemigliptin and metformin XR in FDC and separate tablets were found to be comparable. The FDC tablet of gemigliptin and metformin
A budget-impact and cost-effectiveness model for second-line treatment of major depression.
Malone, Daniel C
2007-07-01
Depressed patients who initially fail to achieve remission when placed on a selective serotonin reuptake inhibitor (SSRI) may require a second treatment. The purpose of this study was to evaluate the effectiveness, cost, cost-effectiveness, and budget impact of second-line pharmacologic treatment for major depressive disorder (MDD). A cost-effectiveness analysis was conducted to evaluate second-line therapies (citalopram, escitalopram, fluoxetine, paroxetine, paroxetine controlled release [CR], sertraline, and venlafaxine extended release [XR]) for the treatment of depression. Effectiveness data were obtained from published clinical studies. The primary outcome was remission defined as a score of 7 or less on the Hamilton Rating Scale for Depression (HAM-D) or a score of 10 or less on the montgomery-Asberg Depression Rating Scale (MADRS) depression rating scales. The wholesale acquisition cost (WAC) for medications and medical treatment costs for depression were included. The perspective was derived from a managed care organization (MCO) with 500,000 members, a 1.9% annual incidence of depression, and treatment duration of 6 months. Assumptions included: second-line treatment is not as effective as first-line treatment, WAC price reflects MCO costs, and side effects were identical. Sensitivity analyses were conducted to determine variables that influenced the results. Second-line remission rates were 20.4% for venlafaxine XR, 16.9% for sertraline, 16.4% for escitalopram, 15.1% for generic SSRIs (weighted average), and 13.6% for paroxetine CR. Pharmacy costs ranged from $163 for generic SSRIs to $319 for venlafaxine SR. Total cost per patient achieving remission was $14,275 for venlafaxine SR, followed by $16,100 for escitalopram. The incremental cost-effectiveness ratio (ICER) for venlafaxine SR compared with generic SSRIs was $2,073 per patient achieving remission, followed by escitalopram with an ICER of $3,566. The model was most sensitive to other therapies
Torres, P. D.
2015-01-01
A stress corrosion evaluation was performed on Inconel 625, Hastelloy C276, titanium commercially pure (TiCP), Ti-6Al-4V, Ti-6Al-4V extra low interstitial, and Cronidur 30 steel as a consequence of a change in formulation of the pretreatment for processing the urine in the International Space Station Environmental Control and Life Support System Urine Processing Assembly from a sulfuric acid-based to a phosphoric acid-based solution. The first five listed were found resistant to stress corrosion in the pretreatment and brine. However, some of the Cronidur 30 specimens experienced reduction in load-carrying ability.
International Nuclear Information System (INIS)
Xin Tang Huang
2000-01-01
High critical current density and in-plane aligned YBa 2 Cu 3 O 7-x (YBCO) film on a textured yttria-stabilized zirconia (YSZ) buffer layer deposited on NiCr alloy (Hastelloy c-275) tape by laser ablation with only O + ion beam assistance was fabricated. The values of the x-ray phi-scan full width at half-maximum (FWHM) for YSZ(202) and YBCO(103) are 18 deg. and 11 deg., respectively. The critical current density of YBCO film is 7.9 x 105 A cm -2 at liquid nitrogen temperature and zero field, and its critical temperature is 90 K. (author)
Effect of helium on creep and fatigue (MAT 11)
International Nuclear Information System (INIS)
Schroeder, H.
1991-03-01
This final report contains experimental results on mechanical properties (creep, fatigue, tensile) and microstructural investigations (SEM, TEM) of pre-implanted samples of steels or alloys. (AISI 316, AISI 316L, DIN 1.4970, JPCA 8206, DIN 1.4914; Incoloy 800H, Hastelloy X, DIN 1.4981, (Fe 0.49 Ni 0.51 ) 3 V, Fe17Ni17Cr, Fe15Ni15Cr, Nimonic PE 16, Ni8Si). Furthermore theoretical aspects and developed models and mechanisms for helium embrittlement are described. This report is presented in the form of an extended summary without figures. (MM)
Superalloy applications in the nuclear field
International Nuclear Information System (INIS)
Ramanathan, L.V.; Padilha, A.F.
1984-01-01
The process conditions in the areas of nuclear fuel processing, fabrication, utilization, reprocessing and disposal are severe, demanding therefore the use of materials with high temperature mechanical strength and corrosion resistance. A number of refractory metal containing superalloys have found application in the diferrent areas of the nuclear field. The main aspects of the microstructure, strengthening mechanisms and corrosion resistance of 3 superalloys, namely Incoloy 825, Inconel 718 and Hastelloy C have been discussed. The role of the refractory metal elements in influencing the mechanical strength and corrosion resistance of superalloys has been emphasised. (Author) [pt
Kim, Seung-Gyu; Kim, Najung; Shim, Hyung-Seok; Kwon, Oh Min; Kwon, Dongil
2018-05-01
The superconductor industry considers cold-rolled austenitic stainless 310S steel a less expensive substitute for Hastelloy X as a substrate for coated superconductor. However, the mechanical properties of cold-rolled 310S substrate degrade significantly in the superconductor deposition process. To overcome this, we applied hot rolling at 900 °C (or 1000 °C) to the 310S substrate. To check the property changes, a simulated annealing condition equivalent to that used in manufacturing was determined and applied. The effects of the hot rolling on the substrate were evaluated by analyzing its physical properties and texture.
Metallic materials corrosion problems in molten salt reactors
International Nuclear Information System (INIS)
Chauvin, G.; Dixmier, J.; Jarny, P.
1977-01-01
The USA forecastings concerning the molten salt reactors are reviewed (mixtures of fluorides containing the fuel, operating between 560 and 700 0 C). Corrosion problems are important in these reactors. The effects of certain characteristic factors on corrosion are analyzed: humidity and metallic impurities in the salts, temperature gradients, speed of circulation of salts, tellurium from fission products, coupling. In the molten fluorides and experimental conditions, the materials with high Ni content are particularly corrosion resistant alloys (hastelloy N). The corrosion of this material is about 2.6 mg.cm -2 at 700 0 C [fr
Electrochemical Impedance Spectroscopy Of Metal Alloys
Macdowell, L. G.; Calle, L. M.
1993-01-01
Report describes use of electrochemical impedance spectroscopy (EIS) to investigate resistances of 19 alloys to corrosion under conditions similar to those of corrosive, chloride-laden seaside environment of Space Transportation System launch site. Alloys investigated: Hastelloy C-4, C-22, C-276, and B-2; Inconel(R) 600, 625, and 825; Inco(R) G-3; Monel 400; Zirconium 702; Stainless Steel 304L, 304LN, 316L, 317L, and 904L; 20Cb-3; 7Mo+N; ES2205; and Ferralium 255. Results suggest electrochemical impedance spectroscopy used to predict corrosion performances of metal alloys.
2013-04-11
require the rough metal films that result from dewetting , the silver films for X-ray photoelectron spectroscopy (XPS) and XR study were made thick...enough to avoid dewetting , since smooth, planar films were needed for those techniques. The preparation conditions for these flat samples were the same...spectroscopy (XPS) and AFM. While TERS and SERS- based detection techniques require the rough metal films that result from dewetting , the silver 4 films
Weierstrass's Theorem – Leaving no 'Stone' Unturned
Indian Academy of Sciences (India)
Page 2 ..... erage winnings be as the number n of throws increases? Since xr is the probability of r darts landing in the black region, and (1 − x)n¡r is the probability that the other n − r darts landing outside the black region and (n r) is the number of ways of choosing r darts from the n thrown, the probability of getting exactly r ...
1979-04-01
Results mt •EVrABLUSH TRAINING OBJECTIVES s$ First. the different requirements to be met by an DSVELOPO ThXrINE MEASUMENT ACM performance measurement...engineering Program Element 63722N. guidelines in designing displays, one of the experi- mental innovations of this project will make future Approach and...zation of People-Related RDT&E, published in May decrease motivation and impair efficiency. 1978. 40 Delays in providing initial documentation and in
82D Airborne Division in Sicily and Italy
1945-11-01
34L.1 ranki, wou1d1 refrain from flashUing his tc;rch inrsiLd4e the caro Neithbler T1’ayloEcr no<->r 3-ar di ror f el+- : nyXr real chill o- f fea -r... Mendez , Louis G, Myers, Joseph F, Muzynski, TWalter J, Nau, Charles E, Ostberg, EJe Parris, Harold L; Polette, Lloyd L, Prager, Clarence’ Prager, Leonard A
1989-03-31
3. the spring stiffness K increases ([60]) 4. the mass M of the slider decreases ([47]). n 10 U I I I I. I I w slider I K I(cb) xr M Idriver fixed F...urbationi at =~ U.-57-7 anid 0.5.50 j)1odueS ".premati:.’ sliding while the same perturbation at u, 0.525. 0.500. ... (loes iot produce, pre,,L. tre" sliding
Geometry of extended null supersymmetry in M theory
International Nuclear Information System (INIS)
Conamhna, Oisin A.P. Mac
2006-01-01
For supersymmetric spacetimes in 11 dimensions admitting a null Killing spinor, a set of explicit necessary and sufficient conditions for the existence of any number of arbitrary additional Killing spinors is derived. The necessary and sufficient conditions are comprised of algebraic relationships, linear in the spinorial components, between the spinorial components and their first derivatives, and the components of the spin connection and four-form. The integrability conditions for the Killing spinor equation are also analyzed in detail, to determine which components of the field equations are implied by arbitrary additional supersymmetries and the four-form Bianchi identity. This provides a complete formalism for the systematic and exhaustive investigation of all spacetimes with extended null supersymmetry in 11 dimensions. The formalism is employed to show that the general bosonic solution of 11 dimensional supergravity admitting a G 2 structure defined by four Killing spinors is either locally the direct product of R 1,3 with a seven-manifold of G 2 holonomy, or locally the Freund-Rubin direct product of AdS 4 with a seven-manifold of weak G 2 holonomy. In addition, all supersymmetric spacetimes admitting a (G 2 xR 7 )xR 2 structure are classified
Bazvand, Fatemeh; Mirshahi, Reza; Fadakar, Kaveh; Faghihi, Houshangh; Sabour, Siamak; Ghassemi, Fariba
2017-08-01
The purpose of this study was to evaluate the vascular density (VD) and the flow area on optic nerve head (ONH) and peripapillary area, and the impact of age and sex using optical coherence tomography angiography (OCTA) in healthy human subjects. Both eyes of each volunteer were scanned by an RTVue XR Avanti; Optovue with OCTA using the split-spectrum amplitude-decorrelation angiography algorithm technique. Masked graders evaluated enface angiodisc OCTA data. The flow area of ONH and the VD were automatically calculated. A total of 79 eyes of patients with a mean age of 37.03±11.27 were examined. The total ONH (papillary and peripapillary) area VD was 56.03%±4.55%. The flow area of the ONH was 1.74±0.10 mm/1.34 mm. The temporal and inferotemporal peripapillary VD was different between male and female patients. Increasing age causes some changes in the flow area of the ONH and the papillary VD from the third to the fourth decade (analysis of variance test; P<0.05). A normal quantitative database of the flow area and VD of the papillary and peripapillary area, obtained by RTVue XR with OCT angiography technique, is presented here.
Drift curves from spray applications on commom bean crop
Directory of Open Access Journals (Sweden)
Mariana Rodrigues Bueno
Full Text Available ABSTRACT In order to avoid the occurrence of drift in pesticide applications, it is fundamental to know the behavior of sprayed droplets. This study aimed to determine drift curves in pesticide applications on common bean crop under brazilian weather conditions, using different nozzle types and compared them with the "German" and "Dutch" drift prediction models. The experiment was conducted in Uberlândia, Minas Gerais/Brazil, in completely randomized design with ten replications and 4 x 20 split-plot arrangement in space. Drift deposited on collectors located over ground level was resulted by 150 L ha-1 carrier volume applications through four nozzle types (XR 11002 (fine droplets; AIXR 11002 (coarse droplets; TT 11002 (medium droplets; TTI 11002 (extremely coarse droplets, collected in 20 downwind distances, parallel to the crop line outside the target area, spaced by 2.5 m. The tracer rhodamine B was added to the spray to be quantified by fluorimetry. Drift prediction models adjusted by exponential functions were obtained considering the 90th percentile for XR, TT, AIXR and TTI nozzles. It is suggested to use the estimated drift models from this study for each nozzle type in drift prediction evaluations on bean crops under brazilian weather conditions.
Alves, Lourdes A; Vitolo, Michele; Felipe, Maria das Graças A; de Almeida e Silva, João Batista
2002-01-01
The sugarcane bagasse hydrolysate, which is rich in xylose, can be used as culture medium for Candida guilliermondii in xylitol production. However, the hydrolysate obtained from bagasse by acid hydrolysis at 120 degrees C for 20 min has by-products (acetic acid and furfural, among others), which are toxic to the yeast over certain concentrations. So, the hydrolysate must be pretreated before using in fermentation. The pretreatment variables considered were: adsorption time (15,37.5, and 60 min), type of acid used (H2So4 and H3Po4), hydrolysate concentration (original, twofold, and fourfold concentrated), and active charcoal (0.5, 1.75 and 3.0%). The suitability of the pretreatment was followed by measuring the xylose reductase (XR) and xylitol dehydrogenase (XD) activity of yeast grown in each treated hydrolysate. The response surface methodology (2(4) full factorial design with a centered face) indicated that the hydrolysate might be concentrated fourfold and the pH adjusted to 7.0 with CaO, followed by reduction to 5.5 with H3PO4. After that it was treated with active charcoal (3.0%) by 60 min. This pretreated hydrolysate attained the high XR/XD ratio of 4.5.
High frequencies of Y chromosome lineages characterized by E3b1, DYS19-11, DYS392-12 in Somali males
DEFF Research Database (Denmark)
Sanchez Sanchez, Juan Jose; Hallenberg, Charlotte; Børsting, Claus
2005-01-01
We genotyped 45 biallelic markers and 11 STR systems on the Y chromosome in 201 male Somalis. In addition, 65 sub-Saharan Western Africans, 59 Turks and 64 Iraqis were typed for the biallelic Y chromosome markers. In Somalis, 14 Y chromosome haplogroups were identified including E3b1 (77.6%) and K2...... (10.4%). The haplogroup E3b1 with the rare DYS19-11 allele (also called the E3b1 cluster gamma) was found in 75.1% of male Somalis, and 70.6% of Somali Y chromosomes were E3b1, DYS19-11, DYS392-12, DYS437-14, DYS438-11 and DYS393-13. The haplotype diversity of eight Y-STRs ('minimal haplotype') was 0......f2) (27.1%), R1b3*(xR1b3d, R1b3f) (20.3%), E3b3 and R1a1*(xR1a1b) (both 11.9%). In Iraqis, 12 haplogroups were identified including J2*(xJ2f2) (29.7%) and J*(xJ2) (26.6%). The data suggest that the male Somali population is a branch of the East African population - closely related to the Oromos...
Directory of Open Access Journals (Sweden)
Felipe Rafael Garcés Fiallos
2011-12-01
Full Text Available This study aimed to evaluate the efficiency of fungicides to leaf control diseases of wheat, when applied to different models of spray nozzles. The experiment was conducted in a randomized block design with four replicates of factorial (4 x 3+1. Data were subjected to analysis of variance and means compared by Tukey test at 5% probability. The fungicides used were: Opera® (pyraclostrobin+epoxiconazole 0.75 L.ha-1 , Opera® 0.75 L.ha-1 +Folicur® (tebuconazole 0.3 L.ha-1 , Priori Xtra® (azoxystrobin+cyproconazole 0.3 L.ha-1 , Priori Xtra® 0.3 L.ha-1 +Tilt® (propiconazole 0.3 L.ha-1 . These fungicides were applied with three models of spray nozzles jet planes: XR 11 001 (fine drop, AIRMIX 11,001 (average drop and AVI 11,001 (coarse drop. We evaluated the incidence and severity (damage per plant leaf of yellow spot (Drechslera tritici-repentis, spot blotch (Bipolaris sorokiniana, leaf rust (Puccinia triticina and grain yield (kg.ha-1 culture. The results show that the application of fungicides for control of leaf diseases in wheat resulted in increases in grain yield, and yield higher values were observed with the application of Opera®, using the XR 11001.
Kwast, H.; Conrad, R.; May, R.; Casadio, S.; Roux, N.; Werle, H.
1994-09-01
In situ tritium release experiments from several candidate fusion blanket ceramic breeder materials have been performed in the High Flux Reactor (HFR) at Petten over the last few years. The sixth experiment, EXOTIC-6, contained pellets of LiAlO 2, Li 2XrO 3, Li 6Xr 2O 7 and Li 8ZrO 6 and pebbles of Li 4SiO 4 and Li 2ZrO 3 which were irradiated up to a lithium burnup of 3%. A large number of temperature transients and purge gas composition changes were performed. From the temperature transients tritium residence times have been determined. Some preliminary results were presented at the 17th Symposium on Fusion Technology (SOFT) held in Rome in 1992. In the present paper results of a further analysis of the residence times are presented together with some postirradiation examination results. The LiAlO 2 pellets showed a better mechanical stability than the Li-zirconates pellets. The pebbels remained intact. The tritium residence times determined from the tritium inventories were in good agreement with those previously determined from temperature transients. The tritium release characteristics of the materials investigated remain substantially unchanged up to the maximum lithium burnup achieved in this experiment.
