Study on the creep constitutive equation of Hastelloy X, (1)

International Nuclear Information System (INIS)

Suzuki, Kazuhiko; Mutoh, Yasushi

1983-01-01

In order to carry out the structural design of high temperature pipings, intermediate heat exchangers and isolating valves for a multipurpose high temperature gas-cooled reactor, in which coolant temperature reaches 1000 deg C, the creep characteristics of Hastelloy X used as the heat resistant material must be clarified. In addition to usual creep rupture life and the time to reach a specified creep strain, the dependence of creep strain curves on time, temperature and stress must be determined and expressed with equations. Therefore, using the creep data of Hastelloy X given in the literatures, the creep constitutive equation was made. Since the creep strain curves under the same test condition were different according to heats, the sensitivity analysis of the creep constitutive equation was performed. The form of the creep constitutive equation was determined to be Garofalo type. The result of the sensitivity analysis is reported. (Kako, I.)

Creep properties of Hastelloy X in a carburizing helium environment

International Nuclear Information System (INIS)

Nakanishi, T.; Kawakami, H.

1982-01-01

In this work, we investigate the environmental effect on the creep behavior of Hastelloy X at 900 0 C in helium and air. Since helium coolant in HTGR is expected to be carburizing and very weakly oxidizing for most metals, testings were focused on the effect of carburizing and slight oxidation. Carburization decreases secondary creep strain rate and delays tertiary creep initiation. On the other hand, the crack growth rate on the specimen surface is enhanced due to very weak oxidation in helium, therefore the tertiary creep strain rate becomes larger than that in air. The rupture time of Hastelloy X was shorter in helium when compared with in air. Stress versus rupture time curves for both environments do not deviate with each other during up to 5000 hours test, and a ratio of rupture stress in helium to that in air was about 0.9

Creep properties of hastelloy x and their application to the structural design

International Nuclear Information System (INIS)

Kiyoshige, Masanori; Murase, Hirokazu; Fujioka, Junzo; Shimizu, Shigeki; Satoh, Keisuke.

1978-01-01

In the creep curve of Hastelloy X, it was difficult to divide it into the three stages of creep. However, these stages were made distinguishable by plotting the relationship between creep rates and time in double-logarithmic coordinates. All the creep data of Hastelloy X, except the isochronous stress-strain curves, required for determining the design stress intensities S sub(o) and S sub(t) were arranged through the Larson-Miller parameter. The isochronous stress-strain curves for a heat of Hastelloy X were derived from the constitutive equations obtained from short-term data. A fairly good agreement between the predicted data and the experimental data was obtained. (auth.)

Comparison of creep behavior under varying load/temperature conditions between Hastelloy XR alloys with different boron content levels

International Nuclear Information System (INIS)

Tsuji, Hirokazu; Nakajima, Hajime; Shindo, Masami; Tanabe, Tatsuhiko; Nakasone, Yuji.

1996-01-01

In the design of the high-temperature components, it is often required to predict the creep rupture life under the conditions in which the stress and/or temperature may vary by using the data obtained with the constant load and temperature creep rupture tests. Some conventional creep damage rules have been proposed to meet the above-mentioned requirement. Currently only limited data are available on the behavior of Hastelloy XR, which is a developed alloy as the structural material for high-temperature components of the High-Temperature Engineering Test Reactor (HTTR), under varying stress and/or temperature creep conditions. Hence a series of constant load and temperature creep rupture tests as well as varying load and temperature creep rupture tests was carried out on two kinds of Hastelloy XR alloys whose boron content levels are different, i.e., below 10 and 60 mass ppm. The life fraction rule completely fails in the prediction of the creep rupture life of Hastelloy XR with 60 mass ppm boron under varying load and temperature conditions though the rule shows good applicability for Hastelloy XR with below 10 mass ppm boron. The change of boron content level of the material during the tests is the most probable source of impairing the applicability of the life fraction rule to Hastelloy XR whose boron content level is 60 mass ppm. The modified life fraction rule has been proposed based on the dependence of the creep rupture strength on the boron content level of the alloy. The modified rule successfully predicts the creep rupture life under the two stage creep test conditions from 1000 to 900degC. The trend observed in the two stage creep tests from 900 to 1000degC can be qualitatively explained by the mechanism that the oxide film which is formed during the prior exposure to 900degC plays the role of the protective barrier against the boron dissipation into the environment. (J.P.N.)

Creep properties of 20% cold-worked Hastelloy XR

International Nuclear Information System (INIS)

Kurata, Y.

1996-01-01

The creep properties of Hastelloy XR, in solution-treated and in 20% cold-worked conditions, were studied at 800, 900 and 1000 C. At 800 C, the steady-state creep rate and rupture ductility decrease, while rupture life increases after cold work to 20%. Although the steady-state creep rate and ductility also decrease at 900 C, the beneficial effect on rupture life disappears. Cold work to 20% enhan ces creep resistance of this alloy at 800 and 900 C due to a high density of dislocations introduced by the cold work. Rupture life of the 20% cold-worked alloy becomes shorter and the steady-state creep rate larger at 1000 C during creep of the 20% cold-worked alloy. It is emphasized that these cold work effects should be taken into consideration in design and operation of high-temperature structural components of high-temperature gas-cooled reactors. (orig.)

ERDA, RBS, TEM and SEM characterization of microstructural evolution in helium-implanted Hastelloy N alloy

Energy Technology Data Exchange (ETDEWEB)

Gao, Jie [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); School of Physical Sciences, University of Chinese Academy of Sciences, Beijing 100049 (China); Bao, Liangman [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); Huang, Hefei, E-mail: huanghefei@sinap.ac.cn [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); Li, Yan, E-mail: liyan@sinap.ac.cn [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); Lei, Qiantao [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); Institute of Modern Physics, Fudan University, Shanghai 200433 (China); Deng, Qi [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); Liu, Zhe; Yang, Guo [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); School of Physical Sciences, University of Chinese Academy of Sciences, Beijing 100049 (China); Shi, Liqun [Institute of Modern Physics, Fudan University, Shanghai 200433 (China)

2017-05-15

Hastelloy N alloy was implanted with 30 keV, 5 × 10{sup 16} ions/cm{sup 2} helium ions at room temperature, and subsequent annealed at 600 °C for 1 h and further annealed at 850 °C for 5 h in vacuum. Using elastic recoil detection analysis (ERDA) and transmission electron microscopy (TEM), the depth profiles of helium concentration and helium bubbles in helium-implanted Hastelloy N alloy were investigated, respectively. The diffusion of helium and molybdenum elements to surface occurred during the vacuum annealing at 850 °C (5 h). It was also observed that bubbles in molybdenum-enriched region were much larger in size than those in deeper region. In addition, it is worth noting that plenty of nano-holes can be observed on the surface of helium-implanted sample after high temperature annealing by scanning electron microscope (SEM). This observation provides the evidence for the occurrence of helium release, which can be also inferred from the results of ERDA and TEM analysis.

Response Surface Design Model to Predict Surface Roughness when Machining Hastelloy C-2000 using Uncoated Carbide Insert

International Nuclear Information System (INIS)

Razak, N H; Rahman, M M; Kadirgama, K

2012-01-01

This paper presents to develop of the response surface design model to predict the surface roughness for end-milling operation of Hastelloy C-2000 using uncoated carbide insert. Mathematical model is developed to study the effect of three input cutting parameters includes the feed rate, axial depth of cut and cutting speed. Design of experiments (DOE) was implemented with the aid of the statistical software package. Analysis of variance (ANOVA) has been performed to verify the fit and adequacy of the developed mathematical model. The result shows that the feed rate gave the more effect on the both prediction values of Ra compared to the cutting speed and axial depth of cut. SEM and EDX analyses were performed in different cutting conditions. It can be concluded that the feed rate and cutting force give the higher impact to influence the machining characteristics of surface roughness. Thus, the optimizing the cutting conditions are essential in order to improve the surface roughness in machining of Hastlelloy C-2000.

Weldability and weld performance of a special grade Hastelloy-X modified for high-temperature gas-cooled reactors

International Nuclear Information System (INIS)

Shimizu, S.; Mutoh, Y.

1984-01-01

The characteristics of weld defects in the electron beam (EB) welding and the tungsten inert gas (TIG) arc welding for Hastelloy-XR, a modified version of Hastelloy-X, are clarified through the bead-on-plate test and the Trans-Varestraint test. Based on the results, weldabilities on EB and TIG weldings for Hastelloy-XR are discussed and found to be almost the same as Hastelloy-X. The creep rupture behaviors of the welded joints are evaluated by employing data on creep properties of the base and the weld metals. According to the evaluation, the creep rupture strength of the EB-welded joint may be superior to that of the TIG-welded joint. The corrosion test in helium containing certain impurities is conducted for the weld metals. There is no significant difference of such corrosion characteristics as weight gain, internal oxidation, depleted zone, and so on between the base and the weld metals. Those are superior to Hastelloy-X

Laser texturing of Hastelloy C276 alloy surface for improved hydrophobicity and friction coefficient

Science.gov (United States)

Yilbas, B. S.; Ali, H.

2016-03-01

Laser treatment of Hastelloy C276 alloy is carried out under the high pressure nitrogen assisting gas environment. Morphological and metallurgical changes in the laser treated layer are examined using the analytical tools including, scanning electron and atomic force microscopes, X-ray diffraction, energy dispersive spectroscopy, and Fourier transform infrared spectroscopy. Microhardness is measured and the residual stress formed in the laser treated surface is determined from the X-ray data. The hydrophibicity of the laser treated surface is assessed using the sessile drop method. Friction coefficient of the laser treated layer is obtained incorporating the micro-tribometer. It is found that closely spaced laser canning tracks create a self-annealing effect in the laser treated layer and lowers the thermal stress levels through modifying the cooling rates at the surface. A dense structure, consisting of fine size grains, enhances the microhardness of the surface. The residual stress formed at the surface is compressive and it is in the order of -800 MPa. Laser treatment improves the surface hydrophobicity significantly because of the formation of surface texture composing of micro/nano-pillars.

One new route to optimize the oxidation resistance of TiC/hastelloy (Ni-based alloy) composites applied for intermediate temperature solid oxide fuel cell interconnect by increasing graphite particle size

Science.gov (United States)

Qi, Qian; Liu, Yan; Wang, Lujie; Zhang, Hui; Huang, Jian; Huang, Zhengren

2017-09-01

TiC/hastelloy composites with suitable thermal expansion and excellent electrical conductivity are promising candidates for IT-SOFC interconnect. In this paper, the TiC/hastelloy composites are fabricated by in-situ reactive infiltration, and the oxidation resistance of composites is optimized by increasing graphite particle size. Results show that the increase of graphite particles size from 1 μm to 40 μm reduces TiC particle size from 2.68 μm to 2.22 μm by affecting the formation process of TiC. Moreover, the decrease of TiC particles size accelerates the fast formation of dense and continuous TiO2/Cr2O3 oxide layer, which bring down the mass gain (800 °C/100 h) from 2.03 mg cm-2 to 1.18 mg cm-2. Meanwhile, the coefficient of thermal expansion decreases from 11.15 × 10-6 °C-1 to 10.80 × 10-6 °C-1, and electrical conductivity maintains about 5800 S cm-1 at 800 °C. Therefore, the decrease of graphite particle size is one simple and effective route to optimize the oxidation resistance of composites, and meantime keeps suitable thermal expansion and good electrical conductivity.

The corrosion behavior of molybdenum and Hastelloy B in sulfur and sodium polysulfides at 623 K

International Nuclear Information System (INIS)

Brown, A.P.

1987-01-01

An experimental study was completed to determine the corrosion behavior of molybdenum and Hastelloy B, a nickel-based alloy with high molybdenum content, in sulfur and sodium polysulfides (Na/sub 2/S/sub 3/,Na/sub 2/S/sub 4/, Na/sub 2/S/sub 5/) at 623 K. In sulfur, molybdenum corrodes very slowly, with a parabolic rate constant of 3.6 x 10/sup -9/ cm s/sup -1/2/. Hastelloy B shows no measurable corrosion after 100h of exposure to sulfur. The corrosion reaction of molybdenum in Na/sub 2/S/sub 3/ is characterized by the formation of a protective film that effectively eliminates further corrosion after the first 100h of exposure. Hastelloy B, however, corrodes rapidly in Na/sub 2/S/sub 3/, with corrosion rates approaching those of pure nickel under the same conditions. After the first 4h of exposure, the kinetics for the corrosion of Hastelloy B in Na/sub 2/S/sub 3/ follows a linear rate law. The scale morphology has multiple spalled layers of NiS/sub 2/, with some crystallites of NiS/sub 2/ appearing on the leading face of the scale and between the individual scale layers. This spalling causes smaller coupons of the Hastelloy B to corrode faster than larger coupons

Evaluation on materials performance of Hastelloy Alloy XR for HTTR uses-5 (Creep properties of base metal and weldment in air)

International Nuclear Information System (INIS)

Watanabe, Katsutoshi; Nakajima, Hajime; Koikegami, Hajime; Higuchi, Makoto; Nakanishi, Tsuneo; Saitoh, Teiichiro; Takatsu, Tamao.

1994-01-01

Creep properties of weldment made from Hastelloy Alloy XR base metals and filler metals for the High Temperature Engineering Test Reactor (HTTR) components were examined by means of creep and creep rupture tests at 900 and 950degC in air. The results obtained are as follows: creep rupture strength was nearly equal or higher than that of Hastelloy Alloy XR master curve and was much higher than design creep rupture strength [S R ]. Furthermore, creep rupture strength and ductility of the present filler metal was in the data band in comparison with those of the previous filler metals. It is concluded from these reasons that this filler metal has fully favorable properties for HTTR uses. (author)

Hastelloy X fuel element creep relaxation and residual effects

International Nuclear Information System (INIS)

Castle, R.A.

1971-01-01

A worst case, seven element, asymmetric fuel, thermal environment was assumed and a creep relaxation analysis generated. The fuel element clad is .020 inch Hastelloy X. The contact load decreased from 11.6 pounds to 5.87 pounds in 100,000 hours. The residual stresses were then computed for various shutdown times. (U.S.)

Etude expérimentale du soudage par laser YAG de l'alliage base nickel Hastelloy X Experimental study of YAG laser welding of nickel base alloy Hastelloy X

Directory of Open Access Journals (Sweden)

Graneix Jérémie

2013-11-01

Full Text Available Le procédé de soudage laser YAG est envisagé pour remplacer le procédé de soudage TIG manuel pour la réalisation de pièces de turboréacteur en alliage nickel-chrome-molybdène Hastelloy X. Cette étude expérimentale a permis de définir un domaine de soudabilité de cet alliage répondant aux critères spécifiques du secteur aéronautique. The YAG laser welding process is contemplated to replace the manual TIG welding process for the production of parts of turbojet in Hastelloy X. This experimental study has identified the field of weldability of this alloy to meet the specific requirements of the aerospace industry.

Application of Hastelloy X in gas-cooled reactor systems

International Nuclear Information System (INIS)

Brinkman, C.R.; Rittenhouse, P.L.; Corwin, W.R.; Strizak, J.P.; Lystrup, A.; DiStefano, J.R.

1976-10-01

Hastelloy X, an Ni--Cr--Fe--Mo alloy, may be an important structural alloy for components of gas-cooled reactor systems. Expected applications of this alloy in the High-Temperature Gas-Cooled Reactor (HTGR) are discussed, and the development of interim mechanical properties and supporting data are reported. Properties of concern include tensile, creep, creep-rupture, fatigue, creep-fatigue interaction, subcritical crack growth, thermal stability, and the influence of helium environments with controlled amounts of impurities on these properties. In order to develop these properties in helium environments that are expected to be prototypic of HTGR operating conditions, it was necessary to construct special environmental test systems. Details of construction and operating parameters are described. Interim results from tests designed to determine the above properties are presented. To date a fairly extensive amount of information has been generated on this material at Oak Ridge National Laboratory and elsewhere concerning behavior in air, which is reviewed. However, only limited data are available from tests conducted in helium. Comparisons of the fatigue and subcritical growth behavior in air between Hastelloy X and a number of other structural alloys are given

Relationship between carburization and zero-applied-stress creep dilation in Alloy 800H and Hastelloy X

International Nuclear Information System (INIS)

Inouye, H.; Rittenhouse, P.L.

1981-01-01

Typical HTGR candidate alloys can carburize when exposed to simulated service environments. The carbon concentration gradients so formed give rise to internal stresses which could cause dilation. Studies performed with Hastelloy X and Alloy 800H showed that dilations of up to almost 1% can occur at 1000 0 C when carbon pickup is high. Dilation was normally observed only when the carbon increase was >1000 μg/cm 2 and ceased when diffusing carbon reached the center of the specimen. (Auth.)

Effects of product form and boron addition on the creep damage in the modified Hastelloy X alloys in a simulated HTGR helium gas environment

International Nuclear Information System (INIS)

Nakasone, Yuji; Tanabe, Tatsuhiko; Tsuji, Hirokazu; Nakajima, Hajime.

1992-01-01

The present paper investigates early-stage-creep damage of Hastelloy XR and XR-II alloys, modified versions of Hastelloy X alloy, which have been developed in Japan as most promising candidate structural alloys for Japanese high-temperature gas-cooled reactors (HTGRs). Creep tests were made on Hastelloy XR forging, tube and XR-II tube at 1,123 to 1,273 K in a simulated HTGR helium gas environment. The tests were interrupted at different strain levels of up to 5 % in order to evaluate creep damage via intergranular voids. The void sizes along grain boundaries and the A-parameter, the ratio of the number of damaged grain boundaries, on which one or more voids are found, to that of the total grain boundaries observed are used in order to evaluate creep damage. Statistical analysis of the A-parameter as well as the void sizes reveals that the values of the parameter show wide variations and follow the Weibull distribution, reflecting spatial randomness of the voids. The void sizes along grain boundaries, on the other hand, follow the log-normal distribution. The maximum void size d max and the mean value of the A-parameter A m are calculated and plotted against interruption creep strain ε int . The resultant d max vs. ε int and A m vs. ε int diagrams show that Hastelloy XR forging had suffered more damage than Hastelloy XR tube; nevertheless, the forging has longer interruption life, or the time to reach a given interruption creep strain. The result indicates that grains may have been deformed more easily in Hastelloy XR in the form of tube than in the form of forging. The diagrams also imply that the addition of boron has suppressed the nucleation as well as the growth of voids and thus has brought about longer interruption life of Hastelloy XR-II. (author)

Temperature dependence of creep properties of cold-worked Hastelloy XR

International Nuclear Information System (INIS)

Kurata, Yuji; Nakajima, Hajime

1995-01-01

The creep properties of Hastelloy XR, in a solution treated, 10% or 20% cold-worked condition, were investigated at temperatures from 800 to 1,000degC for the duration of creep tests up to about 2,500 ks. At 800 and 850degC, the steady-state creep rate and rupture ductility decreased and the rupture life increased after cold work of 10% or 20%. Although the rupture life of the 10% cold-worked alloy was longer at 900degC than that of the solution treated one, the rupture lives of the 10% cold-worked and solution treated alloys were almost equal at 950degC, which is the highest helium temperature in an intermediate heat exchanger of the High Temperature Engineering Test Reactor (HTTR). The beneficial effect of 10% cold work on the rupture life and the steady-state creep rate disappeared at 1,000degC. The beneficial effect of 20% cold work disappeared at 950degC because significant dynamic recrystallization occurred during creep. While rupture ductility of this alloy decreased after cold work of 10% or 20%, it recovered to a considerable extend at 1,000degC. It is emphasized that these cold work effects should be taken into consideration in design, operation and residual life estimation of high temperature components of the HTTR. (author)

Creep curve modeling of hastelloy-X alloy by using the theta projection method

International Nuclear Information System (INIS)

Woo Gon, Kim; Woo-Seog, Ryu; Jong-Hwa, Chang; Song-Nan, Yin

2007-01-01

To model the creep curves of the Hastelloy-X alloy which is being considered as a candidate material for the VHTR (Very High Temperature gas-cooled Reactor) components, full creep curves were obtained by constant-load creep tests for different stress levels at 950 C degrees. Using the experimental creep data, the creep curves were modeled by applying the Theta projection method. A number of computing processes of a nonlinear least square fitting (NLSF) analysis was carried out to establish the suitably of the four Theta parameters. The results showed that the Θ 1 and Θ 2 parameters could not be optimized well with a large error during the fitting of the full creep curves. On the other hand, the Θ 3 and Θ 4 parameters were optimized well without an error. For this result, to find a suitable cutoff strain criterion, the NLSF analysis was performed with various cutoff strains for all the creep curves. An optimum cutoff strain range for defining the four Theta parameters accurately was found to be a 3% cutoff strain. At the 3% cutoff strain, the predicted curves coincided well with the experimental ones. The variation of the four Theta parameters as the function of a stress showed a good linearity, and the creep curves were modeled well for the low stress levels. Predicted minimum creep rate showed a good agreement with the experimental data. Also, for a design usage of the Hastelloy-X alloy, the plot of the log stress versus log the time to a 1% strain was predicted, and the creep rate curves with time and a cutoff strain at 950 C degrees were constructed numerically for a wide rang of stresses by using the Theta projection method. (authors)

Corrosion characteristics of Hastelloy N alloy after He+ ion irradiation

International Nuclear Information System (INIS)

Lin Jianbo; Yu Xiaohan; Li Aiguo; He Shangming; Cao Xingzhong; Wang Baoyi; Li Zhuoxin

2014-01-01

With the goal of understanding the invalidation problem of irradiated Hastelloy N alloy under the condition of intense irradiation and severe corrosion, the corrosion behavior of the alloy after He + ion irradiation was investigated in molten fluoride salt at 700 °C for 500 h. The virgin samples were irradiated by 4.5 MeV He + ions at room temperature. First, the virgin and irradiated samples were studied using positron annihilation lifetime spectroscopy (PALS) to analyze the influence of irradiation dose on the vacancies. The PALS results showed that He + ion irradiation changed the size and concentration of the vacancies which seriously affected the corrosion resistance of the alloy. Second, the corroded samples were analyzed using synchrotron radiation micro-focused X-ray fluorescence, which indicated that the corrosion was mainly due to the dealloying of alloying element Cr in the matrix. Results from weight-loss measurement showed that the corrosion generally correlated with the irradiation dose of the alloy. (author)

Compatibility of aluminide-coated Hastelloy x and Inconel 617 in a simulated gas-cooled reactor environment

International Nuclear Information System (INIS)

Chin, J.; Johnson, W.R.; Chen, K.

1982-03-01

Commercially prepared aluminide coatings on Hastelloy X and Inconel 617 substrates were exposed to controlled-impurity helium at 850 0 and 950 0 C for 3000 h. Optical and scanning electron (SEM) microscopy, electron microprobe profiles, and SEM X-ray mapping were used to evaluate and compare exposed and unexposed control samples. Four coatings were evaluated: aluminide, aluminide with platinum, aluminide with chromium, and aluminide with rhodium. With extended time at elevated temperature, nickel diffused into the aluminide coatings to form epsilon-phase (Ni 3 Al). This diffusion was the primary cause of porosity formation at the aluminide/alloy interface

Effect of temperature upon the fatigue-crack propagation behavior of Hastelloy X-280

International Nuclear Information System (INIS)

James, L.A.

1976-05-01

The techniques of linear-elastic fracture mechanics were employed to characterize the effect of temperature upon the fatigue-crack propagation behavior of Hastelloy X-280 in an air environment. Also included in this study are survey tests to determine the effects of thermal aging and stress ratio upon crack growth behavior in this alloy

Compatibility studies of type 316 stainless steel and Hastelloy N in KNO3--NaNO2--NaNO3

International Nuclear Information System (INIS)

Devan, J.H.; Keiser, J.R.

1978-01-01

The nitrate-based fused salt mixture KNO 3 --NaNO 2 --NaNO 3 (44--49--7 mol %) has been widely used as a heat transport fluid and for metallurgical heat-treating. We have measured the corrosion rate of this salt in the presence of a temperature gradient for an iron-base material, type 316 stainless steel, and a nickel-base material, Hastelloy N. Corrosion rates were measured with maximum loop temperatures of 431 and 504 0 C. Measured corrosion rates were in all cases less than 8 μm/year

Effect of grain size and cold working on high temperature strength of Hastelloy X

International Nuclear Information System (INIS)

Fujioka, J.; Murase, H.; Matsuda, S.

1980-01-01

Effect of grain size and cold working on creep, creep rupture, low cycle fatigue and tensile strengths of Hastelloy X were studied at temperatures ranging from 800 to 1000 0 C. In order to apply these data to design, the allowable design stresses were estimated by expanding the criteria of ASME Code Case 1592 to such a high temperature range. The allowable design stress increased, on the other hand, the low cycle fatigue life decreased with increasing grain size. Cold working up to a ratio of 5 per cent may not be a serious problem in design, because the allowable design stress and the fatigue life were little affected. The cause of these variations in strength was discussed by examining the initiation and growth of cracks, and the microstructures. (author)

Creep-rupture behavior of 2-1/4 Cr-1 Mo steel, Alloy 800H and Hastelloy Alloy X in a simulated HTGR helium environment

International Nuclear Information System (INIS)

Lai, G.Y.; Wolwowicz, R.J.

1979-12-01

Creep-rupture testing was conducted on 1 1/4 Cr-1 Mo steel, Alloy 800H and Hastelloy Alloy X in flowing helium containing nominal concentration of following gases: 1500 μatm H 2 , 450 μatm CO, 50 μatm CH 4 , 50 μatm H 2 O and 5 μatm CO 2 . This environment is believed to represent maximum permissible levels of impurities in the primary coolant for the steam-cycle system of a high-temperature gas-cooled reactor (HTGR) when it is operating continuously with a water and/or steam leak at technical specification limits. Two or three heats of material for each alloy were investigated. Tests were conducted at 482 0 C and 760 0 C (1200 0 F and 1400 0 F) for Alloy 800H, and at 760 0 C and 871 0 C (1400 0 F and 1600 0 F) for Hastelloy Alloy X for times up to 10,000 h. Selected tests were performed on same heat of material in both air and helium environments to make a direct comparison of creep-rupture behaviors between two environments. Metallurgical evaluation was performed on selected post test specimens with respect to gas-metal interactions which included oxidation, carburization and/or decarburization. Correlation between gaseous corrosion and creep-rupture behavior was attempted. Limited tests were also performed to investigate the specimen size effects on creep-rupture behavior in the helium environment

Electrochemical impedance spectrometry using 316L steel, hastelloy, maraging, Inconel 600, Elgiloy, carbon steel, TiN and NiCr. Simulation in tritiated water. 2 volumes; Spectrometrie d`impedance electrochimique sur acier 316L, hastelloy, maraging inconel 600, elgiloy, acier au carbone, TiN, NiCr. Simulations en eau tritiee. 2 volumes

Energy Technology Data Exchange (ETDEWEB)

Bellanger, G.

1994-03-01

Polarization and electrochemical impedance spectrometry curves are presented and discussed. These curves make it possible to ascertain the corrosion domains and to compare the slow and fast kinetics (voltammetry) of different stainless steel alloys. These corrosion kinetics, the actual or simulated tritiated water redox potentials, and the corrosion potentials provide a classification of the steels studied here: 316L, Hastelloy, Maraging, Inconel 600, Elgiloy, carbon steel and TiN and NiCr deposits. From the results it can be concluded that Hastelloy and Elgiloy have the best corrosion resistance. (author). 49 refs., 695 figs., tabs.

Metallurgical and environmental factors influencing creep behaviour of hastelloy-X

International Nuclear Information System (INIS)

Kiuchi, Kiyoshi; Kondo, Tatsuo

1979-03-01

Creep and rupture behaviours of Hastelloy-X and its modified version were examined with special reference to the effect of different test environments; i.e. air, high vacuum and the simulated HTR helium coolant. The respective environments showed different effects. The vacuum environment of about 10 -8 torr. gave best reproducible behaviour with essentially no surface-to-volume ratio effect. Such size effect was significant in the other two environments. The simulated HTR environment was characterized in its potentiality of both oxidizing selected alloy constituents and carburization. The observed behaviour was attributed to the depletion of strengthning solute elements caused by the surface reactions and the associated solid state reactions. (author)

Electrochemical impedance spectrometry using 316L steel, hastelloy, maraging, Inconel 600, Elgiloy, carbon steel, TiN and NiCr. Simulation in tritiated water. 2 volumes

International Nuclear Information System (INIS)

Bellanger, G.

1994-03-01

Polarization and electrochemical impedance spectrometry curves are presented and discussed. These curves make it possible to ascertain the corrosion domains and to compare the slow and fast kinetics (voltammetry) of different stainless steel alloys. These corrosion kinetics, the actual or simulated tritiated water redox potentials, and the corrosion potentials provide a classification of the steels studied here: 316L, Hastelloy, Maraging, Inconel 600, Elgiloy, carbon steel and TiN and NiCr deposits. From the results it can be concluded that Hastelloy and Elgiloy have the best corrosion resistance. (author). 49 refs., 695 figs., tabs

Study on the creep constitutive equation of Hastelloy X, (1)

International Nuclear Information System (INIS)

Hada, Kazuhiko; Mutoh, Yasushi

1983-01-01

A creep constitutive equation of Hastelloy X was obtained from available experimental data. A sensitivity analysis of this creep constitutive equation was carried out. As the result, the following were revealed: (i) Variations in creep behavior with creep constitutive equation are not small. (ii) In a simpler stress change pattern, variations in creep behavior are similar to those in the corresponding fundamental creep characteristics (creep strain curve, stress relaxation curve, etc.). (iii) Cumulative creep damage estimated in accordance with ASME Boiler and Pressure Vessel Code Case N-47 from a stress history predicted by ''the standard creep constitutive equation'' which predicts the average behavior of creep strain curve data is not thought to be on the safe side on account of uncertainties in creep damage caused by variations in creep strain curve. (author)

Application of the Taguchi technique for the optimization of surface roughness and tool life during the milling of Hastelloy C22

International Nuclear Information System (INIS)

Kivak, Turgay; Mert, Senol

2017-01-01

In this study, the effects of machining parameters on surface roughness (Ra) and tool life (Tl) were investigated in the milling of Hastelloy C22 alloy with TiAlN-coated carbide inserts. A number of milling experiments were conducted using the L_2_7 (3"3) Taguchi orthogonal array on a CNC milling machine under different cutting conditions (dry, compressed air and wet). The cutting condition, cutting speed and feed rate were determined as the essential machining parameters. Analysis of variance (ANOVA) and signal-to-noise (S/N) ratio were employed to evaluate the effects of the machining parameters on Ra and Tl, and prediction models were created using quadratic regression analyses. The results revealed that the feed rate and cutting condition were the most influential factors on surface roughness and flank wear. The maximum tool life was achieved under wet cutting condition using a cutting speed of 30 x min"-"1 and a feed rate of 0.08 mm x rev"-"1, while the minimum surface roughness value was obtained under wet cutting condition using a cutting speed of 50 m x min"-"1 and the same feed rate. Using the optimum cutting parameters for Tl (30 m x min"-"1, 0.08 mm x rev"-"1), increases of 234 % and 67 % in tool life were observed under wet and compressed air cutting conditions, respectively, compared to the dry cutting condition.

Application of the Taguchi technique for the optimization of surface roughness and tool life during the milling of Hastelloy C22

Energy Technology Data Exchange (ETDEWEB)

Kivak, Turgay; Mert, Senol [Duezce Univ. (Turkey). Dept. of Manufacturing Engineering

2017-02-01

In this study, the effects of machining parameters on surface roughness (Ra) and tool life (Tl) were investigated in the milling of Hastelloy C22 alloy with TiAlN-coated carbide inserts. A number of milling experiments were conducted using the L{sub 27} (3{sup 3}) Taguchi orthogonal array on a CNC milling machine under different cutting conditions (dry, compressed air and wet). The cutting condition, cutting speed and feed rate were determined as the essential machining parameters. Analysis of variance (ANOVA) and signal-to-noise (S/N) ratio were employed to evaluate the effects of the machining parameters on Ra and Tl, and prediction models were created using quadratic regression analyses. The results revealed that the feed rate and cutting condition were the most influential factors on surface roughness and flank wear. The maximum tool life was achieved under wet cutting condition using a cutting speed of 30 x min{sup -1} and a feed rate of 0.08 mm x rev{sup -1}, while the minimum surface roughness value was obtained under wet cutting condition using a cutting speed of 50 m x min{sup -1} and the same feed rate. Using the optimum cutting parameters for Tl (30 m x min{sup -1}, 0.08 mm x rev{sup -1}), increases of 234 % and 67 % in tool life were observed under wet and compressed air cutting conditions, respectively, compared to the dry cutting condition.

Creep-Rupture Properties and Corrosion Behaviour of 21/4 Cr-1 Mo Steel and Hastelloy X-Alloys in Simulated HTGR Environment

DEFF Research Database (Denmark)

Lystrup, Aage; Rittenhouse, P. L.; DiStefano, J. R.

Hastelloy X and 2/sup 1///sub 4/ Cr-1 Mo steel are being considered as structural alloys for components of a High-Temperature Gas-Cooled Reactor (HTGR) system. Among other mechanical properties, the creep behavior of these materials in HTGR primary coolant helium must be established to form part...

Collect Available Creep-Fatigue Data and Study Existing Creep-Fatigue Evaluation Procedures for Grade 91 and Hastelloy XR

International Nuclear Information System (INIS)

Asayama, Tai; Tachibana, Yukio

2007-01-01

This report describes the results of investigation on Task 5 of DOE/ASME Materials Project based on a contract between ASME Standards Technology, LLC (ASME ST-LLC) and Japan Atomic Energy Agency (JAEA). Task 5 is to collect available creep-fatigue data and study existing creep-fatigue evaluation procedures for Grade 91 steel and Hastelloy XR. Part I of this report is devoted to Grade 91 steel. Existing creep-fatigue data were collected (Appendix A) and analyzed from the viewpoints of establishing a creep-fatigue procedure for VHTR design. A fair amount of creep-fatigue data has been obtained and creep-fatigue phenomena have been clarified to develop design standards mainly for fast breeder reactors. Following this, existing creep-fatigue procedures were studied and it was clarified that the creep-fatigue evaluation procedure of the ASME-NH has a lot of conservatisms and they were analyzed in detail from the viewpoints of the evaluation of creep damage of material. Based on the above studies, suggestions to improve the ASME-NH procedure along with necessary research and development items were presented. Part II of this report is devoted to Hastelloy XR. Existing creep-fatigue data used for development of the high temperature structural design guideline for High Temperature Gas-cooled Reactor (HTGR) were collected. Creep-fatigue evaluation procedure in the design guideline and its application to design of the intermediate heat exchanger (IHX) for High Temperature Engineering Test Reactor (HTTR) was described. Finally, some necessary research and development items in relation to creep-fatigue evaluation for Gen IV and VHTR reactors were presented.

Ion irradiation-induced swelling and hardening effect of Hastelloy N alloy

Energy Technology Data Exchange (ETDEWEB)

Zhang, S.J. [Key Laboratory of Artificial Micro-and Nano-structures of Ministry of Education, School of Physics and Technology, Wuhan University, Wuhan 430072 (China); Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); Li, D.H.; Chen, H.C.; Lei, G.H.; Huang, H.F.; Zhang, W.; Wang, C.B. [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); Yan, L., E-mail: yanlong@sinap.ac.cn [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); Fu, D.J. [Key Laboratory of Artificial Micro-and Nano-structures of Ministry of Education, School of Physics and Technology, Wuhan University, Wuhan 430072 (China); Tang, M. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States)

2017-06-15

The volumetric swelling and hardening effect of irradiated Hastelloy N alloy were investigated in this paper. 7 MeV and 1 MeV Xe ions irradiations were performed at room temperature (RT) with irradiation dose ranging from 0.5 to 27 dpa. The volumetric swelling increases with increasing irradiation dose, and reaches up to 3.2% at 27 dpa. And the irradiation induced lattice expansion is also observed. The irradiation induced hardening initiates at low ion dose (≤1dpa) then saturates with higher ion dose. The irradiation induced volumetric swelling may be ascribed to excess atomic volume of defects. The irradiation induced hardening may be explained by the pinning effect where the defects can act as obstacles for the free movement of dislocation lines. And the evolution of the defects' size and number density could be responsible for the saturation of hardness. - Highlights: •Irradiation Swelling: The irradiation induced volumetric swelling increases with ion dose. •Irradiation Hardening: The irradiation hardening initiates below 1 dpa, then saturates with higher ion dose (1–10 dpa). •Irradiation Mechanism: The irradiation phenomena are ascribed to the microstructural evolution of the irradiation defects.

Creep strength of hastelloy X TIG-welded cylinder under internal pressure at elevated temperature

International Nuclear Information System (INIS)

Udoguchi, Teruyoshi; Indo, Hirosato; Isomura, Kazuyuki; Kobatake, Kiyokazu; Nakanishi, Tsuneo.

1981-01-01

Creep tests on circumferentially TIG-welded Hastelloy x cylinders were carried out under internal pressure for the investigation of structural behavior of welded components in high temperature environment. The creep rupture strength of TIG-welded cylinders was much lower than that of non-welded cylinders, while such reduction was not found in uniaxial creep tests on TIG-welded bars. It was deduced that the reduction was due to the low ductility (ranging from 1 to 5%) of the weld metal to which enhanced creep was induced by the adjacent base metal whose creep strain rate was much higher than that of the weld metal. Therefore, uniaxial creep tests on bar specimens is not sufficient for proper assessment of the creep rupture strength of welded components. Both creep strain rate and creep ductility should be concerned for the assessment. Creep tests by using components such as cylinder under internal pressure are recommendable for the confirmation of creep strength of welded structures and components. (author)

Mechanical characterization of superalloys for space reactors

International Nuclear Information System (INIS)

Duchesne, J.

1989-01-01

The aim of this work is the selection of structural materials that can be used in the temperature range 600-900 0 C for a gas cooled space reactor producing electricity. Superalloys fit best the temperature range required. Five nickel base alloys are chosen for their good mechanical behaviour: HAYNES 230, HASTELLOY S, HASTELLOY X, HASTELLOY XR and PYRAD 38D. Metallography, tensile and hardness tests are realized. Sample contraction is evidenced for some creep tests, under low stress: 20MPa at 800 0 C, on HAYNES 230 and HASTELLOY X, probably related to the structural evolution of these materials corresponding to a decrease of the crystal parameter [fr

Creep properties of EB welded joint on Hastelloy X

International Nuclear Information System (INIS)

Arata, Yoshiaki; Susei, Shuzo; Shimizu, Shigeki; Satoh, Keisuke; Nagai, Hiroyoshi.

1980-01-01

In order to clarify the creep properties of EB welds on Hastelloy X which is one of the candidate alloys for components of VHTR, creep tests on EB weld metal and welded joint were carried out. The results were discussed in comparison with those of base metal and TIG welds. Further, EB welds were evaluated from the standpoint of high temperature structural design. The results obtained are summarized as follows. 1) Both creep rupture strengths of EB weld metal and EB welded joint are almost equal to that of base metal, but those of TIG welds are lower than base metal. As for the secondary creep rate, EB weld metal is higher and TIG weld metal is lower than base metal. As for the time to onset of tertiary creep, no remarkable difference among base metal, EB weld metal and TIG weld metal is observed. 2) In case of EB weld metal, although anisotropy is slightly observed, the ductility is same or more as compared with base metal. In case of TIG weld metal, on the contrary, anisotropy is not observed and the ductility is essentially low. 3) Such rupture morphology of EB weld metal as appears to have resulted from interconnection of voids which occurred at grain boundary is similar to base metal. In case of TIG weld metal, however, many cracks with sharp tips are observed at grain boundary, and the rupture appears to have occurred in brittle by propagation and connection of the cracks. 4) It can be said from the standpoint of high temperature structural design that EB welding is very suitable to welding for structure where creep effects are significant, because both of the creep ductility and the rupture strength are almost equal to those of base metal. (author)

Weldability of the superalloys Haynes 188 and Hastelloy X by Nd:YAG

Directory of Open Access Journals (Sweden)

Graneix Jérémie

2014-01-01

Full Text Available The requirements for welded aircraft parts have become increasingly severe, especially in terms of the reproducibility of the geometry and metallurgical grade of the weld bead. Laser welding is a viable method of assembly to meet these new demands, because of automation, to replace the manual TIG welding process. The purpose of this study is to determine the weldability of Hastelloy X and Haynes 188 alloys by the butt welding process with a Nd:YAG laser. To identify the influential parameters of the welding process (laser power, feed rate, focal diameter and flow of gas while streamlining testing, an experimental design was established with the CORICO software using the graphic correlation method. The position of the focal point was fixed at 1/3 of the thickness of the sheet. The gas flow rate and the power of the beam have a major effect on the mechanical properties and geometry of the weld. The strength of the weld is comparable to that of the base metal. However, there is a significant decrease in the elongation at break of approximately 30%. The first observations of the cross section of the weld by scanning electron microscopy coupled with EBSD analysis show a molten zone presenting dendritic large grains compared to the equiaxed grains of the base metals without a heat affected zone.

Influence of the brazing parameters on microstructure and mechanical properties of brazed joints of Hastelloy B2 nickel base alloy; Influencia de los parametros de soldeo fuerte en la microestructura y propiedades mecanicas de la union de la aleacion base niquel Hastelloy B2

Energy Technology Data Exchange (ETDEWEB)

Sotelo, J. C.; Gonzalez, M.; Porto, E.

2014-07-01

A study of the high vacuum brazing process of solid solution strengthened Hastelloy B2 nickel alloy has been done. A first stage of research has focused on the selection of the most appropriate brazing filler metal to the base material and vacuum furnace brazing process. The influence of welding parameters on joint microstructure constituents, relating the microstructure of the joint to its mechanical properties, has been evaluated. Two gaps of 50 and 200 micrometers, and two dwell times at brazing temperature of 10 and 90 minutes were studied. The braze joint mainly consists of the nickel rich matrix, nickel silicide and ternary compounds. Finally, the results of this study have shown the high bond strength for small gaps and increased dwell times of 90 minutes. (Author)

Corrosion of Inconel-625, Hastelloy-X280 and Incoloy-800 in 550 - 750°C superheated steam. Influence of alloy heat treatment, surface treatment, steam temperature and steam velocity. Part I: Results up to 6000 hours exposure time. RCN Report

International Nuclear Information System (INIS)

Tilborg, P.J. van; Linde, A. van der

1969-10-01

Sheet samples of Inconel-625, Hastelloy-X280 and Incoloy-800 were tested, in the solution annealed and in the solution annealed + 20% cold worked + 800°C tempered condition, in steam with a velocity of 5 m/sec. at 550, 650 and 750°C and in steam with a volocity of 15 and 85 m/sec. at 550°C. At 550°C and 750°C the samples were tested in the heat treated, annealed or tempered and the heat treated + electropolished condition. At 650°C moreover as heat treated + ground and pickled samples were tested. Post-corrosion sample investigations involved measurement of the adherent oxide thickness, the total amount of corroded metal, the metal loss to system, and the metallographic and microprobe investigation of the adherent oxide film and adjacent diffusion disturbed alloy layer. The results obtained up to 6000 hours exposure time showed that the surface treatment has a decisive influence on the corrosion behaviour of all three alloys tested. The differences in the corrosion data for the two heat treatment conditions are small. The influence of the steam velocity, as tested at 550°C, on the initial corrosion rate was surprisingly high, while the long-term linear corrosion rates are only slightly influenced by the gas velocity. In general the linear corrosion rates were low, 1-5 mg/dm 2 month, and not consistently affected by the test-temperature. The metal loss to system values were 2 <15 mg/dm 2 in the low velocity steam at all three test temperatures and <30 mg/dm 2 in the high velocity steam at 550°C. The metallographic and microprobe examinations revealed no remarkable results, as compared with the results of analogous tests reported in literature. (author)

Evaluation of candidate alloys for the construction of metal flex hoses in the STS launch environment

Science.gov (United States)

Ontiveros, Cordelia

1988-01-01

Various vacuum jacketed cryogenic supply lines at the Shuttle launch site use convoluted flexible expansion joints. The atmosphere at the launch site has a very high salt content, and during a launch, fuel combustion products include hydrochloric acid. This extremely corrosive environment has caused pitting corrosion failure in the flex hoses, which were made of 304L stainless steel. A search was done to find a more corrosion resistant replacement material. This study focused on 19 metal alloys. Tests which were performed include electrochemical corrosion testing, accelerated corrosion testing in a salt fog chamber, long term exposure at the beach corrosion testing site, and pitting corrosion tests in ferric chloride solution. Based on the results of these tests, the most corrosion resistant alloys were found to be (in order) Hastelloy C-22, Inconel 625, Hastelloy C-276, Hastelloy C-4, and Inco Alloy G-3. Of these top five alloys, the Hastelloy C-22 stands out as being the best of those tested for this application.

Mechanical characterization of metallic materials for high-temperature gas-cooled reactors in air and in helium environments

International Nuclear Information System (INIS)

Sainfort, G.; Cappelaere, M.; Gregoire, J.; Sannier, J.

1984-01-01

In the French R and D program for high-temperature gas-cooled reactors (HTGRs), three metallic alloys were studied: steel Chromesco-3 with 2.25% chromium, alloy 800H, and Hastelloy-X. The Chromesco-3 and alloy 800H creep behavior is the same in air and in HTGR atmosphere (helium). The tensile tests of Hastelloy-X specimens reveal that aging has embrittlement and hardening effects up to 700 0 C, but the creep tests at 800 0 C show opposite effects. This particular behavior could be due to induced precipitation by aging and the depletion of hardening elements from the matrix. Tests show a low influence of cobalt content on mechanical properties of Hastelloy-X

Material design data of 2.25Cr-1Mo steel and hastelloy-x for the experimental multi-purpose very-high temperature gas-cooled reactor

International Nuclear Information System (INIS)

Kodaira, Tsuneo; Suzuki, Michiaki; Uga, Takeo

1975-08-01

The preliminary structural design guidelines for the experimental multi-purpose very-high temperature gas-cooled reactor have recently been prepared. The components of the primary system operating at temperatures of creep dominant range are grouped in those of pressure and temperature boundaries respectively. In the material selection, 2 1/4Cr-1Mo steel is chosen for the former and Hastelloy-X for the latter taking into account of material properties at operating temperature. Deriving from the literature in the field, material design data of the alloys are established in design forms such as Sy, So, Sm, St, 100% of minimum stress to rupture, design fatigue curves, isochronous stress-strain curves, creep-fatigue interaction damage factor and so on, which are defined in ASME Code Section III, Code Case 1592. (auth.)

Compatibility of heat resistant alloys with boron carbide, (4)

International Nuclear Information System (INIS)

Baba, Sinichi; Saruta, Toru; Ooka, Kiichi; Tanaka, Isao; Aoyama, Isao

1985-07-01

This paper relates to the compatibility test of control rod sheath (Hastelloy XR alloy) and neutron absorber (boronated graphite) for the VHTR, which has been researched and developed by JAERI. The irradiation was conducted by using the OGL-1 irradiation facility in the JMTR in order to study reaction behaviour between Hastelloy XR alloy and boronated graphite as well as to determine a reaction barrier performance of refractory metal foils Nb, Mo, W and Re. Irradiation conditions were as follows. Neutron dose : 4.05 x 10 22 m -2 (E 18 m -2 (E > 0.16 pJ, 1 Mev). Helium coolant : Average temperature 855 0 C, Pressure 2.94 MPa, Total impurity concentration 400 kBq/m 3 . Irradiation time : 5.0 Ms (1390 hours). Post-irradiation examinations i.e. visual inspection, dimensional inspection, weight measurement, metallography, hardness test, morphological observations by SEM and analysis of element distributions by EPMA were carried out. In the result, reaction products of Hastelloy XR alloy were observed in the ellipsoidal form locally. These results were same as those of the out-of-pile tests. Obvious irradiation effects were not detectable but a little accelarated increase in reaction depth of Hastelloy XR alloy by heat effect of specimens was observed. The refractory metal foils had a good performance of reaction barrier between Hastelloy XR alloy and boronated graphite. Furthermore, movement of Ni, Fe and Cr in the reaction area of Hastelloy XR alloy, difference in the reaction depth of B and C, irradiation effects on diffusion coefficient, lithium production and heat effect are discussed. (author)

A life evaluation under creep-fatigue-environment interaction of Ni-base wrought alloys

International Nuclear Information System (INIS)

Hattori, Hiroshi; Kitagawa, Masaki; Ohtomo, Akira; Itoh, Mitsuyoshi

1986-01-01

In order to determine a failure criteria under cyclic loading and affective environment for HTGR systems, a series of strain controlled low-cycle fatigue tests were carried out at HTGR maximum gas temperatures in air, in vacuum and in HTGR helium environments on two nickel-base wrought alloys, namely Inconel 617 and Hastelloy XR. This paper first describes the creep-fatigue-environment properties of these alloys followed by a proposal of an evaluation method of creep-fatigue-environment interaction based on the experimental data to define the more reasonable design criteria, which is a modification of the linear damage summation rule. Second, the creep-fatigue properties of Hastelloy XR at 900 deg C and the result evaluated by this proposed method are shown. This criterion is successfully applied to the life prediction at 900 deg C. In addition, the creep-fatigue properties of Hastelloy XR-II are discussed. (author)

Compatibility of graphite with a martensitic-ferritic steel, an austenitic stainless steel and a Ni-base alloy up to 1250 C

International Nuclear Information System (INIS)

Hofmann, P.

1994-08-01

To study the chemical interactions between graphite and a martensitic-ferritic steel (1.4914), an austenitic stainless steel (1.4919; AISI 316), and a Ni-base alloy (Hastelloy X) isothermal reaction experiments were performed in the temperature range between 900 and 1250 C. At higher temperatures a rapid and complete liquefaction of the components occurred as a result of eutectic interactions. The chemical interactions are diffusion-controlled processes and can be described by parabolic rate laws. The reaction behavior of the two steels is very similar. The chemical interactions of the steels with graphite are much faster above 1100 C than those for the Ni-base alloy. Below 1000 C the effect is opposite. (orig.) [de

Corrosion behaviour of container materials for the disposal of high-level wastes in rock salt formations

International Nuclear Information System (INIS)

Smailos, E.; Schwarzkopf, W.; Koester, R.