Cao, Qingqing; Wang, Hui; Zhang, Yiran; Lal, Rattan; Wang, Renqing; Ge, Xiuli; Liu, Jian
2017-07-14
Wetlands are an important carbon reservoir pool in terrestrial ecosystems. Light fraction organic carbon (LFOC), heavy fraction organic carbon (HFOC), and dissolved organic carbon (DOC) were fractionated in sediment samples from the four wetlands (ZR: Zhaoniu River; ZRCW: Zhaoniu River Constructed Wetland; XR: Xinxue River; XRCW: Xinxue River Constructed Wetland). Organic carbon (OC) from rivers and coasts of China were retrieved and statistically analyzed. At regional scale, HFOC stably dominates the deposition of OC (95.4%), whereas DOC and LFOC in ZR is significantly higher than in ZRCW. Concentration of DOC is significantly higher in XRCW (30.37 mg/l) than that in XR (13.59 mg/l). DOC and HFOC notably distinguish between two sampling campaigns, and the deposition of carbon fractions are limited by low nitrogen input. At the national scale, OC attains the maximum of 2.29% at precipitation of 800 mm. OC has no significant difference among the three climate zones but significantly higher in river sediments than in coasts. Coastal OC increases from Bohai Sea (0.52%) to South Sea (0.70%) with a decrease in latitude. This study summarizes the factors affecting organic carbon storage in regional and national scale, and have constructive implications for carbon assessment, modelling, and management.
Bupropion-SR, sertraline, or venlafaxine-XR after failure of SSRIs for depression.
Rush, A John; Trivedi, Madhukar H; Wisniewski, Stephen R; Stewart, Jonathan W; Nierenberg, Andrew A; Thase, Michael E; Ritz, Louise; Biggs, Melanie M; Warden, Diane; Luther, James F; Shores-Wilson, Kathy; Niederehe, George; Fava, Maurizio
2006-03-23
After unsuccessful treatment for depression with a selective serotonin-reuptake inhibitor (SSRI), it is not known whether switching to one antidepressant is more effective than switching to another. We randomly assigned 727 adult outpatients with a nonpsychotic major depressive disorder who had no remission of symptoms or could not tolerate the SSRI citalopram to receive one of the following drugs for up to 14 weeks: sustained-release bupropion (239 patients) at a maximal daily dose of 400 mg, sertraline (238 patients) at a maximal daily dose of 200 mg, or extended-release venlafaxine (250 patients) at a maximal daily dose of 375 mg. The study was conducted in 18 primary and 23 psychiatric care settings. The primary outcome was symptom remission, defined by a total score of 7 or less on the 17-item Hamilton Rating Scale for Depression (HRSD-17) at the end of the study. Scores on the Quick Inventory of Depressive Symptomatology - Self Report (QIDS-SR-16), obtained at treatment visits, determined secondary outcomes, including remission (a score of 5 or less at exit) and response (a reduction of 50 percent or more on baseline scores). Remission rates as assessed by the HRSD-17 and the QIDS-SR-16, respectively, were 21.3 percent and 25.5 percent for sustained-release bupropion, 17.6 percent and 26.6 percent for sertraline, and 24.8 percent and 25.0 percent for extended-release venlafaxine. QIDS-SR-16 response rates were 26.1 percent for sustained-release bupropion, 26.7 percent for sertraline, and 28.2 percent for extended-release venlafaxine. These treatments did not differ significantly with respect to outcomes, tolerability, or adverse events. After unsuccessful treatment with an SSRI, approximately one in four patients had a remission of symptoms after switching to another antidepressant. Any one of the medications in the study provided a reasonable second-step choice for patients with depression. (ClinicalTrials.gov number, NCT00021528.). Copyright 2006 Massachusetts Medical Society.
International Nuclear Information System (INIS)
Schwarzkopf, W.; Smailos, E.; Koester, R.
1988-01-01
This work reports about in situ corrosion experiments on unalloyed steels, Ti 99,8-Pd, Hastelloy C4, and iron-base alloys, as modular cast iron, Ni-Resist D4 and Si-cast iron, under simulated disposal conditions. The experiments were carried out in the frame of the German/US Brine Migration Test in heated tubed boreholes in the Asse salt mine at T = 150 0 C to 210 0 C, both in the absence and in the presence of a γ-radiation field of 3x10 2 Gy/h (Co-60 source). In addition, the material used to protect the tubing from corrosion (Inconel 600) as well as the backfill material for the annular gap (Al 2 O 3 spheres) were investigated for possible corrosion attack. All materials investigate exhibited high resistance to corrosion under the conditions prevailing in the Brine Migration Test. All material specimens corroded at much lower rates than determined in the previous laboratory-scale tests. All materials and above all the materials with passivating oxide layers such as Ti 99.8-Pd and Hastelloy C4 which may corrode selectively already in the presence of minor amounts of brine had been resistant with respect to any type of local corrosion attack. The γ-radiation of 3x10 2 Gy/h did not exert an influence on the corrosion behaviour of the materials. No corrosion attacks were observed on the Al 2 O 3 spheres. In the case of Inconel 600 traces of sulphur were detected probably resulting from the reaction of Ni with H 2 S to NiS. Measurable general and local corrosion, however, have not been observed. (orig./IHOE) [de
Development of temperature statistical model when machining of aerospace alloy materials
Directory of Open Access Journals (Sweden)
Kadirgama Kumaran
2014-01-01
Full Text Available This paper presents to develop first-order models for predicting the cutting temperature for end-milling operation of Hastelloy C-22HS by using four different coated carbide cutting tools and two different cutting environments. The first-order equations of cutting temperature are developed using the response surface methodology (RSM. The cutting variables are cutting speed, feed rate, and axial depth. The analyses are carried out with the aid of the statistical software package. It can be seen that the model is suitable to predict the longitudinal component of the cutting temperature close to those readings recorded experimentally with a 95% confident level. The results obtained from the predictive models are also compared with results obtained from finite-element analysis (FEA. The developed first-order equations for the cutting temperature revealed that the feed rate is the most crucial factor, followed by axial depth and cutting speed. The PVD coated cutting tools perform better than the CVD-coated cutting tools in terms of cutting temperature. The cutting tools coated with TiAlN perform better compared with other cutting tools during the machining performance of Hastelloy C-22HS. It followed by TiN/TiCN/TiN and CVD coated with TiN/TiCN/Al2O3 and TiN/TiCN/TiN. From the finite-element analysis, the distribution of the cutting temperature can be discussed. High temperature appears in the lower sliding friction zone and at the cutting tip of the cutting tool. Maximum temperature is developed at the rake face some distance away from the tool nose, however, before the chip lift away.
Lesbani, Aldes; Tamba, Palita; Mohadi, Risfidian; Fahmariyanti, Fahmariyanti
2013-01-01
Preparation of calcium oxide from Achatina fulica shell has been carried out systematically by decomposition for 3 h at various temperatures i.e. 600, 700, 800 and 900 °C. Formation of calcium oxide was characterized using XR diffractometer. The calcium oxide obtained with the optimum temperature decomposition was characterized using FTIR spectroscopy to indicate the functional group in the calcium oxide. The results showed that XRD pattern of materials obtained from decomposition of Achatina...
2005-04-01
sulfated vitamin C, however, the - 40% differ- Boskey, A.L, 1989. Hydroxyapatite formation in a dynamic geleigt is most likely attributable to the pre...proteoglycans was significanly in- . bone proteoglycans, decorin and biglycan on hydroxyapatite for-*c e s tin gthat ic ase by te .mation in a gelatin gel. Calcif...between type I collagen "., XR d Cy~stallinity 14ighly Correlated molecules areformed by condensation of hydroxylysine and, to Because of the well
International Nuclear Information System (INIS)
Van de Wetering, J.F.W.H.
1992-01-01
Using perturbative Chern-Simons theory in the almost axial gauge on the euclidean manifold S 1 xR 2 , we give a prescription for the computation of knot invariants. The method gives the correct expectation value of the unknot to all orders in perturbation theory and gives the correct answer for the spectral-parameter-dependent universal R-matrix to second order. All results are derived for a general semi-simple Lie algebra. (orig.)
Lee, R. E.
2015-01-01
Electrochemical test results are presented for six noble metals evaluated in two acidic test solutions which are representative of waste liquids processed in the Environmental Control and Life Support System (ECLSS) aboard the International Space Station (ISS). The two test solutions consisted of fresh waste liquid which had been modified with a proposed or alternate pretreatment formulation and its associated brine concentrate. The six test metals included three titanium grades, (Commercially Pure, 6Al-4V alloy and 6Al-4V Low Interstitial alloy), two nickel-chromium alloys (Inconel® 625 and Hastelloy® C276), and one high tier stainless steel (Cronidur® 30).
Mechanical structure and problem of thorium molten salt reactor
International Nuclear Information System (INIS)
Kamei, Takashi
2011-01-01
After Fukushima Daiichi accident, there became great interest in Thorium Molten Salt Reactor (MSR) for the safety as station blackout leading to auto drainage of molten salts with freeze valve. This article described mechanical structure of MSR and problems of materials and pipes. Material corrosion problem by molten salts would be solved using modified Hastelloy N with Ti and Nb added, which should be confirmed by operation of an experimental reactor. Trends in international activities of MSR were also referred including China declaring MSR development in January 2011 to solve thorium contamination issues at rare earth production and India rich in thorium resources. (T. Tanaka)
Galvanic corrosion resistance of welded dissimilar nickel-base alloys
International Nuclear Information System (INIS)
Corbett, R.A.; Morrison, W.S.; Snyder, R.J.
1986-01-01
A program for evaluating the corrosion resistance of various dissimilar welded nickel-base alloy combinations is outlined. Alloy combinations included ALLCORR, Hastelloy C-276, Inconel 72 and Inconel 690. The GTAW welding process involved both high and minimum heat in-put conditions. Samples were evaluated in the as-welded condition, as well as after having been aged at various condtions of time and temperature. These were judged to be most representative of process upset conditions which might be expected. Corrosion testing evaluated resistance to an oxidizing acid and a severe service environment in which the alloy combinations might be used. Mechanical properties are also discussed
International Nuclear Information System (INIS)
Yakubov, A.; Shahrun, M.S.; Kutty, M.G.; Hamid, S.B.A.; Piven, V.
2011-01-01
10 and 40 wt% Co/ Multi wall Carbon Nano tubes (MWCNT) and 10 and 40 wt% Co/ Santa Barbara Amorphous-15 (SBA) catalysts were prepared via incipient wetness impregnation and characterized by Scanning Electron Microscopy equipped with Energy Dispersive X-ray Spectroscopy (SEM and EDX), N 2 adsorption-desorption (BET), X-ray Diffractometry (XRD), Transmission Electron Microscopy (TEM) and Temperature- Programmed Reduction and H 2 desorption TPD/RO. Co(NO 3 ) 2 * 6H 2 O was used as a cobalt precursor. 200 ml hastelloy autoclave reactor was implemented to see the performance of the catalysts. This report presents details about the catalyst synthesis and reactor study. (author)
Directory of Open Access Journals (Sweden)
Bell KF
2016-10-01
Full Text Available Kelly F Bell, Arie Katz, John J Sheehan AstraZeneca, Wilmington, DE, USA Background: The use of quality measures attempts to improve safety and health outcomes and to reduce costs. In two Phase III trials in treatment-naive patients with type 2 diabetes, dapagliflozin 5 or 10 mg/d as initial combination therapy with metformin extended-release (XR significantly reduced glycated hemoglobin (A1C from baseline to 24 weeks and allowed higher proportions of patients to achieve A1C <7% vs dapagliflozin or metformin monotherapy. Objective: A pooled analysis of data from these two studies assessed the effect of dapagliflozin 5 or 10 mg/d plus metformin XR (combination therapy compared with placebo plus metformin XR (metformin monotherapy on diabetes quality measures. Quality measures include laboratory measures of A1C and low-density lipoprotein cholesterol (LDL-C as well as vital status measures of blood pressure (BP and body mass index (BMI. The proportion of patients achieving A1C, BP, and LDL-C individual and composite measures was assessed, as was the proportion with baseline BMI ≥25 kg/m2 who lost ≥4.5 kg. Subgroup analyses by baseline BMI were also performed. Results: A total of 194 and 211 patients were treated with dapagliflozin 5- or 10-mg/d combination therapy, respectively, and 409 with metformin monotherapy. Significantly higher proportions of patients achieved A1C ≤6.5%, <7%, or <8% with combination therapy vs metformin monotherapy (P<0.02. Significantly higher proportions of patients achieved BP <140/90 mmHg (P<0.02 for each dapagliflozin dose and BP <130/80 mmHg (P<0.02 with dapagliflozin 5 mg/d only with combination therapy vs metformin monotherapy. Similar proportions (29%–33% of patients had LDL-C <100 mg/dL across treatment groups. A higher proportion of patients with baseline BMI ≥25 kg/m2 lost ≥4.5 kg with combination therapy. Combination therapy had a more robust effect on patients with higher baseline BMI. Conclusion
Energy Technology Data Exchange (ETDEWEB)
J. K. Wright
2010-09-01
application in heat exchangers and core internals for the NGNP. The primary candidates are Inconel 617, Haynes 230, Incoloy 800H and Hastelloy XR. Based on the technical maturity, availability in required product forms, experience base, and high temperature mechanical properties all of the vendor pre-conceptual design studies have specified Alloy 617 as the material of choice for heat exchangers. Also a draft code case for Alloy 617 was developed previously. Although action was suspended before the code case was accepted by ASME, this draft code case provides a significant head start for achieving codification of the material. Similarly, Alloy 800H is the material of choice for control rod sleeves. In addition to the above listed considerations, Alloy 800H is already listed in the nuclear section of the ASME Code; although the maximum use temperature and time need to be increased.
Energy Technology Data Exchange (ETDEWEB)
J. K. Wright
2008-04-01
application in heat exchangers and core internals for the NGNP. The primary candidates are Inconel 617, Haynes 230, Incoloy 800H and Hastelloy XR. Based on the technical maturity, availability in required product forms, experience base, and high temperature mechanical properties all of the vendor pre-conceptual design studies have specified Alloy 617 as the material of choice for heat exchangers. Also a draft code case for Alloy 617 was developed previously. Although action was suspended before the code case was accepted by ASME, this draft code case provides a significant head start for achieving codification of the material. Similarly, Alloy 800H is the material of choice for control rod sleeves. In addition to the above listed considerations, Alloy 800H is already listed in the nuclear section of the ASME Code; although the maximum use temperature and time need to be increased.
1992-01-01
ofrindi idual siruxtural ui.inix cn. hoes er, be atitntcdiru Aith current comnputer hardwa~e A firsit oi Xr Model for the detect structure max be...02115 ABSTRACT Atomic force microscopy (AFM) has been used to image the surface atomic structure of hydroxyapatite lCaI0(PO4 )6 (Oll)2 1, HA. and...The structure and chemical nature of the minerals hydroxyapatite and brushite have been studied extensively in biological researchf-t0 HA is found
Safeguarding Privacy by Reliable Automatic Blurring of Faces in Mobile Mapping Images
Puttemans, Steven; Goedemé, Toon; Vanwolputte, Stef
2016-01-01
During this research we made a visualization showing the influence of changing the threshold on the detection certainty score, from a scaled very low value to a scaled very high value, in relation to the amount of false positive detections produced. This clearly shows the influence of changing this param- eter manually in searching an ideal setting for your application. The video can be found at: https: //www.youtube.com/watch?v=-xrBg8sDDOQ.
Larsolle, Anders; Wretblad, Per; Westberg, Carl
2002-01-01
The objective of this study was to compare a selection of spray application techniques with different application volumes, with respect to the spray liquid distribution on flat surfaces, the deposition in fully developed crops and the biological effect. The spray application techniques in this study were conventional spray technique with three different nozzles: Teelet XR, Lechler ID and Lurmark DriftBeta, and also AirTec, Danfoil, Hardi Twin, Kyndestoit and Släpduk. The dynamic spray liquid ...
Bijpost, Erik A; Zuideveld, Martin A.; Meetsma, Auke; Teuben, Jan H
1998-01-01
Reaction of [(η5-C5Me5)2ZrMe][MeB(C6F5)3] (1) with (thio)ether functionalised alkenes: 3-ethoxy-1-propene and 3-(methylthio)-1-propene gives stable insertion products [(η5-C5Me5)2ZrCH2CH(Me)CH2XR][MeB(C6F5)3] (2: X = O, R = Et; 3: X = S, R = Me) in which the (thio)ether function is intramolecularly
Gaber, Dina M; Nafee, Noha; Abdallah, Osama Y
2015-07-05
Whether mini-tablets (tablets, diameters ≤6mm) belong to single- or multiple-unit dosage forms is still questionable. Accordingly, Pharmacopoeial evaluation procedures for mini-tablets are lacking. In this study, the aforementioned points were discussed. Moreover, their potential for oral controlled delivery was assessed. The antidepressant venlafaxine hydrochloride (Vx), a highly soluble drug undergoing first pass effect, low bioavailability and short half-life was selected as a challenging payload. In an attempt to weigh up mini-tablets versus pellets as multiparticulate carriers, Vx-loaded mini-tablets were compared to formulated pellets of the same composition and the innovator Effexor(®)XR pellets. Formulations were prepared using various polymer hydrogels in the core and ethyl cellulose film coating with increasing thickness. Mini-tablets (diameter 2mm) showed extended Vx release (<60%, 8h). Indeed, release profiles comparable to Effexor(®)XR pellets were obtained. Remarkably higher coating thickness was required for pellets to provide equivalent retardation. Ethyl cellulose in the core ensured faster release due to polymer migration to the surface and pore formation in the coat. mini-tablets showed higher stability to pellets upon storage. Industrially speaking, mini-tablets proved to be superior to pellets in terms of manufacturing, product quality and economical aspects. Results point out the urgent need for standardized evaluation procedures for mini-tablets. Copyright © 2015. Published by Elsevier B.V.