1986-01-01

In 1983-84 extensive laboratory-scale experiments (immersion tests) to evaluate the long-term corrosion behaviour of selected materials in salt brines and first in situ experiments were performed. In the laboratory experiments the materials Ti 99.8-Pd, Hastelloy C4 and hot-rolled low carbon steel (reference materials in the joint European corrosion programme) as well as cast steel, spheoroidal cast iron, Si-cast iron and the Ni-Resists type D2 and D4 were investigated. The investigated parameters were: temperature (90 0 C; 170 0 C, 200 0 C), gamma-radiation (10 5 rad/h) and different compositions of salt brines. The results obtained show that, in addition to Ti 99.8-Pd, also Hastelloy C4 and unalloyed steels are in principle suitable for being used for long-term stable HLW-containers if the gamma dose rate is reduced by suitable shielding. Furthermore, the susceptibility of Hastelloy C4 to crevice corrosion must be taken into account. Further studies will be necessary to provide final evidence of the suitability of the materials examined. These will mainly involve clarification of questions related to hydrogen embrittlement (Ti 99.8-Pd, unalloyed steels) and to the influence of pressure and saline impurities (e.g. antiJ, antiBr) on corrosion

Analyzing the effect of cutting parameters on surface roughness and tool wear when machining nickel based hastelloy - 276

International Nuclear Information System (INIS)

Khidhir, Basim A; Mohamed, Bashir

2011-01-01

Machining parameters has an important factor on tool wear and surface finish, for that the manufacturers need to obtain optimal operating parameters with a minimum set of experiments as well as minimizing the simulations in order to reduce machining set up costs. The cutting speed is one of the most important cutting parameter to evaluate, it clearly most influences on one hand, tool life, tool stability, and cutting process quality, and on the other hand controls production flow. Due to more demanding manufacturing systems, the requirements for reliable technological information have increased. For a reliable analysis in cutting, the cutting zone (tip insert-workpiece-chip system) as the mechanics of cutting in this area are very complicated, the chip is formed in the shear plane (entrance the shear zone) and is shape in the sliding plane. The temperature contributed in the primary shear, chamfer and sticking, sliding zones are expressed as a function of unknown shear angle on the rake face and temperature modified flow stress in each zone. The experiments were carried out on a CNC lathe and surface finish and tool tip wear are measured in process. Machining experiments are conducted. Reasonable agreement is observed under turning with high depth of cut. Results of this research help to guide the design of new cutting tool materials and the studies on evaluation of machining parameters to further advance the productivity of nickel based alloy Hastelloy - 276 machining.

Design and qualification testing of a strontium-90 fluoride heat source

International Nuclear Information System (INIS)

Fullam, H.T.

1981-12-01

The Strontium Heat Source Development Program began at the Pacific Northwest Laboratory (PNL) in 1972 and is scheduled to be completed by the end of FY-1981. The program is currently funded by the US Department of Energy (DOE) By-Product Utilization Program. The primary objective of the program has been to develop the data and technology required to permit the licensing of power systems for terrestrial applications that utilize 90 SrF 2 -fueled radioisotope heat sources. A secondary objective of the program has been to design and qualification-test a general purpose 90 SrF 2 -fueled heat source. The effort expended in the design and testing of the heat source is described. Detailed information is included on: heat source design, licensing requirements, and qualification test requirements; the qualification test procedures; and the fabrication and testing of capsules of various materials. The results obtained in the qualification tests show that the outer capsule design proposed for the 90 SrF 2 heat source is capable of meeting current licensing requirements when Hastelloy S is used as the outer capsule material. The data also indicate that an outer capsule of Hastelloy C-4 would probably also meet licensing requirements, although Hastelloy S is the preferred material. Therefore, based on the results of this study, the general purpose 90 SrF 2 heat source will consist of a standard WESF Hastelloy C-276 inner capsule filled with 90 SrF 2 and a Hastelloy S outer capsule having a 2.375-in. inner diameter and 0.500-in. wall thickness. The end closures for this study, the general purpose 90 SrF 2 heat a Hastelloy S outer capsule having a 2.375-in. inner diameter and 0.500-in. wall thickness. The end closures for the outer capsule will utilize an interlocking joint design requiring a 0.1-in. penetration closure weld

Creep rupture behavior of candidate materials for nuclear process heat applications

International Nuclear Information System (INIS)

Schubert, F.; te Heesen, E.; Bruch, U.; Cook, R.; Diehl, H.; Ennis, P.J.; Jakobeit, W.; Penkalla, H.J.; Ullrich, G.

1984-01-01

Creep and stress rupture properties are determined for the candidate materials to be used in hightemperature gas-cooled reactor (HTGR) components. The materials and test methods are briefly described based on experimental results of test durations of about20000 h. The medium creep strengths of the alloys Inconel-617, Hastelloy-X, Nimonic-86, Hastelloy-S, Manaurite-36X, IN-519, and Incoloy-800H are compared showing that Inconel-617 has the best creep rupture properties in the temperature range above 800 0 C. The rupture time of welded joints is in the lower range of the scatterband of the parent metal. The properties determined in different simulated HTGR atmospheres are within the scatterband of the properties obtained in air. Extrapolation methods are discussed and a modified minimum commitment method is favored

Influencia de los parámetros de soldeo fuerte en la microestructura y propiedades mecánicas de la unión de la aleación base níquel Hastelloy B2

Directory of Open Access Journals (Sweden)

Sotelo, José Carlos

2014-09-01

Full Text Available A study of the high vacuum brazing process of solid solution strengthened Hastelloy B2 nickel alloy has been done. A first stage of research has focused on the selection of the most appropriate brazing filler metal to the base material and vacuum furnace brazing process. The influence of welding parameters on joint microstructure constituents, relating the microstructure of the joint to its mechanical properties, has been evaluated. Two gaps of 50 and 200 micrometers, and two dwell times at brazing temperature of 10 and 90 minutes were studied. The braze joint mainly consists of the nickel rich matrix, nickel silicide and ternary compounds. Finally, the results of this study have shown the high bond strength for small gaps and increased dwell times of 90 minutes.Se realizó un estudio pormenorizado del proceso de soldeo fuerte en horno de alto vacío de la aleación base níquel Hastelloy B2 fortalecida por solución sólida. En una primera fase del trabajo se seleccionó el material de aporte acorde al material objeto de unión y a la fuente de calentamiento seleccionada. Posteriormente, se evaluó la influencia del gap (50 y 200 micrómetros y tiempo de permanencia a temperatura de soldeo (10 y 90 minutos sobre los microconstituyentes de la unión, relacionando la microestructura con las propiedades mecánicas de la junta. Los análisis metalográficos mostraron una unión constituida por una matriz rica en níquel, siliciuros de níquel y compuestos ternarios. Finalmente, los resultados de los ensayos mecánicos a esfuerzos cortantes mostraron una elevada resistencia para gaps de 50 micrómetros y tiempos de permanencia de 90 minutos.

Effect of a helium environment on the mechanical properties of HTGR primary system metals

International Nuclear Information System (INIS)

Chow, J.G.Y.; Soo, P.; Sabatini, R.L.

1978-01-01

Creep and high cycle fatigue tests have been carried out on Incoloy 800H and Hastelloy X in a helium environment containing 40 μ atm of H 2 O, 200 μ atm H 2 , 40 μ atm CO, 20 μ atm CH 4 and 10 μ atm CO 2 . The creep behavior of Incoloy 800H does not appear to show significant differences from that measured in air. However, the Hastelloy X at the maximum test temperature studied (871 0 C, 1600 0 F) shows behavior which is inferior. With respect to high cycle fatigue, the Incoloy 800H is weaker in the helium environment at a test temperature of 649 0 C (1200 0 F). At 760 0 C (1400 0 F) the strength in helium is higher but there is a tendency to lose strength more rapidly than for the air tests as the test time increases. Hastelloy X tested at 871 0 C (1600 0 F) also shows higher strength in helium for short test times but for extended tests the strengths in air and helium become similar. Scanning electron microprobe analyses have been carried out to correlate the strength measurements with surface oxidation characteristics and internal structural changes

Influence of heating rate on corrosion behavior of Ni-base heat resistant alloys in simulated VHTR helium environment

International Nuclear Information System (INIS)

Kurata, Yuji; Kondo, Tatsuo

1985-04-01

The influence of heating rate on corrosion and carbon transfer was studied for Ni-base heat resistant alloys exposed to simulated VHTR(very high temperature reactor) coolant environment. Special attention was focused to relationship between oxidation and carburization at early stage of exposure. Tests were conducted on two heats of Hastelloy XR with different boron(B) content and the developmental alloys, 113MA and KSN. Two kinds of heating rates, i.e. 80 0 C/min and 2 0 C/min, were employed. Corrosion tests were carried out at 900 0 C up to 500 h in JAERI Type B helium, one of the simulated VHTR primary coolant specifications. Under higher heating rate, oxidation resistance of both heats of Hastelloy XR(2.8 ppmB and 40 ppmB) were equivalent and among the best, then KSN and 113MA followed in the order. Under lower heating rate only alloy, i.e. Hastelloy XR with 2.8 ppmB, showed some deteriorated oxidation resistance while all others being unaffected by the heating rate. On the other hand the carbon transfer behavior showed strong dependence on the heating rate. In case of higher heating rate, significant carburization occured at early stage of exposure and thereafter the progress of carburization was slow in all the alloys. On the other hand only slow carburization was the case throughout the exposure in case of lower heating rate. The carburization in VHTR helium environment was interpreted as to be affected by oxide film formation in the early stage of exposure. The carbon pick-up was largest in Hastelloy XR with 40 ppmB and it was followed by Hastelloy XR with 2.8 ppmB. 113MA and KSN were carburized only slightly. The observed difference of carbon pick-up among the alloys tested was interpreted to be attributed mainly to the difference of the carbon activity, the carbide precipitation characteristics among the alloys tested. (author)

Swelling in neutron irradiated nickel-base alloys

International Nuclear Information System (INIS)

Brager, H.R.; Bell, W.L.

1972-01-01

Inconel 625, Incoloy 800 and Hastelloy X were neutron irradiated at 500 to 700 0 C. It was found that of the three alloys investigated, Inconel 625 offers the greatest swelling resistance. The superior swelling resistance of Inconel 625 relative to that of Hastelloy-X is probably related to differences in the concentrations of the minor rather than major alloy constituents, and can involve (a) enhanced recombination of defects in the Inconel 625 and (b) preferential attraction of vacancies to incoherent precipitates. (U.S.)

Creep properties of superalloys for the HTGR in impure helium environments

International Nuclear Information System (INIS)

Kawakami, H.; Nakanishi, T.

1981-01-01

This paper describes creep behaviors of two heat resistant alloys, Hastelloy X and Incoloy 800, in helium environments of the HTGR. In impure helium environments, these alloys are susceptible to carburization and oxidization. We have investigated these effects separately, and related them to the creep behaviors of the alloys. Experiments were carried out at 900 0 C both in helium and in air. Carburization results in decrease of secondary creep strain rate and delay of tertiary creep initiation. Oxidization caused decrease in tertiary creep strain rate of Hastelloy X, but did not that of Incoloy 800. Enhancement in tertiary creep strain rate of Hastelloy X in a very weakly oxidizing environment was confirmed in creep crack growth experiment using notched plate specimens. The rupture time of Hastelloy X in helium was short when compared with in air. Stress versus rupture time curves for both environments were parallel up to 5000 hours test, and a ratio of rupture stress in helium to that in air was about 0.9. In case of Incoloy 800, rupture time in helium was markedly prolonged as compared with that in air. (orig.)

Mechanical characterization of superalloys for space reactors

International Nuclear Information System (INIS)

Duchesne, J.

1989-01-01

The purpose of this work is the choice of materials usable between 600 and 900 0 C for nuclear space reactor structures. The main criterion of selection for these materials is their good creep behaviour. Consequently, macroscopic theories of creep and several extrapolation methods were described. Superalloys seem the best materials for the studied range of temperatures. Five of them, base nickel, ones unusual in nuclear industry were selected for their good mechanical properties. Three of them are industrial alloys: the first, HAYNES 230 is a recent one, HASTELLOY S and X are more standard materials. The last two, HASTELLOY XR and PYRAD 38 D are issued from special fabrications. Creep tests metallographic investigations, hardness and tensile tests were performed. A contraction of samples was observed during some creep tests under a low stress, 20MPa at 800 0 C, for HAYNES 230 and HASTELLOY X. This could be due to a structural evolution of these materials connected to a decrease of the cristalline parameter. In addition, correlations were observed between certain characteristics determined from slow tensile tests and short duration creep tests. These correlations present a large interest because, at the present time, creep tests cannot be executed on irradiated materials in our laboratories. Consequently creep behaviour of irradiated materials seem may be deduced. Further studies are needed to explain and confirm the behaviour of the most interesting materials under low stresses: HAYNES 230 and HASTELLOY XR to anticipate their behaviour in working conditions [fr

Creep properties of heat-resistant superalloys for nuclear plants in helium

International Nuclear Information System (INIS)

Shimizu, Shigeki; Satoh, Keisuke; Honda, Yoshio; Matsuda, Shozo; Murase, Hirokazu

1979-01-01

Creep properties of candidate superalloys for VHTR components in a helium environment at both temperatures of 800 0 C and 900 0 C were compared with those of the same alloys in the atmospheric condition, and the superalloys were contrasted with each other from the viewpoint of high temperature structural design. At 800 0 C, no significant effect of a helium environment on creep properties of the superalloys is observed. At 900 0 C, however, creep strength of Inconel 617, Incoloy 800 and Incoloy 807 in the helium environment decrease more than in the atmospheric environment. In Hastelloy X and Inconel 625, there is no significant difference between creep strengths in helium and those in the atmospheric condition. Concerning So and St values in helium at 900 0 C, Inconel 617 and Hastelloy X are clearly superior to other superalloys. (author)

Corrosion behaviour of selected high-level waste packaging materials under gamma irradiation and in-situ disposal conditions in rock salt

International Nuclear Information System (INIS)

Smailos, E.; Schwarzkopf, W.; Koester, R.

1988-07-01

Corrosion studies performed until now on a number of materials have shown that unalloyed steels, Hastelloy C4 and Ti 99.8-Pd are the most promising materials for a long-term resistant packaging to be used in high-level waste (HLW) canister disposal in rock salt formations. To characterize their corrosion behaviour in more detail, additional studies have been performed. The influence has been examined which is exerted by the gamma dose rate (1 Gy/h to 100 Gy/h) on the corrosion of three preselected steels and Hastelloy C4 at 90 0 C in a salt brine (Q-brine) rich in MgCl 2 , i.e., conditions relevant to accident scenarios in a repository. In addition, in-situ corrosion experiments have been carried out in the Asse salt mine at elevated temperatures (120 0 C to 210 0 C) in the absence and in the presence of a gamma radiation field of 3 x 10 2 Gy/h, within the framework of the German/US Brine Migration Test. Under the test conditions the gamma radiation did not exert a significant influence on the corrosion of the steels investigated, whereas Hastelloy C4, exposed to dose rates of 10 Gy/h and 100 Gy/h, underwent pitting and crevice corrosion (20 μm/a at the maximum).The low amounts of migrated salt brine (140 ml after 900 days) in the in-situ- experiment did not produce noticeable corrosion of the materials. (orig./RB) [de

Two different mechanisms of fatigue damage due to cyclic stress loading at 77 K for MOCVD-YBCO-coated conductors

International Nuclear Information System (INIS)

Sugano, M; Yoshida, Y; Hojo, M; Shikimachi, K; Hirano, N; Nagaya, S

2008-01-01

Tensile fatigue tests were carried out at 77 K for YBCO-coated conductors fabricated by metal-organic chemical vapor deposition (MOCVD). The S-N relationship, variation of critical current (I c ) during cyclic loading and microscopic fatigue damage were investigated. Fatigue strength at 10 6 cycles was evaluated to be σ max = 1300 MPa and 890 MPa under the stress ratios of 0.5 and 0.1. Two different mechanisms of fatigue damage, depending on the number of stress cycles to failure, were observed. In one of the fracture mechanisms, fatigue behavior is characterized by overall fracture which occurs at 10 4 -10 5 cycles. For these specimens, I c after unloading does not degrade before overall fracture. Although only shallow slip bands were found at the Ag surface, fatigue cracks were found on the Hastelloy C-276 surface of the fractured specimen. These results suggest that overall fracture due to cyclic stress was caused by fatigue of the Hastelloy substrate. In the other fracture mechanism, even though overall fracture did not occur at 10 6 cycles, a slight decrease of I c was detected after 10 5 cycles. No fatigue crack was found on the Hastelloy surface, while deep slip bands corresponding to the initial stage of fatigue crack were observed on the Ag surface. From these results, we concluded that I c degradation at a high cycle number is attributed to the fatigue of the Ag stabilizing layer

Catalytic effect of different reactor materials under subcritical water conditions: decarboxylation of cysteic acid into taurine

Science.gov (United States)

Faisal, M.

2018-03-01

In order to understand the influence of reactor materials on the catalytic effect for a particular reaction, the decomposition of cysteic acid from Ni/Fe-based alloy reactors under subcritical water conditions was examined. Experiments were carried out in three batch reactors made of Inconel 625, Hastelloy C-22 and SUS 316 over temperatures of 200 to 300 °C. The highest amount of eluted metals was found for SUS 316. The results demonstrated that reactor materials contribute to the resulting product. Under the tested conditions, cysteic acid decomposes readily with SUS 316. However, the Ni-based materials (Inconel 625 and Hastelloy C-22) show better resistance to metal elution. It was found that among the materials used in this work, SUS 316 gave the highest reaction rate constant of 0.1934 s‑1. The same results were obtained at temperatures of 260 and 300 °C. Investigation of the Arrhenius activation energy revealed that the highest activation energy was for Hastelloy C-22 (109 kJ/mol), followed by Inconel 625 (90 kJ/mol) and SUS 316 (70 kJ/mol). The decomposition rate of cysteic acid was found to follow the results for the trend of the eluted metals. Therefore, it can be concluded that the decomposition of cysteic acid was catalyzed by the elution of heavy metals from the surface of the reactor. The highest amount of taurine from the decarboxylation of cysteic acid was obtained from SUS 316.

Advanced heat exchanger development for molten salts

Energy Technology Data Exchange (ETDEWEB)

Sabharwall, Piyush, E-mail: Piyush.Sabharwall@inl.gov [Idaho National Laboratory, Idaho Falls, ID 83415 (United States); Clark, Denis; Glazoff, Michael [Idaho National Laboratory, Idaho Falls, ID 83415 (United States); Zheng, Guiqiu; Sridharan, Kumar; Anderson, Mark [University of Wisconsin, Madison (United States)

2014-12-15

Highlights: • Hastelloy N and 242, shows corrosion resistance to molten salt at nominal operating temperatures. • Both diffusion welds and sheet material in Hastelloy N were corrosion tested in at 650, 700, and 850 °C for 200, 500, and 1000 h. • Thermal gradients and galvanic couples in the molten salts enhance corrosion rates. • Corrosion rates found were typically <10 mils per year. - Abstract: This study addresses present work concerned with advanced heat exchanger development for molten salt in nuclear and non-nuclear thermal systems. The molten salt systems discussed herein use alloys, such as Hastelloy N and 242, that show good corrosion resistance in molten salt at nominal operating temperatures up to 700 °C. These alloys were diffusion welded, and the corresponding information is presented. Test specimens were prepared for exposing diffusion welds to molten salt environments. Hastelloy N and 242 were found to be weldable by diffusion welding, with ultimate tensile strengths about 90% of base metal values. Both diffusion welds and sheet material in Hastelloy N were corrosion tested in 58 mol% KF and 42 mol% ZrF{sub 4} at 650, 700, and 850 °C for 200, 500, and 1000 h. Corrosion rates were similar between welded and nonwelded materials, typically <100 μm per year after 1000 h of corrosion tests. No catastrophic corrosion was observed in the diffusion welded regions. For materials of construction, nickel-based alloys and alloys with dense nickel coatings are effectively inert to corrosion in fluorides, but not so in chlorides. Hence, additional testing of selected alloys for resistance to intergranular corrosion is needed, as is a determination of corrosion rate as a function of the type of salt impurity and alloy composition, with respect to chromium and carbon, to better define the best conditions for corrosion resistance. Also presented is the division of the nuclear reactor and high-temperature components per American Society of Mechanical

Degradation modes of nickel-base alternate waste package overpack materials

International Nuclear Information System (INIS)

Pitman, S.G.

1988-07-01

The suitability of Ti Grade 12 for waste package overpacks has been questioned because of its observed susceptibility to crevice corrosion and hydrogen-assisted crack growth. For this reason, materials have been selected for evaluation as alternatives to Ti Grade 12 for use as waste package overpacks. These alternative materials, which are based on the nickel-chromium-molybdenum (Ni-Cr-Mo) alloy system, are Inconel 625, Hastelloy C-276, and Hastelloy C-22. The degradation modes of the Ni-base alternate materials have been examined at Pacific Northwest Laboratory to determine the suitability of these materials for waste package overpack applications in a salt repository. Degradation modes investigated included general corrosion, crevice corrosion, pitting, stress-corrosion cracking, and hydrogen embrittlement

Creep properties of heat-resistant superalloys for nuclear plants in helium

International Nuclear Information System (INIS)

Shimizu, Shigeki; Satoh, Keisuke; Matsuda, Shozo; Murase, Hirokazu; Fujioka, Junzo.

1979-01-01

In order to estimate the creep and rupture strengths of candidate alloys for the intermediate heat exchanger of VHTR, creep and stress rupture tests in impure helium were conducted on Hastelloy X, Inconel 617, Inconel 625, Incoloy 800 and Incoloy 807 at 900 0 C. The results were discussed in comparison with those in air and the alloys were examined from the point of view of the elevated temperature structural design. The main results obtained are summarized as follows: (1) No appreciable decrease in creep and rupture strengths in helium as compared with those in air is observed on Hastelloy X and Inconel 625. On the contrary, the creep and rupture strengths of Inconel 617 in helium decrease slightly as compared with those in air. In the case of Incoloy 807, the creep strength to cause 1 percent total strain and that to initiate secondary creep increase remarkably in helium as compared with those in air. However, the creep strength to cause initiation of tertiary creep and the rupture strength in helium remarkably decrease as compared with those in air. (2) The order of magnitude of the S 0 value for each material in helium is as follows; Hastelloy X > Inconel 617 > Incoloy 807 > Inconel 625 > Incoloy 800 Meanwhile, that of the S sub(t) value in helium is; Inconel 617 > Hastelloy X > Incoloy 807 > Inconel 625 > Incoloy 800. (author)

Manufacture of a heat-resistant alloy with modified specifications for HTGR structural applications

International Nuclear Information System (INIS)

Sahira, K.; Kondo, T.; Takeiri, T.

1984-01-01

A method of manufacturing a nuclear grade nickel-base heat-resistant alloy in application to heliumcooled reactor primary circuit components has been developed. The Hastelloy-XR alloy, a version of Hastelloy-X, was made available by combining the basic studies of the oxidation behavior of Hastelloy-X and the improvement of manufacturing techniques. In the primary and remelting steps, the choice of appropriate processes was made by performing numerical analyses of the statistical deviation of both chemical composition and the products' mechanical properties. The feasibility of making larger electroslag remelting ingots with reasonable control of macrosegregation was examined by the calculation of a molten metal pool shape during melting. The hot workability of Hastelloy-XR was confirmed to be equivalent to that of Hastelloy-X and the importance of controlling the thermal and mechanical processes more closely was stressed in obtaining a higher level of quality assurance for the nuclear applications. The possibility of enhancing the high-temperature mechanical performance of Hastelloy-XR was suggested based on the preliminary test results with the heats manufactured with controlled boron content

Outgassing rates before, during and after bake-out for various vacuum and first wall candidate materials of a large tokamak device

International Nuclear Information System (INIS)

Yoshikawa, H.; Gomay, J.; Sugiyama, Y.; Mizuno, M.; Komiya, S.; Tazima, T.

1977-01-01

Outgassing rates of vacuum wall candidate materials; stainless steel SS-304L and YUS-170, Inconel-625 and Hastelloy-X, and first wall materials; molybdenum, pyrolytic graphite and silicon carbide are measured before, during and after a bake-out at 500 0 C. The outgassing rate from the inside wall of the cylinder made of each material is estimated from the pressure difference between before and after a calibrated orifice. The ultimate outgassing rates of SS-304L and pyrolytic graphite, and YUS-170 Inconel-625, Hastelloy-X and molybdenum are the orders of 10 -10 and 10 -11 Pa.l.s -1 cm -2 , respectively

Effect of long-term aging at 8150C on the tensile properties and microstructural stability of four cobalt- and nickel-base superalloys

International Nuclear Information System (INIS)

Hammond, J.P.

1976-08-01

Two heats of Haynes alloy 25 and one heat each of Haynes alloy 188, Hastelloy N, and Inconel 625 were tensile tested after aging for 11,000 h at 816 0 C. Yield strength, ultimate tensile strength, and elongation were determined 24, 316, 760, and 982 0 C and compared with typical properties for these materials in the solution annealed condition. Toughness values were determined for these materials from their engineering stress-strain curves. The long-term aging treatment degraded ductility and toughness at room temperature but, contrary to behavior expected for overaging, enhanced them over those for the solution annealed condition in tests at 760 0 C. The tensile properties of the aged superalloys were correlated with mode of fracture and the amounts, identity, and morphology of the precipitates. Aging substantially depleted the hardener tungsten from the matrix in the cobalt-base alloys

Corrosion of several metals in supercritical steam at 5380C

International Nuclear Information System (INIS)

McCoy, H.E.; McNabb, B.

1977-05-01

The corrosion of several iron- and nickel-base alloys in supercritical steam at 24.1 MPa (3500 psi) and 538 0 C was measured to 7.92 x 10 7 s (22,000 h). The experiments were carried out in TVA's Bull Run Steam Plant. Corrosion was measured almost entirely by weight change and visual appearance; a few samples were evaluated by more descriptive analytical techniques. The corrosion rates of low-alloy ferritic steels containing from 1.1 to 8.7 percent Cr and 0.5 to 1.0 percent Mo differed by less than a factor of 2 in steam. Several modified compositions of Hastelloy N were evaluated and found to corrode at about equivalent rates. Of the alloys studied, the lowest weight gain in 3.6 x 10 7 sec (10,000 hr) was 0.01 mg/cm 2 for Inconel 718 and the highest 10 mg/cm 2 for the low-alloy ferritic steels. 25 figures, 3 tables

Some observations on the mechanism of corrosion to be encountered in nuclear waste repositories located in tuffaceous rock

International Nuclear Information System (INIS)

Wilde, M.H.; Wilde, B.E.

1993-01-01

Potentiostatic anodic polarization studies have been conducted in a J-13 simulated nuclear waste repository environment, which was allowed to evaporate to dryness followed by rehydration prior to polarization. The behavior of Type 316L stainless steel, AISI 1020 carbon steel, Hastelloy C22 and platinum was compared with that noted previously for a non-baked simulate. The anodic dissolution characteristics of Type 316L stainless steel in environments containing 1000X Cl - J-13 depend markedly on whether the solution is merely a mixture of virgin chemicals or a mixture that has been evaporated to dryness, baked and rehydrated to the same volume. In the non-evaporated environment Type 316L stainless steel pitted severely, and in the evaporated/rehydrated environment a non-corroding type of behavior was observed along with the precipitation of a dense scale. Similar behavior was observed for Hastelloy C22. The polarization curves for carbon steel and platinum were the same as those noted for 316L and Hastelloy C22, when conducted in the evaporated/rehydrated environment. X-ray diffraction studies indicated that the scale produced in all tests conducted on evaporated/rehydrated solutions was calcium carbonate. Based on the qualitatively similar polarization characteristics of materials having such widely differing corrosion properties, it is concluded that the major factor controlling the anodic charge transfer reaction under these conditions is the formation of a calcium carbonate scale. (Author)

Materials for advanced high temperature reactors

International Nuclear Information System (INIS)

Graham, L.W.

1977-01-01

Materials are studied in advanced applications of high temperature reactors: helium gas turbine and process heat. Long term creep behavior and corrosion tests are conducted in simulated HTR helium up to 1000 deg C with impurities additions in the furnace atmosphere. Corrosion studies on AISI 321 steels at 800-1000 deg C have shown that the O 2 partial pressure is as low as 10 -24+-3 atm, Ni and Fe cannot be oxidised above about 500 and 600 deg C, Cr cease to oxidise at 800 to 900 deg C and Ti at 900 to 1000 deg C depending on alloy composition γ' strengthened superalloys must depend on a protective corrosion mechanism assisted by the presence of Ti and possibly Cr. Carburisation has been identified metallographically in several high temperature materials: Hastelloy X and M21Z. Alloy TZM appears to be inert in HTR Helium at 900 and 1000 deg C. In alloy 800 and Inconel 625 surface cracks initiation is suppressed but crack propagation is accelerated but this was not apparent in AISI steels, Hastelloy X or fine grain Inconel at 750 deg C

Creep rupture properties under varying load/temperature conditions on a nickel-base heat-resistant alloy strengthened by boron addition

International Nuclear Information System (INIS)

Tsuji, Hirokazu; Tanabe, Tatsuhiko; Nakajima, Hajime

1994-01-01

A series of constant load and temperature creep rupture tests and varying load and temperature creep rupture tests was carried out on Hastelloy XR whose boron content level is 60 mass ppm at 900 and 1000 C in order to examine the behavior of the alloy under varying load and temperature conditions. The life fraction rule completely fails in the prediction of the creep rupture life under varying load and temperature conditions though the rule shows good applicability for Hastelloy XR whose boron content level is below 10 mass ppm. The modified life fraction rule has been proposed based on the dependence of the creep rupture strength on the boron content level of the alloy. The modified rule successfully predicts the creep rupture life under the test conditions from 1000 to 900 C. The trend observed in the tests from 900 to 1000 C can be qualitatively explained by the mechanism that the oxide film which is formed during the prior exposure to 900 C plays the role of the protective barrier against the boron dissipation into the environment. (orig.)

Creep rupture properties under varying load/temperature conditions on a nickel-base heat-resistant alloy strengthened by boron addition

International Nuclear Information System (INIS)

Tsuji, Hirokazu; Nakajima, Hajime; Tanabe, Tatsuhiko.

1993-09-01

A series of constant load and temperature creep rupture tests and varying load and temperature creep rupture tests was carried out on Hastelloy XR whose boron content level is 60 mass ppm at 900 and 1000degC in order to examine the behavior of the alloy under varying load and temperature conditions. The life fraction rule completely fails in the prediction of the creep rupture life under varying load and temperature conditions though the rule shows good applicability for Hastelloy XR whose boron content level is below 10 mass ppm. The modified life fraction rule has been proposed based on the dependence of the creep rupture strength on the born content level of the alloy. The modified rule successfully predicts the creep rupture life under the test conditions from 1000degC to 900degC. The trend observed in the tests from 900degC to 1000degC can be qualitatively explained by the mechanism that the oxide film which is formed during the prior exposure to 900degC plays the role of the protective barrier against the boron dissipation into the environment. (author)

Corrosion behaviour of material no. 1. 4539 and nickel based alloys in gas waters. Korrosionsverhalten des Werkstoffs 1. 4539 und von Nickelbasis-Legierungen in Gaswaessern

Energy Technology Data Exchange (ETDEWEB)

Rolle, D [Didier Saeurebau GmbH, Koenigswinter (Germany); Buehler, H E [Didier-Werke AG, Anlagentechnik, Wiesbaden (Germany); Kalfa, H

1993-01-01

Laboratory tests with synthetic gas waters containing the gases ammonia, carbon dioxide, hydrogen sulphide and hydrogen cyanide were carried out in order to examine the influence of medium components on the corrosion of material No. 1.4539 and nickel based alloys Hastelloy C-4, C-22 and C-276. Hydrogen sulfide was identified as the decisive component for corrosion. For stainless steel corrosion rates of about 2 mm.a[sup -1] were already found at 50deg C in a critical pH-range with sulfide concentrations > 2%. As cyanide stimulates corrosion by dissolving sulfide surface layers by complexation of the iron ions, an increased material loss rate per unit area was found in the critical range with increasing cyanide concentration. The much more stable nickel based alloys only revealed considerable weight losses after being exposed in the autoclave at 100deg C. The graduation of the loss rates C-22 > C-4 > C-276 can be explained by the different contents of high grade alloy elements. The testing of nickel based alloys of the Hastelloy type and of material No. 1.4539 and 1.4571 by means of the dynamic tensile test (CERT-method) revealed no risks of stress corrosion cracking in the tested media. (orig.).

Materials performance in off-gas systems containing iodine

International Nuclear Information System (INIS)

Beavers, J.A.; Berry, W.E.; Griess, J.C.

1981-11-01

During the reprocessing of spent reactor fuel elements, iodine is released to gas streams from which it is ultimately removed by conversion to nonvolatile iodic acid. Under some conditions iodine can produce severe corrosion in off-gas lines; in this study these conditions were established. Iron- and nickel-based alloys containing more than 6% molybdenum, such as Hastelloy G (7%), Inconel 625 (9%), and Hastelloy C-276 (16%), as well as titanium and zirconium, remained free of attack under all conditions tested. When the other materials, notably the austenitic stainless steels, were exposed to gas streams containing even only low concentrations of iodine and water vapors at 25 and 40 0 C, a highly corrosive, brownish-green liquid formed on their surfaces. In the complete absence of water vapor, the iodine-containing liquid did not form and all materials remained unaffected. The liquid that formed had a low pH (usually 2 inhibited attack

Structural behaviour of a welded superalloy cylinder with internal pressure in a high temperature environment

International Nuclear Information System (INIS)

Udoguchi, T.; Nakanishi, T.

1981-01-01

Steady and cyclic creep tests with internal pressure were performed at temperatures of 800 to 1000 0 C on Hastelloy X cylinders with and without a circumferential Tungsten Inert Gas (TIG) welding technique. The creep rupture strength of the TIG welded cylinders was much lower than that of the non-welded cylinders whilst creep rupture strength reduction by the TIG technique was not observed in uniaxial creep tests. The reason for the low creep strength of welded cylinders is discussed and it is noted that the creep ductility of weld metal plays an essentially important role. In order to improve the creep strength of the TIG welded cylinder, various welding procedures with assorted weld metals were investigated. Some improvements were obtained by using welding techniques which had either Incoloy 800 or a modified Hastelloy X material as the filler metal. (U.K.)

Corrosion of nickel-base heat resistant alloys in simulated VHTR coolant helium at very high temperatures

International Nuclear Information System (INIS)

Shindo, Masami; Kondo, Tatsuo

1976-01-01

A comparative evaluation was made on three commercial nickel-base heat resistant alloys exposed to helium-base atmosphere at 1000 0 C, which contained several impurities in simulating the helium cooled very high temperature nuclear reactor (VHTR) environment. The choice of alloys was made so that the effect of elements commonly found in commercial alloys were typically examined. The corrosion in helium at 1000 0 C was characterized by the sharp selection of thermodynamically unstable elements in the oxidizing process and the resultant intergranular penetration and internal oxidation. Ni-Cr-Mo-W type solution hardened alloy such as Hastelloy-X showed comparatively good resistance. The alloy containing Al and Ti such as Inconel-617 suffered adverse effect in contrast to its good resistance to air oxidation. The alloy nominally composed only of noble elements, Ni, Fe and Mo, such as Hastelloy-B showed least apparent corrosion, while suffered internal oxidation due to small amount of active impurities commonly existing in commercial heats. The results were discussed in terms of selection and improvement of alloys for uses in VHTR and the similar systems. (auth.)

In situ corrosion studies on selected high level waste packaging materials under simulated disposal conditions in rock salt

International Nuclear Information System (INIS)

Smailos, E.; Schwarzkopf, W.; Koester, R.

1988-01-01

In order to qualify corrosion resistant materials for high level waste (HLW) packagings acting as a long-term barrier in a rock salt repository, the corrosion behavior of preselected materials is being investigated in laboratory-scale and in-situ experiments. This work reports about in-situ corrosion experiments on unalloyed steels, Ti 99.8-Pd, Hastelloy C4, and iron-base alloys, as nodular cast iron, Ni-Resist D4 and Si-cast iron, under simulated disposal conditions. The results of the investigations can be summarized as follows: (1) all materials investigated exhibited high resistance to corrosion under the conditions prevailing in the Brine Migration Test; (2) all materials and above all the materials with passivating oxide layers such as Ti 99.8-Pd and Hastelloy C4 which may corrode selectively already in the presence of minor amounts of brine had been resistant with respect to any type of local corrosion attack; the gamma-radiation of 3 · 10 2 Gy/h did not exert an influence on the corrosion behavior of the materials

Properties of super alloys for high temperature gas cooled reactor

International Nuclear Information System (INIS)

Izaki, Takashi; Nakai, Yasuo; Shimizu, Shigeki; Murakami, Takashi

1975-01-01

The existing data on the properties at high temperature in helium gas of iron base super alloys. Incoloy-800, -802 and -807, nickel base super alloys, Hastelloy-X, Inconel-600, -617 and -625, and a casting alloy HK-40 were collectively evaluated from the viewpoint of the selection of material for HTGRs. These properties include corrosion resistance, strength and toughness, weldability, tube making, formability, radioactivation, etc. Creep strength was specially studied, taking into consideration the data on the creep characteristics in the actual helium gas atmosphere. The necessity of further long run creep data is suggested. Hastelloy-X has completely stable corrosion resistance at high temperature in helium gas. Incoloy 800 and 807 and Inconel 617 are not preferable in view of corrosion resistance. The creep strength of Inconel 617 extraporated to 1,000 deg C for 100,000 hours in air was the greatest rupture strength of 0.6 kg/mm 2 in all above alloys. However, its strength in helium gas began to fall during a relatively short time, so that its creep strength must be re-evaluated in the use for long time. The radioactivation and separation of oxide film in primary construction materials came into question, Inconel 617 and Incoloy 807 showed high induced radioactivity intensity. Generally speaking, in case of nickel base alloys such as Hastelloy-X, oxide film is difficult to break away. (Iwakiri, K.)

The ''C'' family of Ni-Cr-Mo allloys' partnership with the chemical process industry: the last 70 years

International Nuclear Information System (INIS)

Agarwal, D.C.; Herda, W.R.

1997-01-01

The ''C'' family of alloys, the original being Hastelloy trademark alloy C (1930's) was an innovative optimization of Ni-Cr alloys having good resistance to oxidizing corrosive media and Ni-Mo alloys with superior resistance to reducing corrosive media. This combination resulted in the most versatile corrosion resistant alloy in the ''Ni-Cr-Mo'' alloy family, with exceptional corrosion resistance in a wide variety of severe corrosive environments typically encountered in CPI and other industries. The alloy also exhibited excellent resistance to pitting and crevice corrosion attack in low pH, high chloride oxidizing environments and had virtual immunity to chloride stress corrosion cracking. These properties allowed this alloy to serve the industrial needs for many years, although it had some limitations. The decades of the 1960's (alloy C-276), 1970's (alloy C-4), 1980's (alloy C-22 and 622) and 1990's (alloy 59, alloy 686 and alloy C-2000) saw newer alloy developments with improvements in corrosion resistance, which not only overcame the limitations of alloy C, but further expanded the horizons of applications as the needs of the CPI became more critical, severe and demanding. Today the originally alloy ''C'' of the 1930's is practically obsolete except for some usage in form of castings. This paper presents a chronology of the various corrosion resistant alloy developments during this century, with special emphasis on the last 70 years evolution in the ''C'' family of Ni-Cr-Mo alloys and their applications. (orig.)

Hot corrosion behavior of Ni-Cr-W-C alloys in impure helium gas

International Nuclear Information System (INIS)

Ohmura, Taizo; Sahira, Kensho; Sakonooka, Akihiko; Yonezawa, Noboru

1976-01-01

Influence of the minor alloy constituents such as Al, Mn and Si on the hot corrosion behavior of Ni-20Cr-20W-0.07C alloy was studied in 99.995% helium gas at 1000 0 C, comparing with that behavior of commercial Ni-base superalloys (Hastelloy X and Inconel 617). The low oxidizing potential in the impure helium gas usually causes selective oxidation of these elements and the growth of oxide whiskers on the surface of specimen at elevated temperature. The intergranular attack was caused by selective oxidation of Al, Si and Mn. The spalling of oxide film was restrained by addition of Mn and Si, providing tough spinel type oxide film on the surface and 'Keyes' on the oxide-matrix interface respectively. The amount and the morphology of the oxide whiskers depended on Si and Mn content. More than 0.29% of Si content without Mn always caused the growth of rather thinner whiskers with smooth surface, and the whiskers analyzed by electron diffraction patterns and EPMA to be Cr 2 O 3 containing Si. Mn addition changed the whiskers to thicker ones of spinel type oxide (MnCr 2 O 1 ) with rough surface. On the basis of these results, the optimum content of Al, Mn and Si to minimize the growth of whiskers, the intergranular attack and the spalling of oxide film was discussed. (auth.)

Preliminary lifetime predictions for 304 stainless steel as the LANL ABC blanket material

International Nuclear Information System (INIS)

Park, J.J.; Buksa, J.J.; Houts, M.G.; Arthur, E.D.

1997-11-01

The prediction of materials lifetime in the preconceptual Los Alamos National Laboratory (LANL) Accelerator-Based Conversion of Plutonium (ABC) is of utmost interest. Because Hastelloy N showed good corrosion resistance to the Oak Ridge National Laboratory Molten Salt Reactor Experiment fuel salt that is similar to the LANL ABC fuel salt, Hastelloy N was originally proposed for the LANL ABC blanket material. In this paper, the possibility of using 304 stainless steel as a replacement for the Hastelloy N is investigated in terms of corrosion issues and fluence-limit considerations. An attempt is made, based on the previous Fast Flux Test Facility design data, to predict the preliminary lifetime estimate of the 304 stainless steel used in the blanket region of the LANL ABC

Compatibility tests between molten salts and metal materials (2)

International Nuclear Information System (INIS)

Shiina, Yasuaki

2003-08-01

Latent heat storage technology using molten salts can reduce temperature fluctuations of heat transfer fluid by latent heat for middle and high temperature regions. This enables us to operate several heat utilization systems in cascade connected to High Temperature Gas Cooled Reactors (HTGRs) from high to low temperature range by setting the latent heat storage system after a heat utilization system to reduce thermal load after the heat utilization systems. This latent heat technology is expected to be used for effective use of heat such as equalization of electric load between night and daytime. In the application of the latent heat technology, compatibility between molten salts and metal materials is very important because molten salts are corrosive, and heat transfer pipes and vessels will contact with the molten salts. It will be necessary to prevail the latent heat storage technique that normal metal materials can be used for the pipes and vessels. However, a few studies have been reported of compatibility between molten salts and metals in middle and high temperature ranges. In this study, four molten salts, range of the melting temperature from 490degC to 800degC, are selected and five metals, high temperature and corrosion resistance steels of Alloy600, HastelloyB2, HastelloyC276, SUS310S and pure Nickel are selected for the test with the consideration of metal composition. Test was performed in an electric furnace by setting the molten salts and the metals in melting pots in an atmosphere of nitrogen. Results revealed excellent corrosion resistance of pure Nickel and comparatively low corrosion resistance of nickel base alloys such as Alloy600 and Hastelloys against Li 2 CO 3 . Corrosion resistance of SUS310S was about same as nickel based alloys. Therefore, if some amount of corrosion is permitted, SUS310S would be one of the candidate alloys for structure materials. These results will be used as reference data to select metals in latent heat technology

Hot corrosion behavior of Ni-Cr-W-C alloys in impure He gas

International Nuclear Information System (INIS)

Ohmura, Taizo; Sahira, Kensho; Sakonooka, Akihiko; Yonezawa, Noboru

1977-01-01

Influence of the minor alloy constituents such as Al, Mn and Si on the hot corrosion behavior of Ni-20Cr-20W-0.07C alloy was studied in 99.995%He gas at 1,000 0 C, in comparison with the behavior of commercial Ni-base superalloys (Hastelloy X and Inconel 617). The low oxidizing potential in the impure He gas usually causes selective oxidation of the elements described above and the growth of oxide whiskers on the surface of specimen at elevated temperatures. The intergranular attack was caused by selective oxidation of Al, Si and Mn. The spalling of oxide film was restrained by additions of Mn and Si, providing tough spinel type oxide film on the surface and 'keys' on the oxide-matrix interface respectively. The amount and morphology of the oxide whiskers depended on Si and Mn contents. Si of more than 0.29% without Mn always caused the growth of rather thinner whiskers with smooth surface, and the whiskers analyzed by electron diffraction patterns and EPMA to be Cr 2 O 3 containing Si. Mn addition changes the whiskers to thicker ones of spinel type oxide (MnCr 2 O 4 ) with rough surface. On the basis of these results, the optimum contents of Al, Mn and Si to minimize the growth of whiskers, the intergranular attack, and the spalling of oxide film were discussed. (auth.)

Abiotic nitrate and sulphate reduction by hydrogen: a comparative experimental study

International Nuclear Information System (INIS)

Truche, L.; Berger, G.; Albrecht, A.; Giffaut, E.

2010-01-01

Document available in extended abstract form only. The bituminous waste which is part of the intermediate level, long-lived waste (MAVL) is characterised, amongst others, by the coexistence of nitrates, sulphates, organic matter, native metals and hydrogen gas in the waste mixture and package. It can be considered as the most complex example that will be used to discuss redox reactions occurring in such waste mixtures. The evaluation of the redox conditions requires quantification of the amount of electron acceptors and donors and definition of the kinetics of redox reaction. The objectives of an experimental study to unravel some of these reaction complexities are: - to investigate nature and rate of sulphate and nitrate reduction by hydrogen in the presence of different catalysts (stainless steel, hastelloy, magnetite and argillite); - to compare sulphate and nitrate as electron acceptors; - to provide a mechanistic model of these reactions. It is well known that reduction of sulphate and nitrate requires high activation energies, usually supplied either by thermal processes or via bacterial and surface catalysis, of which the latter has been investigated in this study. Preliminary experiments performed at 150 deg. C and under H 2 pressure show that sulphate reduction is enhanced in the presence of magnetite, but essentially under the restricted condition of low sulphate concentration and at a pH below the Point of Zero Charge of magnetite. This suggests that sorption of sulphate contributes to the catalysed reaction (at low pH) but provided that the magnetite surface sites are not saturated with respect to aqueous sulphate (low concentration). On the contrary, nitrate reduction is observed whatever the pH and the nitrate concentration in the presence of both magnetite and hastelloy C276 (Ni, Cr, Mo, W, Fe alloy). The effect of temperature on the rate of nitrate reduction (500 ppm KNO 3 solution) is shown by comparing three different experiments conducted in

Testing and analyses of a high temperature duct for gas-cooled reactors

International Nuclear Information System (INIS)

Black, W.E.; Roberge, A.; Felten, P.; Bastien, R.

1979-01-01

A 0.6 scale model of a steam cycle gas-cooled reactor high temperature duct was tested in a closed loop helium facility. The object of the test series was to determine: 1) the thermal effects of gas permeation within the thermal barrier, 2) the plastic deformation of the metallic components, and 3) the thermal performance of the fibrous insulation. A series of tests was performed with thermal cyclings from 100 0 C to 760 0 C at 50 atmospheres until the system thermal performance had stabilized hence enabling predictions for the reactor life. Additional tests were made to assess permeation by deliberately simulating sealing weld failures thereby allowing gas flow by-pass within the primary thermal barrier. After 100 cycles the entire primary structure was found to have performed without structural failure. Due to high pressures exerted by the insulation on the cover plates and a design oversight, the thin seal sheets were unable to expand in an anticipated manner. Local buckling resulted. Pre and post test metallurgical analyses were conducted on the Hastelloy-X structures and reference specimens. The results gave evidence of aging in the form of noticeable changes in room temperature tensile and reduction in area parameters. The Hastelloy-X welds exhibited greater changes in properties due to thermal aging. The antifriction coating (Cr 3 C 2 ) performed well without spallation or excessive wear. (orig.)

Electrochemical Impedance Spectroscopy Of Metal Alloys

Science.gov (United States)

Macdowell, L. G.; Calle, L. M.

1993-01-01

Report describes use of electrochemical impedance spectroscopy (EIS) to investigate resistances of 19 alloys to corrosion under conditions similar to those of corrosive, chloride-laden seaside environment of Space Transportation System launch site. Alloys investigated: Hastelloy C-4, C-22, C-276, and B-2; Inconel(R) 600, 625, and 825; Inco(R) G-3; Monel 400; Zirconium 702; Stainless Steel 304L, 304LN, 316L, 317L, and 904L; 20Cb-3; 7Mo+N; ES2205; and Ferralium 255. Results suggest electrochemical impedance spectroscopy used to predict corrosion performances of metal alloys.

Corrosion characteristics of thermal sprayed coating of stainless alloys in chloride solution; Taishoku gokin yosha himaku no enkabutsu yoekichu ni okeru fushoku tokusei

Energy Technology Data Exchange (ETDEWEB)

Suzuki, T. [Ajinomoto Co. Inc., Tokyo (Japan); Ishikawa, K. [Tokyo Metallikon Co. Ltd., Tokyo (Japan); Kitamura, Y. [Kitamura Technical Consultant Office, Kanagawa (Japan)

1994-12-15

With an objective to develop a thermal sprayed coating of environment interruption type that can be sprayed at sites, electrochemical discussions, SEM observation, and EPMA surface analysis were performed on corrosion characteristics in chloride solution of coatings of SUS 304, 316 and Hastelloy C thermally sprayed onto test pieces made of structural steel SS400, as well as the effect of improvement in corrosion resistance by means of a coating reforming treatment. The following conclusions were obtained: the degradation in corrosion resistance of the coatings is attributable to increase in anodic solubility due to appearance of innumerable crevices as a result of deposited particles forming porous structure and due to drop of Cr content in the matrix caused by generation of oxides on the surface of the crevices, by which the corrosion progresses in the form of crevice corrosion; and denseness of the passive coating is lost on the surface of the deposited particles, accelerating the cathodic reaction. A suitable means that could be used practically in chloride solution would be a method to use a material with less crevice susceptibility such as Hastelloy C as a base material, and seal the crevice structure with epoxy resin, etc. 7 refs., 10 figs., 3 tabs.

Preparation of YBaCuO superconducting tape by RF magnetron sputtering

Energy Technology Data Exchange (ETDEWEB)

Fukutomi, Masao; Akutsu, Nakao; Tanaka, Yoshiaki; Asano, Toshihisa; Maeda, Hiroshi (National Research Inst. for Metals, Tsukuba (Japan); Mitsui Mining and Smelting Co., Ltd., Tokyo (Japan))

1989-04-01

The effect of buffer layers, conditions of film preparation, and the relation between superconducting characteristics and bombardment of high energy ions on films were discussed in an attempt to fabricate YBaCuO films on metallic substrates by sputtering. Hastelloy-X tapes and Chromel (Ni-10Cr) fine wires were used as metallic substrates, and MgO films as buffer layers, which were provided by sputtering a MgO sintered target and annealing. As a result, superconducting films were favorably obtained on the Hastelloy tapes with the MgO buffer layers, however, counter diffusion at the interface of the film and layer was unavoidable in annealing. C axis-highly oriented film with high zero resistance Tc was obtained in such an arrangement of the target and substrate as to lower the effect of 0{sup {minus}} ion resputtering, resulting in the most favorable Tc=80.4K. YBaCuO superconducting films could be also deposited on a bundle of Chromel fine wires preliminarily. 11 refs., 7 figs.

Compatibility studies of potential molten-salt breeder reactor materials in molten fluoride salts

International Nuclear Information System (INIS)

Keiser, J.R.

1977-05-01

The molten fluoride salt compatibility studies carried out during the period 1974--76 in support of the Molten-Salt Reactor Program are summarized. Thermal-convection and forced-circulation loops were used to measure the corrosion rate of selected alloys. Results confirmed the relationship of time, initial chromium concentration, and mass loss developed by previous workers. The corrosion rates of Hastelloy N and Hastelloy N modified by the addition of 1--3 wt percent Nb were well within the acceptable range for use in an MSBR. 13 figures, 3 tables

Evaluation and Control of Mechanical Degradation of Austenitic Stainless 310S Steel Substrate During Coated Superconductor Processing

Science.gov (United States)

Kim, Seung-Gyu; Kim, Najung; Shim, Hyung-Seok; Kwon, Oh Min; Kwon, Dongil

2018-05-01

The superconductor industry considers cold-rolled austenitic stainless 310S steel a less expensive substitute for Hastelloy X as a substrate for coated superconductor. However, the mechanical properties of cold-rolled 310S substrate degrade significantly in the superconductor deposition process. To overcome this, we applied hot rolling at 900 °C (or 1000 °C) to the 310S substrate. To check the property changes, a simulated annealing condition equivalent to that used in manufacturing was determined and applied. The effects of the hot rolling on the substrate were evaluated by analyzing its physical properties and texture.

Metallic materials corrosion problems in molten salt reactors

International Nuclear Information System (INIS)

Chauvin, G.; Dixmier, J.; Jarny, P.

1977-01-01

The USA forecastings concerning the molten salt reactors are reviewed (mixtures of fluorides containing the fuel, operating between 560 and 700 0 C). Corrosion problems are important in these reactors. The effects of certain characteristic factors on corrosion are analyzed: humidity and metallic impurities in the salts, temperature gradients, speed of circulation of salts, tellurium from fission products, coupling. In the molten fluorides and experimental conditions, the materials with high Ni content are particularly corrosion resistant alloys (hastelloy N). The corrosion of this material is about 2.6 mg.cm -2 at 700 0 C [fr

Corrosion behaviour of container materials for the disposal of high-level waste forms in rock salt formations

International Nuclear Information System (INIS)

Smailos, E.; Schwarzkopf, W.; Koester, R.

1987-05-01

Extensive laboratory-scale experiments to evaluate the long-term corrosion behaviour of selected materials in brines and first in situ experiments were performed. In the laboratory experiments the materials Ti 99.8-Pd, Hastelloy C4 and hot-rolled low carbon steel as well cast steel, spheroidal cast iron, Si-cast iron and the Ni-Resists type D2 and D4 were investigated. The investigated parameters were: temperature, gamma-radiation and different compositions of salt brines. (orig./PW) [de

Summary of Dissimilar Metal Joining Trials Conducted by Edison Welding Institute

Energy Technology Data Exchange (ETDEWEB)

MJ Lambert

2005-11-18

Under the direction of the NASA-Glenn Research Center, the Edison Welding Institute (EWI) in Columbus, OH performed a series of non-fusion joining experiments to determine the feasibility of joining refractory metals or refractory metal alloys to Ni-based superalloys. Results, as reported by EWI, can be found in the project report for EWI Project 48819GTH (Attachment A, at the end of this document), dated October 10, 2005. The three joining methods used in this investigation were inertia welding, magnetic pulse welding, and electro-spark deposition joining. Five materials were used in these experiments: Mo-47Re, T-111, Hastelloy X, Mar M-247 (coarse-grained, 0.5 mm to several millimeter average grain size), and Mar M-247 (fine-grained, approximately 50 {micro}m average grain size). Several iterative trials of each material combination with each joining method were performed to determine the best practice joining method. Mo-47Re was found to be joined easily to Hastelloy X via inertia welding, but inertia welding of the Mo-alloy to both Mar M-247 alloys resulted in inconsistent joint strength and large reaction layers between the two metals. T-111 was found to join well to Hastelloy X and coarse-grained Mar M-247 via inertia welding, but joining to fine-grained Mar M-247 resulted in low joint strength. Magnetic pulse welding (MPW) was only successful in joining T-111 tubing to Hastelloy X bar stock. The joint integrity and reaction layer between the metals were found to be acceptable. This single joining trial, however, caused damage to the electromagnetic concentrators used in this process. Subsequent design efforts to eliminate the problem resulted in a loss of power imparted to the accelerating work piece, and results could not be reproduced. Welding trials of Mar M-247 to T-111 resulted in catastrophic failure of the bar stock, even at lower power. Electro-spark deposition joining of Mo-47Re, in which the deposited material was Hastelloy X, did not have a

Summary of Dissimilar Metal Joining Trials Conducted by Edison Welding Institute

International Nuclear Information System (INIS)

MJ Lambert

2005-01-01

Under the direction of the NASA-Glenn Research Center, the Edison Welding Institute (EWI) in Columbus, OH performed a series of non-fusion joining experiments to determine the feasibility of joining refractory metals or refractory metal alloys to Ni-based superalloys. Results, as reported by EWI, can be found in the project report for EWI Project 48819GTH (Attachment A, at the end of this document), dated October 10, 2005. The three joining methods used in this investigation were inertia welding, magnetic pulse welding, and electro-spark deposition joining. Five materials were used in these experiments: Mo-47Re, T-111, Hastelloy X, Mar M-247 (coarse-grained, 0.5 mm to several millimeter average grain size), and Mar M-247 (fine-grained, approximately 50 (micro)m average grain size). Several iterative trials of each material combination with each joining method were performed to determine the best practice joining method. Mo-47Re was found to be joined easily to Hastelloy X via inertia welding, but inertia welding of the Mo-alloy to both Mar M-247 alloys resulted in inconsistent joint strength and large reaction layers between the two metals. T-111 was found to join well to Hastelloy X and coarse-grained Mar M-247 via inertia welding, but joining to fine-grained Mar M-247 resulted in low joint strength. Magnetic pulse welding (MPW) was only successful in joining T-111 tubing to Hastelloy X bar stock. The joint integrity and reaction layer between the metals were found to be acceptable. This single joining trial, however, caused damage to the electromagnetic concentrators used in this process. Subsequent design efforts to eliminate the problem resulted in a loss of power imparted to the accelerating work piece, and results could not be reproduced. Welding trials of Mar M-247 to T-111 resulted in catastrophic failure of the bar stock, even at lower power. Electro-spark deposition joining of Mo-47Re, in which the deposited material was Hastelloy X, did not have a

In-situ corrosion studies on selected high-level waste packaging materials under simulated disposal conditions in rock salt formations

International Nuclear Information System (INIS)

Schwarzkopf, W.; Smailos, E.; Koester, R.

1988-01-01

This work reports about in situ corrosion experiments on unalloyed steels, Ti 99,8-Pd, Hastelloy C4, and iron-base alloys, as modular cast iron, Ni-Resist D4 and Si-cast iron, under simulated disposal conditions. The experiments were carried out in the frame of the German/US Brine Migration Test in heated tubed boreholes in the Asse salt mine at T = 150 0 C to 210 0 C, both in the absence and in the presence of a γ-radiation field of 3x10 2 Gy/h (Co-60 source). In addition, the material used to protect the tubing from corrosion (Inconel 600) as well as the backfill material for the annular gap (Al 2 O 3 spheres) were investigated for possible corrosion attack. All materials investigate exhibited high resistance to corrosion under the conditions prevailing in the Brine Migration Test. All material specimens corroded at much lower rates than determined in the previous laboratory-scale tests. All materials and above all the materials with passivating oxide layers such as Ti 99.8-Pd and Hastelloy C4 which may corrode selectively already in the presence of minor amounts of brine had been resistant with respect to any type of local corrosion attack. The γ-radiation of 3x10 2 Gy/h did not exert an influence on the corrosion behaviour of the materials. No corrosion attacks were observed on the Al 2 O 3 spheres. In the case of Inconel 600 traces of sulphur were detected probably resulting from the reaction of Ni with H 2 S to NiS. Measurable general and local corrosion, however, have not been observed. (orig./IHOE) [de

The mechanical properties of T-111 at low to intermediate temperatures

International Nuclear Information System (INIS)

McCoy, H.E.; DiStefano, J.R.

1997-01-01

In the design of the 60-W Isotopic Heat Source (IHS), a tantalum alloy (T-111) strength member serves as the primary containment shell for the IHS during operation (He-gas internal environment and inert gas or vacuum external environment). An outer Hastelloy S clad is used to protect the T-111 from oxidation, and both the Hastelloy S clad and the T-111 strength member are sealed by automatic gas tungsten arc (GTA) welding. The expected life of the IHS is 5 years at about 650 C preceded by up to 5 years of storage at approximately 300 C. For this application, one important concern is failure of the T-111 strength member due to capsule pressurization arising from helium generation as a fuel decay product. To provide specific data on the mechanical behavior of base and solid metal T-111 under conditions appropriate to the IHS use conditions, a testing program was formulated and carried out. Three types of mechanical tests were conducted. Tensile properties were measured over the temperature range of 25 to 1100 C on T-111 base metal and samples with either longitudinal or transverse autogenous welds. Creep tests on base metal and samples with transverse welds were run to failure over the temperature range of 1100 to 850 C. Creep tests were also run on several transverse weld samples over the temperature range of 500 to 900 C at stresses where failure did not occur, and the creep rates were measured. Two prototypical capsules of the T-111 strength member were fabricated by EG and G Mound Applied Technologies (Mound Laboratories). To verify the mechanical properties design data developed above, these were tested to failure (leak) in a vacuum chamber with the inside of the capsule pressurized by either argon or helium

Effect of carburizing helium environment on creep behavior of Ni-base heat-resistant alloys for high-temperature gas-cooled reactors

International Nuclear Information System (INIS)

Kurata, Yuji; Ogawa, Yutaka; Nakajima, Hajime

1988-01-01

Creep tests were conducted on Ni-base heat-resistant alloys Hastelloy XR and XR-II, i.e. versions of Hastelloy X modified for nuclear applications, at 950degC using four types of helium environment with different impurity compositions, and mainly the effect of carburization was examined. For all the materials tested, the values of creep rupture time obtained under the carburizing conditions were similar to or longer than those in the commonly used, standard test environment (JAERI Type B helium). The difference among the results was interpreted by the counterbalancing effects of the strengthening due to carburization and possible weakening caused under very low oxidizing potential. In the corrosion monitoring specimens pronounced carbon pick-up was observed in the environment with high carbon activity and very low oxidizing potential. Based on the results obtained in the present and the previous works, it is suggested that a moderate control of the impurity chemistry is important rather than simple purification of the coolant in protecting the material from the environment-enhanced degradation. Either condition with high or low extremes in the oxidizing and carburizing potentials may cause enhanced degradation and thus are desirable to be avoided at the elevated temperatures. (author)

Corrosion studies and recommendation of alloys for an incinerator of glove-boxes wastes

International Nuclear Information System (INIS)

Devisme, F.; Garnier, M.H.

1992-01-01

In the framework of the development of an incineration process for high chlorinated wastes, commercial alloys have been investigated by means of parametric laboratory tests in HCl containing gas mixtures and also in field tests. Recommendations may be formulated for the three main components i.e. pyrolyser, calciner and cooler. In very low oxygen-potential atmospheres, the alloys Hastelloy C276 and Inconel 625 present the best behaviours. For the calciner, alloy Inconel 601 is more satisfactory than AISI 310 steel. As for the cooler, only the alloy Haynes 214 appears acceptable at 1100 deg C. Because of the very low stress level affecting the components, thermomechanical properties do not modify these recommendations based on corrosion behaviour

Effect of glass-ceramic-processing cycle on the metallurgical properties of candidate alloys for actuator housings

Energy Technology Data Exchange (ETDEWEB)

Weirick, L.J.

1982-01-01

This report summarizes the results from an investigation on the effect of a glass ceramic processing cycle on the metallurgical properties of metal candidates for actuator housings. The cycle consists of a 980/sup 0/C sealing step, a 650/sup 0/C crystallization step and a 475/sup 0/C annealing step. These temperatue excursions are within the same temperature regime as annealing and heat treating processes normally employed for metals. Therefore, the effect of the processing cycle on metallurgical properties of microstructure, strength, hardness and ductility were examined. It was found that metal candidates which are single phase or solid solution alloys (such as 21-6-9, Hastelloy C-276 and Inconel 625) were not affected whereas multiphase or precipitation hardened alloys (such as Inconel 718 and Titanium ..beta..-C) were changed by the processing cycle for the glass ceramic.

Modeling and experimental study of oil/water contact angle on biomimetic micro-parallel-patterned self-cleaning surfaces of selected alloys used in water industry

Energy Technology Data Exchange (ETDEWEB)

Nickelsen, Simin; Moghadam, Afsaneh Dorri, E-mail: afsaneh@uwm.edu; Ferguson, J.B.; Rohatgi, Pradeep

2015-10-30

Graphical abstract: - Highlights: • Wetting behavior of four metallic materials as a function of surface roughness has been studied. • A model to predict the abrasive particle size and water/oil contact angles relationship is proposed. • Active wetting regime is determined in different materials using the proposed model. - Abstract: In the present study, the wetting behavior of surfaces of various common metallic materials used in the water industry including C84400 brass, commercially pure aluminum (99.0% pure), Nickle–Molybdenum alloy (Hastelloy C22), and 316 Stainless Steel prepared by mechanical abrasion and contact angles of several materials after mechanical abrasion were measured. A model to estimate roughness factor, R{sub f}, and fraction of solid/oil interface, ƒ{sub so}, for surfaces prepared by mechanical abrasion is proposed based on the assumption that abrasive particles acting on a metallic surface would result in scratches parallel to each other and each scratch would have a semi-round cross-section. The model geometrically describes the relation between sandpaper particle size and water/oil contact angle predicted by both the Wenzel and Cassie–Baxter contact type, which can then be used for comparison with experimental data to find which regime is active. Results show that brass and Hastelloy followed Cassie–Baxter behavior, aluminum followed Wenzel behavior and stainless steel exhibited a transition from Wenzel to Cassie–Baxter. Microstructural studies have also been done to rule out effects beyond the Wenzel and Cassie–Baxter theories such as size of structural details.

Materials for advanced high temperature reactors

International Nuclear Information System (INIS)

Graham, L.W.

1976-01-01

The results recently obtained from the Dragon program are presented to illustrate materials behavior: (a) effect of temperature on oxidation and carburisation in HTR helium (variation in oxide depth and in C content of AISI 321 after 5000 hours in HTR helium; effect of temperature on surface scale formation in the γ' strengthened alloys Nimonic 80A and 713LC); (b) effect of alloy composition on oxidation and carburisation behavior (influence of Nb and Ti on the corrosion of austenitic steels; influence of Ti and Al in IN-102; weight gain of cast high Ni alloys); (c) effect of environment on creep strength (results of tests for hastelloy X, grade I inconel 625, grade II inconel 625 and inconel 617 in He and air between 750 and 800 0 C)

Susceptibility to Stress Corrosion Cracking of 254SMO SS

Directory of Open Access Journals (Sweden)

De Micheli Lorenzo

2002-01-01

Full Text Available The susceptibility to stress corrosion cracking (SCC of solubilized and sensitized 254SMO SS was studied in sodium chloride, and sodium fluoride solutions at 80 °C and sulfuric acid solutions in presence of sodium chloride at 25 °C. The influence of salt concentration, pH values and the addition of thiosulfate was examined. The susceptibility to SCC was evaluated by Slow Strain Rate Tests (SSRT, at 1.5 x 10-6 s-1 strain rate. The behavior of 254SMO was compared to those of AISI 316L SS and Hastelloy C276. 254SMO showed an excellent resistance to SCC in all conditions, except in the more acidic solutions (pH <= 1 where, in the sensitized conditions, intergranular stress corrosion cracking occurred.

Stress Corrosion Evaluation of Various Metallic Materials for the International Space Station Water Recycling System

Science.gov (United States)

Torres, P. D.

2015-01-01

A stress corrosion evaluation was performed on Inconel 625, Hastelloy C276, titanium commercially pure (TiCP), Ti-6Al-4V, Ti-6Al-4V extra low interstitial, and Cronidur 30 steel as a consequence of a change in formulation of the pretreatment for processing the urine in the International Space Station Environmental Control and Life Support System Urine Processing Assembly from a sulfuric acid-based to a phosphoric acid-based solution. The first five listed were found resistant to stress corrosion in the pretreatment and brine. However, some of the Cronidur 30 specimens experienced reduction in load-carrying ability.

In-plane aligned YBCO film on textured YSZ buffer layer deposited on NiCr alloy tape by laser ablation with only O+ ion beam assistance

International Nuclear Information System (INIS)

Xin Tang Huang

2000-01-01

High critical current density and in-plane aligned YBa 2 Cu 3 O 7-x (YBCO) film on a textured yttria-stabilized zirconia (YSZ) buffer layer deposited on NiCr alloy (Hastelloy c-275) tape by laser ablation with only O + ion beam assistance was fabricated. The values of the x-ray phi-scan full width at half-maximum (FWHM) for YSZ(202) and YBCO(103) are 18 deg. and 11 deg., respectively. The critical current density of YBCO film is 7.9 x 105 A cm -2 at liquid nitrogen temperature and zero field, and its critical temperature is 90 K. (author)

Superalloy applications in the nuclear field

International Nuclear Information System (INIS)

Ramanathan, L.V.; Padilha, A.F.

1984-01-01

The process conditions in the areas of nuclear fuel processing, fabrication, utilization, reprocessing and disposal are severe, demanding therefore the use of materials with high temperature mechanical strength and corrosion resistance. A number of refractory metal containing superalloys have found application in the diferrent areas of the nuclear field. The main aspects of the microstructure, strengthening mechanisms and corrosion resistance of 3 superalloys, namely Incoloy 825, Inconel 718 and Hastelloy C have been discussed. The role of the refractory metal elements in influencing the mechanical strength and corrosion resistance of superalloys has been emphasised. (Author) [pt

Development of Textured Buffer Layer on Metal Tapes for Oxide Superconductors

National Research Council Canada - National Science Library

Bhattacharya, Rabi

2002-01-01

.... UES, in collaboration with Argonne National Laboratory, has developed a multilayer architecture based on in-plane textured MgO film by inclined substrate deposition technique oristatic and moving Hastelloy substrates...

Time-dependent high-temperature low-cycle fatigue behavior of nickel-base heat-resistant alloys for HTGR

International Nuclear Information System (INIS)

Tsuji, Hirokazu; Kondo, Tatsuo

1988-06-01

A series of strain controlled low-cycle fatigue tests at 900 deg C in the simulated HTGR helium environment were conducted on Hastelloy X and its modified version, Hastelloy XR in order to examine time-dependent high-temperature low-cycle fatigue behavior. In the tests with the symmetric triangular strain waveform, decreasing the strain rate led to notable reductions in the fatigue life. In the tests with the trapezoidal strain waveform with different holding types, the fatigue life was found to be reduced most effectively in tensile hold-time experiments. Based on the observations of the crack morphology the strain holding in the compressive side was suggested to play the role of suppressing the initiation and the growth of internal cracks or cavities, and to cause crack branching. When the frequency modified fatigue life method and/or the prediction of life by use of the ductility were applied, both the data obtained with the symmetric triangular strain waveform and those with the tensile hold-time experiments lay on the straight line plots. The data, however, obtained with the compressive and/or both hold-time experiments could not be handled satisfactorily by those methods. When the cumulative damage rule was applied, it was found that the reliability of HTGR components was ensured by limiting the creep-fatigue damage fraction within the value of 1. (author)

Development of corrosion and wear resistant coatings by an improved HVOF spraying process

Energy Technology Data Exchange (ETDEWEB)

Ishikawa, Y.; Kawakita, J.; Kuroda, S. [National Inst. for Materials Science, Tsukuba (Japan)

2005-07-01

We have developed an improved HVOF spray process called ''Gas-shrouded HVOF'' (GS-HVOF) over the past several years. By using an extension nozzle at the exit of a commercial HVOF spray gun, GS-HVOF is capable of controlling the oxidation of sprayed materials during flight as well as achieving higher velocity of sprayed particles. These features result in extremely dense and clean microstructure of the sprayed coatings. The process has been successfully applied to corrosion resistant alloys such as SUS316L, Hastelloy C, and alloy 625 as well as cermets such as WC-Cr{sub 3}C{sub 2}-Ni. The spray process, coatings microstructure and property evaluation will be discussed with potential industrial applications in the near future. (orig.)

The performance of electroless nickel deposits in oil-field environments

International Nuclear Information System (INIS)

Mack, R.; Bayes, M.

1984-01-01

An experimental study was conducted on an electroless nickel plated (represented by Enplate NI-422) C-90 steel, uncoated C-90 steel, AISI 420, 174 PH, SAF 2205, and HASTELLOY /sup R/ G-3 to determine their corrosion-performance in twelve simulated downhole oil or gas production environments during 28 day exposures. These environments were aqueous brines containing various concentrations of Cl - , H 2 S and/or CO 2 , and over a range of temperatures. The results from this study and oilfield data for electroless nickel plated low alloy steels are presented and discussed. The study demonstrates the feasibility of electroless nickel coated low alloy steels as an economical substitute for some highly alloyed materials in certain oilfield applications; the field data support this

Examination of several pre-oxidation procedures and their effect as hydrogen permeation-barrier

International Nuclear Information System (INIS)

Heimes, E.

1986-03-01

Several pre-oxidation procedures have been tested with respect to their effect as a hydrogen permeation barrier at the high temperature alloys Hastelloy X and Inconel 617. By outside coating of Hastelloy X samples with alumina the determined impeding effects were very low. A surface aluminium enrichment by different procedures were accomplished before selective oxidation. The method of Aluminium-Hot-Dipping generated oxide layers with a four- to fivefold higher impeding effect compared to specimens fabricated by a standard procedure. With the aid of a metallographical follow-up examination it was shown that the higher impeding effects are due to an improved adhesion between the oxide layer and the high temperature material, whereby in the cooling period after manufacturing a smaller amount of oxide cracking is obtainable. (orig./PW) [de

Development of temperature statistical model when machining of aerospace alloy materials

Directory of Open Access Journals (Sweden)

Kadirgama Kumaran

2014-01-01

Full Text Available This paper presents to develop first-order models for predicting the cutting temperature for end-milling operation of Hastelloy C-22HS by using four different coated carbide cutting tools and two different cutting environments. The first-order equations of cutting temperature are developed using the response surface methodology (RSM. The cutting variables are cutting speed, feed rate, and axial depth. The analyses are carried out with the aid of the statistical software package. It can be seen that the model is suitable to predict the longitudinal component of the cutting temperature close to those readings recorded experimentally with a 95% confident level. The results obtained from the predictive models are also compared with results obtained from finite-element analysis (FEA. The developed first-order equations for the cutting temperature revealed that the feed rate is the most crucial factor, followed by axial depth and cutting speed. The PVD coated cutting tools perform better than the CVD-coated cutting tools in terms of cutting temperature. The cutting tools coated with TiAlN perform better compared with other cutting tools during the machining performance of Hastelloy C-22HS. It followed by TiN/TiCN/TiN and CVD coated with TiN/TiCN/Al2O3 and TiN/TiCN/TiN. From the finite-element analysis, the distribution of the cutting temperature can be discussed. High temperature appears in the lower sliding friction zone and at the cutting tip of the cutting tool. Maximum temperature is developed at the rake face some distance away from the tool nose, however, before the chip lift away.

ECLSS Sustaining Metal Materials Compatibility Final Report, Electrochemical and Crevice Corrosion Test Results

Science.gov (United States)

Lee, R. E.

2015-01-01

Electrochemical test results are presented for six noble metals evaluated in two acidic test solutions which are representative of waste liquids processed in the Environmental Control and Life Support System (ECLSS) aboard the International Space Station (ISS). The two test solutions consisted of fresh waste liquid which had been modified with a proposed or alternate pretreatment formulation and its associated brine concentrate. The six test metals included three titanium grades, (Commercially Pure, 6Al-4V alloy and 6Al-4V Low Interstitial alloy), two nickel-chromium alloys (Inconel® 625 and Hastelloy® C276), and one high tier stainless steel (Cronidur® 30).

Galvanic corrosion resistance of welded dissimilar nickel-base alloys

International Nuclear Information System (INIS)

Corbett, R.A.; Morrison, W.S.; Snyder, R.J.

1986-01-01

A program for evaluating the corrosion resistance of various dissimilar welded nickel-base alloy combinations is outlined. Alloy combinations included ALLCORR, Hastelloy C-276, Inconel 72 and Inconel 690. The GTAW welding process involved both high and minimum heat in-put conditions. Samples were evaluated in the as-welded condition, as well as after having been aged at various condtions of time and temperature. These were judged to be most representative of process upset conditions which might be expected. Corrosion testing evaluated resistance to an oxidizing acid and a severe service environment in which the alloy combinations might be used. Mechanical properties are also discussed

Effect of test temperature on tensile and fatigue properties of nickel-base heat-resistant alloys

International Nuclear Information System (INIS)

Tsuji, Hirokazu; Nakajima, Hajime

1987-01-01

A series of tensile and strain controlled low-cycle fatigue tests were conducted at temperatures ranging from RT to 900 0 C on a nickel-base heat-resistant alloy, Hastelloy XR-II, which is one of the candidate alloys for applications in the process heating high-temperature gas-cooled reactor (HTGR). Fatigue tests at room temperature and all tensile tests were conducted in air, while fatigue tests at and above 400 0 C were conducted in the simulated HTGR helium environment. In those tests the effect of test temperature on tensile and fatigue properties was investigated. The ductility minimum point was observed near 600 0 C, while tensile and fatigue strengths decreased with increasing test temperature. The fatigue lives estimated with the method proposed by Manson were compatible with the experimental results under the given conditions. For the specimens fatigued at and above 700 0 C, the percentage of the intergranular fracture mode gradually increased with increasing test temperature. (orig.)

Embrittlement of nickel-, cobalt-, and iron-base superalloys by exposure to hydrogen

Science.gov (United States)

Gray, H. R.

1975-01-01

Five nickel-base alloys (Inconel 718, Udimet 700, Rene 41, Hastelloy X, and TD-NiCr), one cobalt-base alloy (L-605), and an iron-base alloy (A-286) were exposed in hydrogen at 0.1 MN/sq m (15 psi) at several temperatures in the range from 430 to 980 C for as long as 1000 hours. These alloys were embrittled to varying degrees by such exposures in hydrogen. Embrittlement was found to be: (1) sensitive to strain rate, (2) reversible, (3) caused by large concentrations of absorbed hydrogen, and (4) not associated with any detectable microstructural changes in the alloys. These observations are consistent with a mechanism of internal reversible hydrogen embrittlement.

Corrosion testing of selected packaging materials for disposal of high-level waste glass in rock salt formations

International Nuclear Information System (INIS)

Smailos, E.; Schwarzkopf, W.; Koester, R.; Fiehn, B.; Halm, G.

1990-05-01

In previous corrosion studies performed in salt brines, unalloyed steels, Ti 99.8-Pd and Hastelloy C4 have proved to be the most promising materials for long-term resistant packagings to be used in heat-generating waste (vitrified HLW, spent fuel) disposal in rock-salt formations. To characterise the corrosion behaviour of these materials in more detail, further in-depth laboratory-scale and in-situ corrosion studies have been performed in the present study. Besides the above-mentioned materials, also some in-situ investigations of the iron-base materials Ni-Resist D2 and D4, cast iron and Si-cast iron have been carried out in order to complete the results available to date. (orig.) [de

Fabrication of three 2500-watt (thermal) strontium-90 heat sources

International Nuclear Information System (INIS)

DeVore, J.R.; Haff, K.W.; Tompkins, J.A.

1986-08-01

Three 2500-watt (thermal) heat sources were fabricated by the Oak Ridge National Laboratory (ORNL) for the purpose of fueling a 500-watt (electric) thermoelectric generator as part of the US Department of Energy's Byproducts Utilization Program (BUP). Each of the sources, which are the largest ever assembled, consist of hot-pressed pellets of 90 Sr fluoride, doubly encapsulated in three Haynes-25 inner capsules and in a Hastelloy-S outer capsule. The total 90 Sr inventory of all three sources is 1.12 million curies. The sources were fabricated at the ORNL Fission Product Development Laboratory (FPDL), which is a facility that is capable of processing multi-megacurie quantities of radioactive materials, chiefly 137 Cs and 90 Sr. The source was tested to determine compliance with all of the IAEA Safety Series No. 33 requirements. The source fabrication, assembly, and testing are described in the presentation

Neutronics analysis for HYLIFE-II

International Nuclear Information System (INIS)

Tobin, M.T.

1990-01-01

A preliminary neutronics analysis of the HYLIFE-2 reactor concept gives a tritium breeding ratio of 1.17 and a system energy multiplication factor of 1.14. Modified SS-316 (in which Mn is substituted for Ni) is superior to Hastelloy X and Hastelloy N as a firstwall material considering He generation, dpa-limited lifetime, and shallow-burial index. Since Flibe is corrosive to Mn metals, however, a favorable first-wall material is yet to be decided on. Flibe impurities considered (e.g., inherent impurities and those arising from wall erosion or secondary-coolant leakage) do not increase the hazard to the public over that of pure Flibe. The main issues for HYLIFE-2 are the high shallow-burial index (106) and the requirement to contain some 99.7% of the 18 F inventory to prevent its release to the public 18 refs., 3 figs., 9 tabs

Self-field ac losses in biaxially aligned Y endash Ba endash Cu endash O tape conductors

International Nuclear Information System (INIS)

Iijima, Y.; Hosaka, M.; Sadakata, N.; Saitoh, T.; Kohno, O.; Takeda, K.

1997-01-01

Self-field ac losses were measured by the conventional ac four-probe method in biaxially aligned Y endash Ba endash Cu endash O tapes using polycrystalline Hastelloy tapes with textured yttria-stabilized-zirconia buffer layers. The ac losses increased in proportion to the fourth power of transport current in the high J c sample, and agreed well with Norris close-quote equation for thin strip conductors. However, the low J c sample had rather higher losses than Norris close-quote prediction, suggesting excessive magnetic flux penetration caused by percolated current paths. The results confirmed Norris close-quote prediction of the low ac losses for thin strip conductors, and indicated the importance of removing percolated structures of current paths to avoid higher ac losses than the theoretical predictions based on uniform conductors. copyright 1997 American Institute of Physics

High temperature ductility of austenitic alloys exposed to thermal neutrons

International Nuclear Information System (INIS)

Watanabe, K.; Kondo, T.; Ogawa, Y.

1982-01-01

Loss of high temperature ductility due to thermal neutron irradiation was examined by slow strain rate test in vacuum up to 1000 0 C. The results on two heats of Hastelloy alloy X with different boron contents were analyzed with respect to the influence of the temperatures of irradiation and tensile tests, neutron fluence and the associated helium production due to nuclear transmutation reaction. The loss of ductility was enhanced by increasing either temperature or neutron fluence. Simple extrapolations yielded the estimated threshold fluence and the end-of-life ductility values at 900 and 1000 0 C in case where the materials were used in near-core regions of VHTR. The observed relationship between Ni content and the ductility loss has suggested a potential utilization of Fe-based alloys for seathing of the neutron absorber materials

Minimização de defeitos em revestimentos de superligas de níquel depositada pelo processo TIG com alimentação de arame frio

Directory of Open Access Journals (Sweden)

Cleiton Carvalho Silva

2014-12-01

Full Text Available O objetivo do presente trabalho foi avaliar a influência dos parâmetros de soldagem na formação de defeitos na soldagem de revestimentos com ligas à base de níquel, e sua possível eliminação através do correto ajuste dos referidos parâmetros. Para tanto, foram depositados revestimentos com as ligas à base de Ni do tipo Inconel 625, Hastelloy C276 e Inconel 686, sobre um substrato de aço C-Mn, através do processo TIG com alimentação de arame frio. O planejamento dos experimentos foi realizado aplicando-se o método Taguchi. Os fatores de controle avaliados foram a Técnica da energia (TE, o nível de energia de soldagem (E, o tipo de liga (L, o gás de proteção (G e o tipo de tecimento (T. Outros parâmetros foram mantidos constantes, tendo sido investigados previamente. Os resultados mostraram que o tipo de tecimento em espiral, embora contribua significativamente para a redução da diluição, causa uma forte instabilidade ao processo, resultando na maioria dos casos em defeitos superficiais ou defeitos entre passes. A condição ótima para evitar a formação de defeitos entre passes identificada pelo método Taguchi foi constituída pelas seguintes combinação de fatores de controle 2-2-2-3-3, ou seja: TE-I; Emédia; Liga Hastelloy C276; Gás de proteção Ar+He; Tecimento Duplo-8. A condição ótima para a soldagem sem defeitos resulta em alto nível de diluição não sendo indicada para a soldagem de revestimentos resistentes à corrosão.

Characterization of complex carbide–silicide precipitates in a Ni–Cr–Mo–Fe–Si alloy modified by welding

Energy Technology Data Exchange (ETDEWEB)

Bhattacharyya, D., E-mail: dhb@ansto.gov.au; Davis, J.; Drew, M.; Harrison, R.P.; Edwards, L.

2015-07-15

Nickel based alloys of the type Hastelloy-N™ are ideal candidate materials for molten salt reactors, as well as for applications such as pressure vessels, due to their excellent resistance to creep, oxidation and corrosion. In this work, the authors have attempted to understand the effects of welding on the morphology, chemistry and crystal structure of the precipitates in the heat affected zone (HAZ) and the weld zone of a Ni–Cr–Mo–Fe–Si alloy similar to Hastelloy-N™ in composition, by using characterization techniques such as scanning and transmission electron microscopy. Two plates of a Ni–Cr–Mo–Fe–Si alloy GH-3535 were welded together using a TiG welding process without filler material to achieve a joint with a curved molten zone with dendritic structure. It is evident that the primary precipitates have melted in the HAZ and re-solidified in a eutectic-like morphology, with a chemistry and crystal structure only slightly different from the pre-existing precipitates, while the surrounding matrix grains remained unmelted, except for the zones immediately adjacent to the precipitates. In the molten zone, the primary precipitates were fully melted and dissolved in the matrix, and there was enrichment of Mo and Si in the dendrite boundaries after solidification, and re-precipitation of the complex carbides/silicides at some grain boundaries and triple points. The nature of the precipitates in the molten zone varied according to the local chemical composition. - Graphical abstract: Display Omitted - Highlights: • Ni-based alloy with Cr, Mo, Si, Fe and C was welded, examined with SEM, EBSD, and TEM. • Original Ni{sub 2}(Mo,Cr){sub 4}(Si,C) carbides changed from equiaxed to lamellar shape in HAZ. • Composition and crystal structure remained almost unchanged in HAZ. • Original carbides changed to lamellar Ni{sub 3}(Mo,Cr){sub 3}(Si,C) in some cases in weld metal. • Precipitates were mostly incoherent, but semi-coherent in some cases in weld

Characterization of complex carbide–silicide precipitates in a Ni–Cr–Mo–Fe–Si alloy modified by welding

International Nuclear Information System (INIS)

Bhattacharyya, D.; Davis, J.; Drew, M.; Harrison, R.P.; Edwards, L.

2015-01-01

Nickel based alloys of the type Hastelloy-N™ are ideal candidate materials for molten salt reactors, as well as for applications such as pressure vessels, due to their excellent resistance to creep, oxidation and corrosion. In this work, the authors have attempted to understand the effects of welding on the morphology, chemistry and crystal structure of the precipitates in the heat affected zone (HAZ) and the weld zone of a Ni–Cr–Mo–Fe–Si alloy similar to Hastelloy-N™ in composition, by using characterization techniques such as scanning and transmission electron microscopy. Two plates of a Ni–Cr–Mo–Fe–Si alloy GH-3535 were welded together using a TiG welding process without filler material to achieve a joint with a curved molten zone with dendritic structure. It is evident that the primary precipitates have melted in the HAZ and re-solidified in a eutectic-like morphology, with a chemistry and crystal structure only slightly different from the pre-existing precipitates, while the surrounding matrix grains remained unmelted, except for the zones immediately adjacent to the precipitates. In the molten zone, the primary precipitates were fully melted and dissolved in the matrix, and there was enrichment of Mo and Si in the dendrite boundaries after solidification, and re-precipitation of the complex carbides/silicides at some grain boundaries and triple points. The nature of the precipitates in the molten zone varied according to the local chemical composition. - Graphical abstract: Display Omitted - Highlights: • Ni-based alloy with Cr, Mo, Si, Fe and C was welded, examined with SEM, EBSD, and TEM. • Original Ni 2 (Mo,Cr) 4 (Si,C) carbides changed from equiaxed to lamellar shape in HAZ. • Composition and crystal structure remained almost unchanged in HAZ. • Original carbides changed to lamellar Ni 3 (Mo,Cr) 3 (Si,C) in some cases in weld metal. • Precipitates were mostly incoherent, but semi-coherent in some cases in weld metal

Current status and future prospects of Japanese national project on coated conductor development and its applications

International Nuclear Information System (INIS)

Shiohara, Y.; Yoshizumi, M.; Izumi, T.; Yamada, Y.

2008-01-01

Four years of the current five-year national project since 2003 for development of coated conductors using Y-system superconductors have passed and lots of remarkable results have been achieved. In this paper, the current status and the future prospect of this project are reviewed. The current national project comprises several groups of national laboratories, universities and private companies. The group of high performance tape development, consisting of Fujikura and SRL-NCCC, has worked on the tape by PLD-REBCO superconducting tapes on the PLD-CeO 2 /IBAD-GZO buffered substrates. The high product of I c and L equal to 112,166 A m was achieved in the 368 m-304.8 A GdBCO tape whose I c value is mostly above 350 A/cm-w. The performance under the magnetic fields was also improved up to 42 A at 3 T in a GdBCO short film with doping of ZrO 2 . About 61 m long GdBCO tape with ZrO 2 doping showed a high I c value of 220 A at self field and 30 A at 3 T. On the other hand, the other group focusing on the low production cost has worked on processes of TFA-MOD and MOCVD, etc. The extremely high I c value of 735 A/cm-w was attained in the TFA-MOD films on PLD-CeO 2 /IBAD-GZO/Hastelloy C276 substrate by means of using the effect of Ba-poor nominal composition. In the efforts for long tape production, 200 m long tapes with high I c values of 200 A/cm-w and 205 A/cm-w were obtained by MOD-YBCO/PLD-CeO 2 /IBAD-GZO/Hastelloy C276 and PLD-HoBCO on buffered NiW substrate, respectively. The I c x L value of the MOD-derived tape was 40,000 A m, which is the highest value in the world by the MOD process. Based on the above achievements on the coated conductor process development, two new additional goals were set in the project. One is the development for the extremely low cost tape and another is the development of the basic technologies for making the electric power devices including cables, transformers, motors, current-limiters and cryocoolers. Some of the new themes already

Noncontaminating technique for making holes in existing process systems

Science.gov (United States)

Hecker, T. P.; Czapor, H. P.; Giordano, S. M.

1972-01-01

Technique is developed for making cleanly-contoured holes in assembled process systems without introducing chips or other contaminants into system. Technique uses portable equipment and does not require dismantling of system. Method was tested on Inconel, stainless steel, ASTMA-53, and Hastelloy X in all positions.

A comparative study on optimization of machining parameters by turning aerospace materials according to Taguchi method

Directory of Open Access Journals (Sweden)

Altin Abdullah

2017-01-01

Full Text Available The effects of cutting tool coating material and cutting speed on cutting forces and surface roughness were investigated by Taguchi experimental design. Main cutting force, Fz is considered as a criterion. The effects of machining parameters were investigated using Taguchi L18 orthogonal array. Optimal cutting conditions were determined using the signal-to-noise (S/N ratio which is calculated for average surface roughness and cutting force according to the “the smaller is better” approach. Using results of analysis of variance (ANOVA and signal-to-noise (S/N ratio, effects of parameters on both average surface roughness and cutting forces were statistically investigated. It was observed that feed rate and cutting speed had higher effect on cutting force in Hastelloy X, while the feed rate and cutting tool had higher effect on cutting force in Inconel 625. According to average surface roughness the cutting tool and feed rate had higher effect in Hastelloy X and Inconel 625.

Corrosion susceptibility study of candidate pin materials for ALTC (Active Lithium/Thionyl Chloride) batteries

Science.gov (United States)

Bovard, Francine S.; Cieslak, Wendy R.

1987-09-01

The corrosion susceptibilities of eight alternate battery pin material candidates for ALTC (Active Lithium/Thionyl Chloride) batteries in 1.5M LiAlCl4/SOCl2 electrolyte have been investigated using ampule exposure and electrochemical tests. The thermal expansion coefficients of these candidate materials are expected to match Sandia-developed Li-corrosion resistant glasses. The corrosion resistances of the candidate materials, which included three stainless steels (15-5 PH, 17-4 PH, and 446), three Fe-Ni glass sealing alloys (Kovar, Alloy 52, and Niromet 426), a Ni-based alloy (Hastelloy B-2) and a zirconium-based alloy (Zircaloy), were compared to the reference materials Ni and 316L SS. All of the candidate materials showed some evidence of corrosion and, therefore, did not perform as well as the reference materials. The Hastelloy B-2 and Zircaloy are clearly unacceptable materials for this application. Of the remaining alternate materials, the 446 SS and Alloy 52 are the most promising candidates.

Corrosion susceptibility study of candidate pin materials for ALTC (active lithium/thionyl chloride) batteries. [Active lithium/thionyl chloride

Energy Technology Data Exchange (ETDEWEB)

Bovard, F.S.; Cieslak, W.R.

1987-09-01

(ALTC = active lithium/thionyl chloride.) We have investigated the corrosion susceptibilities of eight alternate battery pin materials in 1.5M LiAlCl/sub 4//SOCl/sub 2/ electrolyte using ampule exposure and electrochemical tests. The thermal expansion coefficients of these candidate materials are expected to match Sandia-developed Li-corrosion resistant glasses. The corrosion resistances of the candidate materials, which included three stainless steels (15-5 PH, 17-4 PH, and 446), three Fe-Ni glass sealing alloys (Kovar, Alloy 52, and Niromet 426), a Ni-based alloy (Hastelloy B-2) and a zirconium-based alloy (Zircaloy), were compared to the reference materials Ni and 316L SS. All of the candidate materials showed some evidence of corrosion and, therefore, did not perform as well as the reference materials. The Hastelloy B-2 and Zircaloy are clearly unacceptable materials for this application. Of the remaining alternate materials, the 446 SS and Alloy 52 are the most promising candidates.

High temperature oxidation characteristics of developed Ni-Cr-W superalloys in air

International Nuclear Information System (INIS)

Suzuki, Tomio; Shindo, Masami

1996-11-01

For expanding utilization of the Ni-Cr-W superalloy, which has been developed as one of new high temperature structural materials used in the advanced High Temperature Gas-cooled Reactors (HTGRs), in various engineering fields including the structural material for heat utilization system, the oxidation behavior of this alloy in air as one of high oxidizing environments becomes one of key factors. The oxidation tests for the industrial scale heat of Ni-Cr-W superalloy with the optimized chemical composition and five kinds of experimental Ni-Cr-W alloys with different Cr/W ratio were carried out at high temperatures in the air compared with Hastelloy XR. The conclusions were obtained as follows. (1) The oxidation resistance of the industrial scale heat of Ni-Cr-W superalloy with the optimized chemical composition was superior to that of Hastelloy XR. (2) The most excellent oxidation resistance was obtained in an alloy with 19% Cr of the industrial scale heat of Ni-Cr-W superalloy. (author)

Fracture and flaking off behavior of coated layer of DyBCO coated conductor under applied tensile strain

International Nuclear Information System (INIS)

Arai, T.; Shin, J.K.; Matsubayashi, H.; Ochiai, S.; Okuda, H.; Osamura, K.; Prusseit, W.

2009-01-01

The tensile behavior of the DyBa 2 Cu 3 O 7-δ (DyBCO) coated conductor with MgO buffer layer deposited on the Hastelloy C-276 substrate by inclined substrate deposition (ISD) was studied. The tensile stress-strain curve showed a flat region, characterized by the discontinuous yielding of the substrate due to the Lueders band extension from the gripped portions of the sample. In the area where the Lueders band had passed, the coating layer showed severe multiple transverse cracking due to the localized plastic deformation of the substrate. The flaking off of the coating layers took place at high applied strain, due to the buckling fracture of the coated layers in the sample width direction, accompanied by the interfacial debonding.

Effect of fission product interactions on the corrosion and mechanical properties of HTGR alloys

International Nuclear Information System (INIS)

Aronson, S.; Chow, J.G.Y.; Soo, P.; Friedlander, M.

1978-01-01

Preliminary experiments have been carried out to determine how fission product interactions may influence the mechanical integrity of reference HTGR structural metals. In this work Type 304 stainless steel, Incoloy 800 and Hastelloy X were heated to 550 to 650 0 C in the presence of CsI. It was found that no corrosion of the alloys occurred unless air or oxygen was also present. A mechanism for the observed behavior is proposed. A description is also given of some long term exposures of HTGR materials to more prototypic, low concentrations of I 2 , Te 2 and CsI in the presence of low partial pressures of O 2 . These samples are scheduled for mechanical bend tests after exposure to determine the degree of embrittlement

Hanford waste encapsulation: strontium and cesium

International Nuclear Information System (INIS)

Jackson, R.R.

1976-06-01

The strontium and cesium fractions separated from high radiation level wastes at Hanford are converted to the solid strontium fluoride and cesium chloride salts, doubly encapsulated, and stored underwater in the Waste Encapsulation and Storage Facility (WESF). A capsule contains approximately 70,000 Ci of 137 Cs or 70,000 to 140,000 Ci of 90 Sr. Materials for fabrication of process equipment and capsules must withstand a combination of corrosive chemicals, high radiation dosages and frequently, elevated temperatures. The two metals selected for capsules, Hastelloy C-276 for strontium fluoride and 316-L stainless steel for cesium chloride, are adequate for prolonged containment. Additional materials studies are being done both for licensing strontium fluoride as source material and for second generation process equipment

Evaluation of metallic materials for use in engineering barrier systems

International Nuclear Information System (INIS)

Pitman, S.G.; Griggs, B.; Elmore, R.P.

1980-01-01

Conclusions of this work are as follows: Inconel, Incoloy, Hastelloy C-276, and titanium alloys all had excellent corrosion resistance in all postulated repository environments tested. Further work will be required to evaluate the pertinent enviro-mechanical properties of these materials; the mechanical properties of grade 2 titanium are better than those of grade 12 titanium, except the tensile and yield strengths. These properties include fatigue-crack-growth rate, environmental fatigue-crack-growth rate, fracture toughness, impact toughness, and dynamic fracture toughness; there is no evidence in the current data to indicate that the simulated repository environment is aggressive to grade 2 or grade 12 titanium. This includes data from corrosion-fatigue, crevice corrosion, wedge-loaded cracked specimens, and residual-stress specimens

Heat-source specification 500 watt(e) RTG

International Nuclear Information System (INIS)

1983-02-01

This specification establishes the requirements for a 90 SrF 2 heat source and its fuel capsule for application in a 500 W(e) thermoelectric generator. The specification covers: fuel composition and quantity; the Hastelloy S fuel capsule material and fabrication; and the quality assurance requirements for the assembled heat source

Compatibility of heat resistant alloys with boron carbide, 5

International Nuclear Information System (INIS)

Baba, Shinichi; Kurasawa, Toshimasa; Endow, Taichi; Someya, Hiroyuki; Tanaka, Isao.

1986-08-01

This paper includes an experimental result of out-of-pile compatibility and capsule design for irradiation test in Japan Materials Testing Reactor (JMTR). The compatibility between sheath material and neutron absorber materials for control rod devices (CRD) was examined for potential use in a very high temperature reactor (VHTR) which is under development at JAERI. The purpose of the compatibility tests are preliminary evaluation of safety prior to irradiation tests. Preliminary compatibility evaluation was concerned with three items as follows : 1) Lithium effects on the penetrating reaction of Incoloy 800H alloy in contact with a mixture of boronated graphite and lithium hydroxide powders, 2) Short term tensile properties of Incoloy 800H and Hastelloy XR alloy reacted with boronated graphite and fracture mode analysis, 3) Reaction behavior of both alloys under transient power conditions of a VHTR. It was clear that the reaction rate constant of the Incoloy 800H alloy was accelerated by doping lithium hydroxide into the boron carbide and graphite powder. The mechanical properties of Incoloy 800H and Hastelloy XR alloy reacted with boronated graphite were decreased. Ultimate tensile strength and tensile ductilities at temperatures over 850 deg C were reduced, but there was no change in the proof (yield) stress. Both alloys exhibited a brittle intergranular fracture mode during transient power conditions of a VHTR and also exhibited severe penetration. Irradiation capsules for compatibility test were designed to simulate three irradiation conditions of VHTR: 1) steady state for VHTR, 2) Transient power condition, 3) Service limited life of CRD. Capsule irradiation experiments have been carried out satisfactorily and thus confirm the validity of the capsule design procedure. (author)

Current status and future prospects of Japanese national project on coated conductor development and its applications

Energy Technology Data Exchange (ETDEWEB)

Shiohara, Y. [Superconductivity Research Laboratory, ISTEC, Shinonome 1-10-13, Koto-ku, Tokyo 135-0062 (Japan)], E-mail: shiohara@istec.or.jp; Yoshizumi, M.; Izumi, T. [Superconductivity Research Laboratory, ISTEC, Shinonome 1-10-13, Koto-ku, Tokyo 135-0062 (Japan); Yamada, Y. [Superconductivity Research Laboratory, ISTEC, Nagoya Coated Conductor Center, 2-4-1, Mutsuno, Atsuta-ku, Nagoya 456-8587 (Japan)

2008-09-15

Four years of the current five-year national project since 2003 for development of coated conductors using Y-system superconductors have passed and lots of remarkable results have been achieved. In this paper, the current status and the future prospect of this project are reviewed. The current national project comprises several groups of national laboratories, universities and private companies. The group of high performance tape development, consisting of Fujikura and SRL-NCCC, has worked on the tape by PLD-REBCO superconducting tapes on the PLD-CeO{sub 2}/IBAD-GZO buffered substrates. The high product of I{sub c} and L equal to 112,166 A m was achieved in the 368 m-304.8 A GdBCO tape whose I{sub c} value is mostly above 350 A/cm-w. The performance under the magnetic fields was also improved up to 42 A at 3 T in a GdBCO short film with doping of ZrO{sub 2}. About 61 m long GdBCO tape with ZrO{sub 2} doping showed a high I{sub c} value of 220 A at self field and 30 A at 3 T. On the other hand, the other group focusing on the low production cost has worked on processes of TFA-MOD and MOCVD, etc. The extremely high I{sub c} value of 735 A/cm-w was attained in the TFA-MOD films on PLD-CeO{sub 2}/IBAD-GZO/Hastelloy C276 substrate by means of using the effect of Ba-poor nominal composition. In the efforts for long tape production, 200 m long tapes with high I{sub c} values of 200 A/cm-w and 205 A/cm-w were obtained by MOD-YBCO/PLD-CeO{sub 2}/IBAD-GZO/Hastelloy C276 and PLD-HoBCO on buffered NiW substrate, respectively. The I{sub c} x L value of the MOD-derived tape was 40,000 A m, which is the highest value in the world by the MOD process. Based on the above achievements on the coated conductor process development, two new additional goals were set in the project. One is the development for the extremely low cost tape and another is the development of the basic technologies for making the electric power devices including cables, transformers, motors, current

Effect of Al added to a NiCrMo alloy on the development of the oxide layer of intermetallic coatings; Efeito do teor de Al adicionado a liga NiCrMo no desenvolvimento dos filmes de oxidos em revestimentos intermetalicos

Energy Technology Data Exchange (ETDEWEB)

D' Oliveira, A.S.C.M.; Cangue, F.J.R. [Universidade Federal do Parana (DEM/UFPR), Curitiba, PR (Brazil). Dept. de Engenharia Mecanica; Clark, E.; Levi, C. [University of California, Santa Barbara, CA (United States)

2010-07-01

Components performance in different environment is strongly dependent on oxides that develop on their surfaces. This study analyzed the oxide layer that develops on coatings processed with mixtures of an atomized Hastelloy C alloy with Al powders. Powder mixtures containing 10, 20 and 30wt%Al were deposited on AISI 1020 and AISI304 steel plates. Coatings were subsequently exposed to 850 deg C for two hours in a low PO{sub 2} environment. X-ray diffraction was used to identify the phases that developed in the coating during processing and Raman analysis and Scanning Electron Microscopy were used to characterize the oxide layers. The results showed that coatings processed with the richer Al mixtures, 30wt%Al, which developed NiAl aluminides, reduced the development of {alpha} alumina when processing was done on AISI 304. Coatings processed on AISI 1020 with the three powder mixtures tested developed the different allotropic forms of alumina, as predicted for the tested temperature. (author)

Effect of Al added to a NiCrMo alloy on the development of the oxide layer of intermetallic coatings

International Nuclear Information System (INIS)

D'Oliveira, A.S.C.M.; Cangue, F.J.R.