In situ X-ray studies of film cathodes for solid oxide fuel cells
International Nuclear Information System (INIS)
Fuoss, Paul; Chang, Kee-Chul; You, Hoydoo
2013-01-01
Highlights: •Synchrotron X-rays are used to study in operando the structural and chemical changes of LSM and LSCF film cathodes during half-cell operations. •A-site and B-site cations actively segregate or desegregate on the changes of temperature, pO 2 , and electrochemical potential. •Chemical lattice expansions show that oxygen-cathode interface is the primary source of rate-limiting processes. •The surface and subsurface of the LSM and LSCF films have different oxidation-states due to vacancy concentration changes. •Liquid-phase infiltration and coarsening processes of cathode materials into porous YSZ electrolyte backbone were monitored by USAXS. -- Abstract: Synchrotron-based X-ray techniques have been used to study in situ the structural and chemical changes of film cathodes during half-cell operations. The X-ray techniques used include X-ray reflectivity (XR), total-reflection X-ray fluorescence (TXRF), high-resolution diffraction (HRD), ultra-small angle X-ray scattering (USAXS). The epitaxial thin film model cathodes for XR, TXRF, and HRD measurements are made by pulse laser deposition and porous film cathodes for USAX measurements are made by screen printing technique. The experimental results reviewed here include A-site and B-site segregations, lattice expansion, oxidation-state changes during cell operations and liquid-phase infiltration and coarsening of cathode to electrolyte backbone
About a method for compressing x-ray computed microtomography data
Mancini, Lucia; Kourousias, George; Billè, Fulvio; De Carlo, Francesco; Fidler, Aleš
2018-04-01
The management of scientific data is of high importance especially for experimental techniques that produce big data volumes. Such a technique is x-ray computed tomography (CT) and its community has introduced advanced data formats which allow for better management of experimental data. Rather than the organization of the data and the associated meta-data, the main topic on this work is data compression and its applicability to experimental data collected from a synchrotron-based CT beamline at the Elettra-Sincrotrone Trieste facility (Italy) and studies images acquired from various types of samples. This study covers parallel beam geometry, but it could be easily extended to a cone-beam one. The reconstruction workflow used is the one currently in operation at the beamline. Contrary to standard image compression studies, this manuscript proposes a systematic framework and workflow for the critical examination of different compression techniques and does so by applying it to experimental data. Beyond the methodology framework, this study presents and examines the use of JPEG-XR in combination with HDF5 and TIFF formats providing insights and strategies on data compression and image quality issues that can be used and implemented at other synchrotron facilities and laboratory systems. In conclusion, projection data compression using JPEG-XR appears as a promising, efficient method to reduce data file size and thus to facilitate data handling and image reconstruction.
Detection and Analysis of X Ray Emission from the Princeton-Field-Reversed Configuration (PFRC-2)
Bosh, Alexandra; Swanson, Charles; Jandovitz, Peter; Cohen, Samuel
2016-10-01
The PFRC is an odd-parity rotating-magnetic-field-driven field-reversed-configuration magnetic confinement experiment. Studying X rays produced via electron Bremsstrahlung with neutral particles is crucial to the further understanding of the energy and particle confinement of the PFRC. The data on the x rays are collected using a detector system comprised of two, spatially scannable Amptek XR-100 CR detectors and a Amptek XR-100 SDD detector that view the plasma column at two axial locations, one in the divertor and one near the axial midplane. These provide X-ray energy and arrival-time information. (Data analysis requires measurement of each detector's efficiency, a parameter that is modified by window transmission. Detector calibrations were performed with a custom-made X-ray tube that impinged 1-microamp 1-5 kV electron beams onto a carbon target.) From the analyzed data, the average electron energy, effective temperature, and electron density can be extracted. Spatial scans then allow the FRC's internal energy to be measured. We present recent measurements of the Bremsstrahlung spectrum from 0.8 to 6 keV and the inferred electron temperature in the PFRC device as functions of heating power, magnetic field and fill gas pressure. This work was supported, in part, by DOE Contract Number DE-AC02-09CH11466.
International Nuclear Information System (INIS)
Sato, Taichi; Watanabe, Hiroshi
1982-01-01
The extraction of zirconium sulfate in aqueous sulfuric acid solutions with trioctylmethylammonium chloride (Aliquat-336; R 3 R'NCl) in organic solvents has been investigated under different conditions. In addition, the organic phases extracted sulfuric acid and zirconium sulfate were examined by IR and NMR spectroscopies. It has been found that Aliquat-336 extracts zirconium (IV) from sulfuric acid solutions according to the following ion-exchange reactions. i) The extraction of sulfuric acid is at first carried out through the equilibria, SO 4 2 - (aq) + 2R 3 R'NCl(org) reversible (R 3 R'N) 2 SO 4 (org) + 2Cl - (aq), (R 3 R'N) 2 SO 4 (org) + H + (aq) + HSO 4- (aq) reversible 2R 3 R'NHSO 4 (org). ii) The extraction of zirconium is expressed as the equilibrium reaction, Zr(SO 4 ) 3 2 - (aq) + 2xR 3 R'NHSO 4 (org) + (1-x)(R 3 R'N) 2 SO 4 (org) reversible (R 3 R'N) 2 [Zr(SO 4 ) 3 ](org) + xH 2 SO 4 (aq) + SO 4 2 - (aq), x = [R 3 R'NHSO 4 ]/(2[(R 3 R'N) 2 SO 4 ] + [R 3 R'NHSO 4 ]). Moreover, the hydrolyzed species (R 3 R'N)[ZrO(OH)(SO 4 )] is formed when zirconium is further extracted in an organic phase. (author)
Measurement of spectra for intra-oral X-ray beams using biological materials as attenuator
International Nuclear Information System (INIS)
Zenóbio, Madelon A.F.; Nogueira-Tavares, Maria S.; Zenóbio, Elton G.; Squair, Peterson Lima; Santos, Marcus A.P.; Silva, Teógenes A. da
2011-01-01
In diagnostic radiology, the radiation interaction probability in matter is a strong function of the X-ray energy. The knowledge of the X-ray energy spectral distribution allows optimizing the radiographic imaging system in order to obtain high quality images with as low as reasonably achievable patient doses. In this study, transmitted X-ray spectra through dentin and enamel that are existing materials in intra-oral radiology were experimentally determined in an X-ray equipment with 40–70 kV variable range. Dentin and enamel samples with 0.4–3.8 and 0.6–2.6 mm thick were used as attenuators. X-ray transmitted spectra were measured with XR-100T model CdTe detector and half-value layers (HVL) were determined. Characteristics of both dentin and enamel transmitted spectra showed that they have differences in the penetration power in matter and in the spectrum distribution. The results will be useful for phantom developments based on dentin and enamel for image quality control in dental radiology. - Highlights: ► The X-ray energy spectral distribution, optimize the radiographic imaging system. Transmitted X-ray spectra through dentin and enamel were experimentally determined. X-ray transmitted spectra were measured (XR-100T model CdTe detector). The transmitted spectra showed differences in the penetration power and spectrum distribution. Dentin and enamel transmitted spectra will be useful for phantom developments.
Design principles and issues of rights expression languages for digital rights management
Wang, Xin
2005-07-01
Digital rights management (DRM) provides a unified approach to specifying, interpreting, enforcing and managing digital rights throughout the entire life cycle of digital assets. Using a declarative rights expression language (REL) for specifying rights and conditions in the form of licenses, as opposite to some other approaches (such as data structures and imperative languages), has been considered and adopted as a superior technology for implementing effective, interoperable and scalable DRM systems. This paper discusses some principles and issues for designing RELs, based on the experiences of developing a family of REL"s (DPRL, XrML 1.x, XrML 2.0 and MPEG REL). It starts with an overview of a family tree of the past and current REL"s, and their development history, followed by an analysis of their data models and a comparison with access-control oriented models. It then presents a number of primary design principles such as syntactic and semantic un-ambiguity, system interoperability, expressiveness in supporting business models and future extensibility, and discusses a number of key design issues such as maintaining stateful information, multi-tier issuance of rights, meta rights, identification of individual and aggregate objects, late-binding of to-beidentified entities, as well as some advanced ones on revocation and delegation of rights. The paper concludes with some remarks on REL profiling and extension for specific application domains.
Directory of Open Access Journals (Sweden)
Henryk Ratajkiewicz
2018-04-01
Full Text Available The study was conducted for the purpose of improving the application of fungicides against potato late blight (Phytophthora infestans (Mont. de Bary (PLB in processing tomato. The usability of coarse spray quality with double flat fan air induction IDKT12003 nozzle and the impact of fixed and variable spray volume and adjuvants during alternate application of azoxystrobin and chlorothalonil were analysed on the basis of plant infestation and fungicide residues. The variable spray volume was calculated based on the number of leaves on a plant. The study was conducted during three vegetation seasons. Spraying of plants with significantly flattened canopies during the peak of the fructification season using an IDKT12003 nozzle was as effective as in the case of fine spraying performed with an XR11003 nozzle and facilitated the increase of fungicides residue. In the case of plants with high-spreading canopy at the beginning of fructification, XR11003 nozzle favoured the reduction of PLB infestation. Both spray volume adjustment systems enabled the same level of protection of tomato against PLB, which could result from alternate application of systemic and contact fungicides. Polyalkyleneoxide modified heptamethyltrisiloxane adjuvant, which causes siginificant increase in wetting and droplet spreading, facilitated the reduction of tomato PLB infestation during the application of fungicides using an IDKT12003 nozzle.
The mechanical properties of T-111 at low to intermediate temperatures
International Nuclear Information System (INIS)
McCoy, H.E.; DiStefano, J.R.
1997-01-01
In the design of the 60-W Isotopic Heat Source (IHS), a tantalum alloy (T-111) strength member serves as the primary containment shell for the IHS during operation (He-gas internal environment and inert gas or vacuum external environment). An outer Hastelloy S clad is used to protect the T-111 from oxidation, and both the Hastelloy S clad and the T-111 strength member are sealed by automatic gas tungsten arc (GTA) welding. The expected life of the IHS is 5 years at about 650 C preceded by up to 5 years of storage at approximately 300 C. For this application, one important concern is failure of the T-111 strength member due to capsule pressurization arising from helium generation as a fuel decay product. To provide specific data on the mechanical behavior of base and solid metal T-111 under conditions appropriate to the IHS use conditions, a testing program was formulated and carried out. Three types of mechanical tests were conducted. Tensile properties were measured over the temperature range of 25 to 1100 C on T-111 base metal and samples with either longitudinal or transverse autogenous welds. Creep tests on base metal and samples with transverse welds were run to failure over the temperature range of 1100 to 850 C. Creep tests were also run on several transverse weld samples over the temperature range of 500 to 900 C at stresses where failure did not occur, and the creep rates were measured. Two prototypical capsules of the T-111 strength member were fabricated by EG and G Mound Applied Technologies (Mound Laboratories). To verify the mechanical properties design data developed above, these were tested to failure (leak) in a vacuum chamber with the inside of the capsule pressurized by either argon or helium
Embrittlement of nickel-, cobalt-, and iron-base superalloys by exposure to hydrogen
Gray, H. R.
1975-01-01
Five nickel-base alloys (Inconel 718, Udimet 700, Rene 41, Hastelloy X, and TD-NiCr), one cobalt-base alloy (L-605), and an iron-base alloy (A-286) were exposed in hydrogen at 0.1 MN/sq m (15 psi) at several temperatures in the range from 430 to 980 C for as long as 1000 hours. These alloys were embrittled to varying degrees by such exposures in hydrogen. Embrittlement was found to be: (1) sensitive to strain rate, (2) reversible, (3) caused by large concentrations of absorbed hydrogen, and (4) not associated with any detectable microstructural changes in the alloys. These observations are consistent with a mechanism of internal reversible hydrogen embrittlement.
International Nuclear Information System (INIS)
Smailos, E.; Schwarzkopf, W.; Koester, R.; Fiehn, B.; Halm, G.
1990-05-01
In previous corrosion studies performed in salt brines, unalloyed steels, Ti 99.8-Pd and Hastelloy C4 have proved to be the most promising materials for long-term resistant packagings to be used in heat-generating waste (vitrified HLW, spent fuel) disposal in rock-salt formations. To characterise the corrosion behaviour of these materials in more detail, further in-depth laboratory-scale and in-situ corrosion studies have been performed in the present study. Besides the above-mentioned materials, also some in-situ investigations of the iron-base materials Ni-Resist D2 and D4, cast iron and Si-cast iron have been carried out in order to complete the results available to date. (orig.) [de
International Nuclear Information System (INIS)
Hofmann, P.
1994-08-01
To study the chemical interactions between graphite and a martensitic-ferritic steel (1.4914), an austenitic stainless steel (1.4919; AISI 316), and a Ni-base alloy (Hastelloy X) isothermal reaction experiments were performed in the temperature range between 900 and 1250 C. At higher temperatures a rapid and complete liquefaction of the components occurred as a result of eutectic interactions. The chemical interactions are diffusion-controlled processes and can be described by parabolic rate laws. The reaction behavior of the two steels is very similar. The chemical interactions of the steels with graphite are much faster above 1100 C than those for the Ni-base alloy. Below 1000 C the effect is opposite. (orig.) [de
Recanning of canned motors (Paper No. 6.3)
International Nuclear Information System (INIS)
Lahiri, B.N.; Venkatappiah, J.; Srikrishnamurthy, G.
1992-01-01
Good performance of any plant necessarily depends on the quality of preventive as well as break-down maintenance management practised along with the adequacy of knowledge and skill of the supporting personnel. Heavy water plants, operating under exceedingly high pressure and varied corrosive atmospheres definitely call for additional care and attention in this regard. Canned motors of different power ratings and shapes find their use in operating heavy water plants. In this paper, complete re-canning procedure of one such canned motor has been discussed giving design details of hydraulic expansion fixture and pulsed-tig welding procedure for longitudinal seam and circumferential edge welding of 0.5 mm thick hastelloy cans. (author). 4 figs
Corrosion studies and recommendation of alloys for an incinerator of glove-boxes wastes
International Nuclear Information System (INIS)
Devisme, F.; Garnier, M.H.
1992-01-01
In the framework of the development of an incineration process for high chlorinated wastes, commercial alloys have been investigated by means of parametric laboratory tests in HCl containing gas mixtures and also in field tests. Recommendations may be formulated for the three main components i.e. pyrolyser, calciner and cooler. In very low oxygen-potential atmospheres, the alloys Hastelloy C276 and Inconel 625 present the best behaviours. For the calciner, alloy Inconel 601 is more satisfactory than AISI 310 steel. As for the cooler, only the alloy Haynes 214 appears acceptable at 1100 deg C. Because of the very low stress level affecting the components, thermomechanical properties do not modify these recommendations based on corrosion behaviour
International Nuclear Information System (INIS)
Swindeman, R.W.; Brinkman, C.R.
1981-01-01
Progress during the 1970's on the production of high-temperature mechanical properties data for pressure vessel materials was reviewed. The direction of the research was toward satisfying new data requirements to implement advances in high-temperature inelastic design methods. To meet these needs, servo-controlled testing machines and high-resolution extensometry were developed to gain more information on the essential behavioral features of high-temperature alloys. The similarities and differences in the mechanical response of various pressure vessel materials were identified. High-temperature pressure vessel materials that have received the most attention included Type 304 stainless steel, Type 316 stainless steel, 2 1/4 Cr-1 Mo steel, alloy 800H, and Hastelloy X
Processing of Ceramics by Biopolymers. Ultrastructure-Property Relationships in Biocrystals
1991-10-09
hydroxyapatite mineral as the inorganic phase leading to the formation of bone [1,5,12]. Similar to the role that collagen plays in the formation of bone, a...production of magnetosomes. One of the main objectives in completing Eixp. III wr&as to determine the-2 nurnber of xr ~4,msrelat%*ive to the ia’., in...material in which elongated particles of hydroxyapatite (a calcium compound that is the mineral titania (TiC2) are distributed also the main mineral
A comparative study of voltage stability indices in a power system
Energy Technology Data Exchange (ETDEWEB)
Sinha, A.K. [I.I.T., Kharagpur (India). Dept. of Electrical Engineering; Hazarika, D. [Assam Engineering College (India)
2000-11-01
The paper compares the effectiveness of voltage stability indices in providing information about the proximity of voltage instability of a power system. Three simple voltage stability indices are proposed and their effectiveness is compared with some of the recently proposed indices. The comparison is carried out over a wide range of system operating conditions by changing the load power factor and feeder X/R ratios. Test results for the IEEE 57 bus and IEEE 118 bus system are presented. (author)
Effects of radiation pressure on the equipotential surfaces in X-ray binaries
Kondo, Y.; Mccluskey, G. E., Jr.; Gulden, S. L.
1976-01-01
Equipotential surfaces incorporating the effect of radiation pressure were computed for the X-ray binaries Cen X-3, Cyg X-1 = HDE 226868, Vela XR-1 = 3U 0900-40 = HD 77581, and 3U 1700-37 = HD 153919. The topology of the equipotential surfaces is significantly affected by radiation pressure. In particular, the so-called critical Roche (Jacobian) lobes, the traditional figure 8's, do not exist. The effects of these results on modeling X-ray binaries are discussed.
Effects of radiation pressure on the equipotential surfaces in x-ray binaries
International Nuclear Information System (INIS)
Kondo, Y.; McCluskey, G.E. Jr.; Gulden, S.L.
1976-01-01
Equipotential surfaces incorporating the effect of radiation pressure were computed for the x-ray binaries Cen X-3, Cyg X-1 = HDE 226868, Vela XR-1 = 3U 0900-40 = HD 77581, and 3U 1700-37 = HD 153919. The topology of the equipotential surfaces is significantly affected by radiation pressure. In particular, the so-called critical Roche (Jacobian) lobes, the traditional figure 8's, do not exist. The effects of these results on modeling x-ray binaries are discussed
International Nuclear Information System (INIS)
Tang Lin; Yan Yiming; Zhou Hongyu; Wen Shenlin; Wang Qi; Sun Shuxu; Ding Xiaoji; Wang Wanhong
1987-04-01
The (n,xr) reactions have been studied for incident neutron energy 14.9 Mev and for the samples C, Al, V, Fe, Co and Nb. The pulsed beam Time-of-Flight technique was adopted to discriminate neutrons and de-excitation r-rays and to improve the background conditions of the experiment. 90 deg. differential gamma production cross sections as the results of experiments are presented. Due to very low background many new r-rays peaks have been obtained. (author). 14 refs, 12 figs, 1 tab
Lobster eye as a collector for water window microscopy
Pina, L.; Maršíková, V.; Inneman, A.; Nawaz, M. F.; Jančárek, A.; Havlíková, R.
2017-08-01
Imaging in EUV, SXR and XR spectral bands of radiation is of increasing interest. Material science, biology and hot plasma are examples of relevant fast developing areas. Applications include spectroscopy, astrophysics, Soft X-ray Ray metrology, Water Window microscopy, radiography and tomography. Especially Water Window imaging has still not fully recognized potential in biology and medicine microscopy applications. Theoretical study and design of Lobster Eye (LE) optics as a collector for water window (WW) microscopy and comparison with a similar size ellipsoidal mirror condensor are presented.
CHAMP: A bespoke integrated system for mobile manipulation
CSIR Research Space (South Africa)
Van Eden, B
2014-11-01
Full Text Available for Mobile Manipulation Beatrice van Eden, Benjamin Rosman, Daniel Withey, Terence Ratshidaho, Mogomotsi Keaikitse, Ditebogo Masha, Ashley Kleinhans, and Ahmed Shaik Mobile Intelligent Autonomous Systems Modelling and Digital Science Council for Scientific... as a rear caster. Each arm has 7 DoF, with an attached Barrett hand. UMAN [19], the UMass Mobile MANipulator also uses a 7 DoF Barrett WAM, with a three-fingered Barrett hand. The arm is mounted on modified Nomadic XR4000 mobile base having four caster...
Healing of Stress Fracture in an Animal Model
2005-09-01
result of damage in vivo [1,15]. (with hydroxyl ions) at the surface of the hydroxyapatite crystal 54 35 Recently, we have found that positron emission...after loading. Scale bar = 500 pm. 4 1 Li ef al. / Bone xr (2005) xtx-xxv A B C -Comparison of Fatigue Loading with Loading without Fatigue AOL 2.0, I.O...groups in the hydroxyapatite crystal . a t P 3 267 of bone to form fluoroapatite. [ F]fluoride is deposited pre- The authors would like totha;lnBce Mock
Casimir effect at finite temperature for the Kalb-Ramond field
International Nuclear Information System (INIS)
Belich, H.; Silva, L. M.; Helayeel-Neto, J. A.; Santana, A. E.
2011-01-01
We use the thermofield dynamics formalism to obtain the energy-momentum tensor for the Kalb-Ramond field in a topology S 1 xS 1 xR 2 . The compactification is carried out by a generalized thermofield dynamics-Bogoliubov transformation that is used to define a renormalized energy-momentum tensor. The expressions for the Casimir energy and pressure at finite temperature are then derived. A comparative analysis with the electromagnetic case is developed, and the results may be important for applications, as in cuprate superconductivity, for instance.
1979-11-01
S.Int. C. F3b 1312 Claim U.S. Cl. X.R. 290-53 Devcloprig and changing kinc:ic energ\\ rmotion ) into -,otcntial dnamic e’crgy contnuousl’, and non...jets on a frame cut the trench. , - i .. The apparatus is motivated by a drive roller that is re- s$ientv urged against the pipellie. Forward guide rol...contacts the pipeine to provide a control on the position of the machine relative to the pipeline and is self motivated . 360 - ,. IA,¢ -’a -- A
Chauhan, Pooja; Jaiswal, Sushil Kumar; Lakhotia, Anjali Rani; Rai, Amit Kumar
2016-09-01
In the present study, we reported two cases of TS with mosaic ring X chromosome showing common clinical characteristics of TS like growth retardation and ovarian dysfunction. The purpose of the present study was to cytogenetically characterize both cases. Whole blood culture and G-banding were performed for karyotyping the cases following standard protocol. Origin of the ring chromosome and degree of mosaicism were further determined by fluorescence in situ hybridization (FISH). Breakpoints and loss of genetic material in formation of different ring X chromosomes r (X) in cases were determined with the help of cytogenetic microarray. Cases 1 and 2 with ring chromosome were cytogenetically characterized as 45, X [114]/46Xr (X) (p22.11q21.32) [116] and 45, X [170]/46, Xr (X) (p22.2q21.33) [92], respectively. Sizes of these ring X chromosomes were found to be ~75 and ~95 Mb in cases 1 and 2, respectively, using visual estimation as part of cytogenetic observation. In both cases, we observed breakpoints on Xq chromosome were within relatively narrow region between Xq21.33 and Xq22.1 compared to regions in previously reported cases associated with ovarian dysgenesis. Our observation agrees with the fact that despite of large heterogeneity, severity of the cases with intact X-inactive specific transcript (XIST) is dependent on degree of mosaicism and extent of Xq deletion having crucial genes involved directly or indirectly in various physiological involving ovarian cyclicity.
International Nuclear Information System (INIS)
Arai, T.; Shin, J.K.; Matsubayashi, H.; Ochiai, S.; Okuda, H.; Osamura, K.; Prusseit, W.
2009-01-01
The tensile behavior of the DyBa 2 Cu 3 O 7-δ (DyBCO) coated conductor with MgO buffer layer deposited on the Hastelloy C-276 substrate by inclined substrate deposition (ISD) was studied. The tensile stress-strain curve showed a flat region, characterized by the discontinuous yielding of the substrate due to the Lueders band extension from the gripped portions of the sample. In the area where the Lueders band had passed, the coating layer showed severe multiple transverse cracking due to the localized plastic deformation of the substrate. The flaking off of the coating layers took place at high applied strain, due to the buckling fracture of the coated layers in the sample width direction, accompanied by the interfacial debonding.
Development of corrosion and wear resistant coatings by an improved HVOF spraying process
Energy Technology Data Exchange (ETDEWEB)
Ishikawa, Y.; Kawakita, J.; Kuroda, S. [National Inst. for Materials Science, Tsukuba (Japan)
2005-07-01
We have developed an improved HVOF spray process called ''Gas-shrouded HVOF'' (GS-HVOF) over the past several years. By using an extension nozzle at the exit of a commercial HVOF spray gun, GS-HVOF is capable of controlling the oxidation of sprayed materials during flight as well as achieving higher velocity of sprayed particles. These features result in extremely dense and clean microstructure of the sprayed coatings. The process has been successfully applied to corrosion resistant alloys such as SUS316L, Hastelloy C, and alloy 625 as well as cermets such as WC-Cr{sub 3}C{sub 2}-Ni. The spray process, coatings microstructure and property evaluation will be discussed with potential industrial applications in the near future. (orig.)
Effect of fission product interactions on the corrosion and mechanical properties of HTGR alloys
International Nuclear Information System (INIS)
Aronson, S.; Chow, J.G.Y.; Soo, P.; Friedlander, M.
1978-01-01
Preliminary experiments have been carried out to determine how fission product interactions may influence the mechanical integrity of reference HTGR structural metals. In this work Type 304 stainless steel, Incoloy 800 and Hastelloy X were heated to 550 to 650 0 C in the presence of CsI. It was found that no corrosion of the alloys occurred unless air or oxygen was also present. A mechanism for the observed behavior is proposed. A description is also given of some long term exposures of HTGR materials to more prototypic, low concentrations of I 2 , Te 2 and CsI in the presence of low partial pressures of O 2 . These samples are scheduled for mechanical bend tests after exposure to determine the degree of embrittlement
Hanford waste encapsulation: strontium and cesium
International Nuclear Information System (INIS)
Jackson, R.R.
1976-06-01
The strontium and cesium fractions separated from high radiation level wastes at Hanford are converted to the solid strontium fluoride and cesium chloride salts, doubly encapsulated, and stored underwater in the Waste Encapsulation and Storage Facility (WESF). A capsule contains approximately 70,000 Ci of 137 Cs or 70,000 to 140,000 Ci of 90 Sr. Materials for fabrication of process equipment and capsules must withstand a combination of corrosive chemicals, high radiation dosages and frequently, elevated temperatures. The two metals selected for capsules, Hastelloy C-276 for strontium fluoride and 316-L stainless steel for cesium chloride, are adequate for prolonged containment. Additional materials studies are being done both for licensing strontium fluoride as source material and for second generation process equipment
The performance of electroless nickel deposits in oil-field environments
International Nuclear Information System (INIS)
Mack, R.; Bayes, M.
1984-01-01
An experimental study was conducted on an electroless nickel plated (represented by Enplate NI-422) C-90 steel, uncoated C-90 steel, AISI 420, 174 PH, SAF 2205, and HASTELLOY /sup R/ G-3 to determine their corrosion-performance in twelve simulated downhole oil or gas production environments during 28 day exposures. These environments were aqueous brines containing various concentrations of Cl - , H 2 S and/or CO 2 , and over a range of temperatures. The results from this study and oilfield data for electroless nickel plated low alloy steels are presented and discussed. The study demonstrates the feasibility of electroless nickel coated low alloy steels as an economical substitute for some highly alloyed materials in certain oilfield applications; the field data support this
Asphahani, Aziz; Siegel, Sidney; Siegel, Edward
2010-03-01
Carbides solid-state chemistry domination of old/new nuclear- reactors/spent-fuel-casks/refineries/jet/missile/rocket-engines in austenitic/FCC Ni/Fe-based(so miscalled)``super"alloys(182/82; Hastelloy-X,600,304/304L-SSs,...,690!!!) GENERIC ENDEMIC EXTANT detrimental(synonyms): Wigner's-diseas(WD)[J.Appl.Phys.17,857 (1946)]/Ostwald-ripening/spinodal-decomposition/overageing- embrittlement/thermal-leading-to-mechanical(TLTM)-INstability: Mayo[Google:``If Leaks Could Kill"; at flickr.com search on ``Giant-Magnotoresistance"; find: Siegel[J.Mag.Mag.Mtls.7,312 (1978)]Politics(1979)]-Hoffman[animatedsoftware.com], what DOE/NRC MISlabels as ``butt-welds" ``stress-corrosion cracking" endpoint's ROOT-CAUSE ULTIMATE-ORIGIN is WD overageing-embritt- lement caused brittle-fracture cracking from early/ongoing AEC/ DOE-n"u"tional-la"v"atories sabotage!!!
Design and fabrication of the Mini-Brayton Recuperator (MBR)
Killackey, J. J.; Graves, R.; Mosinskis, G.
1978-01-01
Development of a recuperator for a 2.0 kW closed Brayton space power system is described. The plate-fin heat exchanger is fabricated entirely from Hastelloy X and is designed for 10 years continuous operation at 1000 K (1300 F) with a Xenon-helium working fluid. Special design provisions assure uniform flow distribution, crucial for meeting 0.975 temperature effectiveness. Low-cycle fatigue, resulting from repeated startup and shutdown cycles, was identified as the most critical structural design problem. It is predicted that the unit has a minimum fatigue life of 220 cycles. This is in excess of the BIPS requirement of 100 cycles. Heat transfer performance and thermal cycle testing with air, using a prototype unit, verified that all design objectives can be met.
Evaluation of metallic materials for use in engineering barrier systems
International Nuclear Information System (INIS)
Pitman, S.G.; Griggs, B.; Elmore, R.P.
1980-01-01
Conclusions of this work are as follows: Inconel, Incoloy, Hastelloy C-276, and titanium alloys all had excellent corrosion resistance in all postulated repository environments tested. Further work will be required to evaluate the pertinent enviro-mechanical properties of these materials; the mechanical properties of grade 2 titanium are better than those of grade 12 titanium, except the tensile and yield strengths. These properties include fatigue-crack-growth rate, environmental fatigue-crack-growth rate, fracture toughness, impact toughness, and dynamic fracture toughness; there is no evidence in the current data to indicate that the simulated repository environment is aggressive to grade 2 or grade 12 titanium. This includes data from corrosion-fatigue, crevice corrosion, wedge-loaded cracked specimens, and residual-stress specimens
DEFF Research Database (Denmark)
Stenger, Patric C.; Wu, Guohui; Miller, Chad E.
2009-01-01
as on a pristine interface, but with a more compact lattice corresponding to a small increase in the surface pressure. These results confirm that albumin adsorption creates a physical barrier that inhibits LS adsorption, and that PEG in the subphase generates a depletion attraction between the LS aggregates...... to subsequent LS adsorption that can be overcome by the depletion attraction induced by polyethylene glycol (PEG) in solution. A combination of grazing incidence x-ray diffraction (GIXD), x-ray reflectivity (XR), and pressure-area isotherms provides molecular-resolution information on the location...
1988-04-01
12 XR7Jw - - DRILLNdL - SITE NAlE: SITE I.D: SITE LOCATION: 009 TDD #R6- DATE: ROLE DESIGNATION: .;] HOLE LOCATION: GROUND ELEV: TOP OF CASING FLEV...0 STAflDBY POWER IASB , 0 HP RP DESCRhIPTION VI~S~G ANDNELL~Rr~T~ T~V~L ~5~ .LLNGTh - IeA : - - - Flur27 AFF:m98 Well, Allt; ’PV$ - p I3 n I’I Figue...require a complete respect for safety by all team members to prevent injury or loss of life. 15.1 ORGANIZATION AND RESPONSIBILITIES There are eight roles
International Nuclear Information System (INIS)
Rodriguez, L.; Jimenez, A.; Grau, A.
1996-01-01
We applied the CIEMAT/NIST method and alpha/beta discrimination to ''210 Pb samples in equilibrium with its daughters, by preparing homogeneous and gel samples. The stability of samples was tested in different available cocktails, HiSafe''tm II, HiSafe''tmIII, Ultima-Gold''tm, Ultima-Gold''tmXR, Ultima-Gold''tmAB, Insta-Gel and e Insta-Gel II. Also we analyzed the disequilibrium of the radioactive chain ''210Pb+''210Bi+''210Po, achieving and excellent agreement between the results of the spectrum unfolding method and the experimental values. (Author) 13 refs
1972-08-01
wI. I’- D;~ U0! IS 0 U)- 00oa u (D0 ILL z In wi Ug iu U)0ii - __ U) w m w0: - -x x xr -j4 COd 0 cr. (0 0 0) 0 ~0 0-I 0 0> I- Zc w 0 -j I I to- 0n / I...sludge ("phosphate calcium", calcium hydroxyapatite - Ca5O1-l(PO4) 3 ) from 0aC03. (Ref. 15.) The CaCO 3 can then be rocalcined while the phosphate sludge
Co-occurrence Models in Music Genre Classification
DEFF Research Database (Denmark)
Ahrendt, Peter; Goutte, Cyril; Larsen, Jan
2005-01-01
Music genre classification has been investigated using many different methods, but most of them build on probabilistic models of feature vectors x\\_r which only represent the short time segment with index r of the song. Here, three different co-occurrence models are proposed which instead consider...... genre data set with a variety of modern music. The basis was a so-called AR feature representation of the music. Besides the benefit of having proper probabilistic models of the whole song, the lowest classification test errors were found using one of the proposed models....
International Nuclear Information System (INIS)
Yang Xiao; Du Dianlou
2010-01-01
The Poisson structure on C N xR N is introduced to give the Hamiltonian system associated with a spectral problem which yields the nonlinear Schroedinger (NLS) hierarchy. The Hamiltonian system is proven to be Liouville integrable. Some (2+1)-dimensional equations including NLS equation, Kadomtesev-Petviashvili I (KPI) equation, coupled KPI equation, and modified Kadomtesev-Petviashvili (mKP) equation, are decomposed into Hamilton flows via the NLS hierarchy. The algebraic curve, Abel-Jacobi coordinates, and Riemann-Jacobi inversion are used to obtain the algebrogeometric solutions of these equations.