2010-01-01

Components performance in different environment is strongly dependent on oxides that develop on their surfaces. This study analyzed the oxide layer that develops on coatings processed with mixtures of an atomized Hastelloy C alloy with Al powders. Powder mixtures containing 10, 20 and 30wt%Al were deposited on AISI 1020 and AISI304 steel plates. Coatings were subsequently exposed to 850 deg C for two hours in a low PO 2 environment. X-ray diffraction was used to identify the phases that developed in the coating during processing and Raman analysis and Scanning Electron Microscopy were used to characterize the oxide layers. The results showed that coatings processed with the richer Al mixtures, 30wt%Al, which developed NiAl aluminides, reduced the development of α alumina when processing was done on AISI 304. Coatings processed on AISI 1020 with the three powder mixtures tested developed the different allotropic forms of alumina, as predicted for the tested temperature. (author)

Technology readiness level (TRL) assessment of cladding alloys for advanced nuclear fuels

International Nuclear Information System (INIS)

Shepherd, Daniel

2015-01-01

Reliable fuel claddings are essential for the safe, sustainable and economic operation of nuclear stations. This paper presents a worldwide TRL assessment of advanced claddings for Gen III and IV reactors following an extensive literature review. Claddings include austenitic, ferritic/martensitic (F/M), reduced activation (RA) and oxide dispersion strengthened (ODS) steels as well as advanced iron-based alloys (Kanthal alloys). Also assessed are alloys of zirconium, nickel (including Hastelloy R ), titanium, chromium, vanadium and refractory metals (Nb, Mo, Ta and W). Comparison is made with Cf/C and SiCf/SiC composites, MAX phase ceramics, cermets and TRISO fuel particle coatings. The results show in general that the higher the maximum operating temperature of the cladding, the lower the TRL. Advanced claddings were found to have lower TRLs than the corresponding fuel materials, and therefore may be the limiting factor in the deployment of advanced fuels and even possibly the entire reactor in the case of Gen IV. (authors)

Effect of thermal neutron irradiation on mechanical properties of alloys for HTR core applications

International Nuclear Information System (INIS)

Ogawa, Yutaka; Kondo, Tatsuo; Ishimoto, Kiyoshi; Ohtsuka, Tamotsu

1979-01-01

An industrial heat of Hastelloy-X containing 2.3 ppm boron was creep-tested at 900 0 C after irradiating thermal neutrons by 6.6 x 10 20 n.cm -2 at temperatures 670 to 880 0 C in JMTR. Significant reduction in rupture life and ductility was observed, and large shift of accelerated deformation stage to short time side was also apparent at comparatively high stresses. Below about 2.2 kg.mm -2 , apparent relief from the degradation was seen. The elongation, however, was found to be due to the formation of numerous intergranular cracks in the premature stage of deformation. Based on the post irradiation tensile properties of several industrial alloys the degree of the ductility loss was found to be nearly dependent on the boron content of the alloys. The post irradiation tensile tests for a special low boron grade heat revealed the means of protecting materials from the effect to be feasible. (author)

Effect of thermal neutron irradiation on mechanical properties of alloys for HTR core applications

International Nuclear Information System (INIS)

Ogawa, Yutaka; Kondo, Tatsuo; Ishimoto, Kiyoshi; Ohtsuka, Tamotsu

1979-02-01

An industrial heat of Hastelloy-X containing 2.3 ppm boron was creep-tested at 900 0 C after irradiating thermal neutrons by 6.6 x 10 20 n/cm 2 at temperatures 670 to 880 0 C in JMTR. Significant reduction in rupture life and ductility was observed, and large shift of accelerated deformation stage to short time side was also apparent at comparatively high stresses. Below about 2.2 kg/mm 2 , apparent relief from the degradation was seen. The elongation, however, was found to be due to the formation of numerous intergranular cracks in the premature stage of deformation. Based on the post irradiation tensile properties of several industrial alloys the degree of the ductility loss was found to be nearly dependent on the boron content of the alloys. The post irradiation tensile tests for a special low boron grade heat revealed the means of protecting materials from the effect to be feasible. (author)

Development of the Sixty Watt Heat-Source hardware components

International Nuclear Information System (INIS)

McNeil, D.C.; Wyder, W.C.

1995-01-01

The Sixty Watt Heat Source is a nonvented heat source designed to provide 60 thermal watts of power. The unit incorporates a plutonium-238 fuel pellet encapsulated in a hot isostatically pressed General Purpose Heat Source (GPHS) iridium clad vent set. A molybdenum liner sleeve and support components isolate the fueled iridium clad from the T-111 strength member. This strength member serves as the pressure vessel and fulfills the impact and hydrostatic strength requirements. The shell is manufactured from Hastelloy S which prevents the internal components from being oxidized. Conventional drawing operations were used to simplify processing and utilize existing equipment. The deep drawing reqirements for the molybdenum, T-111, and Hastelloy S were developed from past heat source hardware fabrication experiences. This resulted in multiple step drawing processes with intermediate heat treatments between forming steps. The molybdenum processing included warm forming operations. This paper describes the fabrication of these components and the multiple draw tooling developed to produce hardware to the desired specifications. copyright 1995 American Institute of Physics

Corrosion studies on selected metallic materials for application in nuclear waste disposal containers

International Nuclear Information System (INIS)

Smailos, E.; Fiehn, B.; Gago, J.A.; Azkarate, I.

1994-03-01

In previous corrosion studies, carbon steels and the alloy Ti 99.8-Pd were identified as promising materials for heat-generating nuclear waste containers acting as a radionuclide barrier in a rock-salt repository. To characterize the long-term corrosion behaviour of these materials in more detail, a research programme including laboratory-scale and in-situ corrosion studies has been undertaken jointly by KfK and ENRESA/INASMET. In the period under review, gamma irradiation corrosion studies of up to about 6 months at 10 Gy/h and stress corrosion cracking studies at slow strain rates (10 -4 -10 -7 s -1 ) were performed on three preselected carbon steels in disposal relevant brines (NaCl-rich, MgCl 2 -rich) at 90 C and 150 C (TStE 355, TStE 460, 15 MnNi 6.3). Moreover, results were obtained from long-term in-situ corrosion studies (maximum test duration 9 years) conducted on carbon steel, Ti 99.8-Pd, Hastelloy C4, Ni-resist D4, and Si-cast iron in boreholes in the Asse salt mine. (orig./MM) [de

A high critical current density MOCVD coated conductor with strong vortex pinning centers suitable for very high field use

International Nuclear Information System (INIS)

Chen, Z; Kametani, F; Larbalestier, D C; Chen, Y; Xie, Y; Selvamanickam, V

2009-01-01

We have made extensive low temperature and high field evaluations of a recent 2.1 μm thick coated conductor (CC) grown by metal-organic chemical vapor deposition (MOCVD) with a view to its use for high field magnet applications, for which its very strong Hastelloy substrate makes it very suitable. This conductor contains dense three-dimensional (Y,Sm) 2 O 3 nanoprecipitates, which are self-aligned in planes tilted ∼7 deg. from the tape plane. Very strong vortex pinning is evidenced by high critical current density J c values of ∼3.1 MA cm -2 at 77 K and ∼43 MA cm -2 at 4.2 K, and by a strongly enhanced irreversibility field H irr , which reaches that of Nb 3 Sn (∼28 T at 1.5 K) at 60 K, even in the inferior direction of H parallel c axis. At 4.2 K, J c values are ∼15% of the depairing current density J d , much the highest of any superconductor suitable for magnet construction.

A high critical current density MOCVD coated conductor with strong vortex pinning centers suitable for very high field use

Energy Technology Data Exchange (ETDEWEB)

Chen, Z; Kametani, F; Larbalestier, D C [National High Magnetic Field Laboratory, Florida State University, Tallahassee, FL 32310 (United States); Chen, Y; Xie, Y; Selvamanickam, V [SuperPower Incorporated, Schenectady, NY 12304 (United States)], E-mail: zhijun@asc.magnet.fsu.edu

2009-05-15

We have made extensive low temperature and high field evaluations of a recent 2.1 {mu}m thick coated conductor (CC) grown by metal-organic chemical vapor deposition (MOCVD) with a view to its use for high field magnet applications, for which its very strong Hastelloy substrate makes it very suitable. This conductor contains dense three-dimensional (Y,Sm){sub 2}O{sub 3} nanoprecipitates, which are self-aligned in planes tilted {approx}7 deg. from the tape plane. Very strong vortex pinning is evidenced by high critical current density J{sub c} values of {approx}3.1 MA cm{sup -2} at 77 K and {approx}43 MA cm{sup -2} at 4.2 K, and by a strongly enhanced irreversibility field H{sub irr}, which reaches that of Nb{sub 3}Sn ({approx}28 T at 1.5 K) at 60 K, even in the inferior direction of H parallel c axis. At 4.2 K, J{sub c} values are {approx}15% of the depairing current density J{sub d}, much the highest of any superconductor suitable for magnet construction.

Frictional forces in an SOFC stack with sliding seals

Energy Technology Data Exchange (ETDEWEB)

Yamazaki, T; Oishi, N; Namikawa, T; Yamazaki, Y [Tokyo Institute of Technology, Tokyo (Japan)

1996-06-05

The detrimental thermal stresses in planar SOFC stacks can be reduced using sliding seals. In the proposal planar stack the electrolyte film is sandwiched by YSZ support rings to release the thermal stresses. In order to estimate the strength of the support ring, the frictional forces between heat resistant alloy and YSZ were measured at 900{degree}C. The coefficient of friction between Hastelloy X and YSZ increased when they were measured lifter 144h heating. However, the coefficient of friction between HA-214 and YSZ did not increase. The measurement and a calculation of the stresses in the support rings led the result that a thickness of 0.6mm was necessary for 200mm diameter support rings under a stack pressure of 0.1kgcm{sup -2}. 6 refs., 9 figs., 1 tab.

Molten salt reactors: chemistry

International Nuclear Information System (INIS)

1983-01-01

This work is a critical analysis of the 1000 MW MSBR project. Behavior of rare gases in the primary coolant circuit, their extraction from helium. Coating of graphite by molybdenum, chemistry of protactinium and niobium produced in the molten salt, continuous reprocessing of the fuel salt and use of stainless steel instead of hastelloy are reviewed [fr

Segregation in welded nickel-base alloys

International Nuclear Information System (INIS)

Akhtar, J.I.; Shoaib, K.A.; Ahmad, M.; Shaikh, M.A.

1990-05-01

Segregation effects have been investigated in nickel-base alloys monel 400, inconel 625, hastelloy C-276 and incoloy 825, test welded under controlled conditions. Deviations from the normal composition have been observed to varying extents in the welded zone of these alloys. Least effect of this type occurred in Monel 400 where the content of Cu increased in some of the areas. Enhancement of Al and Ti has been found over large areas in the other alloys which has been attributed to the formation of low melting slag. Another common feature is the segregation of Cr, Fe or Ti, most likely in the form of carbides. Enrichment of Al, Ti, Nb, Mb, Mo, etc., to different amounts in some of the areas of these materials is in- terpretted in terms of the formation of gamma prime precipitates or of Laves phases. (author)

Corrosion behaviour of container materials for geological disposal of high level radioactive waste

International Nuclear Information System (INIS)

Accary, A.

1985-01-01

The disposal of high level radioactive waste in geological formations, based on the multibarrier concept, may include the use of a container as one of the engineered barriers. In this report the requirements imposed on this container and the possible degradation processes are reviewed. Further on an overview is given of the research being carried out by various research centres in the European Community on the assessment of the corrosion behaviour of candidate container materials. The results obtained on a number of materials under various testing conditions are summarized and evaluated. As a result, three promising materials have been selected for a detailed joint testing programme. It concerns two highly corrosion resistant alloys, resp. Ti-Pd (0.2 Pd%) and Hastelloy C4 and one consumable material namely a low carbon steel. Finally the possibilities of modelling the corrosion phenomena are discussed

Salt Fog Testing Iron-Based Amorphous Alloys

International Nuclear Information System (INIS)

Rebak, Raul B.; Aprigliano, Louis F.; Day, S. Daniel; Farmer, Joseph C.

2007-01-01

Iron-based amorphous alloys are hard and highly corrosion resistant, which make them desirable for salt water and other applications. These alloys can be produced as powder and can be deposited as coatings on any surface that needs to be protected from the environment. It was of interest to examine the behavior of these amorphous alloys in the standard salt-fog testing ASTM B 117. Three different amorphous coating compositions were deposited on 316L SS coupons and exposed for many cycles of the salt fog test. Other common engineering alloys such as 1018 carbon steel, 316L SS and Hastelloy C-22 were also tested together with the amorphous coatings. Results show that amorphous coatings are resistant to rusting in salt fog. Partial devitrification may be responsible for isolated rust spots in one of the coatings. (authors)

Selection of replacement material for the failed surface level gauge wire in Hanford waste tanks

International Nuclear Information System (INIS)

Anantatmula, R.P.; Pitman, S.G.; Lund, A.L.

1995-10-01

Surface level gauges fabricated from AISI Type 316 stainless steel (316) wire failed after only a few weeks of operation in underground storage tanks at the Hanford Site. The wire failure was determined to be due to chloride ion assisted corrosion of the 316 wire. Radiation-induced breakdown of the polyvinyl chloride (PVC) riser liners is suspected to be the primary source of the chloride ions. An extensive literature search followed by expert concurrence was undertaken to select a replacement material for the wire. Platinum (Pt)-20 % Iridium (Ir) alloy was selected as the replacement material from tile candidate materials, P-20% Ir, Pt-1O% Rhodium (Rh), Pt-20%Rh and Hastelloy C-22. The selection was made on the basis of the alloy's immunity towards acidic and basic environments as well as its adequate tensile properties in the fully annealed state

Creep collapse of thick-walled heat transfer tube subjected to external pressure at high temperature

International Nuclear Information System (INIS)

Ioka, Ikuo; Kaji, Yoshiyuki; Terunuma, Isao; Nekoya, Shin-ichi; Miyamoto, Yoshiaki

1994-09-01

A series of creep collapse tests of thick-walled heat transfer tube were examined experimentally and analytically to confirm an analytical method for creep deformation behavior of a heat transfer tube of an intermediate heat exchanger (IHX) at a depressurization accident of secondary cooling system of HTTR (High Temperature Engineering Test Reactor). The tests were carried out using thick-walled heat transfer tubes made of Hastelloy XR at 950degC in helium gas environment. The predictions of creep collapse time obtained by a general purpose FEM-code ABAQUS were in good agreement with the experimental results. A lot of cracks were observed on the outer surface of the test tubes after the creep collapse. However, the cracks did not pass through the tube wall and, therefore, the leak tightness was maintained regardless of a collapse deformation for all tubes tested. (author)

Effect of Molybdenum on the Corrosion Behavior of High-Entropy Alloys CoCrFeNi2 and CoCrFeNi2Mo0.25 under Sodium Chloride Aqueous Conditions

Directory of Open Access Journals (Sweden)

Alvaro A. Rodriguez

2018-01-01

Full Text Available The corrosion behavior of high-entropy alloys (HEAs CoCrFeNi2 and CoCrFeNi2Mo0.25 was investigated in 3.5 wt. percent sodium chloride (NaCl at 25°C by electrochemical methods. Their corrosion parameters were compared to those of HASTELLOY® C-276 (UNS N10276 and stainless steel 316L (UNS 31600 to assess the suitability of HEAs for potential industrial applications in NaCl simulating seawater type environments. The corrosion rates were calculated using corrosion current determined from electrochemical experiments for each of the alloys. In addition, potentiodynamic polarization measurements can indicate active, passive, and transpassive behavior of the metal as well as potential susceptibility to pitting corrosion. Cyclic voltammetry (CV can confirm the alloy susceptibility to pitting corrosion. Electrochemical impedance spectroscopy (EIS elucidates the corrosion mechanism under studied conditions. The results of the electrochemical experiments and scanning electron microscopy (SEM analyses of the corroded surfaces revealed general corrosion on alloy CoCrFeNi2Mo0.25 and HASTELLOY C-276 and pitting corrosion on alloy CoCrFeNi2 and stainless steel 316L.

An experimental study of commercially available alloys for potential use in the CANDU®-SCWR

Energy Technology Data Exchange (ETDEWEB)

Cook, W.; Miles, J.; Bradley, C. [Univ. of New Brunswick, Dept. of Chemical Engineering, Fredericton, New Brunswick (Canada); Li, J.; Zheng, W. [CANMET-MTL, Hamilton, Ontario (Canada)

2010-07-01

In order to study the corrosion of candidate alloys in conditions simulating those proposed for the CANDU®-SCWR, a dynamic test loop has been constructed in the nuclear laboratories in the Department of Chemical Engineering at UNB. For this review, the following materials were selected for analysis: Inconel 625 (I625), Hastelloy C 276 (HC276) and 304SS. I625 and HC276 are members of a class of 'superalloys' comprised primarily of nickel and chromium, which are suitable for high temperature applications and 304SS is a commonly used construction material in current reactors. Coupons were cut from each material and polished to an 800 grit finish. Experiments were conducted at 400{sup o}C, 500{sup o}C and 550{sup o}C at 25MPa with exposure times of 100, 250, and 500 hours to examine the corrosion rate and oxide formation for each of these materials. Preliminary results indicate minimal weight change for both I625 and HC276, while small weight gains were observed for the 304SS samples. These results are supported with SEM work, which shows minimal oxidation on the I625 and HC276 samples. The 304SS samples also showed minimal oxide growth characterized by localized attack on the coupon surfaces. (author)

Abrasive wear of WC-NiMoCrFeCo thermally sprayed coatings in dependence on different types of abrasive sands

Czech Academy of Sciences Publication Activity Database

Kašparová, M.; Zahálka, F.; Houdková, Š.; Ctibor, Pavel

2010-01-01

Roč. 48, č. 1 (2010), s. 75-85 ISSN 0023-432X R&D Projects: GA AV ČR 1QS200430560 Institutional research plan: CEZ:AV0Z20430508 Keywords : WC-Hastelloy * abrasive wear * Al2O3 sand * SiO2 sand * braun size * abrasive efficiency Subject RIV: JG - Metallurgy Impact factor: 0.471, year: 2010 http://kovmat.sav.sk/abstract.php?rr=48&cc=1&ss=73

Stress Corrosion Evaluation of Nitinol 60 for the International Space Station Water Recycling System

Science.gov (United States)

Torres, P. D.

2016-01-01

A stress corrosion cracking (SCC) evaluation of Nitinol 60 was performed because this alloy is considered a candidate bearing material for the Environmental Control and Life Support System (ECLSS), specifically in the Urine Processing Assembly of the International Space Station. An SCC evaluation that preceded this one during the 2013-2014 timeframe included various alloys: Inconel 625, Hastelloy C-276, titanium (Ti) commercially pure (CP), Ti 6Al-4V, extra-low interstitial (ELI) Ti 6Al-4V, and Cronidur 30. In that evaluation, most specimens were exposed for a year. The results of that evaluation were published in NASA/TM-2015-218206, entitled "Stress Corrosion Evaluation of Various Metallic Materials for the International Space Station Water Recycling System,"1 available at the NASA Scientific and Technical Information program web page: http://www.sti.nasa.gov. Nitinol 60 was added to the test program in 2014.

System design description of forced-convection molten-salt corrosion loops MSR-FCL-3 and MSR-FCL-4

International Nuclear Information System (INIS)

Huntley, W.R.; Silverman, M.D.

1976-11-01

Molten-salt corrosion loops MSR-FCL-3 and MSR-FCL-4 are high-temperature test facilities designed to evaluate corrosion and mass transfer of modified Hastelloy N alloys for future use in Molten-Salt Breeder Reactors. Salt is circulated by a centrifugal sump pump to evaluate material compatibility with LiF-BeF 2 -ThF 4 -UF 4 fuel salt at velocities up to 6 m/s (20 fps) and at salt temperatures from 566 to 705 0 C (1050 to 1300 0 F). The report presents the design description of the various components and systems that make up each corrosion facility, such as the salt pump, corrosion specimens, salt piping, main heaters, salt coolers, salt sampling equipment, and helium cover-gas system, etc. The electrical systems and instrumentation and controls are described, and operational procedures, system limitations, and maintenance philosophy are discussed

Corrosion resistant alloy uses in the power industry

International Nuclear Information System (INIS)

Nickerson, J.L.; Hall, F.A.; Asphahani, A.I.

1989-01-01

Nickel-base alloys have been used as cost-effective measures in a variety of severely corrosive situations in pollution control units for coal-fired power plants. Cost effectiveness and practical answers to corrosion problems are illustrated (specifically the wallpaper concept/metallic lining technique). Numerous cases of successful use of HASTELLOY alloys in Flue Gas Desulfurization (FGD) systems and hazardous waste treatment incineration scrubber systems are listed. In this paper developments in nickel-base alloys and their use in FGD and other segments of the power industry are discussed. In the Ni-Cr-Mo-W alloy family, the C-22 alloy has the best resistance to localized corrosion in halide environments (chloride/fluoride-containing solutions). This alloy is also used effectively as a universal filler metal to weld less-resistant alloys were weld corrosion may be a problem. Field performance of this alloy in the power industry is described

High-Temperature Structural Analysis of a Small-Scale Prototype of a Process Heat Exchanger (IV) - Macroscopic High-Temperature Elastic-Plastic Analysis -

International Nuclear Information System (INIS)

Song, Kee Nam; Hong, Sung Deok; Park, Hong Yoon

2011-01-01

A PHE (Process Heat Exchanger) is a key component required to transfer heat energy of 950 .deg. C generated in a VHTR (Very High Temperature Reactor) to a chemical reaction that yields a large quantity of hydrogen. A small-scale PHE prototype made of Hastelloy-X was scheduled for testing in a small-scale gas loop at the Korea Atomic Energy Research Institute. In this study, as a part of the evaluation of the high-temperature structural integrity of the PHE prototype, high-temperature structural analysis modeling, and macroscopic thermal and elastic-plastic structural analysis of the PHE prototype were carried out under the gas-loop test conditions as a preliminary qwer123$ study before carrying out the performance test in the gas loop. The results obtained in this study will be used to design the performance test setup for the modified PHE prototype

Study of tertiary creep instability in several elevated-temperature structural materials

International Nuclear Information System (INIS)

Booker, M.K.; Sikka, V.K.

1978-01-01

Data for a number of common elevated temperature structural materials have been analyzed to yield mathematical predictions for the time and strain to tertiary creep at various rupture lives and temperatures. Materials examined include types 304 and 316 stainless steel, 2 1/4 Cr-1 Mo steel, alloy 800H, alloy 718, Hastelloy alloy X, and ERNiCr--3 weld metal. Data were typically examined over a range of creep temperatures for rupture lives ranging from less than 100 to greater than 10,000 hours. Within a given material, trends in these quantities can be consistently described, but it is difficult to directly relate the onset of tertiary creep to failure-inducing instabilities. A series of discontinued tests for alloy 718 at 649 and 620 0 C showed that the material fails by intergranular cracking but that no significant intergranular cracking occurs until well after the onset of tertiary creep

Resonance bending fatigue testing with simultaneous damping measurement and its application on layered coatings

Czech Academy of Sciences Publication Activity Database

Kovářík, O.; Haušild, P.; Čapek, J.; Medřický, Jan; Siegl, J.; Mušálek, Radek; Pala, Zdeněk; Curry, N.; Bjorklund, S.

2016-01-01

Roč. 82, January (2016), s. 300-309 ISSN 0142-1123. [International Conference on Fatigue Damage of Structural Materials Conference/10./. Massachusetts, 21.09.2014-26.09.2014] R&D Projects: GA ČR GB14-36566G Institutional support: RVO:61389021 Keywords : Crack detection * Damping * Fatigue * Hastelloy-X * Nondestructive test ing Subject RIV: JK - Corrosion ; Surface Treatment of Materials Impact factor: 2.899, year: 2016 http://www.sciencedirect.com/science/article/pii/S0142112315002443

Resonance bending fatigue testing with simultaneous damping measurement and its application on layered coatings

Czech Academy of Sciences Publication Activity Database

Kovářík, O.; Haušild, P.; Čapek, J.; Medřický, Jan; Siegl, J.; Mušálek, Radek; Pala, Zdeněk; Curry, N.; Bjorklund, S.

2016-01-01

Roč. 82, January (2016), s. 300-309 ISSN 0142-1123. [International Conference on Fatigue Damage of Structural Materials Conference/10./. Massachusetts, 21.09.2014-26.09.2014] R&D Projects: GA ČR GB14-36566G Institutional support: RVO:61389021 Keywords : Crack detection * Damping * Fatigue * Hastelloy-X * Nondestructive testing Subject RIV: JK - Corrosion ; Surface Treatment of Materials Impact factor: 2.899, year: 2016 http://www.sciencedirect.com/science/article/pii/S0142112315002443

Unusual behavior in the reactivity of 5-substituted-1H-tetrazoles in a resistively heated microreactor

Science.gov (United States)

Gutmann, Bernhard; Glasnov, Toma N; Razzaq, Tahseen; Goessler, Walter; Roberge, Dominique M

2011-01-01

Summary The decomposition of 5-benzhydryl-1H-tetrazole in an N-methyl-2-pyrrolidone/acetic acid/water mixture was investigated under a variety of high-temperature reaction conditions. Employing a sealed Pyrex glass vial and batch microwave conditions at 240 °C, the tetrazole is comparatively stable and complete decomposition to diphenylmethane requires more than 8 h. Similar kinetic data were obtained in conductively heated flow devices with either stainless steel or Hastelloy coils in the same temperature region. In contrast, in a flow instrument that utilizes direct electric resistance heating of the reactor coil, tetrazole decomposition was dramatically accelerated with rate constants increased by two orders of magnitude. When 5-benzhydryl-1H-tetrazole was exposed to 220 °C in this type of flow reactor, decomposition to diphenylmethane was complete within 10 min. The mechanism and kinetic parameters of tetrazole decomposition under a variety of reaction conditions were investigated. A number of possible explanations for these highly unusual rate accelerations are presented. In addition, general aspects of reactor degradation, corrosion and contamination effects of importance to continuous flow chemistry are discussed. PMID:21647324

Changes in the properties of superalloys by long term heating

International Nuclear Information System (INIS)

Susukida, H.; Tsuji, I.; Kawai, H.

1976-01-01

A laboratory study was conducted in order to determine the effect of long term heating (max. 10000h at 850 0 and 950 0 C) on the microstructure, tensile properties, hardness and stress rupture properties of four kinds of superalloys. These superalloys are two kinds of solid solution hardened Ni-base superalloys Hastelloy X and Inconel 617 and two kinds of dispersion strengthened Ni-base superalloys TD-Ni and TD-NiCr. The result of the study can be summarized as follows: (1) Solid solution hardened superalloys: Many precipitates were observed in the grains and on the grain boundaries after 100 hours of heating, and the precipitates became coarse-grained by over 1000 hours of heating. This tendency was remarkable when they were heated at 950 0 C. With the change of their microstructure, their mechanical properties also changed, particularly their tensile ductility decreased remarkably. (2) Dispersion strengthened superalloys: Their microstructure and mechanical properties were almost unchanged by long term heating. (3) The authors proposed ''solid solution hardening value'' in order to grasp quantitatively the solid solution hardening which has been discussed by the content of each element hitherto. (auth.)

Unusual behavior in the reactivity of 5-substituted-1H-tetrazoles in a resistively heated microreactor

Directory of Open Access Journals (Sweden)

Dominique M. Roberge

2011-04-01

Full Text Available The decomposition of 5-benzhydryl-1H-tetrazole in an N-methyl-2-pyrrolidone/acetic acid/water mixture was investigated under a variety of high-temperature reaction conditions. Employing a sealed Pyrex glass vial and batch microwave conditions at 240 °C, the tetrazole is comparatively stable and complete decomposition to diphenylmethane requires more than 8 h. Similar kinetic data were obtained in conductively heated flow devices with either stainless steel or Hastelloy coils in the same temperature region. In contrast, in a flow instrument that utilizes direct electric resistance heating of the reactor coil, tetrazole decomposition was dramatically accelerated with rate constants increased by two orders of magnitude. When 5-benzhydryl-1H-tetrazole was exposed to 220 °C in this type of flow reactor, decomposition to diphenylmethane was complete within 10 min. The mechanism and kinetic parameters of tetrazole decomposition under a variety of reaction conditions were investigated. A number of possible explanations for these highly unusual rate accelerations are presented. In addition, general aspects of reactor degradation, corrosion and contamination effects of importance to continuous flow chemistry are discussed.

The reactive element effect of yttrium and yttrium silicon on high temperature oxidation of NiCrAl coating

Science.gov (United States)

Ramandhany, S.; Sugiarti, E.; Desiati, R. D.; Martides, E.; Junianto, E.; Prawara, B.; Sukarto, A.; Tjahjono, A.

2018-03-01

The microstructure formed on the bond coat affects the oxidation resistance, particularly the formation of a protective oxide layer. The adhesion of bond coat and TGO increased significantly by addition of reactive element. In the present work, the effect of yttrium and yttrium silicon as reactive element (RE) on NiCrAl coating was investigated. The NiCrAl (without RE) and NiCrAlX (X:Y or YSi) bond coating were deposited on Hastelloy C-276 substrate by High Velocity Oxygen Fuel (HVOF) method. Isothermal oxidation was carried out at 1000 °C for 100 hours. The results showed that the addition of RE could prevent the breakaway oxidation. Therefore, the coating with reactive element were more protective against high temperature oxidation. Furthermore, the oxidation rate of NiCrAlY coating was lower than NiCrAlYSi coating with the total mass change was ±2.394 mg/cm2 after 100 hours of oxidation. The thickness of oxide scale was approximately 1.18 μm consisting of duplex oxide scale of spinel NiCr2O4 in outer scale and protective α-Al2O3 in inner scale.

Phase diagrams for pseudo-binary carbide systems TiC-NbC, TiC-TaC, ZrC-NbC, ZrC-TaC and HfC-TaC

International Nuclear Information System (INIS)

Gusev, A.I.

1985-01-01

Parameters of interaction and energy of mutual exchange in the liquid and solid phases of pseudobinary TiC-NbC, TiC-TaC, ZrC-NbC, ZrC-TaC, HfC-TaC systems are calculated with account of dependence on composition and temperature. Positions of liquidus-solidus phase boundaries on the phase diagrams of the mentioned systems are calculated on the basis of the determined mutual exchange energies in approximati.on of subregular solutions. The existance of latent decomposition ranges in the solid phase on the phase diagrams of the investgated systems is established

Current status and future prospects of Japanese national project on coated conductor development and its applications

Science.gov (United States)

Shiohara, Y.; Yoshizumi, M.; Izumi, T.; Yamada, Y.

2008-09-01

Four years of the current five-year national project since 2003 for development of coated conductors using Y-system superconductors have passed and lots of remarkable results have been achieved. In this paper, the current status and the future prospect of this project are reviewed. The current national project comprises several groups of national laboratories, universities and private companies. The group of high performance tape development, consisting of Fujikura and SRL-NCCC, has worked on the tape by PLD-REBCO superconducting tapes on the PLD-CeO 2/IBAD-GZO buffered substrates. The high product of Ic and L equal to 112,166 A m was achieved in the 368 m-304.8 A GdBCO tape whose Ic value is mostly above 350 A/cm-w. The performance under the magnetic fields was also improved up to 42 A at 3 T in a GdBCO short film with doping of ZrO 2. About 61 m long GdBCO tape with ZrO 2 doping showed a high Ic value of 220 A at self field and 30 A at 3 T. On the other hand, the other group focusing on the low production cost has worked on processes of TFA-MOD and MOCVD, etc. The extremely high Ic value of 735 A/cm-w was attained in the TFA-MOD films on PLD-CeO 2/IBAD-GZO/Hastelloy C276 substrate by means of using the effect of Ba-poor nominal composition. In the efforts for long tape production, 200 m long tapes with high Ic values of 200 A/cm-w and 205 A/cm-w were obtained by MOD-YBCO/PLD-CeO 2/IBAD-GZO/Hastelloy C276 and PLD-HoBCO on buffered NiW substrate, respectively. The Ic × L value of the MOD-derived tape was 40,000 A m, which is the highest value in the world by the MOD process. Based on the above achievements on the coated conductor process development, two new additional goals were set in the project. One is the development for the extremely low cost tape and another is the development of the basic technologies for making the electric power devices including cables, transformers, motors, current-limiters and cryocoolers. Some of the new themes already revealed the

Development of Plasma-Sprayed Molybdenum Carbide-Based Anode Layers with Various Metal Oxides for SOFC

Science.gov (United States)

Faisal, N. H.; Ahmed, R.; Katikaneni, S. P.; Souentie, S.; Goosen, M. F. A.

2015-12-01

Air plasma-sprayed (APS) coatings provide an ability to deposit a range of novel fuel cell materials at competitive costs. This work develops three separate types of composite anodes (Mo-Mo2C/Al2O3, Mo-Mo2C/ZrO2, Mo-Mo2C/TiO2) using a combination of APS process parameters on Hastelloy®X for application in intermediate temperature proton-conducting solid oxide fuel cells. Commercially available carbide of molybdenum powder catalyst (Mo-Mo2C) and three metal oxides (Al2O3, ZrO2, TiO2) was used to prepare three separate composite feedstock powders to fabricate three different anodes. Each of the modified composition anode feedstock powders included a stoichiometric weight ratio of 0.8:0.2. The coatings were characterized by scanning electron microscopy, energy dispersive spectroscopy, x-ray diffraction, nanoindentation, and conductivity. We report herein that three optimized anode layers of thicknesses between 200 and 300 µm and porosity as high as 20% for Mo-Mo2C/Al2O3 (250-µm thick) and Mo-Mo2C/TiO2 (300 µm thick) and 17% for Mo-Mo2C/ZrO2 (220-µm thick), controllable by a selection of the APS process parameters with no addition of sacrificial pore-forming material. The nanohardness results indicate the upper layers of the coatings have higher values than the subsurface layers in coatings with some effect of the deposition on the substrate. Mo-Mo2C/ZrO2 shows high electrical conductivity.

Fatigue performance of TBCs on Hastelloy X substrate during cyclic bending

Czech Academy of Sciences Publication Activity Database

Mušálek, Radek; Kovářík, O.; Tomek, L.; Medřický, Jan; Pala, Zdeněk; Haušild, P.; Čapek, J.; Kolařík, K.; Curry, N.; Bjorklund, S.

2016-01-01

Roč. 25, 1-2 (2016), s. 231-243 ISSN 1059-9630. [ITSC 2015: International Thermal Spray Conference and Exposition. Long Beach, California, 11.05.2015-14.05.2015] R&D Projects: GA ČR GB14-36566G Institutional support: RVO:61389021 Keywords : atmospheric plasma spray * failure mechanism * fatigue * HVAF * NiCoCrAlY * thermal barrier coatings * yttria-stabilized zirconia Subject RIV: JK - Corrosion ; Surface Treatment of Materials Impact factor: 1.488, year: 2016 http://link.springer.com/article/10.1007%2Fs11666-015-0321-4

Correlation between the 12C+12C, 12C+13C, and 13C+13C fusion cross sections

Science.gov (United States)

Notani, M.; Esbensen, H.; Fang, X.; Bucher, B.; Davies, P.; Jiang, C. L.; Lamm, L.; Lin, C. J.; Ma, C.; Martin, E.; Rehm, K. E.; Tan, W. P.; Thomas, S.; Tang, X. D.; Brown, E.

2012-01-01

The fusion cross section for 12C+13C has been measured down to Ec.m.=2.6 MeV, at which the cross section is of the order of 20 nb. By comparing the cross sections for the three carbon isotope systems, 12C+12C, 12C+13C, and 13C+13C, it is found that the cross sections for 12C+13C and 13C+13C provide an upper limit for the fusion cross section of 12C+12C over a wide energy range. After calibrating the effective nuclear potential for 12C+12C using the 12C+13C and 13C+13C fusion cross sections, it is found that a coupled-channels calculation with the ingoing wave boundary condition (IWBC) is capable of predicting the major peak cross sections in 12C+12C. A qualitative explanation for this upper limit is provided by the Nogami-Imanishi model and by level density differences among the compound nuclei. It is found that the strong resonance found at 2.14 MeV in 12C+12C exceeds this upper limit by a factor of more than 20. The preliminary result from the most recent measurement shows a much smaller cross section at this energy, which agrees with our predicted upper limit.

Investigation into solubility and diffusion in SiC-NbC, SiC-TiC, SiC-ZrC systems

International Nuclear Information System (INIS)

Safaraliev, G.K.; Tairov, Yu.M.; Tsvetkov, V.F.; Shabanov, Sh.Sh.

1991-01-01

An investigation is carried out which demonstrates solid-phase interaction between SiC and NbC, TiC and ZrC monocrystals. The monocrystals are subjected to hot pressing in SiC powder with dispersity of 5x10 -6 m. The pressing temperature is 2270-2570 K and pressure is varied in the range of 20-40 MPa. Element composition and the distribution profile in a thin layer near the boundary of SiC-NbC, SiC-TiC and SiC-ZrC are investigated by the Anger spectroscopy method. The obtained results permit to make the conclusion in the possibility of solid solution formation in investigated systems

Fission product behavior in high-temperature water: CsI vs MoO4

Science.gov (United States)

Kanjana, K.; Silva, K.; Channuie, J.

2017-09-01

Fission product behaviors of Cs, a major element released in a severe nuclear accident, still remain unclear. The question frequently addressed is whether Cs released will be in the form of Cs2MoO4 or CsOH. This is a challenging issue since it has been demonstrated that the reaction between Cs2MoO4 and water leading to CsOH production is thermodynamically favored. The present research aims at investigation of CsOH generation through this chemical channel. A high-temperature setup with a flow system based on the cooling system of a water-cooled nuclear reactor has been assembled. The reaction between aqueous solutions of CsI and Na2MoO4 in a high-corrosion-resistant hot cell (Hastelloy) has been studied up to 80 °C in deoxygenated system. The products have been characterized using FTIR and XRD. The results have shown that there is no reaction between CsI and Na2MoO4 under the experimental conditions.

Corrosion studies on retrievable spent fuel containers: a progress report

International Nuclear Information System (INIS)

Ludemann, W.D.; Abrego, L.; McCright, R.D.

1978-12-01

Spent fuel canisters stored in halite (NaCl) deposits (salt beds) are subject to a severely corrosive environment when the hot brine inclusions, rich in calcium and magnesium chlorides, migrate to the canister. Since no data base exists on corrosion in halite brines, a survey was made of the corrosion resistance of potential canister materials in other concentrated brine environments. Corrosion-resistant metals include Ta, Ti Code 12, TiPd Alloy, Inconel 625, Hastelloy C-276, and Fe-base 29-4 Alloy. Although carbon steels have cost and availability advantages, they suffer from excessive corrosion rates in brines. Corrosion-resistant nonmetals include carbon, Teflon-type fluorocarbons, epoxide coatings, and polymer cements. While these materials are not suitable for constructing the canister, they could be used as a protective coating on a carbon steel canister. On the basis of this survey, we recommend a coated carbon steel canister, used with cathodic protection. It is important to start a test program to gather a data base on the corrosion of materials in halite brines and to verify the suitability of canister materials

Prediction of inelastic behavior and creep-fatigue life of perforated plates

International Nuclear Information System (INIS)

Igari, Toshihide; Yamauchi, Masafumi; Nomura, Shinichi.

1992-01-01

Prediction methods of macroscopic and local stress-strain behaviors of perforated plates in plastic and creep regime are proposed in this paper, and are applied to the creep-fatigue life prediction of perforated plates. Both equivalent-solid-plate properties corresponding to the macroscopic behavior and the stress-strain concentration around a hole were obtained by assuming the analogy between plasticity and creep and also by extending the authors' proposal in creep condition. The perforated plates which were made of Hastelloy XR were subjected to the strain-controlled cyclic test at 950degC in air in order to experimentally obtain the macroscopic behavior such as the cyclic stress-strain curve and creep-fatigue life around a hole. The results obtained are summarized as follows. (1) The macroscopic behavior of perforated plates including cyclic stress-strain behavior and relaxation is predictable by using the proposed method in this paper. (2) The creep-fatigue life around a hole can be predicted by using the proposed method for stress-strain concentration around a hole. (author)

Localized corrosion of metallic materials and γ radiation effects in passive layers under simulated radwaste repository conditions. Final report

International Nuclear Information System (INIS)

Schultze, J.W.; Kudelka, S.; Michaelis, A.; Schweinsberg, M.; Thies, A.

1996-02-01

The task of the project was to simulate the conditions in a radwaste repository and to perform local analyses in order to detect the critical conditions and material susceptibilities leading to localized corrosion of materials. The information thus obtained was to yield more precise data on the long-term stability of materials for the intended purpose, in order to be able to appropriately select or optimize the materials (Ti, TiO.2Pd, Hastelloy C4, fine-grained structural steel). A major aspect to be examined was natural inhomogeneities of the electrode surfaces, as determined by the grain structure of the selected materials. Thus a laterally inhomogeneous composition in the welded zone induces an inhomogeneous current distribution, and hence strong susceptibility to localized corrosion. This effect was to be quantified, and the localized corrosion processes had to be identified by means of novel, electrochemical methods with a resolution power of μm. The investigations were to be made under conditions as near to practice as possible, for instance by simulating radwaste repository conditions and performing measurements at elevated temperatures (170 C) in an autoclave. Another task was to examine the radiation effects of γ radiation on passive layers, and describe the possible modifications induced by recrystallisation, photocorrosion, or oxide formation. (orig./MM) [de

Studies on neutron irradiation effects of iron alloys and nickel-base heat resistant alloys

International Nuclear Information System (INIS)

Watanabe, Katsutoshi

1987-09-01

The present paper describes the results of neutron irradiation effects on iron alloys and nickel-base heat resistant alloys. As for the iron alloys, irradiation hardening and embrittlement were investigated using internal friction measurement, electron microscopy and tensile testings. The role of alloying elements was also investigated to understand the irradiation behavior of iron alloys. The essential factors affecting irradiation hardening and embrittlement were thus clarified. On the other hand, postirradiation tensile and creep properties were measured of Hastelloy X alloy. Irradiation behavior at elevated temperatures is discussed. (author)

Experimental investigation of the temperature dependence of sound velocity in the structural materials for nuclear power engineering

International Nuclear Information System (INIS)

Roshchupkin, V.V.; Pokrasin, M.A.; Chernov, A.I.; Semashko, N.A.; Filonenko, S.F.

1999-01-01

The purpose of the study consists in determination of the sound velocity temperature dependence in structural materials for nuclear power engineering. In particular, the Zr-2.5%Nb, Hastelloys-H alloys and X2.5M steel are studied. The facility for studying acoustic parameters of metals and alloys is described. The software makes it possible to obtain the results in various forms with the data stored in the memory for further analysis. The data on the above alloys obtained by use of various methods are presented and analyzed [ru

Liquid Salts as Media for Process Heat Transfer from VHTR's: Forced Convective Channel Flow Thermal Hydraulics, Materials, and Coating

Energy Technology Data Exchange (ETDEWEB)

Sridharan, Kumar; Anderson, Mark; Allen, Todd; Corradini, Michael

2012-01-30

The goal of this NERI project was to perform research on high temperature fluoride and chloride molten salts towards the long-term goal of using these salts for transferring process heat from high temperature nuclear reactor to operation of hydrogen production and chemical plants. Specifically, the research focuses on corrosion of materials in molten salts, which continues to be one of the most significant challenges in molten salts systems. Based on the earlier work performed at ORNL on salt properties for heat transfer applications, a eutectic fluoride salt FLiNaK (46.5% LiF-11.5%NaF-42.0%KF, mol.%) and a eutectic chloride salt (32%MgCl2-68%KCl, mole %) were selected for this study. Several high temperature candidate Fe-Ni-Cr and Ni-Cr alloys: Hastelloy-N, Hastelloy-X, Haynes-230, Inconel-617, and Incoloy-800H, were exposed to molten FLiNaK with the goal of understanding corrosion mechanisms and ranking these alloys for their suitability for molten fluoride salt heat exchanger and thermal storage applications. The tests were performed at 850C for 500 h in sealed graphite crucibles under an argon cover gas. Corrosion was noted to occur predominantly from dealloying of Cr from the alloys, an effect that was particularly pronounced at the grain boundaries Alloy weight-loss due to molten fluoride salt exposure correlated with the initial Cr-content of the alloys, and was consistent with the Cr-content measured in the salts after corrosion tests. The alloys weight-loss was also found to correlate to the concentration of carbon present for the nominally 20% Cr containing alloys, due to the formation of chromium carbide phases at the grain boundaries. Experiments involving molten salt exposures of Incoloy-800H in Incoloy-800H crucibles under an argon cover gas showed a significantly lower corrosion for this alloy than when tested in a graphite crucible. Graphite significantly accelerated alloy corrosion due to the reduction of Cr from solution by graphite and formation

HfC plasma coating of C/C composites

International Nuclear Information System (INIS)

Boncoeur, M.; Schnedecker, G.; Lulewicz, J.D.

1992-01-01

The surface properties of C/C composites such as hardness and corrosion or erosion resistance can be modified by a ceramic coating applied by plasma torch. The technique of plasma spraying in controlled temperature and atmosphere, that was developed and patented by the CEA, makes it possible to apply coatings to the majority of metals and ceramics without affecting the characteristics of the composite. An example of hard deposit of HfC on a C/C composite is described. The characteristics of the deposit and of the bonding with the C/C composite were studied before and after a heat treatment under vacuum for 2 hours at 1000 C. 2 refs

Absorption of molten fluoride salts in glassy carbon, pyrographite and Hastelloy B

Czech Academy of Sciences Publication Activity Database

Vacík, Jiří; Naramoto, H.; Červená, Jarmila; Hnatowicz, Vladimír; Peka, I.; Fink, D.

2001-01-01

Roč. 289, č. 3 (2001), s. 308-314 ISSN 0022-3115 R&D Projects: GA ČR GA202/96/0077; GA ČR GV202/97/K038; GA AV ČR KSK1010104 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.366, year: 2001

Excitation functions of the systems 12C+14C and 13C+12C

International Nuclear Information System (INIS)

Haindl, E.

1975-01-01

The excitation functions of the systems 12 C+ 14 C and 13 C+ 12 C are investigated for different exit channels. The excitation functions measured do not show correlated structures as in the system 12 C+ 12 C. (WL/AK) [de

Molten salt reactor type

International Nuclear Information System (INIS)

1977-01-01

This document is one of the three parts of a first volume devoted to the compilations of American data on the molten salt reactor concept. This part 'CIRCUITS' regroups under a condensed form - in French and using international units - the essential information contained in both basic documents of the American project for a molten-salt breeder power plant. This part is only dealing with things relating to the CEA-EDF workshop 'CIRCUITS'. It is not concerned with information on: the reactor and the moderator replacement, the primary and secondary salts, and the fuel salt reprocessing, that are dealt with in parts 'CORE' and 'CHEMISTRY' respectively. The possible evolutions in the data - and solutions - taken by the American designers for their successive projects (1970 to 1972) are shown. The MSBR power plant comprises three successive heat transfer circuits. The primary circuit (Hastelloy N), radioactive and polluted, containing the fuel salt, includes the reactor, pumps and exchangers. The secondary circuit (pipings made of modified Hastelloy N) contaminated in the exchanger, ensures the separation between the fuel and the fluid operating the turbo-alternator. The water-steam circuit feeds the turbine with steam. This steam is produced in the steam generator flowed by the secondary fluid. Some subsidiary circuits (discharge and storage of the primary and secondary salts, ventilation of the primary circuit ...) complete the three principal circuits which are briefly described. All circuits are enclosed inside the controlled-atmosphere building of the nuclear boiler. This building also ensures the biological protection and the mechanical protection against outer aggressions [fr

Total Synthesis of Zoanthamine Alkaloids, Part 2. Construction of the C1-C5, C6-C10 and C11-C24 Fragments of Zoanthamine

DEFF Research Database (Denmark)

Tanner, David Ackland; Tedenborg, Lars; Somfai, Peter

1997-01-01

This paper describes the construction of three key intermediates for a projected total synthesis of the marine alkaloid zoanthamine. These building blocks, corresponding to the C1-C5, C6-C10 and C11-C24 fragments of the target molecule, are synthesised efficiently form (R)-hydroxymethyl-butyrolac......This paper describes the construction of three key intermediates for a projected total synthesis of the marine alkaloid zoanthamine. These building blocks, corresponding to the C1-C5, C6-C10 and C11-C24 fragments of the target molecule, are synthesised efficiently form (R...