Kołodziejczyk, Michał Krzysztof; Kołodziejska, Justyna; Zgoda, Marian Mikołaj
2012-01-01
Metformin hydrochloride after buformin and phenformin belongs to the group of biguanid derivatives used as oral anti-diabetic drugs. The object of the study is the technological analysis and the potential effect of biodegradable macromolecular polymers on the technological and therapeutic parameters of oral anti-diabetic medicinal products with metformin hydrochloride: Siofor, Formetic, Glucophage, Metformax in doses of 500mg and 1000mg and Glucophage XR in a dose of 500 mg of modified release. Market therapeutic products containing 500 and 1000 mg of metformin hydrochloride in a normal formulation and 500 mg of metformin hydrochloride in a formulation of modified release were analyzed. Following research methods were used: technological analysis of tablets, study of disintegration time of tablets, evaluation of pharmaceutical availability of metformin hydrochloride from tested therapeutic products, mathematical and kinetic analysis of release profiles of metformin hydrochloride, statistical analysis of mean differences of release coefficients. The percentage of excipients in the XR formulation is higher and constitutes 50.5% of a tablet mass. However, in standard formulations the percentage is lower, between 5.5% and 12.76%. On the basis of the results of disintegration time studies, the analysed therapeutic products can be divided into two groups, regardless the dose. The first one are preparations with faster (not fast!) disintegration: Glucophage i Metformax. The second group are preparations with slower disintegration, more balanced in the aspect of a high dose of the biologically active substance: Formetic and Siofor. Products with a lower content of excipients (Metformax, Glucophage) disintegrate in a faster way. The disintegration rate of the products with a higher content of excipients (Formetic, Siofor) is slower. The appearance of metformin hydrochloride concentration in the gastrointestinal contents, balanced in time, caused by a slower disintegration
Directory of Open Access Journals (Sweden)
Cleiton Carvalho Silva
2014-12-01
Full Text Available O objetivo do presente trabalho foi avaliar a influência dos parâmetros de soldagem na formação de defeitos na soldagem de revestimentos com ligas à base de níquel, e sua possível eliminação através do correto ajuste dos referidos parâmetros. Para tanto, foram depositados revestimentos com as ligas à base de Ni do tipo Inconel 625, Hastelloy C276 e Inconel 686, sobre um substrato de aço C-Mn, através do processo TIG com alimentação de arame frio. O planejamento dos experimentos foi realizado aplicando-se o método Taguchi. Os fatores de controle avaliados foram a Técnica da energia (TE, o nível de energia de soldagem (E, o tipo de liga (L, o gás de proteção (G e o tipo de tecimento (T. Outros parâmetros foram mantidos constantes, tendo sido investigados previamente. Os resultados mostraram que o tipo de tecimento em espiral, embora contribua significativamente para a redução da diluição, causa uma forte instabilidade ao processo, resultando na maioria dos casos em defeitos superficiais ou defeitos entre passes. A condição ótima para evitar a formação de defeitos entre passes identificada pelo método Taguchi foi constituída pelas seguintes combinação de fatores de controle 2-2-2-3-3, ou seja: TE-I; Emédia; Liga Hastelloy C276; Gás de proteção Ar+He; Tecimento Duplo-8. A condição ótima para a soldagem sem defeitos resulta em alto nível de diluição não sendo indicada para a soldagem de revestimentos resistentes à corrosão.
Energy Technology Data Exchange (ETDEWEB)
Bhattacharyya, D., E-mail: dhb@ansto.gov.au; Davis, J.; Drew, M.; Harrison, R.P.; Edwards, L.
2015-07-15
Nickel based alloys of the type Hastelloy-N™ are ideal candidate materials for molten salt reactors, as well as for applications such as pressure vessels, due to their excellent resistance to creep, oxidation and corrosion. In this work, the authors have attempted to understand the effects of welding on the morphology, chemistry and crystal structure of the precipitates in the heat affected zone (HAZ) and the weld zone of a Ni–Cr–Mo–Fe–Si alloy similar to Hastelloy-N™ in composition, by using characterization techniques such as scanning and transmission electron microscopy. Two plates of a Ni–Cr–Mo–Fe–Si alloy GH-3535 were welded together using a TiG welding process without filler material to achieve a joint with a curved molten zone with dendritic structure. It is evident that the primary precipitates have melted in the HAZ and re-solidified in a eutectic-like morphology, with a chemistry and crystal structure only slightly different from the pre-existing precipitates, while the surrounding matrix grains remained unmelted, except for the zones immediately adjacent to the precipitates. In the molten zone, the primary precipitates were fully melted and dissolved in the matrix, and there was enrichment of Mo and Si in the dendrite boundaries after solidification, and re-precipitation of the complex carbides/silicides at some grain boundaries and triple points. The nature of the precipitates in the molten zone varied according to the local chemical composition. - Graphical abstract: Display Omitted - Highlights: • Ni-based alloy with Cr, Mo, Si, Fe and C was welded, examined with SEM, EBSD, and TEM. • Original Ni{sub 2}(Mo,Cr){sub 4}(Si,C) carbides changed from equiaxed to lamellar shape in HAZ. • Composition and crystal structure remained almost unchanged in HAZ. • Original carbides changed to lamellar Ni{sub 3}(Mo,Cr){sub 3}(Si,C) in some cases in weld metal. • Precipitates were mostly incoherent, but semi-coherent in some cases in weld
International Nuclear Information System (INIS)
Bhattacharyya, D.; Davis, J.; Drew, M.; Harrison, R.P.; Edwards, L.
2015-01-01
Nickel based alloys of the type Hastelloy-N™ are ideal candidate materials for molten salt reactors, as well as for applications such as pressure vessels, due to their excellent resistance to creep, oxidation and corrosion. In this work, the authors have attempted to understand the effects of welding on the morphology, chemistry and crystal structure of the precipitates in the heat affected zone (HAZ) and the weld zone of a Ni–Cr–Mo–Fe–Si alloy similar to Hastelloy-N™ in composition, by using characterization techniques such as scanning and transmission electron microscopy. Two plates of a Ni–Cr–Mo–Fe–Si alloy GH-3535 were welded together using a TiG welding process without filler material to achieve a joint with a curved molten zone with dendritic structure. It is evident that the primary precipitates have melted in the HAZ and re-solidified in a eutectic-like morphology, with a chemistry and crystal structure only slightly different from the pre-existing precipitates, while the surrounding matrix grains remained unmelted, except for the zones immediately adjacent to the precipitates. In the molten zone, the primary precipitates were fully melted and dissolved in the matrix, and there was enrichment of Mo and Si in the dendrite boundaries after solidification, and re-precipitation of the complex carbides/silicides at some grain boundaries and triple points. The nature of the precipitates in the molten zone varied according to the local chemical composition. - Graphical abstract: Display Omitted - Highlights: • Ni-based alloy with Cr, Mo, Si, Fe and C was welded, examined with SEM, EBSD, and TEM. • Original Ni 2 (Mo,Cr) 4 (Si,C) carbides changed from equiaxed to lamellar shape in HAZ. • Composition and crystal structure remained almost unchanged in HAZ. • Original carbides changed to lamellar Ni 3 (Mo,Cr) 3 (Si,C) in some cases in weld metal. • Precipitates were mostly incoherent, but semi-coherent in some cases in weld metal
Jiang, Hui; Ma, Rong; Zou, Shubiao; Wang, Yongzhong; Li, Zhuqing; Li, Weiping
2017-06-01
Rheumatoid arthritis (RA) is an autoimmune disease with an unknown etiology, occurring in approximately 1.0% of general population. More and more studies have suggested that long non-coding RNAs (lncRNAs) could play important roles in various biological processes and be associated with the pathogenesis of different kinds of diseases including RA. Although a large number of lncRNAs have been found, our knowledge of their function and physiological/pathological significance is still in its infancy. In order to reveal functional lncRNAs and identify the key lncRNAs in RA, we reconstructed a global triple network based on the competitive endogenous RNA (ceRNA) theory using the data from National Center for Biotechnology Information Gene Expression Omnibus and our previous paper. Meanwhile, Gene Ontology (GO) and pathway analysis were performed using Cytoscape plug-in BinGO and Database for Annotation, Visualization, and Integration Discovery (DAVID), respectively. We found that the lncRNA-miRNA-mRNA network was composed of 7 lncRNA nodes, 90 mRNA nodes, 24 miRNA nodes, and 301 edges. The functional assay showed that 147 GO terms and 23 pathways were enriched. In addition, three lncRNAs (S5645.1, XR_006437.1, J01878) were highly related to RA, and therefore, were selected as key lncRNAs. This study suggests that specific lncRNAs are associated with the development of RA, and three lncRNAs (S5645.1, XR_006437.1, J01878) could be used as potential diagnostic biomarkers and therapeutic targets.
International Nuclear Information System (INIS)
Campos Garcia, Juan Pablo
2014-01-01
Radiation doses in skin of patients subjected to interventional procedures is estimated from the utilization and analysis of GAFCHROMIC® XR-RV2 radiochromic films and KODAK® X-Omat films with aid of the ImageJ software. The distribution of the radiation fields in the films is generated to obtain the distribution of dose in skin and to find peaks of dose by isodose curves using ImageJ software. The calibration curves are realized from GAFCHROMIC® XR-RV2 radiochromic films, through the use of a densitometer and two types of scanners (reflection scanner and transmission scanner). The reflection scanner has digitalized color images of 48 bit in TIFF format. The scanner transmission has digitalized in grayscale images to 16 bit in TIFF format. Each method has determined the points with maximum dose in skin. The images of the areas of regions with maximum doses are obtained of the scanner. The quantified doses are compared in the radiochromic films with the band of doses supplied by the manufacturer. The methodologies for the estimation of the doses obtained are compared of the radiochromic films with those obtained with the KODAK® X-Omat films. The procedure of obtaining of the doses is validated in patients with KODAK® X-Omat films. The doses obtained have covered a range from the 0,1Gy to 9 Gy. Radiographic films have allowed an assessment of the doses to 900 cGy due to the saturation thereof, the doses found in that range have been consistent with the doses in radiochromic films [es
Gutierrez, Michele Mario; Meleddu, Marta; Piga, Antonio
2017-01-01
Packaging is associated with a high environmental impact. This is also the case in the food industry despite packaging being necessary for maintaining food quality, safety assurance and preventing food waste. The aim of the present study was to identify improvements in food packaging solutions able to minimize environmental externalities while maximizing the economic sustainability. To this end, the life cycle assessment (LCA) methodology was applied to evaluate the environmental performance of new packaging solutions. The environmental impact of packaging and food losses and the balance between the two were examined in relation to a cheesecake that is normally packaged in low density polyethylene film and has a limited shelf life due to microbial growth. A shelf life extension was sought via application of the well-established modified atmosphere packaging (MAP) technique. Samples for MAP (N 2 /CO 2 : 70/30) were placed inside multilayer gas barrier trays, which were then wrapped with a multilayer gas and water barrier film (i.e. AerPack packaging); control batches were packaged in gas barrier recycled polyethylene terephthalate (XrPet) trays and wrapped with a XrPet film. Samples were then stored at 20°C and inspected at regular intervals for chemical-physical, microbiological and sensory parameters. Results show that the new packaging solution could considerably extend the shelf life of cheesecakes, thereby reducing food waste and decreasing the overall environmental impact. Moreover, the new packaging allows one to minimize transport costs and to generate economies of scale in manufacturing. Copyright © 2016 Elsevier Ltd. All rights reserved.
Materials for advanced high temperature reactors
International Nuclear Information System (INIS)
Graham, L.W.
1976-01-01
The results recently obtained from the Dragon program are presented to illustrate materials behavior: (a) effect of temperature on oxidation and carburisation in HTR helium (variation in oxide depth and in C content of AISI 321 after 5000 hours in HTR helium; effect of temperature on surface scale formation in the γ' strengthened alloys Nimonic 80A and 713LC); (b) effect of alloy composition on oxidation and carburisation behavior (influence of Nb and Ti on the corrosion of austenitic steels; influence of Ti and Al in IN-102; weight gain of cast high Ni alloys); (c) effect of environment on creep strength (results of tests for hastelloy X, grade I inconel 625, grade II inconel 625 and inconel 617 in He and air between 750 and 800 0 C)
Susceptibility to Stress Corrosion Cracking of 254SMO SS
Directory of Open Access Journals (Sweden)
De Micheli Lorenzo
2002-01-01
Full Text Available The susceptibility to stress corrosion cracking (SCC of solubilized and sensitized 254SMO SS was studied in sodium chloride, and sodium fluoride solutions at 80 °C and sulfuric acid solutions in presence of sodium chloride at 25 °C. The influence of salt concentration, pH values and the addition of thiosulfate was examined. The susceptibility to SCC was evaluated by Slow Strain Rate Tests (SSRT, at 1.5 x 10-6 s-1 strain rate. The behavior of 254SMO was compared to those of AISI 316L SS and Hastelloy C276. 254SMO showed an excellent resistance to SCC in all conditions, except in the more acidic solutions (pH <= 1 where, in the sensitized conditions, intergranular stress corrosion cracking occurred.
Effects of HTGR helium on the high cycle fatigue of structural materials
International Nuclear Information System (INIS)
Soo, P.; Sabatini, R.L.; Gerlach, L.
1982-01-01
High cycle fatigue tests have been conducted on Incoloy 800H and Hastelloy X in air and in HTGR helium environments containing low and high levels of moisture. For the helium environments, a higher mositure level usually gives a lower fatigue strength. For air, however, the strength is usually much lower than those for helium. For long test times at higher test temperatures, the fatigue strengths for Incoloy 800H often show a large decrease, and the fatigue limits are much lower than those anticipated from low cycle tests. Optical and scanning electron microscope observations were made to correlate fatigue life with surface and bulk microstructural changes in the material during test. Oxide scale cracking and spallation, surface recrystallization and intergranular attack appear to contribute to losses in fatigue strength
Frictional forces in an SOFC stack with sliding seals
Energy Technology Data Exchange (ETDEWEB)
Yamazaki, T; Oishi, N; Namikawa, T; Yamazaki, Y [Tokyo Institute of Technology, Tokyo (Japan)
1996-06-05
The detrimental thermal stresses in planar SOFC stacks can be reduced using sliding seals. In the proposal planar stack the electrolyte film is sandwiched by YSZ support rings to release the thermal stresses. In order to estimate the strength of the support ring, the frictional forces between heat resistant alloy and YSZ were measured at 900{degree}C. The coefficient of friction between Hastelloy X and YSZ increased when they were measured lifter 144h heating. However, the coefficient of friction between HA-214 and YSZ did not increase. The measurement and a calculation of the stresses in the support rings led the result that a thickness of 0.6mm was necessary for 200mm diameter support rings under a stack pressure of 0.1kgcm{sup -2}. 6 refs., 9 figs., 1 tab.
Separation of 210Pb, 210Bi and 210Po by ion exchange and their Iiquid scintillation standardization
International Nuclear Information System (INIS)
Rodriguez, L.; Jimenez, A.; Grau, A.
1996-01-01
We applied the CIEMAT/NIST method and alpha/beta discrimination to ''210Pb samples in equilibrium with its daughters, by preparing homogeneous and gel samples. The stability of samples was tested in different available cocktails, HiSafe''TM II, HiSafe''TM III, Ultima-Gold''TM, Ultima-Gold''TM XR, Ultima-Gold''TM AB, Insta-Gel''R and e Insta-Gel''R lI. Also we analyzed the disequilibrium of the radioactive chain 210Pb+210Bi+210Po, achieving an excellent agreement between the results of the spectrum unfolding method and the experimental values. (Author) 13 refs
DEFF Research Database (Denmark)
Guo, Xiaoqiang; Lu, Zhigang; Wang, Baocheng
2014-01-01
models fail to predict the system instabilities. In order to solve the problem, a new modeling approach for inverter-dominated microgrids by using dynamic phasors is presented in this paper. Our findings indicate that the proposed dynamic phasor model is able to predict accurately the stability margins...... of the system, while the conventional reduced-order small signal model fails. In addition, the virtual ω-E frame power control method, which deals with the power coupling caused by the line impedance X/R characteristic, has also been chosen as an application example of the proposed modeling technique....
Characterization of Titan III-D Acoustic Pressure Spectra by Least-Squares Fit to Theoretical Model
1980-01-01
P(f) for a set value of P0 and f0" Mhe inverse transform was taken and the result multiplied by a decaying exponential which modelled the envelope of...0 FORWARD TRANSFORM C IF=1 INVERSE TRANSFORM c C M 0 XREAL AND XIMAG RETURNED AS REAL AND IMAG. FOR FORWARD Xr"RM9; C M= " " " MAGNITUDE AND PHASE...34 .. .. C (PHASE IN DEGREE9) C M=2 XREAL RETURNED AS ’PSD’ XIMAG =0. C HERE ’DSD’ MEANS SUM OF N VALUES OF XREAL = MEAN SQU\\Riz OF INPUT C C FOR INVERSE
Gaidies, Fred; Petley-Ragan, Arianne; Pattison, David
2016-04-01
The size, abundance, shape and spatial distribution of metamorphic minerals bears important information on the rates and mechanisms of fundamental processes that take place during metamorphic crystallization. X-ray computed tomography (XR-CT) has become the method of choice to study the three-dimensional (3D) disposition of minerals in rocks as it allows investigation of relatively large sample volumes at sufficiently high resolution required for statistically meaningful analyses, and as its non-destructive fashion permits further studies such as mineral chemical, isotopic or crystallographic analyses of select grains identified through XR-CT. We present results obtained through the quantification of the 3D disposition of cordierite and biotite crystals in a hornfels from the contact aureole of the Bugaboo Batholith (British Columbia, Canada) using XR-CT and global as well as scale-dependent pattern statistics (Petley-Ragan et al., 2016). The results demonstrate a random distribution of cordierite and biotite crystal sizes for all scales across the entire rock volume studied indicative of interface-controlled prograde metamorphic reaction kinetics. We show that the common approach to approximate the shape of crystals as spherical underestimates the influence of the Strauss hard-core process on rock texture which may be misinterpreted to reflect ordering of crystal sizes by inhibition of nucleation and growth commonly associated with diffusion-controlled reaction kinetics. According to our findings, Strauss hard-core ordering develops at length scales equal to and less than the average major axis of the crystal population. This is significantly larger than what is obtained if a spherical crystal geometry would be assumed, and increases with deviation from sphericity. For the cordierite and biotite populations investigated in this research, Strauss hard-core ordering developed at length scales of up to ˜2.2 and 1.25 mm, respectively, which is almost 1 mm longer than
Toward an online cognitive and emotional battery to predict treatment remission in depression
Directory of Open Access Journals (Sweden)
Gordon E
2015-02-01
Full Text Available Evian Gordon,1 A John Rush,2 Donna M Palmer,3,4 Taylor A Braund,3 William Rekshan1 1Brain Resource, San Francisco, CA, USA; 2Duke-NUS, Singapore; 3Brain Resource, Sydney, NSW, Australia; 4Brain Dynamics Center, Sydney Medical School – Westmead and Westmead Millennium Institute, The University of Sydney, Sydney, NSW, Australia Purpose: To evaluate the performance of a cognitive and emotional test battery in a representative sample of depressed outpatients to inform likelihood of remission over 8 weeks of treatment with each of three common antidepressant medications. Patients and methods: Outpatients 18–65 years old with nonpsychotic major depressive disorder (17 sites were randomized to escitalopram, sertraline or venlafaxine-XR (extended release. Participants scored ≥12 on the baseline 16-item Quick Inventory of Depressive Symptomatology – Self-Report and completed 8 weeks of treatment. The baseline test battery measured cognitive and emotional status. Exploratory multivariate logistic regression models predicting remission (16-item Quick Inventory of Depressive Symptomatology – Self-Report score ≤5 at 8 weeks were developed independently for each medication in subgroups stratified by age, sex, or cognitive and emotional test performance. The model with the highest cross-validated accuracy determined the participant proportion in each arm for whom remission could be predicted with an accuracy ≥10% above chance. The proportion for whom a prediction could be made with very high certainty (positive predictive value and negative predictive value exceeding 80% was calculated by incrementally increasing test battery thresholds to predict remission/non-remission. Results: The test battery, individually developed for each medication, improved identification of remitting and non-remitting participants by ≥10% beyond chance for 243 of 467 participants. The overall remission rates were escitalopram: 40.8%, sertraline: 30.3%, and
Radiolysis of water in the vicinity of passive surfaces
International Nuclear Information System (INIS)
Moreau, S.; Fenart, M.; Renault, J.P.
2014-01-01
Highlights: • HO° production through water radiolysis is enhanced near metal surfaces. • Hastelloy and Stainless steel surfaces can also produce HO° radicals through hydrogen peroxide activation. • There is a deficit in solvated electron production compared to hydroxyl radicals near metal surfaces. - Abstract: Porous metals were used to describe the water radiolysis in the vicinity of metal surfaces. The hydroxyl radical production under gamma irradiation was measured by benzoate scavenging in water confined in a 200 nm porous Ni base alloy or in Stainless steel. The presence of the metallic surfaces changed drastically the HO° production level and lifetime. The solvated electron production was measured via glycylglycine scavenging for Stainless steel and was found to be significantly smaller than hydroxyl production. These observations imply that interfacial radiolysis may deeply impact the corrosion behavior of the SS and Ni based alloys
Self-field ac losses in biaxially aligned Y endash Ba endash Cu endash O tape conductors
International Nuclear Information System (INIS)
Iijima, Y.; Hosaka, M.; Sadakata, N.; Saitoh, T.; Kohno, O.; Takeda, K.
1997-01-01
Self-field ac losses were measured by the conventional ac four-probe method in biaxially aligned Y endash Ba endash Cu endash O tapes using polycrystalline Hastelloy tapes with textured yttria-stabilized-zirconia buffer layers. The ac losses increased in proportion to the fourth power of transport current in the high J c sample, and agreed well with Norris close-quote equation for thin strip conductors. However, the low J c sample had rather higher losses than Norris close-quote prediction, suggesting excessive magnetic flux penetration caused by percolated current paths. The results confirmed Norris close-quote prediction of the low ac losses for thin strip conductors, and indicated the importance of removing percolated structures of current paths to avoid higher ac losses than the theoretical predictions based on uniform conductors. copyright 1997 American Institute of Physics
Energy Technology Data Exchange (ETDEWEB)
Weirick, L.J.
1982-01-01
This report summarizes the results from an investigation on the effect of a glass ceramic processing cycle on the metallurgical properties of metal candidates for actuator housings. The cycle consists of a 980/sup 0/C sealing step, a 650/sup 0/C crystallization step and a 475/sup 0/C annealing step. These temperatue excursions are within the same temperature regime as annealing and heat treating processes normally employed for metals. Therefore, the effect of the processing cycle on metallurgical properties of microstructure, strength, hardness and ductility were examined. It was found that metal candidates which are single phase or solid solution alloys (such as 21-6-9, Hastelloy C-276 and Inconel 625) were not affected whereas multiphase or precipitation hardened alloys (such as Inconel 718 and Titanium ..beta..-C) were changed by the processing cycle for the glass ceramic.
Segregation in welded nickel-base alloys
International Nuclear Information System (INIS)
Akhtar, J.I.; Shoaib, K.A.; Ahmad, M.; Shaikh, M.A.
1990-05-01
Segregation effects have been investigated in nickel-base alloys monel 400, inconel 625, hastelloy C-276 and incoloy 825, test welded under controlled conditions. Deviations from the normal composition have been observed to varying extents in the welded zone of these alloys. Least effect of this type occurred in Monel 400 where the content of Cu increased in some of the areas. Enhancement of Al and Ti has been found over large areas in the other alloys which has been attributed to the formation of low melting slag. Another common feature is the segregation of Cr, Fe or Ti, most likely in the form of carbides. Enrichment of Al, Ti, Nb, Mb, Mo, etc., to different amounts in some of the areas of these materials is in- terpretted in terms of the formation of gamma prime precipitates or of Laves phases. (author)
Corrosion behaviour of container materials for geological disposal of high level radioactive waste
International Nuclear Information System (INIS)
Accary, A.
1985-01-01
The disposal of high level radioactive waste in geological formations, based on the multibarrier concept, may include the use of a container as one of the engineered barriers. In this report the requirements imposed on this container and the possible degradation processes are reviewed. Further on an overview is given of the research being carried out by various research centres in the European Community on the assessment of the corrosion behaviour of candidate container materials. The results obtained on a number of materials under various testing conditions are summarized and evaluated. As a result, three promising materials have been selected for a detailed joint testing programme. It concerns two highly corrosion resistant alloys, resp. Ti-Pd (0.2 Pd%) and Hastelloy C4 and one consumable material namely a low carbon steel. Finally the possibilities of modelling the corrosion phenomena are discussed
Salt Fog Testing Iron-Based Amorphous Alloys
International Nuclear Information System (INIS)
Rebak, Raul B.; Aprigliano, Louis F.; Day, S. Daniel; Farmer, Joseph C.
2007-01-01
Iron-based amorphous alloys are hard and highly corrosion resistant, which make them desirable for salt water and other applications. These alloys can be produced as powder and can be deposited as coatings on any surface that needs to be protected from the environment. It was of interest to examine the behavior of these amorphous alloys in the standard salt-fog testing ASTM B 117. Three different amorphous coating compositions were deposited on 316L SS coupons and exposed for many cycles of the salt fog test. Other common engineering alloys such as 1018 carbon steel, 316L SS and Hastelloy C-22 were also tested together with the amorphous coatings. Results show that amorphous coatings are resistant to rusting in salt fog. Partial devitrification may be responsible for isolated rust spots in one of the coatings. (authors)
High temperature ductility of austenitic alloys exposed to thermal neutrons
International Nuclear Information System (INIS)
Watanabe, K.; Kondo, T.; Ogawa, Y.
1982-01-01
Loss of high temperature ductility due to thermal neutron irradiation was examined by slow strain rate test in vacuum up to 1000 0 C. The results on two heats of Hastelloy alloy X with different boron contents were analyzed with respect to the influence of the temperatures of irradiation and tensile tests, neutron fluence and the associated helium production due to nuclear transmutation reaction. The loss of ductility was enhanced by increasing either temperature or neutron fluence. Simple extrapolations yielded the estimated threshold fluence and the end-of-life ductility values at 900 and 1000 0 C in case where the materials were used in near-core regions of VHTR. The observed relationship between Ni content and the ductility loss has suggested a potential utilization of Fe-based alloys for seathing of the neutron absorber materials
Selection of replacement material for the failed surface level gauge wire in Hanford waste tanks
International Nuclear Information System (INIS)
Anantatmula, R.P.; Pitman, S.G.; Lund, A.L.
1995-10-01
Surface level gauges fabricated from AISI Type 316 stainless steel (316) wire failed after only a few weeks of operation in underground storage tanks at the Hanford Site. The wire failure was determined to be due to chloride ion assisted corrosion of the 316 wire. Radiation-induced breakdown of the polyvinyl chloride (PVC) riser liners is suspected to be the primary source of the chloride ions. An extensive literature search followed by expert concurrence was undertaken to select a replacement material for the wire. Platinum (Pt)-20 % Iridium (Ir) alloy was selected as the replacement material from tile candidate materials, P-20% Ir, Pt-1O% Rhodium (Rh), Pt-20%Rh and Hastelloy C-22. The selection was made on the basis of the alloy's immunity towards acidic and basic environments as well as its adequate tensile properties in the fully annealed state
Asphahani, Aziz; Siegel, Sidney; Siegel, Edward
2010-03-01
Siegel [[J.Mag.Mag.Mtls.7,312(78); PSS(a)11,45(72); Semis.& Insuls.5(79)] (at: ORNL, ANS, Westin``KL"ouse, PSEG, IAEA, ABB) warning of old/new nuclear-reactors/spent-fuel-casks/refineries/ jet/missile/rocket-engines austenitic/FCC Ni/Fe-based (so MIS- called)``super"alloys(182/82;Hastelloy-X; 600;304/304L-SSs; 690 !!!) GENERIC ENDEMIC EXTANT detrimental(synonyms): Wigner's- diseas(WD)[J.Appl.Phys.17,857(46)]; Ostwald-ripening; spinodal- decomposition; overageing-embrittlement; thermomechanical- INstability: Mayo[Google: ``If Leaks Could Kill"; at flickr.com search on ``Giant-Magnotoresistance"; find: [SiegelPolitics(79)]; Hoffman[animatedsoftware.com],...what DOE/NRC MISlabels as ``butt-welds" ``stress-corrosion cracking" endpoint's ROOT-CAUSE ULTIMATE-ORIGIN is WD overageing-embrit- tlement caused brittle-fracture cracking from early/ongoing AEC/DOE-n``u''tional-la``v''atories sabotage!!!
International Nuclear Information System (INIS)
Ouamara, H.
2013-01-01
The pathway that has been followed by the imXgam team at CPPM was to adapt the hybrid pixel technology XPAD to biomedical imaging. It is in this context that the micro-CT PIXSCAN II based on the new generation of hybrid pixel detectors called XPAD3 has been developed. This thesis describes the process undertaken to assess the contribution of the hybrid pixel technology in X-ray computed tomography in terms of contrast and dose and to explore new opportunities for biomedical imaging at low doses. Performance evaluation as well as the validation of the results obtained with data acquired with the detector XPAD3 were compared to results obtained with the CCD camera DALSA XR-4 similar to detectors used in most conventional micro-CT systems. The detector XPAD3 allows to obtain reconstructed images of satisfactory quality close to that of images from the DALSA XR-4 camera, but with a better spatial resolution. At low doses, the images from the detector XPAD3 have a better quality that is those from CCD camera. From an instrumentation point of view, this project demonstrated the proper operations of the device PIXSCAN II for mouse imaging. We were able to reproduce an image quality similar to that obtained with a charge integration detector such as a CCD camera. To improve the performance of the detector XPAD3, we will have to optimize the stability of the thresholds and in order to obtain more homogeneous response curves of the pixels as a function as energy by using a denser sensor such as CdTe. (author)
Protein hydrolysates and recovery of muscle damage following eccentric exercise
Directory of Open Access Journals (Sweden)
Dale M.J.
2015-01-01
Full Text Available Background: A whey protein hydrolysate (NatraBoost XR; WPHNB has been shown to speed repair muscle damage. We sought to determine whether this benefit is specific to this hydrolysate to evaluate a marker for quality control. Methods: Three hydrolysates of the same whey protein isolate (WPI were prepared (WPHNB, WPH1 and WPH2. Isometric knee extensor strength was measured in 39 sedentary male participants before and after 100 maximal eccentric contractions of the knee extensors to induce muscle damage. Participants were then randomised to consume 250 ml of flavoured water (FW, n=9, or 250 ml of FW containing 25 g of either NatraBoost XR (n=3, WPH1 (n=9, WPH2 (n=9 or WPI (n=9. Strength was reassessed over the next seven days while the supplements were consumed daily. Fibroblasts were cultured for 48 hr in the presence of the different hydrolysates, WPI, saline or fetal bovine serum to ascertain effects on cell proliferation. Results: Strength was reduced in all treatment groups after eccentric exercise (P<0.001. Strength recovered steadily over 7 days in the FW, WPI, WPH1 and WPH2 treatment groups (P<0.001, with no difference between treatments (P=0.87. WPHNB promoted faster strength recovery compared with the other treatments (P<0.001. Fibroblast proliferation was greater with WPHNB compared with saline, WPI or the other hydrolysates (P<0.001. Conclusions: Promoting recovery from muscle damage seems unique to WPHNB. In vitro fibroblast proliferation may be a useful marker for quality control. It is not clear whether effects on fibroblast proliferation contribute to the in vivo effect of WPHNB on muscle damage.
De Lasalle, Julie; Alexander, Kate; Olive, Julien; Laverty, Sheila
2016-09-01
A better understanding of imaging characteristics of equine stifle osteoarthritis (OA) may allow earlier detection and improve prognosis. Objectives of this ex vivo, prospective, methods comparison study were to (1) describe the location and severity of naturally acquired OA lesions in the equine stifle using ultrasound (US), radiography (XR), computed tomography (CT), and macroscopic evaluation (ME); (2) compare the diagnostic performance of each imaging modality with ME; and (3) describe subchondral bone mineral density (BMD) in equine stifle joints with OA using CT. Radiographic, CT, and US evaluations were performed on 23 equine cadaver stifles and compared with ME. Significant associations were found between osteophyte global scores for all imaging modalities (CT, P ˂ 0.0001; XR, P = 0.005; US, P = 0.04) vs. ME osteophyte global scores. Osteophytes were detected most frequently in the medial femorotibial (MFT) joint. A specific pattern of osteophytes was observed, with a long ridge of new bone at the insertion of the MFT joint capsule cranially on the medial femoral condyle. A novel caudo-10°proximo-5°lateral-cranio-disto-medial oblique radiographic projection was helpful for detection of intercondylar osteophytes. Multiplanar CT reformatted images were helpful for characterizing all osteophytes. Osteophyte grades at most sites did not differ among modalities. Low sensitivity/specificity for subchondral bone sclerosis and flattening of femoral condyles suggested that these signs may not be reliable radiographic and CT indicators of equine stifle OA. Equine stifle OA was associated with a decrease in BMD and specific sites of focal subchondral bone resorption/cyst formation were found in some specimens. © 2016 American College of Veterinary Radiology.
Elkind-Hirsch, Karen E; Paterson, Martha S; Seidemann, Ericka L; Gutowski, Hanh C
2017-01-01
To evaluate efficacy with the dipeptidyl peptidase-4 inhibitor saxagliptin (SAXA), metformin extended release (MET), and combination (SAXA-MET) in patients with polycystic ovary syndrome (PCOS) and impaired glucose regulation. Prospective, randomized, single-blind drug study. Outpatient clinic. Patients (n = 38) with PCOS (aged 18-42 years) and prediabetic hyperglycemia determined by a 75-gram oral glucose tolerance test. Patients were randomized to SAXA-MET (5 mg/2,000 mg), SAXA (5 mg), or MET (2,000 mg) for 16 weeks. Fasting and mean blood glucose, insulin sensitivity, insulin secretion, and insulin secretion-sensitivity index (IS-SI) by oral glucose tolerance tests. Free androgen index and lipid levels, average menstrual interval, and anthropometric measurements (body mass index, waist circumference, and waist/height ratio). The study was completed by 34 patients. Nineteen patients had normal glucose tolerance: 3 of 12 (25%) on MET; 6 of 11 (55%) on SAXA; and 10 of 11 (91%) on SAXA-MET (SAXA-MET statistically superior to MET) at study completion. Body mass index, waist circumference, waist/height ratio, free androgen index, insulin sensitivity, IS-SI, and menses improved in all groups; however, IS-SI and menstrual regularity were significantly better with SAXA-MET vs. MET treatment. Triglyceride, triglyceride/high-density lipoprotein cholesterol ratio and mean blood glucose significantly declined in the SAXA-MET and SAXA groups only. This pilot work provides the first evidence regarding the effects of a dipeptidyl peptidase-4 inhibitor alone and in combination with MET in this patient population. Treatment with SAXA-MET was superior to either drug alone in terms of clinical and metabolic benefits in prediabetic patients with PCOS. NCT02022007. Copyright © 2016 American Society for Reproductive Medicine. Published by Elsevier Inc. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Martinez Gomez, L. C.; Gilarranz Moreno, R.; Rot San Juan, M. J.; Delgado Rodriguez, J. M.; Adaimi Hernandez, P.; Milanes Gaillet, A.