High temperature oxidation of carbide-carbon materials of NbC-C, NbC-TiC-C systems

International Nuclear Information System (INIS)

Afonin, Yu.D.; Shalaginov, V.N.; Beketov, A.R.

1981-01-01

The effect of titanium carbide additions on the oxidation of carbide - carbon composition NbC-TiC-C in oxygen under the pressure of 10 mm Hg and in the air at atmospheric pressure in the temperature range 800-1300 deg is studied. It is shown that the region of negative temperature coefficient during oxidation in the system NbC+C is determined by the processes of sintering and polymorphous transformation. The specific character of the oxide film, formed during oxidation of Nbsub(x)Tisub(y)C+C composites is connected with non-equilibrium nature of carbide grain in its composition. Carbon gasification takes place with the formation of carbon dioxide. Composite materials, containing titanium carbide in complex carbide up to 50-83 mol. %, are the most corrosion resisting ones [ru

Erosion resistance comparison of alternative surface treatments

Science.gov (United States)

Česánek, Z.; Schubert, J.; Houdková, Š.

2017-05-01

Erosion is a process characterized by the particle separation and the damage of component functional surfaces. Thermal spraying technology HP/HVOF (High Pressure / High Velocity Oxygen Fuel) is commonly used for protection of component surfaces against erosive wear. Alloy as well as cermet based coatings meet the requirements for high erosion resistance. Wear resistance is in many cases the determining property of required component functioning. The application suitability of coating materials is particularly influenced by different hardness. This paper therefore presents an erosion resistance comparison of alloy and cermet based coatings. The coatings were applied on steel substrates and were subjected to the erosive test using the device for evaluation of material erosion resistance working on the principle of centrifugal erodent flow. Abrasive sand Al2O3 with grain size 212-250 μm was selected as an erosive material. For this purpose, the specimens were prepared by thermal spraying technology HP/HVOF using commercially available powders Stellite 6, NiCrBSi, Cr3C2-25%NiCr, Cr3C2-25%CoNiCrAlY, Hastelloy C-276 and experimental coating TiMoCN-29% Ni. Erosion resistance of evaluated coatings was compared with erosive resistance of 1.4923 high alloyed steel without nitridation and in nitrided state and further with surface treatment using technology PVD. According to the evaluation, the resulting erosive resistance depends not only on the selected erodent and surface protection, but also on the erodent impact angle.

Linear ketenimines. Variable structures of C,C-dicyanoketenimines and C,C-bis-sulfonylketenimines.

Science.gov (United States)

Finnerty, Justin; Mitschke, Ullrich; Wentrup, Curt

2002-02-22

C,C-dicyanoketenimines 10a-c were generated by flash vacuum thermolysis of ketene N,S-acetals 9a-c or by thermal or photochemical decomposition of alpha-azido-beta-cyanocinnamonitrile 11. In the latter reaction, 3,3-dicyano-2-phenyl-1-azirine 12 is also formed. IR spectroscopy of the keteniminines isolated in Ar matrixes or as neat films, NMR spectroscopy of 10c, and theoretical calculations (B3LYP/6-31G) demonstrate that these ketenimines have variable geometry, being essentially linear along the CCN-R framework in polar media (neat films and solution), but in the gas phase or Ar matrix they are bent, as is usual for ketenimines. Experiments and calculations agree that a single CN substituent as in 13 is not enough to enforce linearity, and sulfonyl groups are less effective that cyano groups in causing linearity. C,C-bis(methylsulfonyl)ketenimines 4-5 and a C-cyano-C-(methylsulfonyl)ketenimine 15 are not linear. The compound p-O2NC6H4N=C=C(COOMe)2 previously reported in the literature is probably somewhat linearized along the CCNR moiety. A computational survey (B3LYP/6-31G) of the inversion barrier at nitrogen indicates that electronegative C-substituents dramatically lower the barrier; this is also true of N-acyl substituents. Increasing polarity causes lower barriers. Although N-alkylbis(methylsulfonyl)ketenimines are not calculated to be linear, the barriers are so low that crystal lattice forces can induce planarity in N-methylbis(methylsulfonyl)ketenimine 3.

Effect of helium on creep and fatigue (MAT 11)

International Nuclear Information System (INIS)

Schroeder, H.

1991-03-01

This final report contains experimental results on mechanical properties (creep, fatigue, tensile) and microstructural investigations (SEM, TEM) of pre-implanted samples of steels or alloys. (AISI 316, AISI 316L, DIN 1.4970, JPCA 8206, DIN 1.4914; Incoloy 800H, Hastelloy X, DIN 1.4981, (Fe 0.49 Ni 0.51 ) 3 V, Fe17Ni17Cr, Fe15Ni15Cr, Nimonic PE 16, Ni8Si). Furthermore theoretical aspects and developed models and mechanisms for helium embrittlement are described. This report is presented in the form of an extended summary without figures. (MM)

Study of superficial films and of electrochemical behaviour of some nickel base alloys and titanium base alloys in solution representation of granitic, argillaceous and salted ground waters

International Nuclear Information System (INIS)

Quang, K.V.; Da Cunha Belo, M.; Benabed, M.S.; Bourelier, F.; Jallerat, N.; Pari, F.L.

1985-01-01

The corrosion behaviour of the stainless steels 304, 316 Ti, 25Cr-20Ni-Mo-Ti, nickel base alloys Hastelloy C4, Inconel 625, Incoloy 800, Ti and Ti-0.2% Pd alloy has been studied in the aerated or deaerated solutions at 20 0 C and 90 0 C whose compositions are representative of interstitial ground waters: granitic or clay waters or salt brine. The electrochemical techniques used are voltametry, polarization resistance and complexe impedance measurements. Electrochemical data show the respective influence of the parameters such as temperature, solution composition and dissolved oxygen, addition of soluble species chloride, fluoride, sulfide and carbonates, on which depend the corrosion current density, the passivation and the pitting potential. The inhibition efficiency of carbonate and bicarbonate activities against pitting corrosion is determined. In clay water at 90 0 C, Ti and Ti-Pd show very high passivation aptitude and a broad passive potential range. Alloying Pd increases cathodic overpotential and also transpassive potential. It makes the alloy less sensitive to the temperature effect. Optical Glow Discharge Spectra show three parts in the composition depth profiles of surface films on alloys. XPS and SIMS spectrometry analyses are also carried out. Electron microscopy observation shows that passive films formed on Ti and Ti-Pd alloy have amorphous structure. Analysis of the alloy constituents dissolved in solutions, by radioactivation in neutrons, gives the order of magnitude of the Ni base alloy corrosion rates in various media. It also points out the preferential dissolution of alloying iron and in certain cases of chromium

General Corrosion studies of a Titanium and Incoloy based alloys under ammoniacal medium and at 290 deg. C

International Nuclear Information System (INIS)

Gokhale, B.K.; Keny, S.J.; Kumbhar, A.G.; Rangarajan, S.; Bera, S.; Nuwad Jitendra; Kumar, Sanjukta A.; Wagh, D. N.; Pradhan, S.

2012-09-01

For their use in future PWR applications, the general corrosion behaviors of two modified alloys of titanium and Incoloy were studied at high temperature and high pressure (290 deg. C, 7400 Kpa) under ammoniated atmosphere and compared. Coupons were exposed to solutions of varying ammonia concentrations of (10, 50 and 100 ppm ) at 290 deg. C under non-deaerated conditions in a static autoclave for 20 days. Surface characteristics of exposed coupons were studied using XRF, SEM, EDAX and XPS. The solution in the autoclave was analyzed for its specific conductivity, pH and for the elemental concentrations leached from alloy. The exposed titanium based alloy showed deposition of white crystalline material (300-1000 nm size) on the surface. Depletion of Ti and increase in the oxygen concentration on the exposed surface was observed. This indicated dissolution of Ti in solution from surface at high temperature and pressure and its reaction with oxygen in solution to form oxide and its redeposition on surface. The oxide film compositions were found to change drastically between 10 and 50 ppm ammoniated solution. Ti was found to be enriched in the oxide film when the solution contained 50 ppm of ammonia whereas the opposite effect was observed at 10 ppm of ammonia. The presence Ti 4+ in oxide environment and traces of Cr 3+ were observed but no nitrogen or Zr was detected. Specific conductivity of the exposed solution was found to increase by 30 μS/cm and pH to decrease by 1.5 units. Slight leaching of Ti was observed in solution. No Zr was found in the leached solution. Presence of other elements like Al, Cr, Ni in the exposed solution indicated leaching of autoclave construction material (hastelloy). This alloy showed good resistance for corrosion under the experimental conditions. The exposed surface of Incoloy based alloy showed Ni, Cr, Cu and Mn on the surface with deposition of crystalline particles (200-300 nm size). The exposed surface also showed a decrease in Cr

Total Synthesis of Zoanthamine Alkaloids, Part 2. Construction of the C1-C5, C6-C10 and C11-C24 Fragments of Zoanthamine

DEFF Research Database (Denmark)

Tanner, David Ackland; Tedenborg, Lars; Somfai, Peter

1997-01-01

This paper describes the construction of three key intermediates for a projected total synthesis of the marine alkaloid zoanthamine. These building blocks, corresponding to the C1-C5, C6-C10 and C11-C24 fragments of the target molecule, are synthesised efficiently form (R...

Multilocus sequence typing (MLST methods for the emerging Campylobacter species C. hyointestinalis, C. lanienae, C. sputorum, C. concisus and C. curvus

Directory of Open Access Journals (Sweden)

William G Miller

2012-04-01

Full Text Available Multilocus sequence typing (MLST systems have been reported previously for multiple food- and food animal-associated Campylobacter species (e.g. C. jejuni, C. coli, C. lari and C. fetus to both differentiate strains and identify clonal lineages. These MLST methods focused primarily on campylobacters of human clinical (e.g. C. jejuni or veterinary (e.g. C. fetus relevance. However, other, emerging, Campylobacter species have been isolated increasingly from environmental, food animal or human clinical samples. We describe herein MLST methods for five emerging Campylobacter species: C. hyointestinalis, C. lanienae, C. sputorum, C. concisus and C. curvus. The concisus/curvus method uses the loci aspA, atpA, glnA, gltA, glyA, ilvD and pgm, whereas the other methods use the seven loci defined for C. jejuni (i.e., aspA, atpA, glnA, gltA, glyA, pgm, and tkt. Multiple food animal and human clinical C. hyointestinalis (n=48, C. lanienae (n=34 and C. sputorum (n=24 isolates were typed, along with 86 human clinical C. concisus and C. curvus isolates. A large number of sequence types (STs were identified using all four MLST methods. Similar to Campylobacter MLST methods described previously, these novel MLST methods identified mixed isolates containing two or more strains of the same species. Additionally, these methods speciated unequivocally isolates that had been typed ambiguously using other molecular-based speciation methods, such as 16S rDNA sequencing. Finally, the design of degenerate primer pairs for some methods permitted the typing of related species; for example, the C. hyointestinalis primer pairs could be used to type C. fetus strains. Therefore, these novel Campylobacter MLST methods will prove useful in speciating and differentiating strains of multiple, emerging Campylobacter species.

Remarkable progress in fabricating RE123 coated conductors by IBAD/PLD technique at Fujikura

Energy Technology Data Exchange (ETDEWEB)

Igarashi, M; Kakimoto, K; Hanyu, S; Tashita, C; Hayashida, T; Hanada, Y; Fujita, S; Morita, K; Nakamura, N; Sutoh, Y; Kutami, H; Iijima, Y; Saitoh, T, E-mail: m_igarashi@fujikura.co.j [Fujikura Ltd., 1440, Mutsuzaki, Sakura, Chiba, 285-8550 (Japan)

2010-06-01

Increase of production rate and improvement of quality for RE123 coated conductors have been tried. In-plane texturing of MgO was attempted by the IBAD system with the world largest ion source. As a result of optimizing condition in large deposition area, the dramatically high throughput of 1000 m / h was realized to obtain the IBAD-MgO with {Delta}{phi} < 10{sup 0}. Furthermore, simple buffer structure was demonstrated. Well textured CeO{sub 2} layer with {Delta}{phi} of around 4{sup 0} was obtained by directly deposited on IBAD-MgO layer in spite of large lattice mismatch of 28% between CeO{sub 2} and MgO. Several over 100 m buffer substrates with the architecture of / PLD-CeO{sub 2} (60 m / h) / IBAD-MgO (333{approx}1000 m / h) / Y{sub 2}O{sub 3} (500 m / h) / Al{sub 2}O{sub 3} (150 m / h) / Hastelloy / were already prepared. On these production substrates, GdBCO layer was deposited by the large PLD system at high throughput. The 260 m long GdBCO tape with I{sub c} > 600 A except some locations was obtained at the throughput of 15 m / h. In addition to the speed-up, the very high I{sub c} of 1040 A was also achieved by the hot-wall heating PLD system.

Synthetic Swan band profile of (1,0) of 12C12C and (0,0) of 12C12C and 12C13C in comets

International Nuclear Information System (INIS)

Swamy, K.S.K.

1987-01-01

The statistical equilibrium calculations of the 12 C 13 C molecule based on the resonance fluorescence process give similar results to those of the normal molecule. Therefore the assumption that the observed intensities of bands of the normal and the isotopic molecule differ only by their abundance ratio is reasonable. The synthetic profile of the (1,0) Swan band of 12 C 13 C (0,0) band of 12 C 12 C and 12 C 13 C have been calculated. The relative merits of using the rotational structure of the (1,0) or (0,0) band for the determination of the isotopic ratio 12 C/ 13 C is discussed briefly. (author)

Substrate-Mediated C-C and C-H Coupling after Dehalogenation.

Science.gov (United States)

Kong, Huihui; Yang, Sha; Gao, Hongying; Timmer, Alexander; Hill, Jonathan P; Díaz Arado, Oscar; Mönig, Harry; Huang, Xinyan; Tang, Qin; Ji, Qingmin; Liu, Wei; Fuchs, Harald

2017-03-15

Intermolecular C-C coupling after cleavage of C-X (mostly, X = Br or I) bonds has been extensively studied for facilitating the synthesis of polymeric nanostructures. However, the accidental appearance of C-H coupling at the terminal carbon atoms would limit the successive extension of covalent polymers. To our knowledge, the selective C-H coupling after dehalogenation has not so far been reported, which may illuminate another interesting field of chemical synthesis on surfaces besides in situ fabrication of polymers, i.e., synthesis of novel organic molecules. By combining STM imaging, XPS analysis, and DFT calculations, we have achieved predominant C-C coupling on Au(111) and more interestingly selective C-H coupling on Ag(111), which in turn leads to selective synthesis of polymeric chains or new organic molecules.

Distinct Signaling Roles of cIMP, cCMP, and cUMP.

Science.gov (United States)

Seifert, Roland

2016-10-04

The cyclic purine nucleotide cIMP and the cyclic pyrimidine nucleotides cCMP and cUMP are emerging second messengers. These cNMPs show different biological effects, but the molecular mechanisms remain elusive. In this issue of Structure, Ng et al. (2016) provide structural evidence for distinct interactions of cIMP, cCMP, and cUMP with ion channels. Copyright © 2016 Elsevier Ltd. All rights reserved.

Materials performance in a high-level radioactive waste vitrification system

International Nuclear Information System (INIS)

Imrich, K.J.; Chandler, G.T.

1996-01-01

The Defense Waste Processing Facility (DWPF) is a Department of Energy Facility designed to vitrify highly radioactive waste. An extensive materials evaluation program has been completed on key components in the DWPF after twelve months of operation using nonradioactive simulated wastes. Results of the visual inspections of the feed preparation system indicate that the system components, which were fabricated from Hastelloy C-276, should achieve their design lives. Significant erosion was observed on agitator blades that process glass frit slurries; however, design modifications should mitigate the erosion. Visual inspections of the DWPF melter top head and off gas components, which were fabricated from Inconel 690, indicated that varying degrees of degradation occurred. Most of the components will perform satisfactorily for their two year design life. The components that suffered significant attack were the borescopes, primary film cooler brush, and feed tubes. Changes in the operation of the film cooler brush and design modifications to the feed tubes and borescopes is expected to extend their service lives to two years. A program to investigate new high temperature engineered materials and alloys with improved oxidation and high temperature corrosion resistance will be initiated

Revestimento de Níquel Depositado pela Soldagem MIG e MIG com Arame Frio

Directory of Open Access Journals (Sweden)

Carlos Alberto Mendes da Mota

Full Text Available Resumo: Este artigo apresenta um estudo das características operacionais, geométricas e microestruturais de soldas MIG e MIGAF (MIG com arame frio aplicadas no revestimento de chapa de um aço AISI 1020, com uma superliga de níquel ER NiCrMo-4, tipo Hastelloy 276C. A soldagem foi automatizada, na posição plana, e realizada por uma fonte eletrônica em CC+ com aquisição instantânea dos oscilogramas de corrente e tensão de soldagem. As variáveis de entrada foram às velocidades do arame eletrodo e do arame frio, e a velocidade de soldagem. Foram avaliadas a operacionalidade dos processos e o efeito da energia de soldagem sobre as características geométricas (reforço e largura, diluição, microestrutura e microdureza do revestimento. Os resultados indicaram um bom desempenho operacional, a ausência de defeitos nos passes isolados e nos revestimentos para as soldagens com MIGAF. Além disso, constataram-se menores níveis de diluição.

Destruction of chemical agent simulants in a supercritical water oxidation bench-scale reactor

Energy Technology Data Exchange (ETDEWEB)

Veriansyah, Bambang [Supercritical Fluid Research Laboratory, Clean Technology Research Center, Korea Institute of Science and Technology (KIST), 39-1 Hawolgok-dong, Seongbuk-gu, Seoul 136-791 (Korea, Republic of) and Department of Green Process and System Engineering, University of Science and Technology, 39-1 Hawolgok-dong, Seongbuk-gu, Seoul 136-791 (Korea, Republic of)]. E-mail: vaveri@kist.re.kr; Kim, Jae-Duck [Supercritical Fluid Research Laboratory, Clean Technology Research Center, Korea Institute of Science and Technology (KIST), 39-1 Hawolgok-dong, Seongbuk-gu, Seoul 136-791 (Korea, Republic of) and Department of Green Process and System Engineering, University of Science and Technology, 39-1 Hawolgok-dong, Seongbuk-gu, Seoul 136-791 (Korea, Republic of)]. E-mail: jdkim@kist.re.kr; Lee, Jong-Chol [Agency for Defense Development (ADD), P.O. Box 35-1, Yuseong-gu, Daejeon (Korea, Republic of)]. E-mail: jcleeadd@hanafos.com

2007-08-17

A new design of supercritical water oxidation (SCWO) bench-scale reactor has been developed to handle high-risk wastes resulting from munitions demilitarization. The reactor consists of a concentric vertical double wall in which SCWO reaction takes place inside an inner tube (titanium grade 2, non-porous) whereas pressure resistance is ensured by a Hastelloy C-276 external vessel. The performances of this reactor were investigated with two different kinds of chemical warfare agent simulants: OPA (a mixture of isopropyl amine and isopropyl alcohol) as the binary precursor for nerve agent of sarin and thiodiglycol [TDG (HOC{sub 2}H{sub 4}){sub 2}S] as the model organic sulfur heteroatom. High destruction rates based on total organic carbon (TOC) were achieved (>99.99%) without production of chars or undesired gases such as carbon monoxide and methane. The carbon-containing product was carbon dioxide whereas the nitrogen-containing products were nitrogen and nitrous oxide. Sulfur was totally recovered in the aqueous effluent as sulfuric acid. No corrosion was noticed in the reactor after a cumulative operation time of more than 250 h. The titanium tube shielded successfully the pressure vessel from corrosion.

Corrosion of container and infrastructure materials under clay repository conditions

International Nuclear Information System (INIS)

Debruyn, W.; Dresselaers, J.; Vermeiren, P.; Kelchtermans, J.; Tas, H.

1991-01-01

With regard to the disposal of high-level radioactive waste, it was recommended in a IAEA Technical Committee meeting to perform tests in realistic environments corresponding with normal and accidental conditions, to qualify and apply corrosion monitoring techniques for corrosion evaluation under real repository conditions and to develop corrosion and near-field evolution models. The actual Belgian experimental programme for the qualification of a container for long-term HLW storage in clay formations complies with these recommendations. The emphasis in the programme is indeed on in situ corrosion testing and monitoring and on in situ control of the near-field chemistry. Initial field experiments were performed in a near-surface clay quarry at Terhaegen. Based on a broad laboratory material screening programme and in agreement with the Commission of the European Communities, three reference materials were chosen for extensive in situ overpack testing. Ti/0.2 Pd and Hastelloy C-4 were chosen as reference corrosion resistant materials and a low-carbon steel as corrosion allowance reference material. This report summarizes progress made in the material qualification programme since the CEC contract of 1983-84. 57 Figs.; 15 Tabs.; 18 Refs

Synthesis of the C(18)-C(34) fragment of amphidinolide C and the C(18)-C(29) fragment of amphidinolide F.

Science.gov (United States)

Roy, Sudeshna; Spilling, Christopher D

2010-11-19

A convergent synthesis of the C(18)-C(34) fragment of amphidinolide C and the C(18)-C(29) fragment of amphidinolide F is reported. The approach involves the synthesis of the common intermediate tetrahydrofuranyl-β-ketophosphonate via cross metathesis, Pd(0)-catalyzed cyclization, and hydroboration-oxidation. The β-ketophosphonate was coupled to three side chain aldehydes using a Horner-Wadsworth-Emmons (HWE) olefination reaction to give dienones, which were reduced with l-selectride to give the fragments of amphidinolide C and F.

Why Y-c.c

Czech Academy of Sciences Publication Activity Database

Chodounský, David; Zapletal, Jindřich

2015-01-01

Roč. 166, č. 11 (2015), s. 1123-1149 ISSN 0168-0072 R&D Projects: GA ČR(CZ) GF15-34700L Institutional support: RVO:67985840 Keywords : c.c.c. partitions * proper forcing * forcing axiom Subject RIV: BA - General Mathematics Impact factor: 0.582, year: 2015 http://www.sciencedirect.com/science/article/pii/S0168007215000664

Alkane Activation at Ambient Temperatures: Unusual Selectivities, C-C, C-H Bond Scission versus C-C Bond Coupling

NARCIS (Netherlands)

Trionfetti, C.; Agiral, A.; Gardeniers, Johannes G.E.; Lefferts, Leonardus; Seshan, Kulathuiyer

2008-01-01

Activating bonds: A cold plasma generated by dielectric barrier discharge in a microreactor converts alkanes (C1–C3) at atmospheric pressure. Large amounts of products with higher molecular weight than the starting hydrocarbons are observed showing that C-H activation at lower T favourably leads to

C59N+ and C69N+: isoelectronic heteroanalogues of C60 and C70

International Nuclear Information System (INIS)

Lamparth, I.; Nuber, B.; Schick, G.; Skiebe, A.; Groesser, T.; Hirsch, A.

1995-01-01

Fragmentation reactions in the mass spectrometer were used to generate the first characterized nitrogen heterofullerene ions C 59 N + and C 69 N + from regioselectively synthesized oligoiminofullerenes. During this process one carbon atom in the fullerene core is removed and replaced with a nitrogen atom. C 59 N + has almost the same structure as the isoelectronic C 60 . (orig.)

Joining of SiC ceramics and SiC/SiC composites

Energy Technology Data Exchange (ETDEWEB)

Rabin, B.H. [Idaho National Engineering Lab., Idaho Falls, ID (United States)

1996-08-01

This project has successfully developed a practical and reliable method for fabricating SiC ceramic-ceramic joints. This joining method will permit the use of SiC-based ceramics in a variety of elevated temperature fossil energy applications. The technique is based on a reaction bonding approach that provides joint interlayers compatible with SiC, and excellent joint mechanical properties at temperatures exceeding 1000{degrees}C. Recent emphasis has been given to technology transfer activities, and several collaborative research efforts are in progress. Investigations are focusing on applying the joining method to sintered {alpha}-SiC and fiber-reinforced SiC/SiC composites for use in applications such as heat exchangers, radiant burners and gas turbine components.

Mechanical structure and problem of thorium molten salt reactor

International Nuclear Information System (INIS)

Kamei, Takashi

2011-01-01

After Fukushima Daiichi accident, there became great interest in Thorium Molten Salt Reactor (MSR) for the safety as station blackout leading to auto drainage of molten salts with freeze valve. This article described mechanical structure of MSR and problems of materials and pipes. Material corrosion problem by molten salts would be solved using modified Hastelloy N with Ti and Nb added, which should be confirmed by operation of an experimental reactor. Trends in international activities of MSR were also referred including China declaring MSR development in January 2011 to solve thorium contamination issues at rare earth production and India rich in thorium resources. (T. Tanaka)

Comparison of Cobalt based Catalysts Supported on MWCNT and SBA-15 Supporters for Fischer-tropsch Synthesis by Using Novel Vortex Type Reactor

International Nuclear Information System (INIS)

Yakubov, A.; Shahrun, M.S.; Kutty, M.G.; Hamid, S.B.A.; Piven, V.

2011-01-01

10 and 40 wt% Co/ Multi wall Carbon Nano tubes (MWCNT) and 10 and 40 wt% Co/ Santa Barbara Amorphous-15 (SBA) catalysts were prepared via incipient wetness impregnation and characterized by Scanning Electron Microscopy equipped with Energy Dispersive X-ray Spectroscopy (SEM and EDX), N 2 adsorption-desorption (BET), X-ray Diffractometry (XRD), Transmission Electron Microscopy (TEM) and Temperature- Programmed Reduction and H 2 desorption TPD/RO. Co(NO 3 ) 2 * 6H 2 O was used as a cobalt precursor. 200 ml hastelloy autoclave reactor was implemented to see the performance of the catalysts. This report presents details about the catalyst synthesis and reactor study. (author)

Structures, stabilities, aromaticity, and electronic properties of C66 fullerene isomers, anions (C662-, C664-, C666-), and metallofullerenes (Sc2-C66)

International Nuclear Information System (INIS)

Cui Yanhong; Tian, Wei Quan; Feng Jikang; Chen Deli

2010-01-01

Among all the 4478 classical isomers of C 66 , C 66 (C s :0060) with the lowest number of pentagon-pentagon fusions was predicted to be the most stable isomer, followed by isomers C 66 (C 2v :0011) and C 66 (C 2 :0083). The infrared spectra and aromaticity of the most stable isomers were predicted. The relative stabilities of C 66 isomers change with charges or doping of metals. The structures and relative stabilities of the most stable metallofullerenes were delineated and compared with experiment. Sc 2 -C 66 (C 2 :0083) was predicted to be the most stable metallofullerene, although Sc 2 -C 66 (C 2v :0011) was observed. Charge-transfer from Sc 2 to the fused pentagons and the bonding between these two moieties significantly decrease the strain energies caused by the pair of fused pentagons thereby stabilizing the fullerene cage.

Oxidation protection of multilayer CVD SiC/B/SiC coatings for 3D C/SiC composite

International Nuclear Information System (INIS)

Liu Yongsheng; Cheng Laifei; Zhang Litong; Wu Shoujun; Li Duo; Xu Yongdong

2007-01-01

A CVD boron coating was introduced between two CVD SiC coating layers. EDS and XRD results showed that the CVD B coating was a boron crystal without other impurity elements. SEM results indicated that the CVD B coating was a flake-like or column-like crystal with a compact cross-section. The crack width in the CVD SiC coating deposited on CVD B is smaller than that in a CVD SiC coating deposited on CVD SiC coating. After oxidation at 700 deg. C and 1000 deg. C, XRD results indicated that the coating was covered by product B 2 O 3 or B 2 O 3 .xSiO 2 film. The cracks were sealed as observed by SEM. There was a large amount of flake-like material on hybrid coating surface after oxidation at 1300 deg. C. Oxidation weight loss and residual flexural strength results showed that hybrid SiC/B/SiC multilayer coating provided better oxidation protection for C/SiC composite than a three layer CVD SiC coating at temperatures from 700 deg. C to 1000 deg. C for 600 min, but worse oxidation protection above 1000 deg. C due to the large amount of volatilization of B 2 O 3 or B 2 O 3 .xSiO 2

Generation of a C3c specific monoclonal antibody and assessment of C3c as a putative inflammatory marker derived from complement factor C3

DEFF Research Database (Denmark)

Palarasah, Yaseelan; Skjodt, Karsten; Brandt, Jette

2010-01-01

complex (C5b-C9) and quantification of complement split products by precipitation-in-gel techniques (e.g. C3d). We have developed a mouse monoclonal antibody (mAb) that is able to detect fluid phase C3c without interference from other products generated from the complement component C3. The C3c specific m....... The C3c mAb was confirmed to be C3c specific, as it showed no cross-reactivity with native (un-cleaved) C3, with C3b, iC3b, or with C3d. Also, no significant reaction was observed with C3 fragments in factor I deficient sera or plasma. This antibody forms the basis for the generation of a robust ELISA...... that allows for a quick and reliable evaluation of complement activation and consumption as a marker for inflammatory processes. We established the C3c plasma range in 100 healthy Danish blood donors with a mean of 3.47 μg/ml and a range of 2.12-4.92 μg/ml. We believe that such an antibody might...

High production rate of IBAD-MgO buffered substrate

Energy Technology Data Exchange (ETDEWEB)

Yoshizumi, M., E-mail: myoshizumi@istec.or.j [Superconductivity Research Laboratory, ISTEC, Shinonome 1-10-13, Koto-ku, Tokyo 135-0062 (Japan); Miyata, S.; Ibi, A.; Fukushima, H.; Yamada, Y.; Izumi, T.; Shiohara, Y. [Superconductivity Research Laboratory, ISTEC, Shinonome 1-10-13, Koto-ku, Tokyo 135-0062 (Japan)

2009-10-15

The conventional IBAD (Ion Beam Assisted Deposition) process using fluorite materials yields low production rates, resulting in high production cost, which reduces the motivation for practical application in spite of its high quality. The IBAD process using rock salt materials, e.g. MgO, is well known as a strong candidate of practical application due to its potential of high production rate and high in-plane grain alignment. In this work, the IBAD-MgO process was investigated for a newly developed architecture of PLD (Pulsed Laser Deposition)-CeO{sub 2}/sputter-LMO (LaMnO{sub 3})/IBAD-MgO/sputter-GZO (Gd{sub 2}Zr{sub 2}O{sub 7})/Hastelloy{sup TM} to make long buffered metal tapes with high properties and a high production rate. The 50 m-long IBAD-MgO substrates with about 4 deg. of DELTAphiCeO{sub 2} in an XRD phi scan could be fabricated repeatedly. A GdBCO (GdBa{sub 2}Cu{sub 3}O{sub x}) layer deposited on the buffered substrate showed the minimum I{sub c} value of 325 A/cm-w in a 41 m-long tape. Almost of the tape showed 500-600 A/cm-w of I{sub c} value. The deposition time for the IBAD-MgO layer was 60 s which was about 2 orders of magnitude shorter than the conventional IBAD process. The production rate of 24 m/h was realized at the IBAD-MgO process to fabricate the GdBCO coated conductor with high J{sub c} and I{sub c} properties.

Volatility study of [C1C1im][NTf2] and [C2C3im][NTf2] ionic liquids

International Nuclear Information System (INIS)

Rocha, Marisa A.A.; Ribeiro, Filipe M.S.; Schröder, Bernd; Coutinho, João A.P.; Santos, Luís M.N.B.F.

2014-01-01

Highlights: • Vapor pressures of [C 1 C 1 im][NTf 2 ] and [C 2 C 3 im][NTf 2 ] ionic liquids are reported. • [C 1 C 1 im][NTf 2 ] presents higher enthalpy and entropy of vaporization than expected. • The high volatility of [C 2 C 3 im][NTf 2 ] is a result from its asymmetric character. -- Abstract: Vapor pressures of 1,3-dimethylimidazolium bis(trifluoromethylsulfonyl)imide, ([C 1 C 1 im][NTf 2 ]) and 1-ethyl-3-propylimidazolium bis(trifluoromethylsulfonyl)imide, ([C 2 C 3 im][NTf 2 ]) ionic liquids were measured as a function of temperature using a Knudsen effusion apparatus combined with a quartz crystal microbalance. Enthalpies and entropies of vaporization were derived from the fitting of vapor pressure and temperature results to the Clarke and Glew equation. [C 1 C 1 im][NTf 2 ] presents a higher enthalpy and entropy of vaporization than the neighboring members of the series. The enthalpy of vaporization of [C 2 C 3 im][NTf 2 ] lies in between the asymmetric and symmetric ionic liquid series, reflecting a decrease in the electrostatic interactions due to a decrease of the charge accessibility between the ionic pairs when the methyl group is replaced by an ethyl group. The obtained higher volatility of [C 2 C 3 im][NTf 2 ] arises from its asymmetric character, leading to an higher entropic contribution that compensates the enthalpic penalty. The border conditions ([C 1 C 1 im][NTf 2 ], [C 2 C 1 im][NTf 2 ] and [C 2 C 2 im][NTf 2 ]), topology ([C 2 C 3 im][NTf 2 ]) and symmetry/asymmetry of the ILs effect were evaluated and rationalized based on a comparative analysis of the thermodynamic properties, enthalpies and entropies of vaporization

Epitaxial growth of 3C-SiC by using C{sub 60} as a carbon source; Untersuchungen zum epitaktischen Wachstum von 3C-SiC bei Verwendung einer C{sub 60}-Kohlenstoffquelle

Energy Technology Data Exchange (ETDEWEB)

Schreiber, Sascha

2006-01-15

Within this work epitaxial 3C-SiC-films were grown on Si(001) substrates and on ion beam synthesized 3C-SiC(001) pseudo substrates. A rather new process was used which is based on the simultaneous deposition of C60 and Si. In order to set up the necessary experimental conditions an ultra-high vacuum chamber has been designed and built. A RHEED system was used to examine SiC film growth in-situ. Using the described technique 3C-SiC films were grown void-free on Si(001) substrates. Deposition rates of C60 and Si were chosen adequately to maintain a Si:C ratio of approximately one during the deposition process. It was shown that stoichiometric and epitaxial 3C-SiC growth with the characteristic relationship (001)[110]Si(001)[110]3C-SiC could be achieved. TEM investigations revealed that the grown 3C-SiC films consist of individual grains that extend from the Si substrate to the film surface. Two characteristic grain types could be identified. The correlation between structure and texture of void-free grown 3C-SiC films and film thickness was studied by X-ray diffraction (XRD). Pole figure measurements showed that thin films only contain first-order 3C-SiC twins. With higher film thickness also second-order twins are found which are located as twin lamellae in grain type 2. Improvement of polar texture with increasing film thickness couldn't be observed in the investigated range of up to 550 nm. On ion beam synthesized 3C-SiC pseudo substrates homoepitaxial 3C-SiC growth could be demonstrated for the first time by using a C{sub 60} carbon source. In respect to the crystalline quality of the grown films the surface quality of the used substrates was identified as a crucial factor. Furthermore a correlation between the ratio of deposition rates of C{sub 60} and Si and 3C-SiC film quality could be found. Under silicon-rich conditions, i.e. with a Si:C ratio of slightly greater one, homoepitaxial 3C-SiC layer-by-layer growth can be achieved. Films grown under these

The methylenetetrahydrofolate reductase c.c.677 C>T and c.c.1298 A>C polymorphisms in reproductive failures: Experience from an RSA and RIF study on a Polish population.

Science.gov (United States)

Nowak, Izabela; Bylińska, Aleksandra; Wilczyńska, Karolina; Wiśniewski, Andrzej; Malinowski, Andrzej; Wilczyński, Jacek R; Radwan, Paweł; Radwan, Michał; Barcz, Ewa; Płoski, Rafał; Motak-Pochrzęst, Hanna; Banasik, Małgorzata; Sobczyński, Maciej; Kuśnierczyk, Piotr

2017-01-01

Almost 1600 individuals from the Polish population were recruited to this study. Among them 319 were fertile couples, 289 were recurrent spontaneous abortion (RSA) couples, and 131 were in the group of recurrent implantation failure (RIF) following in vitro fertilization. The aim of this study was to evaluate the MTHFR c.c.677 C>T and c.c.1298 A>C polymorphisms' association with RSA and RIF. We used PCR-RFLP with HinfI (677 C>T) and MboII (1298 A>C) digestion. We observed a protective effect of the female AC genotype (OR = 0.64, p = 0.01) and the C allele (AC+CC genotypes; OR = 0.65, p = 0.009) against RSA. Moreover, 1298 AA/677 CT women were more frequent in RSA (31.14%) and RIF (25.20%) groups in comparison to fertile women (22.88%), although this difference was significant only in the case of RSA (p = 0.022, OR = 1.52). Male combined genotype analysis revealed no association with reproductive failure of their partners. Nevertheless, the female/male combination AA/AC of the 1298 polymorphism was more frequent in RSA couples (p = 0.049, OR = 1.49). However, the significant results became insignificant after Bonferroni correction. In addition, analysis of haplotypes showed significantly higher frequency of the C/C haplotype (1298 C/677 C) in the female control group than in the female RSA group (p = 0.03, OR = 0.77). Moreover, the association between elevated homocysteine (Hcy) level in plasma of RSA and RIF women and MTHFR polymorphisms was investigated but did not reveal significant differences. In conclusion, for clinical practice, it is better to check the homocysteine level in plasma and, if the Hcy level is increased, to recommend patients to take folic acid supplements rather than undergo screening of MTHFR for 1298 A>C and 677 C>T polymorphisms.

Synthesis of the C(18)–C(34) Fragment of Amphidinolide C and the C(18)–C(29) Fragment of Amphidinolide F

Science.gov (United States)

Roy, Sudeshna; Spilling, Christopher D.

2010-01-01

A convergent synthesis of the C(18)–C(34) fragment of amphidinolide C and the C(18)–C(29) fragment of amphidinolide F is reported. The approach involves the synthesis of the common intermediate tetrahydrofuranyl-β-ketophosphonate via cross metathesis, Pd(0)-catalyzed cyclization and hydroboration-oxidation. The β-ketophosphonate was coupled to three side chain aldehydes using a Horner-Wadsworth-Emmons (HWE) olefination reaction to give dienones, which were reduced with L-selectride to give the fragments of amphidinolide C and F. PMID:21028791

Hemoglobin C, S-C, and E Diseases

Science.gov (United States)

... quickly than others, resulting in chronic anemia. Hemoglobin C disease Hemoglobin C disease occurs mostly in blacks. ... a common complication of hemoglobin C disease. Hemoglobin S-C disease Hemoglobin S-C disease occurs in people who ...

C r C =

Indian Academy of Sciences (India)

Administrator

C r. C. = CTPPY: concentration of TPPY; CAuNPs: concentration of Au NPs. The concentration of the Au NPs is calculated as follows: (1) The weight of Au (WAu) produced from the complete reduction of HAuCl4 is calculated by multiplying the mole of added HAuCl4 (weight of added. HAuCl4·4H2O divided by molecular ...

Fourier spectroscopy of the 12C2, 13C2, and 12C13C (0-0) swan bands

International Nuclear Information System (INIS)

Amiot, C.

1983-01-01

The (0-0) band of the C 2 Swan electronic system d 3 Pi/sub g/→a 3 Pi/sub u/ has been recorded by Fourier spectroscopy. The three isotopes species 12 C 2 , 13 C 2 , and 12 C 13 C were investigated. The observed wavenumbers were reduced to molecular parameters using a nonlinear least-square fitting procedure. Well-known perturbations at N' = 47 and N' = 51 again observed in the e 12 C 2 d 3 Pi/sub g/ (v = 0) level. Perturbations of the same kind are present in the 13 C 2 spectrum at N' = 34 and N' = 44,48,52. The 12 C 13 C spectrum exhibits in the observed spectral range a unique perturbation for N' = 41

Advanced C and C++ compiling

CERN Document Server

Stevanovic, Milan

2014-01-01

Learning how to write C/C++ code is only the first step. To be a serious programmer, you need to understand the structure and purpose of the binary files produced by the compiler: object files, static libraries, shared libraries, and, of course, executables.Advanced C and C++ Compiling explains the build process in detail and shows how to integrate code from other developers in the form of deployed libraries as well as how to resolve issues and potential mismatches between your own and external code trees.With the proliferation of open source, understanding these issues is increasingly the res

Oxidation behavior of TiC, ZrC, and HfC dispersed in oxide matrices

International Nuclear Information System (INIS)

Arun, R.; Subramanian, M.; Mehrotra, G.M.

1990-01-01

The oxidation behavior of hot pressed TiC-Al 2 O 3 , TiC-ZrO 2 , ZrC-ZrO 2 , and HfC-HfO 2 composites has been investigated at 1273 K. The oxidation of TiC, ZrC, and HfC in hot-pressed composites containing ZrO 2 and HfO 2 has been found to be extremely rapid. The kinetics of oxidation of TiC and a 90 wt% TiC-Al 2 O 3 composite appear to be faster compared to that of pure TiC. X-ray diffraction results for hot-pressed ZrC-HfO 2 and HfC-HfO 2 composites indicate partial stabilization of tetragonal ZrO 2 and HfO 2 phases in these composites

De novo Transcriptome Assembly and Comparison of C3, C3-C4, and C4 Species of Tribe Salsoleae (Chenopodiaceae

Directory of Open Access Journals (Sweden)

Maximilian Lauterbach

2017-11-01

Full Text Available C4 photosynthesis is a carbon-concentrating mechanism that evolved independently more than 60 times in a wide range of angiosperm lineages. Among other alterations, the evolution of C4 from ancestral C3 photosynthesis requires changes in the expression of a vast number of genes. Differential gene expression analyses between closely related C3 and C4 species have significantly increased our understanding of C4 functioning and evolution. In Chenopodiaceae, a family that is rich in C4 origins and photosynthetic types, the anatomy, physiology and phylogeny of C4, C2, and C3 species of Salsoleae has been studied in great detail, which facilitated the choice of six samples of five representative species with different photosynthetic types for transcriptome comparisons. mRNA from assimilating organs of each species was sequenced in triplicates, and sequence reads were de novo assembled. These novel genetic resources were then analyzed to provide a better understanding of differential gene expression between C3, C2 and C4 species. All three analyzed C4 species belong to the NADP-ME type as most genes encoding core enzymes of this C4 cycle are highly expressed. The abundance of photorespiratory transcripts is decreased compared to the C3 and C2 species. Like in other C4 lineages of Caryophyllales, our results suggest that PEPC1 is the C4-specific isoform in Salsoleae. Two recently identified transporters from the PHT4 protein family may not only be related to the C4 syndrome, but also active in C2 photosynthesis in Salsoleae. In the two populations of the C2 species S. divaricata transcript abundance of several C4 genes are slightly increased, however, a C4 cycle is not detectable in the carbon isotope values. Most of the core enzymes of photorespiration are highly increased in the C2 species compared to both C3 and C4 species, confirming a successful establishment of the C2 photosynthetic pathway. Furthermore, a function of PEP-CK in C2 photosynthesis

Alcohol binding in the C1 (C1A + C1B) domain of protein kinase C epsilon

Science.gov (United States)

Pany, Satyabrata; Das, Joydip

2015-01-01

Background Alcohol regulates the expression and function of protein kinase C epsilon (PKCε). In a previous study we identified an alcohol binding site in the C1B, one of the twin C1 subdomains of PKCε. Methods In this study, we investigated alcohol binding in the entire C1 domain (combined C1A and C1B) of PKCε. Fluorescent phorbol ester, SAPD and fluorescent diacylglycerol (DAG) analog, dansyl-DAG were used to study the effect of ethanol, butanol, and octanol on the ligand binding using fluorescence resonance energy transfer (FRET). To identify alcohol binding site(s), PKCεC1 was photolabeled with 3-azibutanol and 3-azioctanol, and analyzed by mass spectrometry. The effects of alcohols and the azialcohols on PKCε were studied in NG108-15 cells. Results In the presence of alcohol, SAPD and dansyl-DAG showed different extent of FRET, indicating differential effects of alcohol on the C1A and C1B subdomains. Effects of alcohols and azialcohols on PKCε in NG108-15 cells were comparable. Azialcohols labeled Tyr-176 of C1A and Tyr-250 of C1B. Inspection of the model structure of PKCεC1 reveals that these residues are 40 Å apart from each other indicating that these residues form two different alcohol binding sites. Conclusions The present results provide evidence for the presence of multiple alcohol-binding sites on PKCε and underscore the importance of targeting this PKC isoform in developing alcohol antagonists. PMID:26210390

Molecular resonances in sub-Coulomb energy region (12C-12C, 12C-24Mg, 12C-9Be systems)

International Nuclear Information System (INIS)

Takimoto, Kiyohiko; Shimomura, Susumu; Tanaka, Makoto; Murakami, Tetsuya; Fukada, Mamoru; Sakaguchi, Atsushi

1982-01-01

Molecular resonance in sub-Coulomb energy region was studied on 12 C- 12 C, 12 C- 24 Mg and 12 C- 9 Be systems. The excitation functions and the angular distributions were measured on the reactions 12 C( 12 C, 8 Besub(g,s,)) 16 Osub(g,s,), 24 Mg( 12 C, α) 32 S and 9 Be ( 12 C, 8 Besub(g,s,)) 13 Csub(g,s,). Sub-Coulomb resonances were observed in all systems and the contribution of the 12 Csub(2nd)*(0 + , 7.65 MeV) state is proposed. (author)

Borane-catalyzed cracking of C-C bonds in coal; Boran-katalysierte C-C-Bindungungsspaltung in Steinkohle

Energy Technology Data Exchange (ETDEWEB)

Narangerel, J; Haenel, M W [Max-Planck-Institut fuer Kohlenforschung, Muelheim an der Ruhr (Germany)

1998-09-01

Coal, especially coking coal, was reacted with hydrogen at comparatively mild reaction conditions (150-280 degrees centigrade, 20 MPa hydrogen pressure) in the presence of catalysts consisting of borange reagents and certain transition metal halides to obtaine more than 80 percent of pyridine-soluble products. The influence of the degree of coalification, catalyst and temperature on the borane-catalyzed hydrogenolysis of C-C bonds in coal was investigated. (orig.) [Deutsch] Steinkohlen, insbesondere im Inkohlungsbereich der Fettkohlen (Kokskohlen), werden in Gegenwart von Katalysatoren aus Boran-Reagentien und bestimmten Uebergangsmetallhalogeniden mit Wasserstoff bei vergleichsweise milden Reaktionsbedingungen (250-280 C, 20 MPa Wasserstoffdruck) in zu ueber 80% pyridinloesliche Produkte umgewandelt. Der Einfluss von Inkohlungsgrad, Katalysator und Temperatur auf die Boran-katalysierte C-C-Bindungshydrogenolyse in Kohle wurde untersucht. (orig.)

Determination of material properties for short fibre reinforced C/C-SiC

Directory of Open Access Journals (Sweden)

Hausherr J.-M.

2015-01-01

Full Text Available Determining the mechanical properties of short fibre reinforced CMC using standard sized coupons has always been a challenge due to a high statistical scattering of the measured values. Although the random orientation of short fibres results in a quasi-isotropic material behavior of 2D-structures with a sufficiently large volume, the small volume typical for test coupons usually results in a non-isotropic fibre orientation in the tested volume. This paper describes a method for manufacturing unidirectional oriented short fibre reinforced CMC materials and presents material properties of UD-C/C-SiC. After verifying the fibre orientation of the CMC using micro-computed tomography, coupons were extracted to determine the orthotropic material properties. These orthotropic material properties were then used to predict the properties of C/C-SiC with randomly distributed short fibres. To validate the method, micro-computed tomography is used to quantitatively determine the fibre orientation within coupons extracted from randomly distributed short fibre C/C-SiC. After mechanical three-point-bending tests, the measured stiffness and bending strength is compared with the predicted properties. Finally, the data are used to devise a method suited for reducing the inherent large spread of material properties associated with the measurement of CMC materials with randomly distributed short fibres.

Synthesis of [5,6-13C2, 1-14C]olivetolic acid, methyl [1'-13C]olivetolate and [5,6-13C2, 1-14C]cannabigerolic acid

International Nuclear Information System (INIS)

Porwoll, J.P.; Leete, E.

1985-01-01

Potential advanced intermediates in the biosynthesis of delta 9 -tetrahydrocannabinol, the major psychoactive principle of marijuana, have been synthesized labeled with two contiguous 13 C atoms and 14 C. Methyl [5,6- 13 C 2 , 1- 14 C]olivetolate was prepared from lithium [ 13 C 2 ]acetylide and dimethyl [2- 14 C]malonate. Reaction with geranyl bromide afforded methyl [5,6- 13 C 2 , 1- 14 C]cannabigerolate, and hydrolysis of these methyl esters with lithium propyl mercaptide yielded the corresponding labeled acids. The 13 C- 13 C couplings observable in the 13 C NMR spectra of these 13 C-enriched compounds and their synthetic precursors are recorded. Methyl [1'- 14 C]olivetolate was prepared from 13 CO 2 to confirm assignments of the 13 C chemical shifts in the pentyl side chain of these compounds. (author)

Research and Development programs for HTGRs in JAERI

Energy Technology Data Exchange (ETDEWEB)

Nishiguchi, Isoharu; Saito, Sinzo [Department of HTTR Project, Japan Atomic Energy Research Institute (Japan)

1990-07-01

Since 1969, JAERI has conducted research and development (R and D) programs for High-Temperature Gas-Cooled Reactors (HTGR). And the High Temperature engineering Test Reactor (HTTR), which will be the first High Temperature Gas Cooled Reactor (HTGR) in Japan, is under licensing process now. In this paper, some of the results of R and D are outlined in the following fields which are closely connected with the HTTR design, that is: i) fuel; ii) nuclear design; iii) thermal-hydraulic design; iv) graphite structure and v) high temperature metal structure. In the field of fuel, extensive investigations have been performed to develop the fabrication technology of coated particle fuel (cpf). In parallel, data of coated fuel particle failure and fission product release in in- and ex-reactor experiments as well as mechanical properties data were obtained and irradiation tests have been done using the Oarai Gas Loop No.1 (OGL-1) to verify the integrity of mass-produced fuel. Concerning the nuclear design, critical experiments were conducted using the Very High-Temperature Reactor Critical Assembly (VHTRC). Also carried out were hydrodynamical and thermal experiments using the Helium Engineering Demonstration Loop (HENDEL). On the graphite structures which compose the reactor internals, design criteria have been developed based on ASME BandPV Code Section III Div.2, subsection CE and design data have been accumulated on a domestic graphite material. High temperature metal structure is also one of major subjects of R and D for HTGRs. Hastelloy XR, which is a modified version of Hastelloy X, was developed and various tests have been conducted which include creep tests, creep-fatigue tests, etc. to establish design criteria and allowables. Component tests of the Intermediate Heat Exchanger (IHX) have been also performed. (author)

Research and Development programs for HTGRs in JAERI

International Nuclear Information System (INIS)

Nishiguchi, Isoharu; Saito, Sinzo

1990-01-01

Since 1969, JAERI has conducted research and development (R and D) programs for High-Temperature Gas-Cooled Reactors (HTGR). And the High Temperature engineering Test Reactor (HTTR), which will be the first High Temperature Gas Cooled Reactor (HTGR) in Japan, is under licensing process now. In this paper, some of the results of R and D are outlined in the following fields which are closely connected with the HTTR design, that is: i) fuel; ii) nuclear design; iii) thermal-hydraulic design; iv) graphite structure and v) high temperature metal structure. In the field of fuel, extensive investigations have been performed to develop the fabrication technology of coated particle fuel (cpf). In parallel, data of coated fuel particle failure and fission product release in in- and ex-reactor experiments as well as mechanical properties data were obtained and irradiation tests have been done using the Oarai Gas Loop No.1 (OGL-1) to verify the integrity of mass-produced fuel. Concerning the nuclear design, critical experiments were conducted using the Very High-Temperature Reactor Critical Assembly (VHTRC). Also carried out were hydrodynamical and thermal experiments using the Helium Engineering Demonstration Loop (HENDEL). On the graphite structures which compose the reactor internals, design criteria have been developed based on ASME BandPV Code Section III Div.2, subsection CE and design data have been accumulated on a domestic graphite material. High temperature metal structure is also one of major subjects of R and D for HTGRs. Hastelloy XR, which is a modified version of Hastelloy X, was developed and various tests have been conducted which include creep tests, creep-fatigue tests, etc. to establish design criteria and allowables. Component tests of the Intermediate Heat Exchanger (IHX) have been also performed. (author)

Synthesis of [2-13C, 2-14C] 2-aminoethanol, [1-13C, 1-14C] 2-chloroethylamine, N,N'-bis([1-13C, 1-14C] 2-chloroethyl)-N-nitrosourea(BCNU) and N-([1-13C, 1-14C] 2-chloroethyl)-N-nitrosourea(CNU)

International Nuclear Information System (INIS)

Narayan, R.; Chang, C-j.