2013-07-01
In this work we have evaluated uncertainties by comparing the calculated dose with films from a calibration reference with dose measurements ionization with chamber using beams in clinical conditions. (Author)
Handbook of Thermal Insulation Applications.
1983-01-01
Wiuppuoror *tIe beamsWiefag ln~ td ~oair ilmstool beams Plate 18. Metal Building Ceilings - A 18b: Fir* hataird rathge may limit the use of foam Insulation...RFCTANGUI.AR SOL TD A = 2(WxL+LxH+HxW) B V = WxLxH H L TRAPEZOID A 2 (A + B) x H A CONE A -n xRxS+ i xR 2 B V =( /3)x R2 x H TRIANGLE A BxH A- 2 CYLI NDER H 2...FABRICATIIG RECTANGULAR HEATING AND COOLING DUCTWORK. FIBERGLAS DUCT BOARD OWENS-CORNING FIBERGLAS CORP GLASS FIBER RIGID BOARD WITH ALUMINUM 4bD FOIL VAPOR
RX: a nonimaging concentrator.
Miñano, J C; Benítez, P; González, J C
1995-05-01
A detailed description of the design procedure for a new concentrator, RX, and some examples of it's use are given. The method of design is basically the same as that used in the design of two other concentrators: the RR and the XR [Appl. Opt. 31, 3051 (1992)]. The RX is ideal in two-dimensional geometry. The performance of the rotational RX is good when the average angular spread of the input bundle is small: up to 95% of the power of the input bundle can be transferred to the output bundle (with the assumption of a constant radiance for the rays of the input bundle).
Analysis of thevenin equivalent network of a distribution system for solar integration studies
DEFF Research Database (Denmark)
Yang, Guangya; Mattesen, Majken; Kjaer, Søren Bækhøj
2012-01-01
generations and expected to play a significant role in the future sustainable energy system. Currently one of the main issues for solar integration is the voltage regulation problem in the LV grid, as to the small X/R ratios. Hence, the voltage control techniques developed for the MV and HV networks may need...... to be further evaluated before applied for the LV grid. For the inverter voltage control design, it is useful to develop a realistic Thevenin equivalent model for the grid to ease the analysis. In this paper, case studies are performed based on the analysis of a realistic distribution network for the design...
Directory of Open Access Journals (Sweden)
Maneeton Narong
2012-09-01
Full Text Available Abstract Background Schizophrenia and bipolar depression trials suggest that quetiapine may have an antidepressant effect. Objectives This meta-analysis aimed to determine the efficacy, acceptability and tolerability of quetiapine treatment for major depressive disorder (MDD. Only the randomized controlled trials (RCTs comparison between quetiapine and placebo were included. The authors searched such clinical trials carried out between 1991 and February 2012. Data sources MEDLINE, EMBASE, CINHL, PsycINFO and Cochrane Controlled Trials Register were searched in February 2012. Study populations comprised adults with MDD or major depression. Study eligible criteria, participants and interventions Eligible studies were randomized, placebo-controlled trials of quetiapine monotherapy carried out in adults with MDD and presenting endpoint outcomes relevant to: i depression severity, ii response rate, iii overall discontinuation rate, or iv discontinuation rate due to adverse events. No language restriction was applied. Study appraisal and synthesis methods All abstracts identified by the electronic searches were examined. The full reports of relevant studies were assessed, and the data of interest were extracted. Based on the Cochrane methods of bias assessment, risks of bias were determined. The studies with two risks or less were included. The efficacy outcomes were the mean change scores of depression rating scales, the overall response rate, and the overall remission rates. The overall discontinuation rate was considered as a measure of acceptability. The discontinuation rate due to adverse events was a measure of tolerability. Relative risks (RRs and weighted mean differences (WMDs with 95% confidence intervals (CIs were computed by using a random effect model. Results A total of 1,497 participants in three RCTs were included. All trials examined the quetiapine extended-release (XR. The pooled mean change scores of the Montgomery-Asberg Depression
Directory of Open Access Journals (Sweden)
Park SI
2015-02-01
Full Text Available Sang-In Park,1,* Howard Lee,1,2,* Jaeseong Oh,1 Kyoung Soo Lim,3 In-Jin Jang,1 Jeong-Ae Kim,4 Jong Hyuk Jung,4 Kyung-Sang Yu1 1Department of Clinical Pharmacology and Therapeutics, Seoul National University College of Medicine and Hospital, Seoul, 2Department of Transdisciplinary Studies, Graduate School of Convergence Science and Technology, Seoul National University, Clinical Trials Center, Seoul National University Hospital, Seoul, 3Department of Clinical Pharmacology and Therapeutics, CHA University School of Medicine and CHA Bundang Medical Center, Seongnam, 4LG Life Sciences, Ltd, Seoul, Republic of Korea *These authors contributed equally to this work Background: In type 2 diabetes mellitus, fixed-dose combination (FDC can provide the complementary benefits of correction of multiple pathophysiologic defects such as dysfunctions in glycemic or metabolic control while improving compliance compared with separate tablets taken together. The objective of the study reported here was to compare the pharmacodynamic (PD, pharmacokinetic (PK, and tolerability profiles of gemigliptin and extended-release metformin (metformin XR between FDC and separate tablets.Methods: A randomized, open-label, single-dose, two-way, two-period, crossover study was conducted in 28 healthy male volunteers. Two FDC tablets of gemigliptin/metformin 25/500 mg or separate tablets of gemigliptin (50 mg ×1 and metformin XR (500 mg ×2 were orally administered in each period. Serial blood samples were collected up to 48 hours post-dose to determine dipeptidyl peptidase 4 (DPP-4 activity using spectrophotometric assay and concentrations of gemigliptin and metformin using tandem mass spectrometry. Geometric mean ratios (GMRs of FDC to separate tablet formulations and their 90% confidence intervals (CIs were calculated to compare the PD and PK parameters between the two formulations. Tolerability was assessed throughout the study.Results: The plasma DPP-4 activity
Stress Corrosion Evaluation of Nitinol 60 for the International Space Station Water Recycling System
Torres, P. D.
2016-01-01
A stress corrosion cracking (SCC) evaluation of Nitinol 60 was performed because this alloy is considered a candidate bearing material for the Environmental Control and Life Support System (ECLSS), specifically in the Urine Processing Assembly of the International Space Station. An SCC evaluation that preceded this one during the 2013-2014 timeframe included various alloys: Inconel 625, Hastelloy C-276, titanium (Ti) commercially pure (CP), Ti 6Al-4V, extra-low interstitial (ELI) Ti 6Al-4V, and Cronidur 30. In that evaluation, most specimens were exposed for a year. The results of that evaluation were published in NASA/TM-2015-218206, entitled "Stress Corrosion Evaluation of Various Metallic Materials for the International Space Station Water Recycling System,"1 available at the NASA Scientific and Technical Information program web page: http://www.sti.nasa.gov. Nitinol 60 was added to the test program in 2014.
International Nuclear Information System (INIS)
Hammond, J.P.
1976-08-01
Two heats of Haynes alloy 25 and one heat each of Haynes alloy 188, Hastelloy N, and Inconel 625 were tensile tested after aging for 11,000 h at 816 0 C. Yield strength, ultimate tensile strength, and elongation were determined 24, 316, 760, and 982 0 C and compared with typical properties for these materials in the solution annealed condition. Toughness values were determined for these materials from their engineering stress-strain curves. The long-term aging treatment degraded ductility and toughness at room temperature but, contrary to behavior expected for overaging, enhanced them over those for the solution annealed condition in tests at 760 0 C. The tensile properties of the aged superalloys were correlated with mode of fracture and the amounts, identity, and morphology of the precipitates. Aging substantially depleted the hardener tungsten from the matrix in the cobalt-base alloys
System design description of forced-convection molten-salt corrosion loops MSR-FCL-3 and MSR-FCL-4
International Nuclear Information System (INIS)
Huntley, W.R.; Silverman, M.D.
1976-11-01
Molten-salt corrosion loops MSR-FCL-3 and MSR-FCL-4 are high-temperature test facilities designed to evaluate corrosion and mass transfer of modified Hastelloy N alloys for future use in Molten-Salt Breeder Reactors. Salt is circulated by a centrifugal sump pump to evaluate material compatibility with LiF-BeF 2 -ThF 4 -UF 4 fuel salt at velocities up to 6 m/s (20 fps) and at salt temperatures from 566 to 705 0 C (1050 to 1300 0 F). The report presents the design description of the various components and systems that make up each corrosion facility, such as the salt pump, corrosion specimens, salt piping, main heaters, salt coolers, salt sampling equipment, and helium cover-gas system, etc. The electrical systems and instrumentation and controls are described, and operational procedures, system limitations, and maintenance philosophy are discussed
Corrosion resistant alloy uses in the power industry
International Nuclear Information System (INIS)
Nickerson, J.L.; Hall, F.A.; Asphahani, A.I.
1989-01-01
Nickel-base alloys have been used as cost-effective measures in a variety of severely corrosive situations in pollution control units for coal-fired power plants. Cost effectiveness and practical answers to corrosion problems are illustrated (specifically the wallpaper concept/metallic lining technique). Numerous cases of successful use of HASTELLOY alloys in Flue Gas Desulfurization (FGD) systems and hazardous waste treatment incineration scrubber systems are listed. In this paper developments in nickel-base alloys and their use in FGD and other segments of the power industry are discussed. In the Ni-Cr-Mo-W alloy family, the C-22 alloy has the best resistance to localized corrosion in halide environments (chloride/fluoride-containing solutions). This alloy is also used effectively as a universal filler metal to weld less-resistant alloys were weld corrosion may be a problem. Field performance of this alloy in the power industry is described
International Nuclear Information System (INIS)
Song, Kee Nam; Hong, Sung Deok; Park, Hong Yoon
2011-01-01
A PHE (Process Heat Exchanger) is a key component required to transfer heat energy of 950 .deg. C generated in a VHTR (Very High Temperature Reactor) to a chemical reaction that yields a large quantity of hydrogen. A small-scale PHE prototype made of Hastelloy-X was scheduled for testing in a small-scale gas loop at the Korea Atomic Energy Research Institute. In this study, as a part of the evaluation of the high-temperature structural integrity of the PHE prototype, high-temperature structural analysis modeling, and macroscopic thermal and elastic-plastic structural analysis of the PHE prototype were carried out under the gas-loop test conditions as a preliminary qwer123$ study before carrying out the performance test in the gas loop. The results obtained in this study will be used to design the performance test setup for the modified PHE prototype
Vessels for elevated temperature service
International Nuclear Information System (INIS)
O'Donnell, W.J.; Porowski, J.S.
1983-01-01
The subject is covered in chapters, entitled: introduction (background; elevated temperature concerns; design tools); design of pressure vessels for elevated temperature per ASME code; basic elevated temperature failure modes; allowable stresses and strains per ASME code (basic allowable stress limits; ASME code limits for bending; time-fraction summations; strain limits; buckling and instability; negligible creep and stress-rupture effects); combined membrane and bending stresses in creep regime; thermal stress cycles; bounding methods based on elastic core concept (bounds on accumulated strains; more accurate bounds; strain ranges; maximum stresses; strains at discontinuities); elastic follow-up; creep strain concentrations; time-dependent fatigue (combined creep rupture and fatigue damage; limits for inelastic design analyses; limits for elastic design analyses); flaw evaluation techniques; type 316 stainless steel; type 304 stainless steel; steel 2 1/4Cr1Mo; Inconel 718; Incolloy 800; Hastelloy X; detailed inelastic design analyses. (U.K.)
Study of tertiary creep instability in several elevated-temperature structural materials
International Nuclear Information System (INIS)
Booker, M.K.; Sikka, V.K.
1978-01-01
Data for a number of common elevated temperature structural materials have been analyzed to yield mathematical predictions for the time and strain to tertiary creep at various rupture lives and temperatures. Materials examined include types 304 and 316 stainless steel, 2 1/4 Cr-1 Mo steel, alloy 800H, alloy 718, Hastelloy alloy X, and ERNiCr--3 weld metal. Data were typically examined over a range of creep temperatures for rupture lives ranging from less than 100 to greater than 10,000 hours. Within a given material, trends in these quantities can be consistently described, but it is difficult to directly relate the onset of tertiary creep to failure-inducing instabilities. A series of discontinued tests for alloy 718 at 649 and 620 0 C showed that the material fails by intergranular cracking but that no significant intergranular cracking occurs until well after the onset of tertiary creep
The molten salt reactor adventure
International Nuclear Information System (INIS)
MacPherson, H.G.
1985-01-01
A personal history of the development of molten salt reactors in the United States is presented. The initial goal was an aircraft propulsion reactor, and a molten fluoride-fueled Aircraft Reactor Experiment was operated at Oak Ridge National Laboratory in 1954. In 1956, the objective shifted to civilian nuclear power, and reactor concepts were developed using a circulating UF 4 -ThF 4 fuel, graphite moderator, and Hastelloy N pressure boundary. The program culminated in the successful operation of the Molten Salt Reactor Experiment in 1965 to 1969. By then the Atomic Energy Commission's goals had shifted to breeder development; the molten salt program supported on-site reprocessing development and study of various reactor arrangements that had potential to breed. Some commercial and foreign interest contributed to the program which, however, was terminated by the government in 1976. The current status of the technology and prospects for revived interest are summarized
International Nuclear Information System (INIS)
Furukawa, Kazuo; Tsukada, Kineo; Nakahara, Yasuaki; Oomichi, Toshihiko; Oono, Hideo.
1982-01-01
Purpose: To simplify the structure, as well as improve the technical reliability and safety by the elimination of a proton beam entering window. Constitution: The nuclear reactor container main body is made of Hastelloy N and provided at the inner surface with two layers of graphite shields except for openings. An aperture was formed in the upper surface of the container, through which protons accelerated by a linear accelerator are directly entered to the liquid surface of molten salts such as 7LiF-BeF 2 -ThF 4 , 7LiF-NaF-ThF 4 , 7LiF-Rb-UF 4 , NaF-KF-UF 4 and the like. The heated molten salts are introduced by way of a pipeway into a heat exchanger where the heat is transferred to coolant salts and electric generation is conducted by way of heated steams. (Furukawa, Y.)
Fiot, Elodie; Zenaty, Delphine; Boizeau, Priscilla; Haigneré, Jeremy; Dos Santos, Sophie; Léger, Juliane
2016-03-01
Short stature is a key aspect of the phenotype of patients with Turner syndrome (TS). SHOX haploinsufficiency is responsible for about two-thirds of the height deficit. The aim was to investigate the effect of X-chromosome gene dosage on anthropometric parameters at birth, spontaneous height, and adult height (AH) after growth hormone (GH) treatment. We conducted a national observational multicenter study. Birth parameter SDS for gestational age, height, and AH before and after GH treatment respectively, and height deficit with respect to target height (SDS) were classified by karyotype subgroup in a cohort of 1501 patients with TS: 45,X (36%), isoXq (19%), 45,X/46,XX (15%), XrX (7%), presence of Y (6%), or other karyotypes (17%). Birth weight, length (P<0.0001), and head circumference (P<0.001), height and height deficit with respect to target height (SDS) before GH treatment, at a median age of 8.8 (5.3-11.8) years and after adjustment for age and correction for multiple testing (P<0.0001), and AH deficit with respect to target height at a median age of 19.3 (18.0-21.8) years and with additional adjustment for dose and duration of GH treatment (P=0.006), were significantly associated with karyotype subgroup. Growth retardation tended to be more severe in patients with XrX, isoXq, and, to a lesser extent, 45,X karyotypes than in patients with 45,X/46,XX karyotypes or a Y chromosome. These data suggest that haploinsufficiency for an unknown Xp gene increases the risk of fetal and postnatal growth deficit and short AH with respect to target height after GH therapy. © 2016 European Society of Endocrinology.