1982-01-01

[2- 13 C, 2- 14 C]2-Aminoethanol hydrochloride was prepared in good yield from Na*CN in a two step sequence by first converting the Na*CN to OHCH 2 *CN and then reducing the nitrile directly with a solution of borane-tetrahydrofuran complex. The reaction procedure was simple and the pure product could be obtained readily. Using this specifically labelled precursor, the synthesis of [1- 13 C, 1- 14 C]2-chloroethylamine hydrochloride, N-([1- 13 C, 1- 14 C]2-chloroethyl)-N-nitrosourea(CNU) and N,N'-bis([1- 13 C, 1- 14 C]2-chloroethyl)-N-nitrosourea(BCNU) in good yield without isotope scrambling was also reported. (author)

Gas-phase reactivity of lanthanide cations with fluorocarbons: C-F versus C-H and C-C bond activation

International Nuclear Information System (INIS)

Cornehl, H.H.; Hornung, G.; Schwarz, H.

1996-01-01

The gas-phase reactivity of the fluorinated hydrocarbons CF 4 , CHF 3 , CH 3 F, C 2 F 6 , 1,1-C 2 H 4 F 2 , and C 6 F 6 with the lanthanide cations Ce + , Pr + , Sm + , Ho + , Tm + , and Yb + and the reactivity of C 6 H 5 F with all lanthanide cations Ln + (Ln = La-Lu, with the exception of Pm + ) have been examined by Fourier-transform ion cyclotron resonance mass spectrometry. The perfluorinated compounds tetrafluoromethane and hexafluoroethane as well as trifluoromethane do not react with any lanthanide cation. Selective activation of the strong C-F bonds in fluoromethane, 1,1-difluoroethane, hexafluorobenzene, and fluorobenzene appears as a general reaction scheme along the 4f row. Experimental evidence is given for a 'harpoon'-like mechanism for the F atom abstraction process which operates via an initial electron transfer from the lanthanide cation to the fluorinated substrate in the encounter complex Ln + RF. The most reactive lanthanides La + , Ce + , Gd + , and Tb + and also the formal closed-shell species Lu + exhibit additional C-H and C-C bond activation pathways in the reaction with fluorobenzene, namely dehydrohalogenation as well as loss of a neutral acetylene molecule. In the case of Tm + and Yb + the formation of neutral LnF 3 is observed in a multistep process via C-C coupling and charge transfer. 17 refs., 2 figs., 2 tabs

Atmospheric histories and growth trends of C4F10, C5F12, C6F14, C7F16 and C8F18

Directory of Open Access Journals (Sweden)

R. F. Weiss

2012-05-01

Full Text Available Atmospheric observations and trends are presented for the high molecular weight perfluorocarbons (PFCs: decafluorobutane (C4F10, dodecafluoropentane (C5F12, tetradecafluorohexane (C6F14, hexadecafluoroheptane (C7F16 and octadecafluorooctane (C8F18. Their atmospheric histories are based on measurements of 36 Northern Hemisphere and 46 Southern Hemisphere archived air samples collected between 1973 to 2011 using the Advanced Global Atmospheric Gases Experiment (AGAGE "Medusa" preconcentration gas chromatography-mass spectrometry systems. A new calibration scale was prepared for each PFC, with estimated accuracies of 6.8% for C4F10, 7.8% for C5F12, 4.0% for C6F14, 6.6% for C7F16 and 7.9% for C8F18. Based on our observations the 2011 globally averaged dry air mole fractions of these heavy PFCs are: 0.17 parts-per-trillion (ppt, i.e., parts per 1012 for C4F10, 0.12 ppt for C5F12, 0.27 ppt for C6F14, 0.12 ppt for C7F16 and 0.09 ppt for C8F18. These atmospheric mole fractions combine to contribute to a global average radiative forcing of 0.35 mW m−2, which is 6% of the total anthropogenic PFC radiative forcing (Montzka and Reimann, 2011; Oram et al., 2012. The growth rates of the heavy perfluorocarbons were largest in the late 1990s peaking at 6.2 parts per quadrillion (ppq, i.e., parts per 1015 per year (yr for C4F10, at 5.0 ppq yr−1 for C5F12 and 16.6 ppq yr−1 for C6F14 and in the early 1990s for C7F16 at 4.7 ppq yr−1 and in the mid 1990s for C8F18 at 4.8 ppq yr−1. The 2011 globally averaged mean atmospheric growth rates of these PFCs are subsequently lower at 2.2 ppq yr−1 for C4F10, 1.4 ppq yr−1 for C5F12, 5.0 ppq yr−1 for C6F14, 3.4 ppq yr−1 for C7F16 and 0.9 ppq yr−1 for C8F18. The more recent slowdown in the growth rates suggests that emissions are declining as compared to the 1980s and 1990s.

Recanning of canned motors (Paper No. 6.3)

International Nuclear Information System (INIS)

Lahiri, B.N.; Venkatappiah, J.; Srikrishnamurthy, G.

1992-01-01

Good performance of any plant necessarily depends on the quality of preventive as well as break-down maintenance management practised along with the adequacy of knowledge and skill of the supporting personnel. Heavy water plants, operating under exceedingly high pressure and varied corrosive atmospheres definitely call for additional care and attention in this regard. Canned motors of different power ratings and shapes find their use in operating heavy water plants. In this paper, complete re-canning procedure of one such canned motor has been discussed giving design details of hydraulic expansion fixture and pulsed-tig welding procedure for longitudinal seam and circumferential edge welding of 0.5 mm thick hastelloy cans. (author). 4 figs

Progress in understanding the mechanical behavior of pressure-vessel materials at elevated temperatures

International Nuclear Information System (INIS)

Swindeman, R.W.; Brinkman, C.R.

1981-01-01

Progress during the 1970's on the production of high-temperature mechanical properties data for pressure vessel materials was reviewed. The direction of the research was toward satisfying new data requirements to implement advances in high-temperature inelastic design methods. To meet these needs, servo-controlled testing machines and high-resolution extensometry were developed to gain more information on the essential behavioral features of high-temperature alloys. The similarities and differences in the mechanical response of various pressure vessel materials were identified. High-temperature pressure vessel materials that have received the most attention included Type 304 stainless steel, Type 316 stainless steel, 2 1/4 Cr-1 Mo steel, alloy 800H, and Hastelloy X

A specific assay for quantification of human C4c by use of an anti-C4c monoclonal antibody

DEFF Research Database (Denmark)

Pilely, Katrine; Skjoedt, Mikkel-Ole; Nielsen, Christian

2014-01-01

a mouse monoclonal antibody (mAb) that is able to detect fluid phase C4c without interference from other products generated from the complement component C4. The C4c specific mAb was tested in different enzyme-linked immunosorbent assay (ELISA) combinations with various types of in vitro activated sera...

Early antihepatitis C virus response with second-generation C200/C22 ELISA

NARCIS (Netherlands)

van der Poel, C. L.; Bresters, D.; Reesink, H. W.; Plaisier, A. A.; Schaasberg, W.; Leentvaar-Kuypers, A.; Choo, Q. L.; Quan, S.; Polito, A.; Houghton, M.

1992-01-01

Detection of early antibody to hepatitis C virus (HCV) by a new second-generation C200/C22 anti-HCV enzyme-linked immunosorbent assay (ELISA) and a four-antigen recombinant immunoblot assay (4-RIBA) was compared with the first-generation anti-HCV C100 ELISA using sequential serum samples of 9

Despite phylogenetic effects, C3-C4 lineages bridge the ecological gap to C4 photosynthesis.

Science.gov (United States)

Lundgren, Marjorie R; Christin, Pascal-Antoine

2017-01-01

C 4 photosynthesis is a physiological innovation involving several anatomical and biochemical components that emerged recurrently in flowering plants. This complex trait evolved via a series of physiological intermediates, broadly termed 'C 3 -C 4 ', which have been widely studied to understand C 4 origins. While this research program has focused on biochemistry, physiology, and anatomy, the ecology of these intermediates remains largely unexplored. Here, we use global occurrence data and local habitat descriptions to characterize the niches of multiple C 3 -C 4 lineages, as well as their close C 3 and C 4 relatives. While C 3 -C 4 taxa tend to occur in warm climates, their abiotic niches are spread along other dimensions, making it impossible to define a universal C 3 -C 4 niche. Phylogeny-based comparisons suggest that, despite shifts associated with photosynthetic types, the precipitation component of the C 3 -C 4 niche is particularly lineage specific, being highly correlated with that of closely related C 3 and C 4 taxa. Our large-scale analyses suggest that C 3 -C 4 lineages converged toward warm habitats, which may have facilitated the transition to C 4 photosynthesis, effectively bridging the ecological gap between C 3 and C 4 plants. The intermediates retained some precipitation aspects of their C 3 ancestors' habitat, and likely transmitted them to their C 4 descendants, contributing to the diversity among C 4 lineages seen today. © The Author 2016. Published by Oxford University Press on behalf of the Society for Experimental Biology.

Geometric factors in f.c.c. and b.c.c. metal-on-metal epitaxy

International Nuclear Information System (INIS)

Bruce, L.A.; Jaeger, H.

1978-01-01

Deposits of Ni, Au and Ag formed by condensing metal vapour in U.H.V. onto (001)W, held at a temperature Tsub(s) in the range 300K< Tsub(s)<1200 K, always form epitaxial layers. However, while Au and Ag form (001) epitaxial layers of f.c.c. single crystals, (001)d parallel to (001)s with, say, [110]d parallel to [010]s, Ni and Cu occur in two orthogonal domains, each characterized by an exclusive set of fault (or twin) planes. Within a fault plane, atoms are hexagonally close-packed and, within a domain, fault planes are normal to either [1-1-0]s or [1-10]s and a close-packed direction in the planes is normal to the substrate. The lateral stacking of the fault planes may range from random at low values of Tsub(s) to that of, say, (11-1-) planes in heavily faulted and/or twinned (110) epitaxed f.c.c. material, or of basal planes in (110) epitaxed h.c.p. material at high values of Tsub(s). The results are readily explained on the basis of a growth model developed for deposits of Ni and Cu on (001) Ag. (author)

Low dose irradiation performance of SiC interphase SiC/SiC composites

International Nuclear Information System (INIS)

Snead, L.L.; Lowden, R.A.; Strizak, J.; More, K.L.; Eatherly, W.S.; Bailey, J.; Williams, A.M.; Osborne, M.C.; Shinavski, R.J.

1998-01-01

Reduced oxygen Hi-Nicalon fiber reinforced composite SiC materials were densified with a chemically vapor infiltrated (CVI) silicon carbide (SiC) matrix and interphases of either 'porous' SiC or multilayer SiC and irradiated to a neutron fluence of 1.1 x 10 25 n m -2 (E>0.1 MeV) in the temperature range of 260 to 1060 C. The unirradiated properties of these composites are superior to previously studied ceramic grade Nicalon fiber reinforced/carbon interphase materials. Negligible reduction in the macroscopic matrix microcracking stress was observed after irradiation for the multilayer SiC interphase material and a slight reduction in matrix microcracking stress was observed for the composite with porous SiC interphase. The reduction in strength for the porous SiC interfacial material is greatest for the highest irradiation temperature. The ultimate fracture stress (in four point bending) following irradiation for the multilayer SiC and porous SiC interphase materials was reduced by 15% and 30%, respectively, which is an improvement over the 40% reduction suffered by irradiated ceramic grade Nicalon fiber materials fabricated in a similar fashion, though with a carbon interphase. The degradation of the mechanical properties of these composites is analyzed by comparison with the irradiation behavior of bare Hi-Nicalon fiber and Morton chemically vapor deposited (CVD) SiC. It is concluded that the degradation of these composites, as with the previous generation ceramic grade Nicalon fiber materials, is dominated by interfacial effects, though the overall degradation of fiber and hence composite is reduced for the newer low-oxygen fiber. (orig.)

Highly Stable [C60AuC60]+/- Dumbbells.

Science.gov (United States)

Goulart, Marcelo; Kuhn, Martin; Martini, Paul; Chen, Lei; Hagelberg, Frank; Kaiser, Alexander; Scheier, Paul; Ellis, Andrew M

2018-05-17

Ionic complexes between gold and C 60 have been observed for the first time. Cations and anions of the type [Au(C 60 ) 2 ] +/- are shown to have particular stability. Calculations suggest that these ions adopt a C 60 -Au-C 60 sandwich-like (dumbbell) structure, which is reminiscent of [XAuX] +/- ions previously observed for much smaller ligands. The [Au(C 60 ) 2 ] +/- ions can be regarded as Au(I) complexes, regardless of whether the net charge is positive or negative, but in both cases, the charge transfer between the Au and C 60 is incomplete, most likely because of a covalent contribution to the Au-C 60 binding. The C 60 -Au-C 60 dumbbell structure represents a new architecture in fullerene chemistry that might be replicable in synthetic nanostructures.

SiC-SiC and C-SiC Honeycomb for Advanced Flight Structures, Phase II

Data.gov (United States)

National Aeronautics and Space Administration — The proposed project builds upon the work done in Phase I with the development of a C-SiC CMC honeycomb material that was successfully tested for mechanical...

Quantification of C=C and C=O Surface Carbons in Detonation Nanodiamond by NMR

Energy Technology Data Exchange (ETDEWEB)

Cui, J -F; Fang, X -W; Schmidt-Rohr, K

2014-05-08

The ability of solid-state 13C NMR to detect and quantify small amounts of sp2-hybridized carbon on the surface of ~5 nm diameter nanodiamond particles is demonstrated. The C=C carbon fraction is only 1.1 ± 0.4% in pristine purified detonation nanodiamond, while a full single-layer graphitic or “bucky diamond” shell would contain ca. 25% of all C in a 5 nm diameter particle. Instead of large aromatic patches repeatedly proposed in the recent literature, sp3-hybridized CH and COH carbons cover most of the nanodiamond particle surface, accounting for ~5% each. C=O and COO groups also seen in X-ray absorption near-edge structure spectroscopy (XANES) but not detected in previous NMR studies make up ca. 1.5% of all C. They are removed by heat treatment at 800 °C, which increases the aromatic fraction. 13C{1H} NMR demonstrates that the various sp2-hybridized carbons are mostly not protonated, but cross-polarization shows that they are separated from 1H by only a few bond lengths, which proves that they are near the protonated surface. Together, the observed C–H, C–OH, C=O, and C=C groups account for 12–14% of all C, which matches the surface fraction expected for bulk-terminated 5 nm diameter diamond particles.

A comparative study of low energy radiation responses of SiC, TiC and ZrC

International Nuclear Information System (INIS)

Jiang, M.; Xiao, H.Y.; Zhang, H.B.; Peng, S.M.; Xu, C.H.; Liu, Z.J.; Zu, X.T.

2016-01-01

In this study, an ab initio molecular dynamics method is employed to compare the responses of SiC, TiC and ZrC to low energy irradiation. It reveals that C displacements are dominant in the cascade events of the three carbides. The associated defects in SiC are mainly Frenkel pairs and antisite defects, whereas damage end states in TiC and ZrC generally consist of Frenkel pairs and very few antisite defects are created. It is proposed that the susceptibility to antisite formation in SiC contributes to its crystalline-to-amorphous transformation under irradiation that is observed experimentally. The stronger radiation tolerance of TiC and ZrC than SiC can be originated from their different electronic structures, i.e., the C> and C> bonds are a mixture of covalent, metallic, and ionic character, whereas the C> bond is mainly covalent. The presented results provide underlying mechanisms for defect generation in SiC, TiC and ZrC, and advance the fundamental understanding of the radiation resistances of carbide materials.

Investigation of corrosion and analysis of passive films concerning some nickel alloys and stainless steels in reconstructed geological environments

International Nuclear Information System (INIS)

Jallerat, Nelly

1984-01-01

This research thesis addresses the corrosion behaviour of materials which might be used for the fabrication of radioactive waste containers. After a bibliographical study on films formed on Fe-Cr-Ni alloys, this research concentrates on passivation and de-passivation phenomena of three nickel-base alloys among the most resistant to corrosion and which also meet processing and economic criteria: Hastelloy C4, Inconel 625 and ZICNDU 25-20. Titanium and Ti-Pd alloy are also studied. Parameters governing pitting corrosion are notably studied. After a recall of knowledge on passive films formed on Fe-Cr-Ni alloys, and a presentation of experimental and technical conditions, the author reports and discussed the results obtained by electrochemical studies, reports the determination of factors governing alloy passivation in geological waters. The influence of some soluble impurities is notably studied. The author reports the analysis by glow discharge optical emission spectrometry to determine the composition of passive films with respect to geological water nature, the immersion duration and the electrode potential. Additional surface analyses are performed by X-ray photoelectron spectrometry (XPS or ESCA) and secondary ion mass spectrometry (SIMS). Finally, the author uses a dosing method by neutron radio-activation of alloy elements to determine dissolution mechanisms [fr

Effects of a range of machined and ground surface finishes on the simulated reactor helium corrosion of several candidate structural materials

International Nuclear Information System (INIS)

Thompson, L.D.

1981-02-01

This report discusses the corrosion behavior of several candidate reactor structural alloys in a simulated advanced high-temperature gas-cooled reactor (HTGR) environment over a range of lathe-machined and centerless-ground surface finishes. The helium environment contained 50 Pa H 2 /5 Pa CO/5 Pa CH 4 / 2 O (500 μatm H 2 /50 μatm CO/50 μatm CH 4 / 2 O) at 900 0 C for a total exposure of 3000 h. The test alloys included two vacuum-cast superalloys (IN 100 and IN 713LC); a centrifugally cast austenitic alloy (HK 40); three wrought high-temperature alloys (Alloy 800H, Hastelloy X, and Inconel 617); and a nickel-base oxide-dispersion-strengthened alloy (Inconel MA 754). Surface finish variations did not affect the simulated advanced-HTGR corrosion behavior of these materials. Under these conditions, the availability of reactant gaseous impurities controls the kinetics of the observed gas-metal interactions. Variations in the near-surface activities and mobilities of reactive solute elements, such as chromium, which might be expected to be affected by changes in surface finish, do not seem to greatly influence corrosion in this simulated advanced HTGR environment. 18 figures, 4 tables

Research and development on chemical reactors made of industrial structural materials and hydriodic acid concentration technique for thermochemical hydrogen production IS process

International Nuclear Information System (INIS)

Kubo, Shinji; Iwatsuki, Jin; Takegami, Hiroaki; Kasahara, Seiji; Tanaka, Nobuyuki; Noguchi, Hiroki; Kamiji, Yu; Onuki, Kaoru

2015-10-01

Japan Atomic Energy Agency has been conducting a study on IS process for thermochemical hydrogen production in order to develop massive hydrogen production technology for hydrogen society. Integrity of the chemical reactors and concentration technology of hydrogen iodide in HIx solution were studied. In the former study, the chemical reactors were trial-fabricated using industrial materials. A test of 30 times of thermal cycle test under circulating condition of the Bunsen reaction solution showed integrity of the Bunsen reactor made of fluororesin lined steel. Also, 100 hours of reaction tests showed integrity of the sulfuric acid decomposer made of silicon carbide and of the hydrogen iodide decomposer made of Hastelloy C-276. In the latter study, concerning electro-electrodialysis using cation-exchange membrane, sulfuric acid in the anolyte had little influence on the concentration performance. These results suggest the purification system of HIx solution can be simplified. Based on the Nernst-Planck equation and the Smoluchowski equation, proton transport number, water permeance, and IR drop of the cation exchange membrane were formulated. The derived equations enable quantitative estimation for the performance indexes of Nafion ® membrane and, also, of ETFE-St membranes made by radiation-induced graft polymerization method. (author)

Mechanical Property and Its Comparison of Superalloys for High Temperature Gas Cooled Reactor

International Nuclear Information System (INIS)

Kim, Woo Gon; Kim, D. W.; Ryu, W. S.; Han, C. H.; Yoon, J. H.; Chang, J.

2005-01-01

Since structural materials for high temperature gas cooled reactor are used during long period in nuclear environment up to 1000 .deg. C, it is important to have good properties at elevated temperature such as mechanical properties (tensile, creep, fatigue, creep-fatigue), microstructural stability, interaction between metal and gas, friction and wear, hydrogen and tritium permeation, irradiation behavior, corrosion by impurity in He. Thus, in order to select excellent materials for the high temperature gas cooled reactor, it is necessary to understand the material properties and to gather the data for them. In this report, the items related to material properties which are needed for designing the high temperature gas cooled reactor were presented. Mechanical properties; tensile, creep, and fatigue etc. were investigated for Haynes 230, Hastelloy-X, In 617 and Alloy 800H, which can be used as the major structural components, such as intermediate heat exchanger (IHX), hot duct and piping and internals. Effect of He and irradiation on these structural materials was investigated. Also, mechanical properties; physical properties, tensile properties, creep and creep crack growth rate were compared for them, respectively. These results of this report can be used as important data to select superior materials for high temperature gas reactor

Essential oils from Calyptranthes concinna, C. lucida and C. rubella (Myrtaceae Óleos essenciais de Calyptranthes concinna, C. lucida and C. rubella (Myrtaceae

Directory of Open Access Journals (Sweden)

Renata Pereira Limberger

2002-09-01

Full Text Available Essential oils from Calyptranthes concinna, C. lucida and C. rubella, collected in Southern Brazil, were analyzed by GC and GC/MS. Sixty-two compounds were identified representing about 98% of the oil contents. All samples were rich in cyclic sesquiterpenes (more than 90 %, mainly those from cadinane, bisabolane and germacrane cyclization pathway. The mainly components characterized were bicyclogermacrene (22.1% in C. concinna;11.7% in C. rubella, cis-calamenene (10.3% in C. concinna, beta-caryophyllene (16.5% in C. rubella; 9.4% in C. lucida, beta-bisabolene (25.5% in C. lucida, spathulenol (15.4% in C. rubella and caryophyllene oxide (7.6% in C. concinna.Os óleos essenciais de Calyptranthes concinna, C. lucida e C. rubella, coletadas no sul do Brasil, foram analisados por GC/FID e GC/MS. Sessenta e dois constituintes foram identificados representando cerca de 98% do óleo. Todas as amostras mostraram-se ricas em sesquiterpenos cíclicos (mais de 90%, principalmente aquelas da via de ciclização dos cadinanos, bisabolanos e germacranos. Os principais constituintes caracterizados foram biciclogermacreno (22,1% em C. concinna; 11,7% em C. rubella, cis-calameneno (10,3% em C. concinna, betacariofileno (16,5% em C. rubella; 9,4% em C. lucida, beta-bisaboleno (25,5% em C. lucida, espatulenol (15,4% em C. rubella e óxido de cariofileno (7,6% em C. concinna.

Thermal effect of TiC in the Mo/TiC/SiC system at elevated temperature

International Nuclear Information System (INIS)

Roger, Jerome; Audubert, Fabienne; Le Petitcorps, Yann

2010-01-01

In this study, we examined the effect induced by the addition of a TiC interlayer on the stability of the Mo/SiC system at high temperature. Indeed, Mo/SiC couple is unstable at high temperature with formation of Mo 2 C and Mo 5 Si 3 C x phases. In order to limit the degradation of Mo mechanical properties, a TiC film was inserted between Mo and SiC. Samples used in this work were prepared on metallic wires substrates, SiC and TiC being deposited by CVD. The protection given by TiC layer was considered in the 1473-1673 K temperature range and for TiC thicknesses up to about 60 μm. From our results, TiC is not effective enough to mitigate C and Si atoms diffusion. Nevertheless, a notable reduction of the reaction extent is obtained at any temperatures. The so-observed effect depends on the TiC thickness and the temperature. In actual fact, TiC efficiency increases when temperature and/or TiC layer thickness increases without reaching a complete protection.

The Λc(2860), Λc(2880), Ξc(3055) and Ξc(3080) as D-wave baryon states in QCD

Science.gov (United States)

Wang, Zhi-Gang

2018-01-01

In this article, we tentatively assign the Λc (2860), Λc (2880), Ξc (3055) and Ξc (3080) to be the D-wave baryon states with the spin-parity JP = 3/2+, 5/2 +, 3/2+ and 5/2+, respectively, and study their masses and pole residues with the QCD sum rules in a systematic way by constructing three-types interpolating currents with the quantum numbers (Lρ ,Lλ) = (0 , 2), (2 , 0) and (1 , 1), respectively. The present predictions favor assigning the Λc (2860), Λc (2880), Ξc (3055) and Ξc (3080) to be the D-wave baryon states with the quantum numbers (Lρ ,Lλ) = (0 , 2) and JP = 3/2+, 5/2+, 3/2+ and 5/2+, respectively. While the predictions for the masses of the (Lρ ,Lλ) = (2 , 0) and (1 , 1) D-wave Λc and Ξc states can be confronted to the experimental data in the future.

Beginning C

CERN Document Server

Horton, Ivor

2013-01-01

Beginning C, 5th Edition teaches you how to program using the widely-available C language. You'll begin from first-principles and progress through step-by-step examples to become a competent, C-language programmer. All you need are this book and any of the widely available free or commercial C or C++ compilers, and you'll soon be writing real C programs. C is a foundational language that every programmer ought to know. C is the basis for C# used in Microsoft .NET programming. It is the basis for Objective-C used in programming for the iPhone, the iPad, and other Apple devices. It is the basis

SystemC and systemC-AMS in practice systemC 2.3, 2.2 and systemC-AMS 1.0

CERN Document Server

Banerjee, Amal

2013-01-01

This book describes how engineers can make optimum use of the two industry standard analysis/design tools, SystemC and SystemC-AMS.  The authors use a system-level design approach, emphasizing how SystemC and SystemC-AMS features can be exploited most effectively to analyze/understand a given electronic system and explore the design space. The approach taken by this book enables system engineers to concentrate on only those SystemC/SystemC-AMS features that apply to their particular problem, leading to more efficient design. The presentation includes numerous, realistic and complete examples,

Hot pressing of B4C/SiC composites

International Nuclear Information System (INIS)

Sahin, F.C.; Turhan, E.; Yesilcubuk, S.A.; Addemir, O.

2005-01-01

B 4 C/SiC ceramic composites containing 10-20-30 vol % SiC were prepared by hot pressing method. The effect of SiC addition and hot pressing temperature on sintering behaviour and mechanical properties of hot pressed composites were investigated. Microstructures of hot pressed samples were examined by SEM technique. Three different temperatures (2100 deg. C, 2200 deg. C and 2250 deg. C) were used to optimize hot pressing temperature applying 100 MPa pressure under argon atmosphere during the sintering procedure. The highest relative density of 98.44 % was obtained by hot pressing at 2250 deg. C. However, bending strengths of B 4 C/SiC composite samples were lower than monolithic B 4 C in all experimental conditions. (authors)

Preparation and oxidation protection of CVD SiC/a-BC/SiC coatings for 3D C/SiC composites

International Nuclear Information System (INIS)

Liu Yongsheng; Zhang Litong; Cheng Laifei; Yang Wenbin; Zhang Weihua; Xu Yongdong

2009-01-01

An amorphous boron carbide (a-BC) coating was prepared by LPCVD process from BCl 3 -CH 4 -H 2 -Ar system. XPS result showed that the boron concentration was 15.0 at.%, and carbon was 82.0 at.%. One third of boron was distributed to a bonding with carbon and 37.0 at.% was dissolved in graphite lattice. A multiple-layered structure of CVD SiC/a-BC/SiC was coated on 3D C/SiC composites. Oxidation tests were conducted at 700, 1000, and 1200 deg. C in 14 vol.% H 2 O/8 vol.% O 2 /78 vol.% Ar atmosphere up to 100 h. The 3D C/SiC composites with the modified coating system had a good oxidation resistance. This resulted in the high strength retained ratio of the composites even after the oxidation.

Interfacial characterization of CVI-SiC/SiC composites

International Nuclear Information System (INIS)

Yang, W.; Kohyama, A.; Noda, T.; Katoh, Y.; Hinoki, T.; Araki, H.; Yu, J.

2002-01-01

The mechanical properties of the interfaces of two families of chemical vapor infiltration SiC/SiC composites, advanced Tyranno-SA and Hi-Nicalon fibers reinforced SiC/SiC composites with various carbon and SiC/C interlayers, were investigated by single fiber push-out/push-back tests. Interfacial debonding and fibers sliding mainly occurred adjacent to the first carbon layer on the fibers. The interfacial debonding strengths and frictional stresses for both Tyranno-SA/SiC and Hi-Nicalon/SiC composites were correlated with the first carbon layer thickness. Tyranno-SA/SiC composites exhibited much larger interfacial frictional stresses compared to Hi-Nicalon/SiC composites. This was assumed to be mainly contributed by the rather rough surface of the Tyranno-SA fiber

Management of C2-C3 fracture subluxation by anterior cervical approach and C2-C3 trans-cortical screw placement

Directory of Open Access Journals (Sweden)

Agrawal Amit

2018-03-01

Full Text Available Cervical spine injuries are the major cause of morbidity and mortality in trauma victims. Upper cervical spine injuries account for about 24% of acute fractures and dislocations and one third of fractures occur at the level of C2, while one half of injuries occur at the C6 or C7 levels. In contrast to this approach we used the transverse cervical, platysma splitting incision at a lower (C3-C4 disc to expose the upper cervical spine particularly lower border of C3 (entry point for the screw.

Effective modern C++ 42 specific ways to improve your use of C++11 and C++14

CERN Document Server

Meyers, Scott

2015-01-01

At first glance, C++11 and C++14 are defined by the new features they introduce, e.g., auto type declarations, move semantics, lambda expressions, and concurrency support. Information on these features is easy to come by, but learning to apply them effectively (such that the resulting software is correct, efficient, maintainable, and portable) is more challenging. That’s the role of this book. It describes how to write effective software using C++11 and C++14, i.e., using modern C++. Topics include: * The pros and cons of uniform initialization, noexcept specifications, perfect forwarding, and smart pointer make functions. * The relationships among std::move, std::forward, rvalues references, and universal references. * The most effective forms of lambda capture. * How best practices in “old” C++ programming (i.e., C++98) require revision for modern C++. Effective Modern C++ follows the proven format of Scott Meyers’ earlier Effective books (Effective C++, More Effective C++, and Effective STL), but c...

On the sintering behaviour of steel bonded TiC-Cr3C2 and TiC-Cr3C2-WC mixed carbides

International Nuclear Information System (INIS)

Stojanov, L.G.; Exner, H.E.

1978-01-01

Powder mixtures of TiC+Cr 3 C 2 and TiC+Cr 3 C 2 + WC were hot pressed to nearly full density. The lattice parameter of the resulting cubic mixed crystal decreases linearly with increasing additions of Cr 3 C 2 and (Cr 3 C 2 +WC 1:1). Microhardness increases with Cr 3 C 2 content up to 20 wt.%. By addition of WC, microhardness is increased further and reaches a maximum value of approx. 38 000 MN/m 2 for 20 wt.% Cr 3 C 2 and 20 wt.% WC. From these solid solutions powder compositions of Ferro-TiC type were produced by milling with 55 wt.% Fe and 0.4 wt.% C. The sintering behaviour of these powders was studied in a vacuum dilatometer. The pronounced increase of shrinkage by Cr 3 C 2 and higher amounts of Cr 3 C 2 +WC dissolved in TiC previous to binder phase melting is attributed to the increased solubility of the carbide in solid iron. Presintering at 700 0 C in hydrogen has a negative influence on sintering activity and requires much higher temperatures for complete densification during subsequent vacuum sintering. (orig.) [de

Irradiation effect on Nite-SiC/SiC composites

International Nuclear Information System (INIS)

Hinoki, T.; Choi, Y.B.; Kohyama, A.; Ozawa, K.

2007-01-01

Full text of publication follows: Silicon carbide (SiC) and SiC composites are significantly attractive materials for nuclear application in particular due to exceptional low radioactivity, excellent high temperature mechanical properties and chemical stability. Despite of the excellent potential of SiC/SiC composites, the prospect of industrialization has not been clear mainly due to the low productivity and the high material cost. Chemical vapor infiltration (CVI) method can produce the excellent SiC/SiC composites with highly crystalline and excellent mechanical properties. It has been reported that the high purity SiC/SiC composites reinforced with highly crystalline fibers and fabricated by CVI method is very stable to neutron irradiation. However the production cost is high and it is difficult to fabricate thick and dense composites by CVI method. The novel processing called Nano-powder Infiltration and Transient Eutectic Phase (NITE) Processing has been developed based on the liquid phase sintering (LPS) process modification. The NITE processing can achieve both the excellent material quality and the low processing cost. The productivity of the processing is also excellent, and various kinds of shape and size of SiC/SiC composites can be produced by the NITE processing. The NITE processing can form highly crystalline matrix, which is requirement for nuclear application. The objective of this work is to understand irradiation effect of the NITESiC/SiC composites. The SiC/SiC composites used were reinforced with high purity SiC fibers, Tyranno TM SA and fabricated by the NITE method. The NITE-SiC/SiC composite bars and reference monolithic SiC bars fabricated by CVI and NITE were irradiated at up to 1.0 dpa and 600-1000 deg. C at JMTR, Japan. Mechanical properties of non-irradiated and irradiated NITESiC/ SiC composites bars were evaluated by tensile tests. Monolithic SiC bars were evaluated by flexural tests. The fracture surface was examined by SEM. Ultimate

Studying of the function of expected ABC transporter Rv1458c-Rv1457c-Rv1456c in mycobacteria; Studium funkcie predpokladaneho ABC transportera Rv1458c-Rv1457c-Rv1456c v mykobakteriach

Energy Technology Data Exchange (ETDEWEB)

Sarkan, M; Mikusova, K; Kordulakova, J [Univerzita Komenskeho v Bratislave, Prirodovedecka fakulta, Katedra biochemie, 84215 Bratislava (Slovakia)

2012-04-25

The bacterium Mycobacterium tuberculosis - the originator of tuberculosis in humans - is characterized by a complex cell wall, which is responsible for a high bacteria resistant to adverse external environmental conditions, as well as to the common antibiotics. The structure of the cell wall components and enzymes involved into its biosynthesis are relatively well described, but there is no information on the transfer of intermediate products of its biosynthetic across the plasmatic membrane. Orthologues of genes rv1459c-rv1458c-rv1457c-rv1456c of M. tuberculosis are in the same configuration in genomes of all previously sequenced mycobacterial strains. Rv1459c gene encodes a probable glycosyltransferases and genes rv1458c, rv1457c rv1456c code nucleotide binding and transmembrane subunits of expected ABC transporter. In our work we focused on the study of the function of expected ABC transporter Rv1458c-Rv1457c-Rv1456c, through analysis of phenotypes of strains M. Smegmatis. They have orthologues of genes encoding the transmembrane subunits of this transporter suspended by fragment encoding resistance to kanamycin. (authors)

Dicty_cDB: CHH542 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 35.1 UCRCS08_0003L02_f Parent Washington Navel Orange Callus cDNA Library UCRCS08...cDNA library - UCR Poncirus trifoliata cDNA clone UCRPT01_02_C04, mRNA sequence. 40 0.002 2 CV714035 |CV7140

Measurements of psi -> K-Lambda(Xi)over-bar(+) + c.c. and psi -> gamma K-Lambda(Xi)over-bar(+) + c.c.

NARCIS (Netherlands)

Ablikim, M.; Achasov, M. N.; Ai, X. C.; Albayrak, O.; Albrecht, M.; Ambrose, D. J.; Amoroso, A.; An, F. F.; An, Q.; Bai, J. Z.; Ferroli, R. Baldini; Ban, Y.; Bennett, D. W.; Bennett, J. V.; Bertani, M.; Bettoni, D.; Bian, J. M.; Bianchi, F.; Boger, E.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Cai, H.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, H. Y.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, X.; Chen, X. R.; Chen, Y. B.; Cheng, H. P.; Chu, X. K.; Cibinetto, G.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dbeyssi, A.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; De Mori, F.; Ding, Y.; Dong, C.; Dong, J.; Dong, L. Y.; Dong, M. Y.; Duan, S. X.; Duan, P. F.; Fan, J. Z.; Fang, J.; Fang, S. S.; Fang, X.; Fang, Y.; Fava, L.; Feldbauer, F.; Felici, G.; Feng, C. Q.; Fioravanti, E.; Fritsch, M.; Fu, C. D.; Gao, Q.; Gao, X. Y.; Gao, Y.; Gao, Z.; Garzia, I.; Geng, C.; Goetzen, K.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, Y.; Guo, Y. P.; Haddadi, Z.; Hafner, A.; Han, S.; Han, Y. L.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, Z. Y.; Held, T.; Heng, Y. K.; Hou, Z. L.; Hu, C.; Hu, H. M.; Hu, J. F.; Hu, T.; Hu, Y.; Huang, G. M.; Huang, G. S.; Huang, H. P.; Huang, J. S.; Huang, X. T.; Huang, Y.; Hussain, T.; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, L. L.; Jiang, L. W.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Johansson, T.; Julin, A.; Kalantar-Nayestanaki, N.; Kang, X. L.; Kang, X. S.; Kavatsyuk, M.; Ke, B. C.; Kliemt, R.; Kloss, B.; Kolcu, O. B.; Kopf, B.; Kornicer, M.; Kuehn, W.; Kupsc, A.; Lai, W.; Lange, J. S.; Lara, M.; Larin, P.; Leng, C.; Li, C. H.; Li, Cheng; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, Jin; Li, K.; Li, K.; Li, Lei; Li, P. R.; Li, T.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. M.; Li, X. N.; Li, X. Q.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Lin, D. X.; Liu, B. J.; Liu, C. X.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H. B.; Liu, H. H.; Liu, H. H.; Liu, H. M.; Liu, J.; Liu, J. P.; Liu, J. Y.; Liu, K.; Liu, K. Y.; Liu, L. D.; Liu, P. L.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, X. X.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H.; Lou, X. C.; Lu, H. J.; Lu, J. G.; Lu, R. Q.; Lu, Y.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lv, M.; Lyu, X. R.; Ma, F. C.; Ma, H. L.; Ma, L. L.; Ma, Q. M.; Ma, S.; Ma, T.; Ma, X. N.; Ma, X. Y.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Marcello, S.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Mo, Y. J.; Morales, C. Morales; Moriya, K.; Muchnoi, N. Yu.; Muramatsu, H.; Nefedov, Y.; Nerling, F.; Nikolaev, I. B.; Ning, Z.; Nisar, S.; Niu, S. L.; Niu, X. Y.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Patteri, P.; Pelizaeus, M.; Peng, H. P.; Peters, K.; Pettersson, J.; Ping, J. L.; Ping, R. G.; Poling, R.; Pu, Y. N.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, L. Q.; Qin, N.; Qin, X. S.; Qin, Y.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Redmer, C. F.; Ren, H. L.; Ripka, M.; Rong, G.; Ruan, X. D.; Santoro, V.; Sarantsev, A.; Savrie, M.; Schoenning, K.; Schumann, S.; Shan, W.; Shao, M.; Shen, C. P.; Shen, P. X.; Shen, X. Y.; Sheng, H. Y.; Song, W. M.; Song, X. Y.; Sosio, S.; Spataro, S.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tapan, I.; Thorndike, E. H.; Tiemens, M.; Toth, D.; Ullrich, M.; Uman, I.; Varner, G. S.; Wang, B.; Wang, B. L.; Wang, D.; Wang, D. Y.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q. J.; Wang, S. G.; Wang, W.; Wang, X. F.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. H.; Wang, Z. Y.; Weber, T.; Wei, D. H.; Wei, J. B.; Weidenkaff, P.; Wen, S. P.; Wiedner, U.; Wolke, M.; Wu, L. H.; Wu, Z.; Xia, L. G.; Xia, Y.; Xiao, D.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, L.; Xu, Q. J.; Xu, Q. N.; Xu, X. P.; Yan, L.; Yan, W. B.; Yan, W. C.; Yan, Y. H.; Yang, H. X.; Yang, L.; Yang, Y.; Yang, Y. X.; Ye, H.; Ye, M.; Ye, M. H.; Yin, J. H.; Yu, B. X.; Yu, C. X.; Yu, H. W.; Yu, J. S.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Yuncu, A.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J. J.; Zhang, J. L.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, K.; Zhang, L.; Zhang, S. H.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Y. T.; Zhang, Z. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, H. S.; Zhao, J. W.; Zhao, J. Y.; Zhao, J. Z.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, Q. W.; Zhao, S. J.; Zhao, T. C.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, W. J.; Zheng, Y. H.; Zhong, B.; Zhou, L.; Zhou, Li; Zhou, X.; Zhou, X. K.; Zhou, X. R.; Zhou, X. Y.; Zhu, K.; Zhu, K. J.; Zhu, S.; Zhu, X. L.; Zhu, Y. C.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zotti, L.; Zou, B. S.; Zou, J. H.

2015-01-01

Using a sample of 1.06 x 10(8) psi(3686) events produced in e(+)e(-) collisions at root s = 3.686 GeV and collected with the BESIII detector at the BEPCII collider, we present studies of the decays psi(3686) -> K-Lambda(Xi) over bar (+) + c.c. and psi(3686) -> gamma K-Lambda(Xi) over bar (+) + c.c.

$\\chi^{\\vphantom\\dagger}_{c0}(3915)$ As the Lightest $c\\bar c s \\bar s$ State

CERN Document Server

Lebed, Richard F.

2016-05-23

The state $\\chi^{\\vphantom\\dagger}_{c0}(3915)$ has recently been demoted by the Particle Data Group from its previous status as the conventional $c\\bar c$ $2 {}^3P_0$ state, largely due to the absence of expected $D\\bar D$ decays. We propose that $\\chi^{\\vphantom\\dagger}_{c0}(3915)$ is actually the lightest $c\\bar c s \\bar s$ state, and calculate the spectrum of such states using the diquark model, identifying many of the observed charmoniumlike states that lack open-charm decay modes as $c\\bar c s \\bar s$. Among other results, we argue that $Y(4140)$ is a $J^{PC} = 1^{++}$ $c\\bar c s \\bar s$ state that has been not been seen in two-photon fusion largely as a consequence of the Landau-Yang theorem.

Isomerisation of c4-c6 aldoses with zeolites

DEFF Research Database (Denmark)

2014-01-01

The present invention relates to isomerization of C4-C6 aldoses to their corresponding C4-C6 ketoses. In particular, the invention concerns isomerization of C4-C6 aldoses over solid zeolite catalysts free of any metals other than aluminum, in the presence of suitable solvent(s) at suitable elevated...... temperatures. C6 and C5 aldose sugars such as glucose and xylose, which are available in large amounts from biomass precursors, are isomerized to fructose and xylulose respectively, in a one or two-step process over inexpensive commercially available zeolite catalysts, containing aluminum as the only metal...

Review of the thermodynamics of the U--C, Pu--C, and U--Pu--C systems

International Nuclear Information System (INIS)

Tetenbaum, M.; Sheth, A.; Olson, W.

1975-06-01

Thermodynamic properties such as enthalpy, heat capacity, entropy, heat and free energy of formation, and vaporization behavior are presented for the U--C, Pu--C, and U--Pu--C systems. These properties are of interest to scientists and engineers involved in the expanding field of advanced fuel LMFBR systems. The information on these systems has been derived largely from the discussions of the IAEA Panel on the assessment of thermodynamic properties of the U--C, Pu--C, and U--Pu--C systems. (U.S.)

BURNER RIG TESTING OF A500 C/SiC

Science.gov (United States)

2018-03-17

AFRL-RX-WP-TR-2018-0071 BURNER RIG TESTING OF A500® C /SiC Larry P. Zawada Universal Technology Corporation Jennifer Pierce UDRI...TITLE AND SUBTITLE BURNER RIG TESTING OF A500® C /SiC 5a. CONTRACT NUMBER In-House 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 62102F 6...test program characterized the durability behavior of A500® C /SiC ceramic matrix composite material at room and elevated temperature. Specimens were

χ_{c1} and χ_{c2} Resonance Parameters with the Decays χ_{c1,c2}→J/ψμ^{+}μ^{-}.

Science.gov (United States)

Aaij, R; Adeva, B; Adinolfi, M; Ajaltouni, Z; Akar, S; Albrecht, J; Alessio, F; Alexander, M; Alfonso Albero, A; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves, A A; Amato, S; Amerio, S; Amhis, Y; An, L; Anderlini, L; Andreassi, G; Andreotti, M; Andrews, J E; Appleby, R B; Archilli, F; d'Argent, P; Arnau Romeu, J; Artamonov, A; Artuso, M; Aslanides, E; Atzeni, M; Auriemma, G; Baalouch, M; Babuschkin, I; Bachmann, S; Back, J J; Badalov, A; Baesso, C; Baker, S; Balagura, V; Baldini, W; Baranov, A; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Baryshnikov, F; Batozskaya, V; Battista, V; Bay, A; Beaucourt, L; Beddow, J; Bedeschi, F; Bediaga, I; Beiter, A; Bel, L J; Beliy, N; Bellee, V; Belloli, N; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Beranek, S; Berezhnoy, A; Bernet, R; Berninghoff, D; Bertholet, E; Bertolin, A; Betancourt, C; Betti, F; Bettler, M-O; van Beuzekom, M; Bezshyiko, Ia; Bifani, S; Billoir, P; Birnkraut, A; Bizzeti, A; Bjørn, M; Blake, T; Blanc, F; Blusk, S; Bocci, V; Boettcher, T; Bondar, A; Bondar, N; Bordyuzhin, I; Borghi, S; Borisyak, M; Borsato, M; Bossu, F; Boubdir, M; Bowcock, T J V; Bowen, E; Bozzi, C; Braun, S; Britton, T; Brodzicka, J; Brundu, D; Buchanan, E; Burr, C; Bursche, A; Buytaert, J; Byczynski, W; Cadeddu, S; Cai, H; Calabrese, R; Calladine, R; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D H; Capriotti, L; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carniti, P; Carson, L; Carvalho Akiba, K; Casse, G; Cassina, L; Cattaneo, M; Cavallero, G; Cenci, R; Chamont, D; Chapman, M G; Charles, M; Charpentier, Ph; Chatzikonstantinidis, G; Chefdeville, M; Chen, S; Cheung, S F; Chitic, S-G; Chobanova, V; Chrzaszcz, M; Chubykin, A; Ciambrone, P; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Cogan, J; Cogneras, E; Cogoni, V; Cojocariu, L; Collins, P; Colombo, T; Comerma-Montells, A; Contu, A; Cook, A; Coombs, G; Coquereau, S; Corti, G; Corvo, M; Costa Sobral, C M; Couturier, B; Cowan, G A; Craik, D C; Crocombe, A; Cruz Torres, M; Currie, R; D'Ambrosio, C; Da Cunha Marinho, F; Dall'Occo, E; Dalseno, J; Davis, A; De Aguiar Francisco, O; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Serio, M; De Simone, P; Dean, C T; Decamp, D; Del Buono, L; Dembinski, H-P; Demmer, M; Dendek, A; Derkach, D; Deschamps, O; Dettori, F; Dey, B; Di Canto, A; Di Nezza, P; Dijkstra, H; Dordei, F; Dorigo, M; Dosil Suárez, A; Douglas, L; Dovbnya, A; Dreimanis, K; Dufour, L; Dujany, G; Durante, P; Dzhelyadin, R; Dziewiecki, M; Dziurda, A; Dzyuba, A; Easo, S; Ebert, M; Egede, U; Egorychev, V; Eidelman, S; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; Ely, S; Esen, S; Evans, H M; Evans, T; Falabella, A; Farley, N; Farry, S; Fazzini, D; Federici, L; Ferguson, D; Fernandez, G; Fernandez Declara, P; Fernandez Prieto, A; Ferrari, F; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fini, R A; Fiorini, M; Firlej, M; Fitzpatrick, C; Fiutowski, T; Fleuret, F; Fohl, K; Fontana, M; Fontanelli, F; Forshaw, D C; Forty, R; Franco Lima, V; Frank, M; Frei, C; Fu, J; Funk, W; Furfaro, E; Färber, C; Gabriel, E; Gallas Torreira, A; Galli, D; Gallorini, S; Gambetta, S; Gandelman, M; Gandini, P; Gao, Y; Garcia Martin, L M; García Pardiñas, J; Garra Tico, J; Garrido, L; Garsed, P J; Gascon, D; Gaspar, C; Gavardi, L; Gazzoni, G; Gerick, D; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gianì, S; Gibson, V; Girard, O G; Giubega, L; Gizdov, K; Gligorov, V V; Golubkov, D; Golutvin, A; Gomes, A; Gorelov, I V; Gotti, C; Govorkova, E; Grabowski, J P; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graverini, E; Graziani, G; Grecu, A; Greim, R; Griffith, P; Grillo, L; Gruber, L; Gruberg Cazon, B R; Grünberg, O; Gushchin, E; Guz, Yu; Gys, T; Göbel, C; Hadavizadeh, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hamilton, B; Han, X; Hancock, T H; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Hasse, C; Hatch, M; He, J; Hecker, M; Heinicke, K; Heister, A; Hennessy, K; Henrard, P; Henry, L; van Herwijnen, E; Heß, M; Hicheur, A; Hill, D; Hombach, C; Hopchev, P H; Hu, W; Huard, Z C; Hulsbergen, W; Humair, T; Hushchyn, M; Hutchcroft, D; Ibis, P; Idzik, M; Ilten, P; Jacobsson, R; Jalocha, J; Jans, E; Jawahery, A; Jiang, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Jurik, N; Kandybei, S; Karacson, M; Kariuki, J M; Karodia, S; Kazeev, N; Kecke, M; Keizer, F; Kelsey, M; Kenzie, M; Ketel, T; Khairullin, E; Khanji, B; Khurewathanakul, C; Kirn, T; Klaver, S; Klimaszewski, K; Klimkovich, T; Koliiev, S; Kolpin, M; Kopecna, R; Koppenburg, P; Kosmyntseva, A; Kotriakhova, S; Kozeiha, M; Kravchuk, L; Kreps, M; Kress, F; Krokovny, P; Kruse, F; Krzemien, W; Kucewicz, W; Kucharczyk, M; Kudryavtsev, V; Kuonen, A K; Kvaratskheliya, T; Lacarrere, D; Lafferty, G; Lai, A; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; Leflat, A; Lefrançois, J; Lefèvre, R; Lemaitre, F; Lemos Cid, E; Leroy, O; Lesiak, T; Leverington, B; Li, P-R; Li, T; Li, Y; Li, Z; Likhomanenko, T; Lindner, R; Lionetto, F; Lisovskyi, V; Liu, X; Loh, D; Loi, A; Longstaff, I; Lopes, J H; Lucchesi, D; Luchinsky, A; Lucio Martinez, M; Luo, H; Lupato, A; Luppi, E; Lupton, O; Lusiani, A; Lyu, X; Machefert, F; Maciuc, F; Macko, V; Mackowiak, P; Maddrell-Mander, S; Maev, O; Maguire, K; Maisuzenko, D; Majewski, M W; Malde, S; Malecki, B; Malinin, A; Maltsev, T; Manca, G; Mancinelli, G; Marangotto, D; Maratas, J; Marchand, J F; Marconi, U; Marin Benito, C; Marinangeli, M; Marino, P; Marks, J; Martellotti, G; Martin, M; Martinelli, M; Martinez Santos, D; Martinez Vidal, F; Massacrier, L M; Massafferri, A; Matev, R; Mathad, A; Mathe, Z; Matteuzzi, C; Mauri, A; Maurice, E; Maurin, B; Mazurov, A; McCann, M; McNab, A; McNulty, R; Mead, J V; Meadows, B; Meaux, C; Meier, F; Meinert, N; Melnychuk, D; Merk, M; Merli, A; Michielin, E; Milanes, D A; Millard, E; Minard, M-N; Minzoni, L; Mitzel, D S; Mogini, A; Molina Rodriguez, J; Mombächer, T; Monroy, I A; Monteil, S; Morandin, M; Morello, M J; Morgunova, O; Moron, J; Morris, A B; Mountain, R; Muheim, F; Mulder, M; Müller, D; Müller, J; Müller, K; Müller, V; Naik, P; Nakada, T; Nandakumar, R; Nandi, A; Nasteva, I; Needham, M; Neri, N; Neubert, S; Neufeld, N; Neuner, M; Nguyen, T D; Nguyen-Mau, C; Nieswand, S; Niet, R; Nikitin, N; Nikodem, T; Nogay, A; O'Hanlon, D P; Oblakowska-Mucha, A; Obraztsov, V; Ogilvy, S; Oldeman, R; Onderwater, C J G; Ossowska, A; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pais, P R; Palano, A; Palutan, M; Papanestis, A; Pappagallo, M; Pappalardo, L L; Parker, W; Parkes, C; Passaleva, G; Pastore, A; Patel, M; Patrignani, C; Pearce, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perret, P; Pescatore, L; Petridis, K; Petrolini, A; Petrov, A; Petruzzo, M; Picatoste Olloqui, E; Pietrzyk, B; Pikies, M; Pinci, D; Pisani, F; Pistone, A; Piucci, A; Placinta, V; Playfer, S; Plo Casasus, M; Polci, F; Poli Lener, M; Poluektov, A; Polyakov, I; Polycarpo, E; Pomery, G J; Ponce, S; Popov, A; Popov, D; Poslavskii, S; Potterat, C; Price, E; Prisciandaro, J; Prouve, C; Pugatch, V; Puig Navarro, A; Pullen, H; Punzi, G; Qian, W; Quagliani, R; Quintana, B; Rachwal, B; Rademacker, J H; Rama, M; Ramos Pernas, M; Rangel, M S; Raniuk, I; Ratnikov, F; Raven, G; Ravonel Salzgeber, M; Reboud, M; Redi, F; Reichert, S; Dos Reis, A C; Remon Alepuz, C; Renaudin, V; Ricciardi, S; Richards, S; Rihl, M; Rinnert, K; Rives Molina, V; Robbe, P; Robert, A; Rodrigues, A B; Rodrigues, E; Rodriguez Lopez, J A; Rogozhnikov, A; Roiser, S; Rollings, A; Romanovskiy, V; Romero Vidal, A; Ronayne, J W; Rotondo, M; Rudolph, M S; Ruf, T; Ruiz Valls, P; Ruiz Vidal, J; Saborido Silva, J J; Sadykhov, E; Sagidova, N; Saitta, B; Salustino Guimaraes, V; Sanchez Mayordomo, C; Sanmartin Sedes, B; Santacesaria, R; Santamarina Rios, C; Santimaria, M; Santovetti, E; Sarpis, G; Sarti, A; Satriano, C; Satta, A; Saunders, D M; Savrina, D; Schael, S; Schellenberg, M; Schiller, M; Schindler, H; Schmelling, M; Schmelzer, T; Schmidt, B; Schneider, O; Schopper, A; Schreiner, H F; Schubiger, M; Schune, M-H; Schwemmer, R; Sciascia, B; Sciubba, A; Semennikov, A; Sepulveda, E S; Sergi, A; Serra, N; Serrano, J; Sestini, L; Seyfert, P; Shapkin, M; Shapoval, I; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, V; Siddi, B G; Silva Coutinho, R; Silva de Oliveira, L; Simi, G; Simone, S; Sirendi, M; Skidmore, N; Skwarnicki, T; Smith, E; Smith, I T; Smith, J; Smith, M; Soares Lavra, L; Sokoloff, M D; Soler, F J P; Souza De Paula, B; Spaan, B; Spradlin, P; Sridharan, S; Stagni, F; Stahl, M; Stahl, S; Stefko, P; Stefkova, S; Steinkamp, O; Stemmle, S; Stenyakin, O; Stepanova, M; Stevens, H; Stone, S; Storaci, B; Stracka, S; Stramaglia, M E; Straticiuc, M; Straumann, U; Sun, J; Sun, L; Sutcliffe, W; Swientek, K; Syropoulos, V; Szumlak, T; Szymanski, M; T'Jampens, S; Tayduganov, A; Tekampe, T; Tellarini, G; Teubert, F; Thomas, E; van Tilburg, J; Tilley, M J; Tisserand, V; Tobin, M; Tolk, S; Tomassetti, L; Tonelli, D; Toriello, F; Tourinho Jadallah Aoude, R; Tournefier, E; Traill, M; Tran, M T; Tresch, M; Trisovic, A; Tsaregorodtsev, A; Tsopelas, P; Tully, A; Tuning, N; Ukleja, A; Usachov, A; Ustyuzhanin, A; Uwer, U; Vacca, C; Vagner, A; Vagnoni, V; Valassi, A; Valat, S; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; van Veghel, M; Velthuis, J J; Veltri, M; Veneziano, G; Venkateswaran, A; Verlage, T A; Vernet, M; Vesterinen, M; Viana Barbosa, J V; Viaud, B; Vieira, D; Vieites Diaz, M; Viemann, H; Vilasis-Cardona, X; Vitti, M; Volkov, V; Vollhardt, A; Voneki, B; Vorobyev, A; Vorobyev, V; Voß, C; de Vries, J A; Vázquez Sierra, C; Waldi, R; Wallace, C; Wallace, R; Walsh, J; Wang, J; Ward, D R; Wark, H M; Watson, N K; Websdale, D; Weiden, A; Weisser, C; Whitehead, M; Wicht, J; Wilkinson, G; Wilkinson, M; Williams, M; Williams, M P; Williams, M; Williams, T; Wilson, F F; Wimberley, J; Winn, M; Wishahi, J; Wislicki, W; Witek, M; Wormser, G; Wotton, S A; Wraight, K; Wyllie, K; Xie, Y; Xu, M; Xu, Z; Yang, Z; Yang, Z; Yao, Y; Yin, H; Yu, J; Yuan, X; Yushchenko, O; Zarebski, K A; Zavertyaev, M; Zhang, L; Zhang, Y; Zhelezov, A; Zheng, Y; Zhu, X; Zhukov, V; Zonneveld, J B; Zucchelli, S

2017-12-01

The decays χ_{c1}→J/ψμ^{+}μ^{-} and χ_{c2}→J/ψμ^{+}μ^{-} are observed and used to study the resonance parameters of the χ_{c1} and χ_{c2} mesons. The masses of these states are measured to be m(χ_{c1})=3510.71±0.04(stat)±0.09(syst)  MeV and m(χ_{c2})=3556.10±0.06(stat)±0.11(syst)  MeV, where the knowledge of the momentum scale for charged particles dominates the systematic uncertainty. The momentum-scale uncertainties largely cancel in the mass difference m(χ_{c2})-m(χ_{c1})=45.39±0.07(stat)±0.03(syst)  MeV. The natural width of the χ_{c2} meson is measured to be Γ(χ_{c2})=2.10±0.20(stat)±0.02(syst)  MeV. These results are in good agreement with and have comparable precision to the current world averages.

Transport properties at 3C-SiC interfaces

OpenAIRE

Eriksson, Gustav Jens Peter

2011-01-01

For years cubic (3C) silicon carbide (SiC) has been believed to be a very promising wide bandgap semiconductor for high frequency and high power electronics. However, 3C-SiC is fraught with large concentrations of various defects, which have so far hindered the achievement of the predicted properties at a macroscopic level. These defects have properties that are inherently nanoscale and that will have a strong influence on the electrical behavior of the material, particularly at interfaces c...

Porous SiC/SiC composites development for industrial application

International Nuclear Information System (INIS)

Maeta, S.; Hinoki, T.

2014-01-01

Silicon carbide (SiC) is promising structural materials in nuclear fields due to an excellent irradiation resistance and low activation characteristics. Conventional SiC fibers reinforced SiC matrix (SiC/SiC composites) fabricated by liquid phase sintering (LPS-SiC/SiC composites) have been required high cost and long processing time. And microstructure and mechanical property data of finally obtained LPS-SiC/SiC composites are easily scattered, because quality of the composites depend on personal skill. Thus, conventional LPS-SiC/SiC composites are inadequate for industrial use. In order to overcome these issues, the novel “porous SiC/SiC composites” have been developed by means of liquid phase sintering fabrication process. The composites consist of porous SiC matrix and SiC fibers without conventional carbon interfacial layer. The composites don’t have concerns of the degradation interfacial layer at the severe accident. Porous SiC/SiC composites preform was prepared with a thin sheet shape of SiC, sintering additives and carbon powder mixture by tape casting process which was adopted because of productive and high yielding rate fabrication process. The preform was stacked with SiC fibers and sintered in hot-press at the high temperature in argon environment. The sintered preform was decarburized obtain porous matrix structure by heat-treatment in air. Moreover, mechanical property data scattering of the obtained porous SiC/SiC composites decreased. In the flexural test, the porous SiC/SiC composites showed pseudo-ductile behavior with sufficient strength even after heat treatment at high temperature in air. From these conclusions, it was proven that porous SiC/SiC composites were reliable material at severe environment such as high temperature in air, by introducing tape casting fabrication process that could produce reproducible materials with low cost and simple way. Therefore development of porous SiC/SiC composites for industrial application was

Mechanical behavior of SiCf/SiC composites with alternating PyC/SiC multilayer interphases

International Nuclear Information System (INIS)

Yu, Haijiao; Zhou, Xingui; Zhang, Wei; Peng, Huaxin; Zhang, Changrui

2013-01-01

Highlights: ► Superior combination of flexural strength and fracture toughness of the 3D SiC/SiC composite was achieved by interface tailoring. ► Resulted composite possesses a much higher flexural strength and fracture toughness than its counterparts in literatures. ► Mechanisms that PyC/SiC multilayer coatings improve the mechanical properties were illustrated. -- Abstract: In order to tailor the fiber–matrix interface of continuous silicon carbide fiber reinforced silicon carbide (SiC f /SiC) composites for improved fracture toughness, alternating pyrolytic carbon/silicon carbide (PyC/SiC) multilayer coatings were applied to the KD-I SiC fibers using chemical vapor deposition (CVD) method. Three dimensional (3D) KD-I SiC f /SiC composites reinforced by these coated fibers were fabricated using a precursor infiltration and pyrolysis (PIP) process. The interfacial characteristics were determined by the fiber push-out test and microstructural examination using scanning electron microscopy (SEM). The effect of interface coatings on composite mechanical properties was evaluated by single-edge notched beam (SENB) test and three-point bending test. The results indicate that the PyC/SiC multilayer coatings led to an optimum interfacial bonding between fibers and matrix and greatly improved the fracture toughness of the composites.

Efficient C/C++ programming smaller, faster, better

CERN Document Server

Heller, Steve

1994-01-01

Efficient C/C++ Programming describes a practical, real-world approach to efficient C/C++ programming. Topics covered range from how to save storage using a restricted character set and how to speed up access to records by employing hash coding and caching. A selective mailing list system is used to illustrate rapid access to and rearrangement of information selected by criteria specified at runtime.Comprised of eight chapters, this book begins by discussing factors to consider when deciding whether a program needs optimization. In the next chapter, a supermarket price lookup system is used to

SiC/SiC Cladding Materials Properties Handbook

Energy Technology Data Exchange (ETDEWEB)

Snead, Mary A. [Brookhaven National Lab. (BNL), Upton, NY (United States); Katoh, Yutai [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Koyanagi, Takaaki [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Singh, Gyanender P. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

2017-08-01

When a new class of material is considered for a nuclear core structure, the in-pile performance is usually assessed based on multi-physics modeling in coordination with experiments. This report aims to provide data for the mechanical and physical properties and environmental resistance of silicon carbide (SiC) fiber–reinforced SiC matrix (SiC/SiC) composites for use in modeling for their application as accidenttolerant fuel cladding for light water reactors (LWRs). The properties are specific for tube geometry, although many properties can be predicted from planar specimen data. This report presents various properties, including mechanical properties, thermal properties, chemical stability under normal and offnormal operation conditions, hermeticity, and irradiation resistance. Table S.1 summarizes those properties mainly for nuclear-grade SiC/SiC composites fabricated via chemical vapor infiltration (CVI). While most of the important properties are available, this work found that data for the in-pile hydrothermal corrosion resistance of SiC materials and for thermal properties of tube materials are lacking for evaluation of SiC-based cladding for LWR applications.

Nanosized f.c.c. thallium inclusions in aluminium

International Nuclear Information System (INIS)

Johnson, E.; Johansen, A.; Thoft, N.B.; Andersen, H.H.; Sarholt-Kristensen, L.

1993-01-01

Ion implantation of pure aluminium with thallium induces the formation of nanosized crystalline inclusions of thallium with a f.c.c. structure. The size of the inclusions depends on the implantation conditions and subsequent annealing treatments and is typically in the range from 1 to 10 nm. The inclusions are aligned topotactically with the aluminium matrix with a cube-cube orientation relationship and they have a truncated octahedral shape bounded by {111} and {001} planes. The lattice parameter of the f.c.c. thallium inclusions is 0.484 ± 0.002 nm, which is slightly but significantly larger than in the high-pressure f.c.c. thallium phase known to be stable above 3.8 GPa. (Author)

Microscopic investigation of the 12C + 12C interaction

International Nuclear Information System (INIS)

Baye, D.; Pecher, N.; Brussels Univ.

1982-01-01

The 12 C + 12 C system is studied in the framework of the generator coordinate method. Each 12 C nucleus is described by a closed psub(3/2) subshell. Phase shifts and resonances are determined for several effective two-body interactions involving a spin-orbit term. The existence and properties of simple local equivalent potentials for the 12 C + 12 C collision are discussed. The 12 C + 12 C system is too light to be well described by potentials independent of the angular momentum or weakly dependent on it. (orig.)

Kinetics for exchange of imino protons in the d(C-G-C-G-A-A-T-T-C-G-C-G) double helix and in two similar helices that contain a G . T base pair, d(C-G-T-G-A-A-T-T-C-G-C-G), and an extra adenine, d(C-G-C-A-G-A-A-T-T-C-G-C-G).

Science.gov (United States)

Pardi, A; Morden, K M; Patel, D J; Tinoco, I

1982-12-07

The relaxation lifetimes of imino protons from individual base pairs were measured in (I) a perfect helix, d(C-G-C-G-A-A-T-T-C-G-C-G), (II) this helix with a G . C base pair replaced with a G . T base pair, d(C-G-T-G-A-A-T-T-C-G-C-G), and (III) the perfect helix with an extra adenine base in a mismatch, d(C-G-C-A-G-A-A-T-T-C-G-C-G). The lifetimes were measured by saturation recovery proton nuclear magnetic resonance experiments performed on the imino protons of these duplexes. The measured lifetimes of the imino protons were shown to correspond to chemical exchange lifetimes at higher temperatures and spin-lattice relaxation times at lower temperatures. Comparison of the lifetimes in these duplexes showed that the destabilizing effect of the G . T base pair in II affected the opening rate of only the nearest-neighbor base pairs. For helix III, the extra adenine affected the opening rates of all the base pairs in the helix and thus was a larger perturbation for opening of the base pairs than the G . T base pair. The temperature dependence of the exchange rates of the imino proton in the perfect helix gives values of 14-15 kcal/mol for activation energies of A . T imino protons. These relaxation rates were shown to correspond to exchange involving individual base pair opening in this helix, which means that one base-paired imino proton can exchange independent of the others. For the other two helices that contain perturbations, much larger activation energies for exchange of the imino protons were found, indicating that a cooperative transition involving exchange of at least several base pairs was the exchange mechanism of the imino protons. The effects of a perturbation in a helix on the exchange rates and the mechanisms for exchange of imino protons from oligonucleotide helices are discussed.

A comparative study of the mechanical and thermal properties of defective ZrC, TiC and SiC.

Science.gov (United States)

Jiang, M; Zheng, J W; Xiao, H Y; Liu, Z J; Zu, X T

2017-08-24

ZrC and TiC have been proposed to be alternatives to SiC as fuel-cladding and structural materials in nuclear reactors due to their strong radiation tolerance and high thermal conductivity at high temperatures. To unravel how the presence of defects affects the thermo-physical properties under irradiation, first-principles calculations based on density function theory were carried out to investigate the mechanical and thermal properties of defective ZrC, TiC and SiC. As compared with the defective SiC, the ZrC and TiC always exhibit larger bulk modulus, smaller changes in the Young's and shear moduli, as well as better ductility. The total thermal conductivity of ZrC and TiC are much larger than that of SiC, implying that under radiation environment the ZrC and TiC will exhibit superior heat conduction ability than the SiC. One disadvantage for ZrC and TiC is that their Debye temperatures are generally lower than that of SiC. These results suggest that further improving the Debye temperature of ZrC and TiC will be more beneficial for their applications as fuel-cladding and structural materials in nuclear reactors.

Electronic structure of C28, Pa at sign C28, and U at sign C28

International Nuclear Information System (INIS)

Zhao, K.; Pitzer, R.M.

1996-01-01

Electronic structure calculations, including relativistic core potentials and the spin-orbit interaction, have been carried out on the C 28 , Pa at sign C 28 , and U at sign C 28 species. Excitation energies, spin-orbit splittings, the electron affinity, and the ionization potential are computed for C 28 . The ground state of C 28 is described well by the Hartree-Fock wave functions, but other states are not. The computed electron affinity and ionization potential are similar to those of C 60 . Strong metal-cage binding is found for Pa at sign C 28 and U at sign C 28 , similar to that in U(C 8 H 8 ) 2 . The ground electronic states depend on the order of the lowest-energy cage π * and metal 5f orbitals, with (π * ) 1 and (π * ) 1 (5f) 1 found to be the ground electronic configurations for the two complexes. U at sign C 28 is found to be diamagnetic. 30 refs., 1 fig., 13 tabs

Dicty_cDB: VHJ195 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available -B/AFN547Q.Seq.d/ 1342 0.0 SLE172 (SLE172Q) /CSM/SL/SLE1-C/SLE172Q.Seq.d/ 1102 0.0 SLD492 (SLD492Q) /CSM/SL/SLD4-D/SLD492...8502 ) Dictyostelium discoideum cDNA clone:dda28m11, 5' ... 839 0.0 2 ( AU052538 ) Dictyostelium discoideum slug cDNA, clone SLD492...2597 ) Dictyostelium discoideum slug cDNA, clone SLD569. 113 2e-20 1 ( AU061182 ) Dictyostelium discoideum slug cDNA, clone SLD492

Rhodium-Catalyzed C-C Bond Formation via Heteroatom-Directed C-H Bond Activation

Energy Technology Data Exchange (ETDEWEB)

Colby, Denise; Bergman, Robert; Ellman, Jonathan

2010-05-13

Once considered the 'holy grail' of organometallic chemistry, synthetically useful reactions employing C-H bond activation have increasingly been developed and applied to natural product and drug synthesis over the past decade. The ubiquity and relative low cost of hydrocarbons makes C-H bond functionalization an attractive alternative to classical C-C bond forming reactions such as cross-coupling, which require organohalides and organometallic reagents. In addition to providing an atom economical alternative to standard cross - coupling strategies, C-H bond functionalization also reduces the production of toxic by-products, thereby contributing to the growing field of reactions with decreased environmental impact. In the area of C-C bond forming reactions that proceed via a C-H activation mechanism, rhodium catalysts stand out for their functional group tolerance and wide range of synthetic utility. Over the course of the last decade, many Rh-catalyzed methods for heteroatom-directed C-H bond functionalization have been reported and will be the focus of this review. Material appearing in the literature prior to 2001 has been reviewed previously and will only be introduced as background when necessary. The synthesis of complex molecules from relatively simple precursors has long been a goal for many organic chemists. The ability to selectively functionalize a molecule with minimal pre-activation can streamline syntheses and expand the opportunities to explore the utility of complex molecules in areas ranging from the pharmaceutical industry to materials science. Indeed, the issue of selectivity is paramount in the development of all C-H bond functionalization methods. Several groups have developed elegant approaches towards achieving selectivity in molecules that possess many sterically and electronically similar C-H bonds. Many of these approaches are discussed in detail in the accompanying articles in this special issue of Chemical Reviews. One approach

Search for the rare decays J /ψ →D0e+e-+c .c . and ψ (3686 )→D0e+e-+c .c .

Science.gov (United States)

Ablikim, M.; Achasov, M. N.; Ahmed, S.; Albrecht, M.; Amoroso, A.; An, F. F.; An, Q.; Bai, J. Z.; Bakina, O.; Baldini Ferroli, R.; Ban, Y.; Bennett, D. W.; Bennett, J. V.; Berger, N.; Bertani, M.; Bettoni, D.; Bian, J. M.; Bianchi, F.; Boger, E.; Boyko, I.; Briere, R. A.; Cai, H.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chai, J.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, X. R.; Chen, Y. B.; Chu, X. K.; Cibinetto, G.; Dai, H. L.; Dai, J. P.; Dbeyssi, A.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; de Mori, F.; Ding, Y.; Dong, C.; Dong, J.; Dong, L. Y.; Dong, M. Y.; Dorjkhaidav, O.; Dou, Z. L.; Du, S. X.; Duan, P. F.; Fang, J.; Fang, S. S.; Fang, X.; Fang, Y.; Farinelli, R.; Fava, L.; Fegan, S.; Feldbauer, F.; Felici, G.; Feng, C. Q.; Fioravanti, E.; Fritsch, M.; Fu, C. D.; Gao, Q.; Gao, X. L.; Gao, Y.; Gao, Y. G.; Gao, Z.; Garzia, I.; Goetzen, K.; Gong, L.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, S.; Gu, Y. T.; Guo, A. Q.; Guo, L. B.; Guo, R. P.; Guo, Y. P.; Haddadi, Z.; Hafner, A.; Han, S.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, X. Q.; Heinsius, F. H.; Held, T.; Heng, Y. K.; Holtmann, T.; Hou, Z. L.; Hu, C.; Hu, H. M.; Hu, T.; Hu, Y.; Huang, G. S.; Huang, J. S.; Huang, X. T.; Huang, X. Z.; Huang, Z. L.; Hussain, T.; Ikegami Andersson, W.; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, X. S.; Jiang, X. Y.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Johansson, T.; Julin, A.; Kalantar-Nayestanaki, N.; Kang, X. L.; Kang, X. S.; Kavatsyuk, M.; Ke, B. C.; Khan, T.; Kiese, P.; Kliemt, R.; Kloss, B.; Koch, L.; Kolcu, O. B.; Kopf, B.; Kornicer, M.; Kuemmel, M.; Kuhlmann, M.; Kupsc, A.; Kühn, W.; Lange, J. S.; Lara, M.; Larin, P.; Lavezzi, L.; Leithoff, H.; Leng, C.; Li, C.; Li, Cheng; Li, D. M.; Li, F.; Li, F. Y.; Li, G.; Li, H. B.; Li, H. J.; Li, J. C.; Li, Jin; Li, Kang; Li, Ke; Li, Lei; Li, P. L.; Li, P. R.; Li, Q. Y.; Li, T.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Lin, D. X.; Liu, B.; Liu, B. J.; Liu, C. X.; Liu, D.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H. B.; Liu, H. M.; Liu, Huanhuan; Liu, Huihui; Liu, J. B.; Liu, J. P.; Liu, J. Y.; Liu, K.; Liu, K. Y.; Liu, Ke; Liu, L. D.; Liu, P. L.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, Y. B.; Liu, Y. Y.; Liu, Z. A.; Liu, Zhiqing; Long, Y. F.; Lou, X. C.; Lu, H. J.; Lu, J. G.; Lu, Y.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lyu, X. R.; Ma, F. C.; Ma, H. L.; Ma, L. L.; Ma, M. M.; Ma, Q. M.; Ma, T.; Ma, X. N.; Ma, X. Y.; Ma, Y. M.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Marcello, S.; Messchendorp, J. G.; Mezzadri, G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Mo, Y. J.; Morales Morales, C.; Morello, G.; Muchnoi, N. Yu.; Muramatsu, H.; Musiol, P.; Mustafa, A.; Nefedov, Y.; Nerling, F.; Nikolaev, I. B.; Ning, Z.; Nisar, S.; Niu, S. L.; Niu, X. Y.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Pan, Y.; Papenbrock, M.; Patteri, P.; Pelizaeus, M.; Pellegrino, J.; Peng, H. P.; Peters, K.; Pettersson, J.; Ping, J. L.; Ping, R. G.; Poling, R.; Prasad, V.; Qi, H. R.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, J. J.; Qin, N.; Qin, X. S.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Redmer, C. F.; Richter, M.; Ripka, M.; Rong, G.; Rosner, Ch.; Ruan, X. D.; Sarantsev, A.; Savrié, M.; Schnier, C.; Schoenning, K.; Shan, W.; Shao, M.; Shen, C. P.; Shen, P. X.; Shen, X. Y.; Sheng, H. Y.; Song, J. J.; Song, W. M.; Song, X. Y.; Sosio, S.; Sowa, C.; Spataro, S.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, X. H.; Sun, Y. J.; Sun, Y. K.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, G. Y.; Tang, X.; Tapan, I.; Tiemens, M.; Tsednee, B. T.; Uman, I.; Varner, G. S.; Wang, B.; Wang, B. L.; Wang, D.; Wang, D. Y.; Wang, Dan; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, W. P.; Wang, X. F.; Wang, Y.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. H.; Wang, Z. Y.; Wang, Zongyuan; Weber, T.; Wei, D. H.; Wei, J. H.; Weidenkaff, P.; Wen, S. P.; Wiedner, U.; Wolke, M.; Wu, L. H.; Wu, L. J.; Wu, Z.; Xia, L.; Xia, Y.; Xiao, D.; Xiao, H.; Xiao, Y. J.; Xiao, Z. J.; Xie, Y. G.; Xie, Y. H.; Xiong, X. A.; Xiu, Q. L.; Xu, G. F.; Xu, J. J.; Xu, L.; Xu, Q. J.; Xu, Q. N.; Xu, X. P.; Yan, L.; Yan, W. B.; Yan, W. C.; Yan, Y. H.; Yang, H. J.; Yang, H. X.; Yang, L.; Yang, Y. H.; Yang, Y. X.; Ye, M.; Ye, M. H.; Yin, J. H.; You, Z. Y.; Yu, B. X.; Yu, C. X.; Yu, J. S.; Yuan, C. Z.; Yuan, Y.; Yuncu, A.; Zafar, A. A.; Zeng, Y.; Zeng, Z.; Zhang, B. X.; Zhang, B. Y.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J.; Zhang, J. L.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, K.; Zhang, L.; Zhang, S. Q.; Zhang, X. Y.; Zhang, Y. H.; Zhang, Y. T.; Zhang, Yang; Zhang, Yao; Zhang, Yu; Zhang, Z. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, J. W.; Zhao, J. Y.; Zhao, J. Z.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, S. J.; Zhao, T. C.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, W. J.; Zheng, Y. H.; Zhong, B.; Zhou, L.; Zhou, X.; Zhou, X. K.; Zhou, X. R.; Zhou, X. Y.; Zhou, Y. X.; Zhu, K.; Zhu, K. J.; Zhu, S.; Zhu, S. H.; Zhu, X. L.; Zhu, Y. C.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zotti, L.; Zou, B. S.; Zou, J. H.; Besiii Collaboration

2017-12-01

Using the data samples of (1310.6 ±7.2 )×106 J /ψ events and (448.1 ±2.9 )×106 ψ (3686 ) events collected with the BESIII detector, we search for the rare decays J /ψ →D0e+e-+c .c . and ψ (3686 )→D0e+e-+c .c . No significant signals are observed and the corresponding upper limits on the branching fractions at the 90% confidence level are determined to be B (J /ψ →D0e+e-+c .c .)<8.5 ×10-8 and B (ψ (3686 )→D0e+e-+c .c .)<1.4 ×10-7 , respectively. Our limit on B (J /ψ →D0e+e-+c .c .) is more stringent by 2 orders of magnitude than the previous results, and B (ψ (3686 )→D0e+e-+c .c .) is measured for the first time.

Dicty_cDB: CHR636 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available p 8. 48 0.50 1 CO165293 |CO165293.1 FLD1_53_C12.g1_A029 Root flooded Pinus taeda cDNA clone FLD1_53_C12_A029... 5', mRNA sequence. 46 2.0 1 CO165215 |CO165215.1 FLD1_53_C12.b1_A029 Root floode

Theoretical study of actinide monocarbides (ThC, UC, PuC, and AmC)

Science.gov (United States)

Pogány, Peter; Kovács, Attila; Visscher, Lucas; Konings, Rudy J. M.

2016-12-01

A study of four representative actinide monocarbides, ThC, UC, PuC, and AmC, has been performed with relativistic quantum chemical calculations. The two applied methods were multireference complete active space second-order perturbation theory (CASPT2) including the Douglas-Kroll-Hess Hamiltonian with all-electron basis sets and density functional theory with the B3LYP exchange-correlation functional in conjunction with relativistic pseudopotentials. Beside the ground electronic states, the excited states up to 17 000 cm-1 have been determined. The molecular properties explored included the ground-state geometries, bonding properties, and the electronic absorption spectra. According to the occupation of the bonding orbitals, the calculated electronic states were classified into three groups, each leading to a characteristic bond distance range for the equilibrium geometry. The ground states of ThC, UC, and PuC have two doubly occupied π orbitals resulting in short bond distances between 1.8 and 2.0 Å, whereas the ground state of AmC has significant occupation of the antibonding orbitals, causing a bond distance of 2.15 Å.

A simple, versatile, low-cost and remotely operated apparatus for [11C]acetate, [11C]choline, [11C]methionine and [11C]PIB synthesis

International Nuclear Information System (INIS)

Cheung Manki; Ho Chilai

2009-01-01

A simple, efficient and remotely operated synthesis apparatus for carrying out routine [ 11 C]carboxylation, on-column and bubbling [ 11 C]methylation was essential for reliable, day-to-day production of [ 11 C]-labelled PET radiopharmaceuticals. We developed an in-house apparatus specifically applied to the synthesis of [ 11 C]acetate, [ 11 C]choline, [ 11 C]methionine and 2-(4'-N-[ 11 C]methylaminophenyl)-6-hydroxybenzothiazole ([ 11 C]PIB), where high radiochemical purity (≥97%) and moderate radiochemical yields (18% for [ 11 C]PIB, 41-55% for the others) could be achieved. These findings provided evidence that this was a fast, versatile and reliable apparatus suitable for a PET/CT centre with limited financial budget and hot cell space for synthesis of [ 11 C]-labelled radiopharmaceuticals

C Borges

Indian Academy of Sciences (India)

C Borges. Articles written in Pramana – Journal of Physics. Volume 60 Issue 4 April 2003 pp 817-828. Study of deconfinement in NA50 · Paula bordalo M C Abreu B Alessandro C Alexa R Arnaldi M Atayan C Baglin A Baldit M Bedjidian S Beolé V Boldea Paula Bordalo S R Borenstein C Borges A Bussiére L Capelli C ...

Behaviors of 14C-butachlor, 14C-chlorpyrifos and 14C-DDT in Rana japonica japonica Guenther

International Nuclear Information System (INIS)

Zhang Yiqiang; Zhong Chuangguang; Zhao Xiaokui; Chen Shunhua

2002-01-01

The research on the behaviors of 14 C-butachlor, 14 C-chlorpyrifos and 14 C-DDT in the frog Rana japonica japonica Guenther was carried out. After administrated per os to the frogs in doses of 380, 347, 363 Bq/g, 14 C-butachlor, 14 C-chlorpyrifos and 14 C-DDT, were distributed respectively to various organs within 24 h with specific accumulating organs as gallbladder, intestine and intestine, relevantly to the pesticides described. Compared to that in gallbladder and intestine, the radioactivity of many organs was extremely low, and this might due to the characters of the pesticides. Analysis of the metabolites of 14 C-DDT in frog at 24 th hr demonstrated that DDT was difficult to be degraded. Most 14 C-butachlor, 14 C-chlorpyrifos 14 C-DDT in liver and fat or ovary of frog was extractable with acetone. However, there were some differences between the pesticides, and the organs as well. And 14 C-butachlor, 14 C-chlorpyrifos or 14 C-DDT were better bound in liver than in fat

Search for C+ C clustering in Mg ground state

Indian Academy of Sciences (India)

2017-01-04

Jan 4, 2017 ... Finite-range knockout theory predictions were much larger for (12C,212C) reaction, indicating a very small 12C−12C clustering in 24Mg. (g.s.) . Our present results contradict most of the proposed heavy cluster (12C+12C) structure models for the ground state of 24Mg. Keywords. Direct nuclear reactions ...

Thermal fatigue behavior of C/C composites modified by SiC-MoSi2-CrSi2 coating

International Nuclear Information System (INIS)

Chu Yanhui; Fu Qiangang; Li Hejun; Li Kezhi

2011-01-01

Highlights: → The low-density C/C composites were modified by SiC-MoSi 2 -CrSi 2 multiphase coating by pack cementation. → The thermal fatigue behavior of the modified C/C composites was studied after undergoing thermal cycling for 20 times under the different environments. → The decrease of the flexural strength of the modified C/C composites during thermal cycle in air was primarily attributed to the partial oxidation of the modified C/C samples. - Abstract: Carbon/carbon (C/C) composites were modified by SiC-MoSi 2 -CrSi 2 multiphase coating by pack cementation, and their thermal fatigue behavior under thermal cycling in Ar and air environments was investigated. The modified C/C composites were characterized by scanning electron microscopy and X-ray diffraction. Results of tests show that, after 20-time thermal cycles between 1773 K and room temperature in Ar environment, the flexural strength of modified C/C samples decreased lightly and the percentage of remaining strength was 94.92%. While, after thermal cycling between 1773 K and room temperature in air for 20 times, the weight loss of modified C/C samples was 5.1%, and the flexural strength of the modified C/C samples reduced obviously and the percentage of remaining strength was only 75.22%. The fracture mode of modified C/C samples changed from a brittle behavior to a pseudo-plastic one as the service environment transformed from Ar to air. The decrease of the flexural strength during thermal cycle in air was primarily attributed to the partial oxidation of modified C/C samples.

Hot pressing of B{sub 4}C/SiC composites

Energy Technology Data Exchange (ETDEWEB)

Sahin, F.C.; Turhan, E.; Yesilcubuk, S.A.; Addemir, O. [Ystanbul Technical University, Faculty of Chemistry and Metallurgy, Materials and Metallurgical Engineering Dept., Maslak-Ystanbul (Turkey)

2005-07-01

B{sub 4}C/SiC ceramic composites containing 10-20-30 vol % SiC were prepared by hot pressing method. The effect of SiC addition and hot pressing temperature on sintering behaviour and mechanical properties of hot pressed composites were investigated. Microstructures of hot pressed samples were examined by SEM technique. Three different temperatures (2100 deg. C, 2200 deg. C and 2250 deg. C) were used to optimize hot pressing temperature applying 100 MPa pressure under argon atmosphere during the sintering procedure. The highest relative density of 98.44 % was obtained by hot pressing at 2250 deg. C. However, bending strengths of B{sub 4}C/SiC composite samples were lower than monolithic B{sub 4}C in all experimental conditions. (authors)

FRAUD/SABOTAGE Killing Nuclear-Reactors Need Modeling!!!: "Super"alloys GENERIC ENDEMIC Wigner's-Disease/.../IN-stability: Ethics? SHMETHICS!!!

Science.gov (United States)

Asphahani, Aziz; Siegel, Sidney; Siegel, Edward

2010-03-01

Carbides solid-state chemistry domination of old/new nuclear- reactors/spent-fuel-casks/refineries/jet/missile/rocket-engines in austenitic/FCC Ni/Fe-based(so miscalled)``super"alloys(182/82; Hastelloy-X,600,304/304L-SSs,...,690!!!) GENERIC ENDEMIC EXTANT detrimental(synonyms): Wigner's-diseas(WD)[J.Appl.Phys.17,857 (1946)]/Ostwald-ripening/spinodal-decomposition/overageing- embrittlement/thermal-leading-to-mechanical(TLTM)-INstability: Mayo[Google:``If Leaks Could Kill"; at flickr.com search on ``Giant-Magnotoresistance"; find: Siegel[J.Mag.Mag.Mtls.7,312 (1978)]Politics(1979)]-Hoffman[animatedsoftware.com], what DOE/NRC MISlabels as ``butt-welds" ``stress-corrosion cracking" endpoint's ROOT-CAUSE ULTIMATE-ORIGIN is WD overageing-embritt- lement caused brittle-fracture cracking from early/ongoing AEC/ DOE-n"u"tional-la"v"atories sabotage!!!

Design and fabrication of the Mini-Brayton Recuperator (MBR)

Science.gov (United States)

Killackey, J. J.; Graves, R.; Mosinskis, G.

1978-01-01

Development of a recuperator for a 2.0 kW closed Brayton space power system is described. The plate-fin heat exchanger is fabricated entirely from Hastelloy X and is designed for 10 years continuous operation at 1000 K (1300 F) with a Xenon-helium working fluid. Special design provisions assure uniform flow distribution, crucial for meeting 0.975 temperature effectiveness. Low-cycle fatigue, resulting from repeated startup and shutdown cycles, was identified as the most critical structural design problem. It is predicted that the unit has a minimum fatigue life of 220 cycles. This is in excess of the BIPS requirement of 100 cycles. Heat transfer performance and thermal cycle testing with air, using a prototype unit, verified that all design objectives can be met.

Studies on the selectivity of the reaction of (CO){sub 5}W=C(aryl)H with enynes: transfer of the carbene ligand to the C=C Bond versus insertion of the C triple bond C into the W=C Bond

Energy Technology Data Exchange (ETDEWEB)

Fischer, H.; Volkland, H.P.; Stumpf, R.

1996-10-01

The strongly electrophilic monophenylcarbene complex [(CO){sub 5}W=C(Ph)H] (2a) reacts with the enynes H-C triple bond C-R(R=-C(Me)=CH{sub 2})(3), -C{sub 6}H{sub 4}-CH=CH{sub 2}-p (5) and subsequently with PMe{sub 3} to form the C{sub a}lpha-PMe{sub 3} adducts of the vinylidene complexes [(CO){sub 5}W-{l_brace}C(PMe{sub 3})=CH-C{sub 3}H{sub 3}(Me)Ph{r_brace}] (4) and [(CO){sub 5}W {l_brace}C(PMe{sub 3})=CH-C{sub 6}H{sub 4}-C{sub 3}H{sub 4}Ph{r_brace}] (6). The reaction very likely proceeds by transfer of the carbene ligand to the C=C bond of the enyne to form a cyclopropyl-substituted alkyne complex which is in equilibrium with its vinylidene isomer.

Objective-C

CERN Document Server

DeVoe, Jiva

2011-01-01

A soup-to-nuts guide on the Objective-C programming language. Objective-C is the language behind Cocoa and Cocoa Touch, which is the Framework of applications written for the Macintosh, iPod touch, iPhone, and iPad platforms. Part of the Developer Reference series covering the hottest Apple topics, this book covers everything from the basics of the C language to advanced aspects of Apple development. You'll examine Objective-C and high-level subjects of frameworks, threading, networking, and much more.: Covers the basics of the C language and then quickly moves onto Objective-C and more advanc

Fracture behavior of C/SiC composites at elevated temperature

Energy Technology Data Exchange (ETDEWEB)

Yoon, Dong Hyun; Lee, Jeong Won; Kim, Jae Hoon; Shin, Ihn Cheol; Lim, Byung Joo [Chungnam National University, Daejeon (Korea, Republic of)

2017-08-15

The fracture behavior of carbon fiber-reinforced silicon carbide (C/SiC) composites used in rocket nozzles has been investigated under tension, compression, and fracture conditions at room temperature, 773 K and 1173 K. The C/SiC composites used in this study were manufactured by liquid silicon infiltration process at ~1723 K. All experiments were conducted using two types of specimens, considering fiber direction and oxidation condition. Experimental results show that temperature, fiber direction, and oxidation condition affect the behavior of C/SiC composites. Oxidation was found to be the main factor that changes the strength of C/SiC composites. By applying an anti-oxidation coating, the tensile and compressive strengths of the C/SiC composites increased with temperature. The fracture toughness of the C/SiC composites also increased with increase temperature. A fractography analysis of the fractured specimens was conducted using a scanning electron microscope.

Volume properties and refraction of aqueous solutions of bisadducts of light fullerene C60 and essential amino acids lysine, threonine, and oxyproline (C60(C6H13N2O2)2, C60(C4H8NO3)2, and C60(C5H9NO2)2) at 25°C

Science.gov (United States)

Semenov, K. N.; Ivanova, N. M.; Charykov, N. A.; Keskinov, V. A.; Kalacheva, S. S.; Duryagina, N. N.; Garamova, P. V.; Kulenova, N. A.; Nabieva, A.

2017-02-01

Concentration dependences of the density of aqueous solutions of bisadducts of light fullerene C60 and essential amino acids are studied by pycnometry. Concentration dependences of the average molar volumes and partial volumes of components (H2O and corresponding bisadducts) are calculated for C60(C6H13N2O2)2-H2O, C60(C4H8NO3)2-H2O, and C60(C5H9NO2)2-H2O binary systems at 25°C. Concentration dependences of the indices of refraction of C60(C6H13N2O2)2-H2O, C60(C4H8NO3)2-H2O, and C60(C5H9NO2)2-H2O binary systems are determined at 25°C. The concentration dependences of specific refraction and molar refraction of bisadducts and aqueous solutions of them are calculated.

Thermochemistry analyses for transformation of C6 glucose compound into C9, C12 and C15 alkanes using density functional theory

Science.gov (United States)

Verma, Anand Mohan; Kishore, Nanda

2017-02-01

The hydrolysis of cellulose fraction of biomass yields C6 glucose which further can be transformed into long-chain hydrocarbons by C-C coupling. In this study, C6 glucose is transformed into three chain alkanes, namely, C9, C12 and C15 using C-C coupling reactions under the gas and aqueous phase milieus. The geometry optimisation and vibrational frequency calculations are carried out at well-known hybrid-GGA functional, B3LYP with the basis set of 6-31+g(d,p) under the density functional theory framework. The single point energetics are calculated at M05-2X/6-311+g(3df,2p) level of theory. All thermochemical properties are calculated over a wide range of temperature between 300 and 900 K at an interval of 100 K. The thermochemistry suggested that the aqueous phase behaviour is suitable for the hydrolysis of sugar into long-chain alkanes compared to gas-phase environment. The hydrodeoxygenation reactions under each reaction pathway are found as most favourable reactions in both phases; however, aqueous phase dominates over gas phase in all discussed thermodynamic parameters.

Mass spectra for q c q ¯ c ¯, s c s ¯ c ¯, q b q ¯ ¯, s b s ¯ ¯ tetraquark states with JP C=0++ and 2++

Science.gov (United States)

Chen, Wei; Chen, Hua-Xing; Liu, Xiang; Steele, T. G.; Zhu, Shi-Lin

2017-12-01

We have studied the mass spectra of the hidden-charm/bottom q c q ¯c ¯, s c s ¯c ¯ and q b q ¯b ¯, s b s ¯b ¯ tetraquark states with JP C=0++ and 2++ in the framework of QCD sum rules. We construct ten scalar and four tensor interpolating currents in a systematic way and calculate the mass spectra for these tetraquark states. The X*(3860 ) may be either an isoscalar tetraquark state or χc 0(2 P ). If the X*(3860 ) is a tetraquark candidate, our results prefer the 0++ option over the 2++ one. The X (4160 ) may be classified as either the scalar or tensor q c q ¯c ¯ tetraquark state, while the X (3915 ) favors a 0++ q c q ¯c ¯ or s c s ¯c ¯ tetraquark assignment over the tensor one. The X (4350 ) cannot be interpreted as a s c s ¯c ¯ tetraquark with either JP C=0++ or 2++.

Caffeine-11C, ephedrine-11C and methylephedrine-11C: synthesis and distribution in mice

International Nuclear Information System (INIS)

Saji, Hideo; Ido, Tatsuo; Iwata, Ren; Suzuki, Kazutoshi; Tamate, Kazuhiko

1978-01-01

Caffeine, ephedrine and methylephedrine were labeled with carbon-11 by the action of methyliodide- 11 C on theophylline, norephedrine and ephedrine, respectively. Caffeine- 11 C was prepared in 44 min. with a radiochemical yield of 40%, ephedrine- 11 C in 45 min. with a 11% radiochemical yield and methylephedrine- 11 C in 36 min. with a 43% radiochemical yield. When injected in mice intravenously, these products show a high uptake in the liver, the kidney and the blood for caffeine- 11 C and in the liver and the kidney for ephedrine- 11 C and methylephedrine- 11 C. The brain uptake for these products was found to be 2.4 to 3.9% of the injected dose per gram at 5 min. after injection. These studies in mice have demonstrated that these products are potentially useful agents for the dynamic studies of the brain. (auth.)

Sim3C: simulation of Hi-C and Meta3C proximity ligation sequencing technologies.

Science.gov (United States)

DeMaere, Matthew Z; Darling, Aaron E

2018-02-01

Chromosome conformation capture (3C) and Hi-C DNA sequencing methods have rapidly advanced our understanding of the spatial organization of genomes and metagenomes. Many variants of these protocols have been developed, each with their own strengths. Currently there is no systematic means for simulating sequence data from this family of sequencing protocols, potentially hindering the advancement of algorithms to exploit this new datatype. We describe a computational simulator that, given simple parameters and reference genome sequences, will simulate Hi-C sequencing on those sequences. The simulator models the basic spatial structure in genomes that is commonly observed in Hi-C and 3C datasets, including the distance-decay relationship in proximity ligation, differences in the frequency of interaction within and across chromosomes, and the structure imposed by cells. A means to model the 3D structure of randomly generated topologically associating domains is provided. The simulator considers several sources of error common to 3C and Hi-C library preparation and sequencing methods, including spurious proximity ligation events and sequencing error. We have introduced the first comprehensive simulator for 3C and Hi-C sequencing protocols. We expect the simulator to have use in testing of Hi-C data analysis algorithms, as well as more general value for experimental design, where questions such as the required depth of sequencing, enzyme choice, and other decisions can be made in advance in order to ensure adequate statistical power with respect to experimental hypothesis testing.

C&S Enterprise, L.L.C.

Science.gov (United States)

The EPA is providing notice of a proposed Administrative Penalty Assessment against C & S Enterprise, L.L.C. (“Respondent”), a business located at 2454 480th Ave, Deep River, IA 52222, for alleged violations of the Clean Water Act at property owned by Resp

Generation of Anaphylatoxins by Human β-Tryptase from C3, C4, and C51

Science.gov (United States)

Fukuoka, Yoshihiro; Xia, Han-Zhang; Sanchez-Muñoz, Laura B.; Dellinger, Anthony L.; Escribano, Luis; Schwartz, Lawrence B.