Williams, Ryan T; Heinemann, Allen W; Neumann, Holly Demark; Fann, Jesse R; Forchheimer, Martin; Richardson, Elizabeth J; Bombardier, Charles H
2016-06-01
To compare the measurement properties and responsiveness to change of the Patient Health Questionnaire-9 (PHQ-9), the Hopkins Symptom Checklist-20 (HSCL-20), and the Hamilton Depression Rating Scale (HAM-D) in people with spinal cord injury (SCI) diagnosed with major depressive disorder (MDD). Secondary analysis of depression symptoms measured at 6 occasions over 12 weeks as part of a randomized controlled trial of venlafaxine XR for MDD in persons with SCI. Outpatient and community settings. Individuals (N=133) consented and completed the drug trial. Eligibility criteria were age at least 18 years, traumatic SCI, and diagnosis of MDD. Venlafaxine XR. Patients completed the PHQ-9 and the HSCL-20 depression scales; clinical investigators completed the HAM-D and the Structured Clinical Interview for Diagnostic and Statistical Manual of Mental Disorders-Fourth Edition (DSM-IV) Dissociative Disorders, which was used as a diagnostic criterion measure. All 3 instruments were improved with rating scale analysis. The HSCL-20 and the HAM-D contained items that misfit the underlying construct and that correlated weakly with the total scores. Removing these items improved the internal consistency, with floor effects increasing slightly. The HAM-D correlated most strongly with Structured Clinical Interview for DSM-IV Dissociative Disorders diagnoses. Improvement in depression was similar on all outcome measures in both treatment and control groups. The psychometric properties of the revised depression instruments are more than adequate for routine use in adults with SCI and are responsive to clinical improvement. The PHQ-9 is the simplest instrument with measurement properties as good as or better than those of the other instruments and required the fewest modifications. Copyright © 2016 American Congress of Rehabilitation Medicine. Published by Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Silva, Mauro W. Oliveira da; Canevaro, Lucia V.; Rodrigues, Barbara B. Dias
2011-01-01
In interventional cardiology (IC), coronary angiography (CA) and percutaneous transluminal coronary angioplasty (PTCA) procedures are the most frequent ones. Since the 1990s, the number of IC procedures has increased rapidly. It is also known that these procedures are associated with high radiation doses due to long fluoroscopy time (FT) and large number of cine-frames (CF) acquired to document the procedure. Mapping skin doses in IC is useful to find the probability of skin injuries, to detect areas of overlapping field, and to get a permanent record of the most exposed areas of skin. The purpose of this study was to estimate the maximum skin dose (MSD) in patients undergoing CA and PTCA, and to compare these values with the reference levels proposed in the literature. Patients' dose measurements were carried out on a sample of 38 patients at the hemodynamic department, in four local hospitals in Rio de Janeiro, Brazil, using Gafchromic XR-RV2 films. In PTCA procedures, the median and third quartile values of MSD were estimated at 2.5 and 5.3 Gy, respectively. For the CA procedures, the median and third quartile values of MSD were estimated at 0.5 and 0.7 Gy, respectively. In this paper, we used the Pearson's correlation coefficient (r), and we found a fairly strong correlation between FT and MSD (r=0.8334, p<0.0001), for CA procedures. The 1 Gy threshold for deterministic effects was exceeded in nine patients. The use of Gafchromic XR-RV2 films was shown to be an effective method to measure MSD and the dose distribution map. The method is effective to identify the distribution of radiation fields, thus allowing the follow-up of the patient to investigate the appearance of skin injuries. (author)
Influence of energy dependence GafChromic XR-RV3 movies to the extent of skin dose
International Nuclear Information System (INIS)
Martinez Gomez, L. C.; Gilarranz Moreno, R.; Rot San Juan, M. J.; Delgado Rodriguez, J. M.; Adaimi Hernandez, P.; Milanes Gaillet, A.
2013-01-01
In this work we have evaluated uncertainties by comparing the calculated dose with films from a calibration reference with dose measurements ionization with chamber using beams in clinical conditions. (Author)
Freely Drifting Swallow Float Array: May 1987 Trip Report
1988-05-01
co’-4 v-4~ I00 I.U I6z oJy 2ZIWO Is Y)L Figur X.4x ca C)CD U) Lo Cc r(no _0 I IC VV ~.N L) Figue X. 4bD !K U.n a1 u iP K ( o 0) 1 1(: I.,L Il 4, U ch...La. Pw ~’(rh I y- El - tD Efp KL Cr) -- - If MaIKuOOPzlwO FigreXr)b. -~ jtn x4 a(I-~)WIo u- _0 c ca CO _ -4 I’a) Fic’uX15~ 4-0C es ~ -J-L p -S.7e -f-i
Mass spectrum in 5D Warped Einstein Universe and El Naschie's quantum golden field theory
International Nuclear Information System (INIS)
Dariescu, Marina-Aura; Dariescu, Ciprian; Pirghie, Ana-Camelia
2009-01-01
The present paper deals with the massive bosons evolving in a 5D manifold, where the four-dimensional slices are the S 3 xR spacetime. By solving the Einstein equations with a perfect fluid source, we find the expression of the warp factor and write down the corresponding Gordon equation in the bulk, near one of the degenerated vacua of an effective potential with a spontaneously broken Z 2 -symmetry. We obtain the general form of the wave functions and analyze how the Kaluza-Klein-type spectrum is affecting the mass of the scalar on the brane. By inspecting the mass spectrum, we point out a connection with the golden mean based El Naschie's field theory.
Energy Technology Data Exchange (ETDEWEB)
Rodriguez, L.; Jimenez, A.; Grau, A.
1996-07-01
We applied the CIEMAT/NIST method and alpha/beta discrimination to ''210Pb samples in equilibrium with its daughters, by preparing homogeneous and gel samples. The stability of samples was tested in different available cocktails, HiSafe''TM II, HiSafe''TM III, Ultima-Gold''TM, Ultima-Gold''TM XR, Ultima-Gold''TM AB, Insta-Gel''R and e Insta-Gel''R lI. Also we analyzed the disequilibrium of the radioactive chain 210Pb+210Bi+210Po, achieving an excellent agreement between the results of the spectrum unfolding method and the experimental values. (Author) 13 refs.
Energy Technology Data Exchange (ETDEWEB)
D' Oliveira, A.S.C.M.; Cangue, F.J.R. [Universidade Federal do Parana (DEM/UFPR), Curitiba, PR (Brazil). Dept. de Engenharia Mecanica; Clark, E.; Levi, C. [University of California, Santa Barbara, CA (United States)
2010-07-01
Components performance in different environment is strongly dependent on oxides that develop on their surfaces. This study analyzed the oxide layer that develops on coatings processed with mixtures of an atomized Hastelloy C alloy with Al powders. Powder mixtures containing 10, 20 and 30wt%Al were deposited on AISI 1020 and AISI304 steel plates. Coatings were subsequently exposed to 850 deg C for two hours in a low PO{sub 2} environment. X-ray diffraction was used to identify the phases that developed in the coating during processing and Raman analysis and Scanning Electron Microscopy were used to characterize the oxide layers. The results showed that coatings processed with the richer Al mixtures, 30wt%Al, which developed NiAl aluminides, reduced the development of {alpha} alumina when processing was done on AISI 304. Coatings processed on AISI 1020 with the three powder mixtures tested developed the different allotropic forms of alumina, as predicted for the tested temperature. (author)
Effect of Al added to a NiCrMo alloy on the development of the oxide layer of intermetallic coatings
International Nuclear Information System (INIS)
D'Oliveira, A.S.C.M.; Cangue, F.J.R.
2010-01-01
Components performance in different environment is strongly dependent on oxides that develop on their surfaces. This study analyzed the oxide layer that develops on coatings processed with mixtures of an atomized Hastelloy C alloy with Al powders. Powder mixtures containing 10, 20 and 30wt%Al were deposited on AISI 1020 and AISI304 steel plates. Coatings were subsequently exposed to 850 deg C for two hours in a low PO 2 environment. X-ray diffraction was used to identify the phases that developed in the coating during processing and Raman analysis and Scanning Electron Microscopy were used to characterize the oxide layers. The results showed that coatings processed with the richer Al mixtures, 30wt%Al, which developed NiAl aluminides, reduced the development of α alumina when processing was done on AISI 304. Coatings processed on AISI 1020 with the three powder mixtures tested developed the different allotropic forms of alumina, as predicted for the tested temperature. (author)
Preliminary design study of an alternate heat source assembly for a Brayton isotope power system
Strumpf, H. J.
1978-01-01
Results are presented for a study of the preliminary design of an alternate heat source assembly (HSA) intended for use in the Brayton isotope power system (BIPS). The BIPS converts thermal energy emitted by a radioactive heat source into electrical energy by means of a closed Brayton cycle. A heat source heat exchanger configuration was selected and optimized. The design consists of a 10 turn helically wound Hastelloy X tube. Thermal analyses were performed for various operating conditions to ensure that post impact containment shell (PICS) temperatures remain within specified limits. These limits are essentially satisfied for all modes of operation except for the emergency cooling system for which the PICS temperatures are too high. Neon was found to be the best choice for a fill gas for auxiliary cooling system operation. Low cycle fatigue life, natural frequency, and dynamic loading requirements can be met with minor modifications to the existing HSA.
International Nuclear Information System (INIS)
Silverman, M.D.; Huntley, W.R.; Robertson, H.E.
1976-10-01
Heat transfer coefficients were determined experimentally for two molten-fluoride salts [LiF-BeF 2 -ThF 2 -UF 4 (72-16-12-0.3 mole %) and NaBF 4 -NaF (92-8 mole %] proposed as the fuel salt and coolant salt, respectively, for molten-salt breeder reactors. Information was obtained over a wide range of variables, with salt flowing through 12.7-mm-OD (0.5-in.) Hastelloy N tubing in a forced convection loop (FCL-2b). Satisfactory agreement with the empirical Sieder-Tate correlation was obtained in the fully developed turbulent region at Reynolds moduli above 15,000 and with a modified Hausen equation in the extended transition region (Re approx.2100-15,000). Insufficient data were obtained in the laminar region to allow any conclusions to be drawn. These results indicate that the proposed salts behave as normal heat transfer fluids with an extended transition region
International Nuclear Information System (INIS)
Susei, S.; Shimizu, S.; Aota, T.
1982-04-01
In this report, electron-beam (EB) welded joints and TIG welded joints of various superalloys to be used for nuclear plants, such as Hastelloy-type, Inconel-type and Incoloy-type, are systematically evaluated in terms of tensile properties, low-cycle fatigue properties at elevated temperatures, creep and creep-rupture properties. It was fully confirmed as conclusion that the EB welded joints are superior to the TIG welded ones in mechanical properties, especially at high temperature. In the evaluation of creep properties, ductility is one of the most important criteria to represent the resistance against fracture due to creep deformation, and this criterion is very useful in evaluating the properties of welded joints. Therefore, the more comparable to the base metal the electron beam welded joint becomes in terms of ductility, the more resistant is it against fracture. From this point of view, the electron beam welded joint is considerably superior to the TIG welded joint [fr
Corrosion of several metals in supercritical steam at 5380C
International Nuclear Information System (INIS)
McCoy, H.E.; McNabb, B.
1977-05-01
The corrosion of several iron- and nickel-base alloys in supercritical steam at 24.1 MPa (3500 psi) and 538 0 C was measured to 7.92 x 10 7 s (22,000 h). The experiments were carried out in TVA's Bull Run Steam Plant. Corrosion was measured almost entirely by weight change and visual appearance; a few samples were evaluated by more descriptive analytical techniques. The corrosion rates of low-alloy ferritic steels containing from 1.1 to 8.7 percent Cr and 0.5 to 1.0 percent Mo differed by less than a factor of 2 in steam. Several modified compositions of Hastelloy N were evaluated and found to corrode at about equivalent rates. Of the alloys studied, the lowest weight gain in 3.6 x 10 7 sec (10,000 hr) was 0.01 mg/cm 2 for Inconel 718 and the highest 10 mg/cm 2 for the low-alloy ferritic steels. 25 figures, 3 tables
Energy Technology Data Exchange (ETDEWEB)
Boustie, M.; Aoroux, E.; Romain, J.-P. [Ecole Nationale Superieure de Mecanique et d' Aerotechnique (ENSMA), 86 - Futuroscope (FR). Lab. de Combustion et de Detonique (LCD)
2000-10-01
High power pulsed lasers are used to induce shock waves in Hastelloy X targets coated with tungsten carbide of 70 {mu}m and 50 {mu}m thickness. In suitable irradiation conditions, a debonding of the substrate/coating interface due to the generation of tensile stresses is observed. Experimental results are analyzed with the use of numerical simulations yielding the stress history at interface and its dependence on laser pulse intensity up to 600 GW/cm{sup 2} with 1 ns and 3 ns durations under direct irradiation, and 23 ns with water confinement. As a consequence of shock decay during the propagation through the substrate, a strong variation of incident intensity results in a small variation of tensile stress. This allows an accurate determination of the debonding threshold which is found in the range of 1.0 to 1.3 GPa for short laser pulses (1 and 3 ns) and 0.5 to 0.6 GPa for long laser pulses (23 ns confined). (orig.)
Non-ferrous metals, anorganic and organic materials resistent to fluorides
International Nuclear Information System (INIS)
Hauffe, K.
1986-01-01
Aluminium and its alloys are resistant in fluoride solutions up to 400 K. Aluminium is also a suitable reactor material for the thermal decomposition of acidic fluorides between 750 and 825 K. Brass corrodes at room temperature in a 0,1 m KF solution with and without inhibitors very slowly ( -1 ). Nickel and the nickel alloys Inconel 600, Hastelloy N and Monel 500 are the most resistant materials against fluoride solutions and melts. A similar behavior exhibit zirconium-titanium-iron and zirconium-titanium-molybdenum alloys, respectively. From the inorganic compounds, compressed graphite, Al 2 O 3 and hexaborides of earth and rare earth metals, particularly LaB 6 , are extraordinarily resistant against fluorine ions at high temperatures. If the reaction temperature remains below 370 K, then polymers and resins, e.g. polyolefines, PVC, acrylic and epoxy resins and fluorcarbon resins can be employed as coating or compound material (resin + carbon fibers) resistant against fluorine ions up to 370 K. (orig.) [de
Thermochemical properties of media for pyrometallurgical nuclear fuel reprocessing
International Nuclear Information System (INIS)
Hosoya, Yuji; Terai, Takayuki
1998-01-01
Molten chloride/cadmium system is considered to be applied to a solvent in pyrochemical reprocessing of spent nuclear fuel. In this work, phase diagrams for molten chloride systems were constructed, using NdCl 3 as an imitative substance in place of UCl 3 or PuCl 3 . Hastelloy-X (Ni/Cr21/Fe18/Mo9/W) was examined as a structural material for the corrosion-resistance against molten chloride baths containing NdCl 3 . The process of corrosion was thermochemically discussed and the form of the corrosion was illustrated. Rutherford backscattering spectroscopy was successfully applied to determine the elemental distribution profile of specimens tested on the compatibility with molten chloride mixture at elevated temperature. Ferritic steel was also examined as another candidate material for the compatibility with molten cadmium covered with LiCl-KCl eutectic salt. Variation of near-surface composition was observed by comparing the results of Rutherford backscattering spectroscopy obtained before and after the dipping. (author)
Technology readiness level (TRL) assessment of cladding alloys for advanced nuclear fuels
International Nuclear Information System (INIS)
Shepherd, Daniel
2015-01-01
Reliable fuel claddings are essential for the safe, sustainable and economic operation of nuclear stations. This paper presents a worldwide TRL assessment of advanced claddings for Gen III and IV reactors following an extensive literature review. Claddings include austenitic, ferritic/martensitic (F/M), reduced activation (RA) and oxide dispersion strengthened (ODS) steels as well as advanced iron-based alloys (Kanthal alloys). Also assessed are alloys of zirconium, nickel (including Hastelloy R ), titanium, chromium, vanadium and refractory metals (Nb, Mo, Ta and W). Comparison is made with Cf/C and SiCf/SiC composites, MAX phase ceramics, cermets and TRISO fuel particle coatings. The results show in general that the higher the maximum operating temperature of the cladding, the lower the TRL. Advanced claddings were found to have lower TRLs than the corresponding fuel materials, and therefore may be the limiting factor in the deployment of advanced fuels and even possibly the entire reactor in the case of Gen IV. (authors)
Effect of thermal neutron irradiation on mechanical properties of alloys for HTR core applications
International Nuclear Information System (INIS)
Ogawa, Yutaka; Kondo, Tatsuo; Ishimoto, Kiyoshi; Ohtsuka, Tamotsu
1979-01-01
An industrial heat of Hastelloy-X containing 2.3 ppm boron was creep-tested at 900 0 C after irradiating thermal neutrons by 6.6 x 10 20 n.cm -2 at temperatures 670 to 880 0 C in JMTR. Significant reduction in rupture life and ductility was observed, and large shift of accelerated deformation stage to short time side was also apparent at comparatively high stresses. Below about 2.2 kg.mm -2 , apparent relief from the degradation was seen. The elongation, however, was found to be due to the formation of numerous intergranular cracks in the premature stage of deformation. Based on the post irradiation tensile properties of several industrial alloys the degree of the ductility loss was found to be nearly dependent on the boron content of the alloys. The post irradiation tensile tests for a special low boron grade heat revealed the means of protecting materials from the effect to be feasible. (author)
Effect of thermal neutron irradiation on mechanical properties of alloys for HTR core applications
International Nuclear Information System (INIS)
Ogawa, Yutaka; Kondo, Tatsuo; Ishimoto, Kiyoshi; Ohtsuka, Tamotsu
1979-02-01
An industrial heat of Hastelloy-X containing 2.3 ppm boron was creep-tested at 900 0 C after irradiating thermal neutrons by 6.6 x 10 20 n/cm 2 at temperatures 670 to 880 0 C in JMTR. Significant reduction in rupture life and ductility was observed, and large shift of accelerated deformation stage to short time side was also apparent at comparatively high stresses. Below about 2.2 kg/mm 2 , apparent relief from the degradation was seen. The elongation, however, was found to be due to the formation of numerous intergranular cracks in the premature stage of deformation. Based on the post irradiation tensile properties of several industrial alloys the degree of the ductility loss was found to be nearly dependent on the boron content of the alloys. The post irradiation tensile tests for a special low boron grade heat revealed the means of protecting materials from the effect to be feasible. (author)
1985-03-01
DIVISION ;! -0 N xr-0 n 0n4 1 1 I- C) 0 Ic 0 C WIx W Qr - - r -r 01............................. I Cq I1 -a I- I X 0’ an w I w kI~r 1 0r- r- r . 0~~~ Cs CW 1...object from the SAR platform . Ground range, the 102 ~RIM RADAR DIVISION 0 0 sc 0’. C4 C4 Xn en % >4-4 441i V-u -- - W 1-11 04 v4 0o 0 4 0 (A~U Go 4J...Rg = rRF -hy ,(3) for the flat earth or low-altitude case, where h is the platform altitude. Because the range and azimuth scales are not the same