2009-01-01

Both mast cells and complement participate in innate and acquired immunity. The current study examines whether β-tryptase, the major protease of human mast cells, can directly generate bioactive complement anaphylatoxins. Important variables included pH, monomeric vs tetrameric forms of β-tryptase, and the β-tryptase-activating polyanion. The B12 mAb was used to stabilize β-tryptase in its monomeric form. C3a and C4a were best generated from C3 and C4, respectively, by monomeric β-tryptase in the presence of low molecular weight dextran sulfate or heparin at acidic pH. High molecular weight polyanions increased degradation of these anaphylatoxins. C5a was optimally generated from C5 at acidic pH by β-tryptase monomers in the presence of high molecular weight dextran sulfate and heparin polyanions, but also was produced by β-tryptase tetramers under these conditions. Mass spectrometry verified that the molecular mass of each anaphylatoxin was correct. Both β-tryptase-generated C5a and C3a (but not C4a) were potent activators of human skin mast cells. These complement anaphylatoxins also could be generated by β-tryptase in releasates of activated skin mast cells. Of further biologic interest, β-tryptase also generated C3a from C3 in human plasma at acidic pH. These results suggest β-tryptase might generate complement anaphylatoxins in vivo at sites of inflammation, such as the airway of active asthma patients where the pH is acidic and where elevated levels of β-tryptase and complement anaphylatoxins are detected. PMID:18424754

Thermochemical instability effects in SiC-based fibers and SiC{sub f}/SiC composites

Energy Technology Data Exchange (ETDEWEB)

Youngblood, G.E.; Henager, C.H.; Jones, R.H. [Pacific Northwest National Laboratory, Richland, WA (United States)

1997-08-01

Thermochemical instability in irradiated SiC-based fibers with an amorphous silicon oxycarbide phase leads to shrinkage and mass loss. SiC{sub f}/SiC composites made with these fibers also exhibit mass loss as well as severe mechanical property degradation when irradiated at 800{degrees}C, a temperature much below the generally accepted 1100{degrees}C threshold for thermomechanical degradation alone. The mass loss is due to an internal oxidation mechanism within these fibers which likely degrades the carbon interphase as well as the fibers in SiC{sub f}/SiC composites even in so-called {open_quotes}inert{close_quotes} gas environments. Furthermore, the mechanism must be accelerated by the irradiation environment.

Synthesis of [21-14C]-fusarin C by enzymic demethylation and remethylation with [14C]-diazomethane

International Nuclear Information System (INIS)

Lu, S.-J.; Li, M.H.

1989-01-01

Fusarin C, a potent mutagen isolated from Fusarium moniliforme culture extracts, has been prepared radiolabeled in two steps by enzymic hydrolysis of the 21-methyl ester group, using phenobarbital induced microsomal preparations, followed by remethylation using [ 14 F]-diazomethane. Yields, based upon fusarin C, were essentially quantitative and approximately 10% of the [ 14 C]-methyl-nitrosourea, converted to diazomethane, reacted to yield [ 14 C]-fusarin C. (author)

Characterization of amorphous yttria layers deposited by aqueous solutions of Y-chelate alkoxides complex

Science.gov (United States)

Kim, Young-Soon; Lee, Yu-Ri; Kim, Byeong-Joo; Lee, Jae-Hun; Moon, Seung-Hyun; Lee, Hunju

2015-01-01

Crack-free amorphous yttria layers were deposited by dip coating in solutions of different Y-chelate alkoxides complex. Three Y-chelate solutions of different concentrations were prepared using yttrium acetate tetrahydrate, yttrium stearic acid as Y source materials. PEG, diethanolamine were used as chelating agents, while ethanol, methanol and tetradecane were used as solvent. Three different combinations of chelating and solvents were used to prepare solutions for Y2O3 dip coating on SUS, electropolished and non-electropolished Hastelloy C-276 substrates. The thickness of the films was varied by changing the number of dipping cycles. At an optimized condition, the substrate surface roughness (rms) value was reduced from ∼50 nm to ∼1 nm over a 10 × 10 μm2 area. After Y2O3 deposition, MgO was deposited using ion-beam assisted deposition (IBAD), then LaMnO3 (LMO) was deposited using sputtering and GdBCO was deposited using reactive co-evaporation by deposition and reaction (RCE-DR). Detailed X-ray study indicates that LMO/MgO/Y2O3 and GdBCO/LMO/MgO/Y2O3 stack films have good out-of-plane and in-plane textures with strong c-axis alignment. The critical current (Ic) of GdBCO/LMO/MgO/Y2O3 multilayer structure varied from 190 to 420 A/cm with different solutions, when measured at 77 K. These results demonstrated that amorphous yttria can be easily deposited by dip coating using Y-chelates complex as a diffusion barrier and nucleation layer.

Demonstration of SiC Pressure Sensors at 750 C

Science.gov (United States)

Okojie, Robert S.; Lukco, Dorothy; Nguyen, Vu; Savrun, Ender

2014-01-01

We report the first demonstration of MEMS-based 4H-SiC piezoresistive pressure sensors tested at 750 C and in the process confirmed the existence of strain sensitivity recovery with increasing temperature above 400 C, eventually achieving near or up to 100% of the room temperature values at 750 C. This strain sensitivity recovery phenomenon in 4H-SiC is uncharacteristic of the well-known monotonic decrease in strain sensitivity with increasing temperature in silicon piezoresistors. For the three sensors tested, the room temperature full-scale output (FSO) at 200 psig ranged between 29 and 36 mV. Although the FSO at 400 C dropped by about 60%, full recovery was achieved at 750 C. This result will allow the operation of SiC pressure sensors at higher temperatures, thereby permitting deeper insertion into the engine combustion chamber to improve the accurate quantification of combustor dynamics.

Dicty_cDB: VSI127 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available w*nwnw*iksccnchtkftrvngfiqkcfwc*c**tses s*twcnnsicwirkykn*itpsiwr*itn*kffkkesirwy...ii*yqyrkw*qnw*yyw*nwnw*iksccnchtkftrvngfiqkcfwc*c**tses s*twcnnsicwirkykn*itpsiwr*itn*kffkkesirwyssylfrs**ys...scsqnfis rkc*ny*sntkdwcsw*TSCFLTSKINEWCFSRIRRKIKIIYRIFFKKK--- ---lnk**ii*yqyrkw*qnw*yyw*nwnw*iksccnchtkftrvngfiqkcfwc*c**t sess*twcnn

Dicty_cDB: VHE759 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 5 CX072513 |CX072513.1 UCRCS08_28E10_g Parent Washington Navel Orange Callus cDNA Library UCRCS08-2 Citrus s...72512.1 UCRCS08_28E10_b Parent Washington Navel Orange Callus cDNA Library UCRCS08-2 Citrus sinensis cDNA cl...inensis cDNA clone UCRCS08-28E10-J20-1-4.g, mRNA sequence. 46 1.5 1 CX072512 |CX0

Preparation of PtSn/C, PtRu/C, PtRh/C, PtRuRh/C and PtSnRh/C electrocatalysts using an alcohol-reduction process for methanol and ethanol oxidation

International Nuclear Information System (INIS)

Dias, Ricardo Rodrigues

2009-01-01

In this work, Pt/C, PtRh (90:10), PtRh/C (50:50), PtSn/C (50:50), PtRu (50:50)/C, PtRuRh/C (50:40:10) and PtSnRh/C (50:40:10) were prepared by an alcohol-reduction process with metal loading of 20 wt.% using H 2 PtCl 6 .6H 2 O (Aldrich), SnCl 2 .2H 2 O (Aldrich),and RhCl 2 .XH 2 O (Aldrich) as metals sources and Vulcan XC72 as support. The electrocatalysts were characterized by EDX, XRD and cyclic voltammetry (CV). The electro-oxidation of ethanol was studied by CV, chronoamperomety at room temperature in acid medium and tests at 100 deg C on a single cell of a direct methanol or ethanol fuel cell. The EDX analysis showed that the metal atomic ratios of the obtained electrocatalysts were similar to the nominal atomic ratios used in the preparation. The diffractograms of electrocatalysts prepared showed four peaks at approximately 2θ = 40 0 , 47 0 , 67 0 and 82 0 , which are associated with the (111), (200), (220) and (311) planes, respectively, of a face cubic-centered (fcc) structure characteristic of platinum and platinum alloys. The average crystallite sizes using the Scherrer equation and the calculated values were in the range of 2–3 nm. For PtSn/C and PtSnRh/C two additional peaks were observed at 2θ = 34 0 and 52 0 that were identified as a SnO 2 phase. PtSn/C (50:50) and PtSnRh/C (50:40:10) electrocatalyst showed the best performance for ethanol oxidation at room temperature. For methanol oxidation at room temperature PtRu/C, PtSn/C and PtRuRh/C electrocatalysts showed the best performance. Tests at 100 deg C on a single cell of a direct ethanol fuel cell PtSnRh/C showed the best performance, for methanol oxidation PtRuRh/C showed the best performance. (author)

Study of the unimolecular decompositions of the (C3H6)+2 and (c-C3H6)+2 complexes

International Nuclear Information System (INIS)

Tzeng, W.; Ono, Y.; Linn, S.H.; Ng, C.Y.

1985-01-01

The major product channels identified in the unimolecular decompositions ofC 3 H + 6 xC 3 H 6 and c-C 3 H + 6 xc-C 3 H 6 in the total energy [neutral (C 3 H 6 ) 2 or (c-C 3 H 6 ) 2 heat of formation plus excitation energy] range of approx.230--450 kcal/mol are C 3 H + 7 +C 3 H 5 , C 4 H + 7 +C 2 H 5 , C 4 H + 8 +C 2 H 4 , and C 5 H + 9 +CH 3 . The measured appearance energy for C 4 H + 7 (9.54 +- 0.04 eV) from (C 3 H 6 ) 2 is equal to the thermochemical threshold for the formation of C 4 H + 7 +C 2 H 5 from (C 3 H 6 ) 2 , indicating that the exit potential energy barrier for the ion--molecule reaction C 3 H + 6 +C 3 H 6 →C 4 H + 7 +C 2 H 5 is negligible. There is evidence that the formations of C 4 H + 7 +C 2 H 4 +H from (C 3 H 6 ) + 2 and (c-C 3 H 6 ) + 2 also proceed with high probabilities when they are energetically allowed. The variations of the relative abundances for C 4 H + 7 ,C 4 H + 8 , and C 5 H + 9 from (C 3 H 6 ) + 2 and (c-C 3 H 6 ) + 2 as a function of ionizing photon energy are in qualitative agreement, suggesting that (C 3 H 6 ) + 2 and (c-C 3 H 6 ) + 2 rearrange to similar C 6 H + 12 isomers prior to fragmentation. The fact that C 6 H + 11 is found to be a primary ion from the unimolecular decomposition of (c-C 3 H 6 ) + 2 but not (C 3 H 6 ) + 2 supports the conclusion that the distribution of C 6 H + 12 collision complexes involved in the C 3 H + 6 +C 3 H 6 reactions is different from that in the cyclopropane ion--molecule reactions

Competitive Interactions between C. albicans, C. glabrata and C. krusei during Biofilm Formation and Development of Experimental Candidiasis

Science.gov (United States)

Rossoni, Rodnei Dennis; Barbosa, Júnia Oliveira; Vilela, Simone Furgeri Godinho; dos Santos, Jéssica Diane; de Barros, Patrícia Pimentel; Prata, Márcia Cristina de Azevedo; Anbinder, Ana Lia; Fuchs, Beth Burgwyn; Jorge, Antonio Olavo Cardoso; Mylonakis, Eleftherios; Junqueira, Juliana Campos

2015-01-01

In this study, we evaluated the interactions between Candida albicans, Candida krusei and Candida glabrata in mixed infections. Initially, these interactions were studied in biofilms formed in vitro. CFU/mL values of C. albicans were lower in mixed biofilms when compared to the single biofilms, verifying 77% and 89% of C. albicans reduction when this species was associated with C. glabrata and C. krusei, respectively. After that, we expanded this study for in vivo host models of experimental candidiasis. G. mellonella larvae were inoculated with monotypic and heterotypic Candida suspensions for analysis of survival rate and quantification of fungal cells in the haemolymph. In the groups with single infections, 100% of the larvae died within 18 h after infection with C. albicans. However, interaction groups achieved 100% mortality after 72 h of infection by C. albicans-C. glabrata and 96 h of infection by C. albicans-C. krusei. C. albicans CFU/mL values from larvae hemolymph were lower in the interacting groups compared with the monoespecies group after 12 h of infection. In addition, immunosuppressed mice were also inoculated with monotypic and heterotypic microbial suspensions to induce oral candidiasis. C. albicans CFU/mL values recovered from oral cavity of mice were higher in the group with single infection by C. albicans than the groups with mixed infections by C. albicans-C. glabrata and C. albicans-C. krusei. Moreover, the group with single infection by C. albicans had a higher degree of hyphae and epithelial changes in the tongue dorsum than the groups with mixed infections. We concluded that single infections by C. albicans were more harmful for animal models than mixed infections with non-albicans species, suggesting that C. albicans establish competitive interactions with C. krusei and C. glabrata during biofilm formation and development of experimental candidiasis. PMID:26146832

Competitive Interactions between C. albicans, C. glabrata and C. krusei during Biofilm Formation and Development of Experimental Candidiasis.

Science.gov (United States)

Rossoni, Rodnei Dennis; Barbosa, Júnia Oliveira; Vilela, Simone Furgeri Godinho; dos Santos, Jéssica Diane; de Barros, Patrícia Pimentel; Prata, Márcia Cristina de Azevedo; Anbinder, Ana Lia; Fuchs, Beth Burgwyn; Jorge, Antonio Olavo Cardoso; Mylonakis, Eleftherios; Junqueira, Juliana Campos

2015-01-01

In this study, we evaluated the interactions between Candida albicans, Candida krusei and Candida glabrata in mixed infections. Initially, these interactions were studied in biofilms formed in vitro. CFU/mL values of C. albicans were lower in mixed biofilms when compared to the single biofilms, verifying 77% and 89% of C. albicans reduction when this species was associated with C. glabrata and C. krusei, respectively. After that, we expanded this study for in vivo host models of experimental candidiasis. G. mellonella larvae were inoculated with monotypic and heterotypic Candida suspensions for analysis of survival rate and quantification of fungal cells in the haemolymph. In the groups with single infections, 100% of the larvae died within 18 h after infection with C. albicans. However, interaction groups achieved 100% mortality after 72 h of infection by C. albicans-C. glabrata and 96 h of infection by C. albicans-C. krusei. C. albicans CFU/mL values from larvae hemolymph were lower in the interacting groups compared with the monoespecies group after 12 h of infection. In addition, immunosuppressed mice were also inoculated with monotypic and heterotypic microbial suspensions to induce oral candidiasis. C. albicans CFU/mL values recovered from oral cavity of mice were higher in the group with single infection by C. albicans than the groups with mixed infections by C. albicans-C. glabrata and C. albicans-C. krusei. Moreover, the group with single infection by C. albicans had a higher degree of hyphae and epithelial changes in the tongue dorsum than the groups with mixed infections. We concluded that single infections by C. albicans were more harmful for animal models than mixed infections with non-albicans species, suggesting that C. albicans establish competitive interactions with C. krusei and C. glabrata during biofilm formation and development of experimental candidiasis.

Dicty_cDB: SHJ446 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available X4, complete sequence. 42 0.41 8 CX076494 |CX076494.1 UCRCS08_50C12_g Parent Washington Navel Orange Callus ... |CX076493.1 UCRCS08_50C12_b Parent Washington Navel Orange Callus cDNA Library U

Speciation of Campylobacter coli, C. jejuni, C. helveticus, C. lari, C. sputorum, and C. upsaliensis by Matrix-Assisted Laser Desorption Ionization-Time of Flight Mass Spectrometry†

Science.gov (United States)

Mandrell, Robert E.; Harden, Leslie A.; Bates, Anna; Miller, William G.; Haddon, William F.; Fagerquist, Clifton K.

2005-01-01

Multiple strains of Campylobacter coli, C. jejuni, C. helveticus, C. lari, C. sputorum, and C. upsaliensis isolated from animal, clinical, or food samples have been analyzed by matrix-assisted laser desorption ionization-time of flight mass spectrometry (MALDI-TOF MS). Whole bacterial cells were harvested from colonies or confluent growth on agar and transferred directly into solvent and then to a spot of dried 3-methoxy-4-hydroxycinnamic acid (matrix). Multiple ions in the 5,000- to 15,000-Da mass range were evident in spectra for each strain; one or two ions in the 9,500- to 11,000-Da range were consistently high intensity. “Species-identifying” biomarker ions (SIBIs) were evident from analyses of multiple reference strains for each of the six species, including the genome strains C. jejuni NCTC 11168 and C. jejuni RM1221. Strains grown on nine different combinations of media and atmospheres yielded SIBI masses within ±5 Da with external instrument calibration. The highest-intensity C. jejuni SIBIs were cytosolic proteins, including GroES, HU/HCj, and RplL. Multiple intraspecies SIBIs, corresponding probably to nonsynonymous nucleotide polymorphisms, also provided some intraspecies strain differentiation. MALDI-TOF MS analysis of 75 additional Campylobacter strains isolated from humans, poultry, swine, dogs, and cats revealed (i) associations of SIBI type with source, (ii) strains previously speciated incorrectly, and (iii) “strains” composed of more than one species. MALDI-TOF MS provides an accurate, sensitive, and rapid method for identification of multiple Campylobacter species relevant to public health and food safety. PMID:16204551

Speciation of Campylobacter coli, C. jejuni, C. helveticus, C. lari, C. sputorum, and C. upsaliensis by matrix-assisted laser desorption ionization-time of flight mass spectrometry.

Science.gov (United States)

Mandrell, Robert E; Harden, Leslie A; Bates, Anna; Miller, William G; Haddon, William F; Fagerquist, Clifton K

2005-10-01

Multiple strains of Campylobacter coli, C. jejuni, C. helveticus, C. lari, C. sputorum, and C. upsaliensis isolated from animal, clinical, or food samples have been analyzed by matrix-assisted laser desorption ionization-time of flight mass spectrometry (MALDI-TOF MS). Whole bacterial cells were harvested from colonies or confluent growth on agar and transferred directly into solvent and then to a spot of dried 3-methoxy-4-hydroxycinnamic acid (matrix). Multiple ions in the 5,000- to 15,000-Da mass range were evident in spectra for each strain; one or two ions in the 9,500- to 11,000-Da range were consistently high intensity. "Species-identifying" biomarker ions (SIBIs) were evident from analyses of multiple reference strains for each of the six species, including the genome strains C. jejuni NCTC 11168 and C. jejuni RM1221. Strains grown on nine different combinations of media and atmospheres yielded SIBI masses within +/-5 Da with external instrument calibration. The highest-intensity C. jejuni SIBIs were cytosolic proteins, including GroES, HU/HCj, and RplL. Multiple intraspecies SIBIs, corresponding probably to nonsynonymous nucleotide polymorphisms, also provided some intraspecies strain differentiation. MALDI-TOF MS analysis of 75 additional Campylobacter strains isolated from humans, poultry, swine, dogs, and cats revealed (i) associations of SIBI type with source, (ii) strains previously speciated incorrectly, and (iii) "strains" composed of more than one species. MALDI-TOF MS provides an accurate, sensitive, and rapid method for identification of multiple Campylobacter species relevant to public health and food safety.

Potential Hazards Relating to Pyrolysis of c-C4F8O, n-C4F10 and c-C4F8 in selected gaseous diffusion plant operations

International Nuclear Information System (INIS)

Trowbridge, L.D.

2000-01-01

As part of a program intended to replace the present evaporative coolant at the gaseous diffusion plants (GDPs) with a non-ozone-depleting alternate, a series of investigations of the suitability of candidate substitutes is under way. This report summarizes studies directed at estimating the chemical and thermal stability of three candidate coolants, c-C 4 F 8 O, n-C 4 F 10 and c-C 4 4F 8 , in a few specific environments to be found in gaseous diffusion plant operations

Dicty_cDB: VSD136 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 8 |CB290208.1 UCRCS01_01aa10_g1 Washington Navel orange cold acclimated flavedo & albedo cDNA library Citrus....1 UCRCS01_04cd07_g1 Washington Navel orange cold acclimated flavedo & albedo cDNA library Citrus sinensis c

Dicty_cDB: SHJ838 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 4 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza S...alvia miltiorrhiza cDNA 5', mRNA sequence. 54 6e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.scf cDNA Libra

Dicty_cDB: CHN523 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available -09 5 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA... 5', mRNA sequence. 54 5e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.scf cDNA L

Oxidation of C/SiC Composites at Reduced Oxygen Partial Pressures

Science.gov (United States)

Opila, Elizabeth J.; Serra, Jessica

2009-01-01

Carbon-fiber reinforced SiC (C/SiC) composites are proposed for leading edge applications of hypersonic vehicles due to the superior strength of carbon fibers at high temperatures (greater than 1500 C). However, the vulnerability of the carbon fibers in C/SiC to oxidation over a wide range of temperatures remains a problem. Previous oxidation studies of C/SiC have mainly been conducted in air or oxygen, so that the oxidation behavior of C/SiC at reduced oxygen partial pressures of the hypersonic flight regime are less well understood. In this study, both carbon fibers and C/SiC composites were oxidized over a wide range of temperatures and oxygen partial pressures to facilitate the understanding and modeling of C/SiC oxidation kinetics for hypersonic flight conditions.

Dicty_cDB: Contig-U03072-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available verselong Onychiurus arcticus d... 38 0.010 2 ( CF439672 ) EST676017 normalized cDNA library of ...ornis cDN... 68 8e-07 1 ( BU884919 ) R017H10 Populus root cDNA library Populus tremula... 68 8e-07 1 ( ...us dormant bud cDNA library Populus ... 60 2e-04 1 ( CK110478 ) N067A08 Populus bark cDNA library Populus tremul...04 1 ( BU887484 ) R062A08 Populus root cDNA library Populus tremula... 60 2e-04 1 ( BU880608 ) UM52TC12 Populus flower cDNA library...us tremula cambium cDNA library Po... 60 2e-04 1 ( BU819297 ) UA42BPA08 Populus tremula cambium cDNA library

C and C* among intermediate rings

NARCIS (Netherlands)

Sack, J.; Watson, S.

2014-01-01

Given a completely regular Hausdorff space X, an intermediate ring A(X) is a ring of real valued continuous functions between C*(X) and C(X). We discuss two correspondences between ideals in A(X) and z-filters on X, both reviewing old results and introducing new results. One correspondence, ZA,

Competitive cAMP Antagonists for cAMP-Receptor Proteins

NARCIS (Netherlands)

Haastert, Peter J.M. van; Driel, Roel van; Jastorff, Bernd; Baraniak, Janina; Stec, Wojciech J.; Wit, René J.W. de

1984-01-01

The two exocyclic oxygen atoms at phosphorus of cAMP have been replaced by a sulfur atom or by a dimethylamino group. These substitutions introduce chirality at the phosphorus atom; therefore, two diastereoisomers are known for each derivative: (SP)-cAMPS, (RP)-cAMPS, (SP)-cAMPN(CH3)2, and

A new SiC/C bulk FGM for fusion reactor

International Nuclear Information System (INIS)

Changchun, G.; Anhua, W.; Wenbin, C.; Jiangtao, L.

2001-01-01

Graphite is widely used in present Tokamak facilities and a C/C composite has been selected as one of the candidate materials for the ITER. But C-based material has an excessive chemical sputtering yield at 600-1000 K and exhibits irradiation enhanced sublimation at >1200 K under plasma erosion condition, causing serious C-contamination of plasma. Low Z material SiC has several advantages for use in fusion reactor, such as excellent high temperature properties, corrosion resistance, low density, and especially its low activation irradiation. To reduce C contamination during plasma exposure, previously SiC coatings were chemically deposited on the surface of C-substrate, however, the thermal stresses arise on the interface between the coating layers and the substrate under high temperature. Heating/cooling cycle leading to cracks in SiC/C interface, small thickness of coating and long processing time are limiting factors for FGM made with CVD process. In this paper, a new SiC/C bulk FGM has been successfully fabricated with P/M hot pressing process. The chemical sputtering yield, gas desorption performance, thermal shock resistance and physical sputtering performance in Tokamak are outlined in this paper. (author)

Dicty_cDB: SHE451 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available evipalpis DNA, complete genome. 34 0.015 17 CV091260 |CV091260.1 NA1759 cDNA non acclimated Bluecrop library... Vaccinium corymbosum cDNA 5', mRNA sequence. 46 0.036 2 CV091166 |CV091166.1 NA1661 cDNA non acclimated Blu

Dicty_cDB: SFE866 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available cDNA library MtBC from arbuscular mycorrhiza of cultivar Jemalong of Medicago tru...protein. 94 1e-21 2 AL385573 |AL385573.1 Medicago truncatula EST MtBC29C12F1 : T3 end of clone MtBC29C12 of

Dicty_cDB: SSJ172 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available cDNA library MtBC from arbuscular mycorrhiza of cultivar Jemalong of Medicago tru...te cds. 494 e-147 3 AL386374 |AL386374.1 Medicago truncatula EST MtBC34C06F1 : T3 end of clone MtBC34C06 of

Mol 7C/6; Mol 7C/6

Energy Technology Data Exchange (ETDEWEB)

Aberle, J.; Schleisiek, K.; Schmuck, I.; Schmidt, L.; Romer, O.; Weih, G.

1995-08-01

The Mol 7C/6 coolant blockage experiment in the Belgian BR2 reactor yielded results different from Mol 7C experiments with low burnup pins: At 10% burnup local failure is not self-limiting, but requires active systems for detection and scram. The Mol 7C series was finished in 1991. In each of the test bundles Mol 7C/4, /5 and /6, 30 Mk I pins pre-irradiated in KNK II were used. The central blockage consisted of enriched UO{sub 2} covering 30 percent of the bundle cross-section, with a height of 40 mm. The most important system for timely detection of coolant blockages of the type studied in Mol 7C/6 is based on DND. (orig.)

Reassessment of the C-13/C-12 and C-14/C-12 isotopic fractionation ratio and its impact on high-precision radiocarbon dating

NARCIS (Netherlands)

Fahrni, Simon M.; Southon, John R.; Santos, Guaciara M.; Palstra, Sanne W. L.; Meijer, Harro A. J.; Xu, Xiaomei

2017-01-01

The vast majority of radiocarbon measurement results (C-14/C-12 isotopic ratios or sample activities) are corrected for isotopic fractionation processes (measured as C-13/C-12 isotopic ratios) that occur in nature, in sample preparation and measurement. In 1954 Harmon Craig suggested a value of 2.0

Selective terminal C–C scission of C5-carbohydrates

NARCIS (Netherlands)

Klis, van der F.; Gootjes, L.; Haveren, van J.; Es, van D.S.; Bitter, J.H.

2015-01-01

The selective catalytic production of C4-tetritols (erythritol and threitol) from C5-sugars is an attractive route for the conversion of non-digestible sugars to C4-building blocks from agro residues. Here we show that an unprecedented high selectivity of 20–25% C4-tertritols can be achieved under

The structure of C2b, a fragment of complement component C2 produced during C3 convertase formation

Energy Technology Data Exchange (ETDEWEB)

Krishnan, Vengadesan [Center for Biophysical Sciences and Engineering, School of Optometry, University of Alabama at Birmingham, Birmingham, AL 35294 (United States); Xu, Yuanyuan [Division of Clinical Immunology and Rheumatology, University of Alabama at Birmingham, Birmingham, AL 35294 (United States); Macon, Kevin [Center for Biophysical Sciences and Engineering, School of Optometry, University of Alabama at Birmingham, Birmingham, AL 35294 (United States); Volanakis, John E. [Department of Medicine, University of Alabama at Birmingham, Birmingham, AL 35294 (United States); Narayana, Sthanam V. L., E-mail: narayana@uab.edu [Center for Biophysical Sciences and Engineering, School of Optometry, University of Alabama at Birmingham, Birmingham, AL 35294 (United States)

2009-03-01

The crystal structure of C2b has been determined at 1.8 Å resolution, which reveals the arrangement of its three complement control protein (CCP) modules. A model for complement component C2 is presented and its conformational changes during the C3-convertase formation are also discussed. The second component of complement (C2) is a multi-domain serine protease that provides catalytic activity for the C3 and C5 convertases of the classical and lectin pathways of human complement. The formation of these convertases requires the Mg{sup 2+}-dependent binding of C2 to C4b and the subsequent cleavage of C2 by C1s or MASP2, respectively. The crystal structure of full-length C2 is not yet available, although the structure of its C-terminal catalytic segment C2a has been determined. The crystal structure of the N-terminal segment C2b of C2 determined to 1.8 Å resolution presented here reveals the arrangement of its three CCP domains. The domains are arranged differently compared with most other CCP-domain assemblies, but their arrangement is similar to that found in the Ba part of the full-length factor B structure. The crystal structures of C2a, C2b and full-length factor B are used to generate a model for C2 and a discussion of the domain association and possible interactions with C4b during formation of the C4b–C2 complex is presented. The results of this study also suggest that upon cleavage by C1s, C2a domains undergo conformational rotation while bound to C4b and the released C2b domains may remain folded together similar to as observed in the intact protein.

The structure of C2b, a fragment of complement component C2 produced during C3 convertase formation

International Nuclear Information System (INIS)

Krishnan, Vengadesan; Xu, Yuanyuan; Macon, Kevin; Volanakis, John E.; Narayana, Sthanam V. L.

2009-01-01

The crystal structure of C2b has been determined at 1.8 Å resolution, which reveals the arrangement of its three complement control protein (CCP) modules. A model for complement component C2 is presented and its conformational changes during the C3-convertase formation are also discussed. The second component of complement (C2) is a multi-domain serine protease that provides catalytic activity for the C3 and C5 convertases of the classical and lectin pathways of human complement. The formation of these convertases requires the Mg 2+ -dependent binding of C2 to C4b and the subsequent cleavage of C2 by C1s or MASP2, respectively. The crystal structure of full-length C2 is not yet available, although the structure of its C-terminal catalytic segment C2a has been determined. The crystal structure of the N-terminal segment C2b of C2 determined to 1.8 Å resolution presented here reveals the arrangement of its three CCP domains. The domains are arranged differently compared with most other CCP-domain assemblies, but their arrangement is similar to that found in the Ba part of the full-length factor B structure. The crystal structures of C2a, C2b and full-length factor B are used to generate a model for C2 and a discussion of the domain association and possible interactions with C4b during formation of the C4b–C2 complex is presented. The results of this study also suggest that upon cleavage by C1s, C2a domains undergo conformational rotation while bound to C4b and the released C2b domains may remain folded together similar to as observed in the intact protein

A complex of cardiac cytochrome c1 and cytochrome c.

Science.gov (United States)

Chiang, Y L; Kaminsky, L S; King, T E

1976-01-10

The interactions of cytochrome c1 and cytochrome c from bovine cardiac mitochondria were investigated. Cytochrome c1 and cytochrome c formed a 1:1 molecular complex in aqueous solutions of low ionic strength. The complex was stable to Sephadex G-75 chromatography. The formation and stability of the complex were independent of the oxidation state of the cytochrome components as far as those reactions studied were concerned. The complex was dissociated in solutions of ionic strength higher than 0.07 or pH exceeding 10 and only partially dissociated in 8 M urea. No complexation occurred when cytochrome c was acetylated on 64% of its lysine residues or photooxidized on its 2 methionine residues. Complexes with molecular ratios of less than 1:1 (i.e. more cytochrome c) were obtained when polymerized cytochrome c, or cytochrome c with all lysine residues guanidinated, or a "1-65 heme peptide" from cyanogen bromide cleavage of cytochrome c was used. These results were interpreted to imply that the complex was predominantly maintained by ionic interactions probably involving some of the lysine residues of cytochrome c but with major stabilization dependent on the native conformations of both cytochromes. The reduced complex was autooxidizable with biphasic kinetics with first order rate constants of 6 X 10(-5) and 5 X U0(-5) s-1 but did not react with carbon monoxide. The complex reacted with cyanide and was reduced by ascorbate at about 32% and 40% respectively, of the rates of reaction with cytochrome c alone. The complex was less photoreducible than cytochrome c1 alone. The complex exhibited remarkably different circular dichroic behavior from that of the summation of cytochrome c1 plus cytochrome c. We concluded that when cytochromes c1 and c interacted they underwent dramatic conformational changes resulting in weakening of their heme crevices. All results available would indicate that in the complex cytochrome c1 was bound at the entrance to the heme crevice of

Screening effects on 12C+12C fusion reaction

Science.gov (United States)

Koyuncu, F.; Soylu, A.

2018-05-01

One of the important reactions for nucleosynthesis in the carbon burning phase in high-mass stars is the 12C+12C fusion reaction. In this study, we investigate the influences of the nuclear potentials and screening effect on astrophysically interesting 12C+12C fusion reaction observables at sub-barrier energies by using the microscopic α–α double folding cluster (DFC) potential and the proximity potential. In order to model the screening effects on the experimental data, a more general exponential cosine screened Coulomb (MGECSC) potential including Debye and quantum plasma cases has been considered in the calculations for the 12C+12C fusion reaction. In the calculations of the reaction observables, the semi-classical Wentzel-Kramers-Brillouin (WKB) approach and coupled channel (CC) formalism have been used. Moreover, in order to investigate how the potentials between 12C nuclei produce molecular cluster states of 24Mg, the normalized resonant energy states of 24Mg cluster bands have been calculated for the DFC potential. By analyzing the results produced from the fusion of 12C+12C, it is found that taking into account the screening effects in terms of MGECSC is important for explaining the 12C+12C fusion data, and the microscopic DFC potential is better than the proximity potential in explaining the experimental data, also considering that clustering is dominant for the structure of the 24Mg nucleus. Supported by the Turkish Science and Research Council (TÜBİTAK) with (117R015)

Dicty_cDB: Contig-U15640-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available -15 3 ( EX266810 ) 1447411_5_I01_007 PY06 Carica papaya cDNA, mRNA s... 86 4e-15 3 ( EX123475 ) BR107305 mature green leaf cDNA libra....2 1 ( CN487418 ) EST2064 Puccinellia tenuiflora cDNA library Pucci... 48 1.2 1 ( CJ870341 ) Triticu...m cDNA, RIKEN fu... 44 2.2 2 ( CB283146 ) BT1417 Blomia tropicalis cDNA library Blomia trop... 40 2.4 2 ( AB174436 ) Macaca fascicul...malized ... 62 1e-08 2 ( CK265529 ) EST711607 potato abiotic stress cDNA library Sola... 62 1e-08 2 ( DV6022...45C09.g Maize Endosperm cDNA Library Zea ... 56 2e-07 4 ( CK259915 ) EST705993 potato abiotic stress cDNA library

Chemical vapor deposition of SiC on C-C composites as plasma facing materials for fusion application

International Nuclear Information System (INIS)

Kim, W. J.; Lee, M. Y.; Park, J. Y.; Hong, G. W.; Kim, J. I.; Choi, D. J.

2000-01-01

Because of the low activation and excellent mechanical properties at elevated temperatures, carbon-fiber reinforced carbon(C-C) composites have received much attention for plasma facing materials for fusion reactor and high-temperature structural applications such as aircrafts and space vehicles. These proposed applications have been frustrated by the lack of resistance to hydrogen erosion and oxidation on exposure to ambient oxidizing conditions at high temperature. Although Silicon Carbide (SiC) has shown excellent properties as an effective erosion-and oxidation-protection coating, many cracks are developed during fabrication and thermal cycles in use due to the Coefficients of Thermal Expansion(CTE) mismatch between SiC and C-C composite. In this study, we adopted a pyrolitic carbon as an interlayer between SiC and C-C substrate in order to minimize the CTE mismatch. The oxidation-protection performance of this composite was investigated as well

Dicty_cDB: CHJ706 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 09 6 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA ...5', mRNA sequence. 54 2e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.scf cDNA Library of Salvia miltiorrhiz

Metal-organic cooperative catalysis in C-H and C-C bond activation and its concurrent recovery.

Science.gov (United States)

Park, Young Jun; Park, Jung-Woo; Jun, Chul-Ho

2008-02-01

The development of an efficient catalytic activation (cleavage) system for C-H and C-C bonds is an important challenge in organic synthesis, because these bonds comprise a variety of organic molecules such as natural products, petroleum oils, and polymers on the earth. Among many elegant approaches utilizing transition metals to activate C-H and C-C bonds facilely, chelation-assisted protocols based on the coordinating ability of an organic moiety have attracted great attention, though they have often suffered from the need for an intact coordinating group in a substrate. In this Account, we describe our entire efforts to activate C-H or C-C bonds adjacent to carbonyl groups by employing a new concept of metal-organic cooperative catalysis (MOCC), which enables the temporal installation of a 2-aminopyridyl group into common aldehydes or ketones in a catalytic way. Consequently, a series of new catalytic reactions such as alcohol hydroacylation, oxo-ester synthesis, C-C triple bond cleavage, hydrative dimerization of alkynes, and skeletal rearrangements of cyclic ketones was realized through MOCC. In particular, in the quest for an optimized MOCC system composed of a Wilkinson's catalyst (Ph 3P) 3RhCl and an organic catalyst (2-amino-3-picoline), surprising efficiency enhancements could be achieved when benzoic acid and aniline were introduced as promoters for the aldimine formation process. Furthermore, a notable accomplishment of C-C bond activation has been made using 2-amino-3-picoline as a temporary chelating auxiliary in the reactions of unstrained ketones with various terminal olefins and Wilkinson's catalyst. In the case of seven-membered cyclic ketones, an interesting ring contraction to five- or six-membered ones takes place through skeletal rearrangements initiated by the C-C bond activation of MOCC. On the other hand, the fundamental advances of these catalytic systems into recyclable processes could be achieved by immobilizing both metal and organic

Accelerated C# 2010

CERN Document Server

Nash, Trey

2010-01-01

C# 2010 offers powerful new features, and this book is the fastest path to mastering them-and the rest of C#-for both experienced C# programmers moving to C# 2010 and programmers moving to C# from another object-oriented language. Many books introduce C#, but very few also explain how to use it optimally with the .NET Common Language Runtime (CLR). This book teaches both core C# language concepts and how to wisely employ C# idioms and object-oriented design patterns to exploit the power of C# and the CLR. This book is both a rapid tutorial and a permanent reference. You'll quickly master C# sy

Electronically excited C 2 from laser photodissociated C 60

Science.gov (United States)

Arepalli, S.; Scott, C. D.; Nikolaev, P.; Smalley, R. E.

2000-03-01

Spectral and transient emission measurements are made of radiation from products of laser excitation of buckminsterfullerene (C 60) vapor diluted in argon at 973 K. The principal radiation is from the Swan band system of C 2 and, at early times, also from a black-body continuum. Transient measurements indicate two characteristic periods of decay 2 and 50 μs long, with characteristic decay times of ˜0.3 and 5 μs, respectively. The first period is thought to be associated with decomposition and radiative cooling of C 60 molecules or nano-sized carbon particles and the second period continues with decomposition products of laser excited C 60, C 58, C 56, etc.

Dicty_cDB: Contig-U16300-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 632 ) 95999.1 Cold Sweetening C Solanum tuberosum cDNA ... 62 2e-14 3 ( CK280013 ) EST726091 potato abiotic stress cDNA library...(Normalize... 72 6e-18 4 ( CK277106 ) EST723184 potato abiotic stress cDNA library Sola... 56 7e-18 4 ( CK25...na cDNA 5', ... 74 5e-14 4 ( CX082679 ) EHAB017TR E. histolytica Normalized cDNA library ... 52...( CX089904 ) EHAE563TR E. histolytica Normalized cDNA library ... 52 7e-14 4 ( EB...a strain T4 cDNA library. 56 1e-12 4 ( AB077052 ) Nicotiana tabacum NtCK2a3 mRNA for casein kina

Mechanical properties of hot-pressed SiC-TiC composites

Directory of Open Access Journals (Sweden)

Kamil Kornaus

2017-12-01

Full Text Available SiC-TiC composites, with 0, 5, 10 and 20 vol.% of TiC, were sintered by the hot-pressing technique at temperature of 2000 °C under argon atmosphere. SiC sintering process was activated by liquid phase created by the reaction between Al2O3 and Y2O3, in which it is possible to dissolve passivating oxide layers (SiO2 and TiO2 and partially SiC and TiC carbides. Microstructure observation and density measurements confirmed that the composites were dense with uniformly distributed components. Differences in thermal expansion coefficients between SiC and TiC led to complex stress state occurrence. These stresses combined with the liquid-derived separate phase between grains boundaries increased fracture toughness of the composites, which ranged from 5.8 to 6.3 MPa·m0.5. Opposite to the bending strength, fracture toughness increased with the TiC volume fraction. By means of simulation of residual thermal stresses in the composites, it was found that with the increasing volume fraction of TiC, tensile stress in TiC grains is reduced simultaneously with strong rise of compressive stresses in the matrix.

Dysfunctional C8 beta chain in patients with C8 deficiency.

Science.gov (United States)

Tschopp, J; Penea, F; Schifferli, J; Späth, P

1986-12-01

Two sera from unrelated individuals, each lacking C8 activity, were examined by Western blot analysis. Using antisera raised against whole C8, the two sera are shown to lack the C8 beta chain, indicating a C8 beta deficiency, which is frequently observed in cases of dysfunctional C8. In contrast, by means of a specific anti-C8-beta antiserum, a C8 beta-like polypeptide chain of apparently identical molecular weight compared to normal C8 beta was detected. Digestion of normal and dysfunctional C8 beta with Staphylococcus aureus V8 protease revealed distinct differences in the enzymatic digestion pattern. We conclude that the dysfunction in the C8 protein in these two patients resides in the dysfunctional C8 beta chain, and that this form of C8 deficiency is distinct from C8 deficiencies previously reported, in which one or both C8 subunits are lacking.

Professional C++

CERN Document Server

Gregoire, Marc; Kleper, Scott J

2011-01-01

Essential reading for experienced developers who are determined to master the latest release of C++ Although C++ is often the language of choice from game programming to major commercial software applications, it is also one of the most difficult to master. With this no-nonsense book, you will learn to conquer the latest release of C++. The author deciphers little-known features of C++, shares detailed code examples that you can then plug into your own code, and reveals the significant changes to C++ that accompany the latest release. You'll discover how to design and build applications that

Complete cDNA sequence of human complement C1s and close physical linkage of the homologous genes C1s and C1r

International Nuclear Information System (INIS)

Tosi, M.; Duponchel, C.; Meo, T.; Julier, C.

1987-01-01

Overlapping molecular clones encoding the complement subcomponent C1s were isolated from a human liver cDNA library. The nucleotide sequence reconstructed from these clones spans about 85% of the length of the liver C1s messenger RNAs, which occur in three distinct size classes around 3 kilobases in length. Comparisons with the sequence of C1r, the other enzymatic subcomponent of C1, reveal 40% amino acid identity and conservation of all the cysteine residues. Beside the serine protease domain, the following sequence motifs, previously described in C1r, were also found in C1s: (a) two repeats of the type found in the Ba fragment of complement factor B and in several other complement but also noncomplement proteins, (b) a cysteine-rich segment homologous to the repeats of epidermal growth factor precursor, and (c) a duplicated segment found only in C1r and C1s. Differences in each of these structural motifs provide significant clues for the interpretation of the functional divergence of these interacting serine protease zymogens. Hybridizations of C1r and C1s probes to restriction endonuclease fragments of genomic DNA demonstrate close physical linkage of the corresponding genes. The implications of this finding are discussed with respect to the evolution of C1r and C1s after their origin by tandem gene duplication and to the previously observed combined hereditary deficiencies of Clr and Cls

Effect of sintering temperature on structure of C-B4C-SiC composites with silicon additive

International Nuclear Information System (INIS)

Wu Lijun; Academia Sinica, Shenyang; Huang Qizhong; Yang Qiaoqin; Zhao Lihu; Xu Zhongyu

1996-01-01

Carbon materials possess good electric conductivity, heat conductivity, corrosion-resistance, self-lubrication and hot-shocking resistance, and are easily machined. However, they have low mechanical strength, and are easily oxidized in air at high temperature. On the contrary, ceramic materials have high mechanical strength and hardness, and have good wear-resistance and oxidation-resistance. However, they have the shortages of poor thermal-shock resistance lubrication, and are difficult to machine. Therefore, carbon/ceramic composites with the advantages of both carbon and ceramic materials have been widely studied in the recent years. Huang prepared C-B 4 C-SiC composites with the free sintering method and the hot pressing method, and studied the effects of Si, Al, Al 2 O 3 , Ni and Ti additives on the properties of the composites. The results showed that these additives could improve the properties of the composites. Zhao et al. studies the structure of C-B 4 C-SiC composites with Si additive sintered at 2,000 C and found two c-center monoclinic phases. In this paper, the authors discussed the effect of the sintering temperature on the structure of C-B 4 C-SiC composites with Si additive by means of transmission electron microscope (TEM) and x-ray diffractometer (XRD)

C.C.D. readout of a picosecond streak camera with an intensified C.C.D

International Nuclear Information System (INIS)

Lemonier, M.; Richard, J.C.; Cavailler, C.; Mens, A.; Raze, G.

1984-08-01

This paper deals with a digital streak camera readout device. The device consists in a low light level television camera made of a solid state C.C.D. array coupled to an image intensifier associated to a video-digitizer coupled to a micro-computer system. The streak camera images are picked-up as a video signal, digitized and stored. This system allows the fast recording and the automatic processing of the data provided by the streak tube

Investigation of low spin resonances in the 12C+12C and 16O+12C systems

International Nuclear Information System (INIS)

Uzureau, J.L.; Fieni, J.M.; Cocu, F.; Michaudon, A.

1979-01-01

The excitation functions of the 12 C( 12 C,α) 20 Ne and 12 C( 16 O,α) 24 Mg reactions were measured at different angles below the Coulomb barrier. Resonant structures were found at Esub(cm)=5.80 MeV in the 12 C+ 12 C system and at Esub(cm)=6.10 MeV in the 16 O+ 12 C system. From the analysis of angular distributions measured at the previous resonant energies, values of respectively Jsup(π)=0 + and 2 + have been deduced [fr

Dicty_cDB: CHM552 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available actuca sativa cDNA clone QGB20J11, mRNA sequence. 80 6e-11 1 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA ...Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence. 54 3e-09 3 CV172465 |CV172465.1 rsmsx

Dicty_cDB: SHL126 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ce. 52 6e-09 5 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorr...hiza cDNA 5', mRNA sequence. 54 7e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.scf cDNA Library of Salvia m

Dicty_cDB: SHG607 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available sativa cDNA clone QGJ1L02, mRNA sequence. 80 9e-11 1 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library... of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence. 54 6e-09 3 CV172465 |CV172465.1 rsmsxlre

Dicty_cDB: Contig-U14038-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available hophyton rubrum cDNA library 8 Tric... 54 0.006 1 ( DW708366 ) EST031847 Tric...hophyton rubrum cDNA library 8 Tric... 54 0.006 1 ( DW693636 ) EST017117 Trichophyton rubrum cDNA library 3 Tric...... 54 0.006 1 ( DW688891 ) EST012372 Trichophyton rubrum cDNA library 2 Tric... 54 0.006 1 ( DW688872 ) EST012353 Tric...hophyton rubrum cDNA library 2 Tric... 54 0.006 1 ( DW686711 ) EST010192 Tric...hophyton rubrum cDNA library 1 Tric... 54 0.006 1 ( DW685118 ) EST008599 Trichophyton rubrum cDNA library 1 Tric

Dicty_cDB: Contig-U05851-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 92694 ) ENTMF30TR Entamoeba histolytica Sheared DNA Entam... 36 2.2 2 ( DT758331 ) EST1192180 Aquilegia cDNA library...CX093708 ) EHAFO88TR E. histolytica Normalized cDNA library ... 56 7e-04 2 ( CX084682 ) EHABU33TR E. histolytica Normalized cDNA libr...ary ... 56 7e-04 2 ( CX084490 ) EHABR37TR E. histolytica Normalized cDNA library .....a Normalized cDNA library ... 56 0.001 2 ( CX085755 ) EHAC996TR E. histolytica Normalized cDNA library... 2 ( DT754356 ) EST1188205 Aquilegia cDNA library Aquilegia formo... 46 0.010 2 (

Dicty_cDB: Contig-U15146-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available us BAC clone RP24-129G21 from chromosom... 38 1.7 4 ( FG066604 ) dlbw0_003512 cDNA library... of cambium of Betula pl... 40 2.6 2 ( FG065202 ) dlbw0_000186 cDNA library of cambium of Betul...0 2 ( FG065344 ) dlbw0_000454 cDNA library of cambium of Betula pl... 40 3.1 2 ( FG067998 ) dlbw0_005638 cDNA library...vus cDNA 3', mRNA ... 34 3.7 2 ( BU836156 ) T083C10 Populus apical shoot cDNA library Popul... 1 ( BU572652 ) PA__Ea0001H21f Almond developing seed Prunus dulc... 48 0.25 1 ( BQ641167 ) EST290 almond cDNA library Prunus dul

High-temperature protective coatings for C/SiC composites

Directory of Open Access Journals (Sweden)

Xiang Yang

2014-12-01

Full Text Available Carbon fiber-reinforced silicon carbide (C/SiC composites were well-established light weight materials combining high specific strength and damage tolerance. For high-temperature applications, protective coatings had to provide oxidation and corrosion resistance. The literature data introduced various technologies and materials, which were suitable for the application of coatings. Coating procedures and conditions, materials design limitations related to the reactivity of the components of C/SiC composites, new approaches and coating systems to the selection of protective coatings materials were examined. The focus of future work was on optimization by further multilayer coating systems and the anti-oxidation ability of C/SiC composites at temperatures up to 2073 K or higher in water vapor.

Synthesis of (5,6-/sup 13/C/sub 2/, 1-/sup 14/C)olivetolic acid, methyl (1'-/sup 13/C)olivetolate and (5,6-/sup 13/C/sub 2/, 1-/sup 14/C)cannabigerolic acid

Energy Technology Data Exchange (ETDEWEB)

Porwoll, J P; Leete, E [Minnesota Univ., Minneapolis (USA). Dept. of Chemistry

1985-03-01

Potential advanced intermediates in the biosynthesis of delta/sup 9/-tetrahydrocannabinol, the major psychoactive principle of marijuana, have been synthesized labeled with two contiguous /sup 13/C atoms and /sup 14/C. Methyl (5,6-/sup 13/C/sub 2/, 1-/sup 14/C)olivetolate was prepared from lithium (/sup 13/C/sub 2/)acetylide and dimethyl (2-/sup 14/C)malonate. Reaction with geranyl bromide afforded methyl (5,6-/sup 13/C/sub 2/, 1-/sup 14/C)cannabigerolate, and hydrolysis of these methyl esters with lithium propyl mercaptide yielded the corresponding labeled acids. The /sup 13/C-/sup 13/C couplings observable in the /sup 13/C NMR spectra of these /sup 13/C-enriched compounds and their synthetic precursors are recorded. Methyl (1'-/sup 14/C)olivetolate was prepared from /sup 13/CO/sub 2/ to confirm assignments of the /sup 13/C chemical shifts in the pentyl side chain of these compounds.

Efficient processing of two-dimensional arrays with C or C++

Science.gov (United States)

Donato, David I.

2017-07-20

Because fast and efficient serial processing of raster-graphic images and other two-dimensional arrays is a requirement in land-change modeling and other applications, the effects of 10 factors on the runtimes for processing two-dimensional arrays with C and C++ are evaluated in a comparative factorial study. This study’s factors include the choice among three C or C++ source-code techniques for array processing; the choice of Microsoft Windows 7 or a Linux operating system; the choice of 4-byte or 8-byte array elements and indexes; and the choice of 32-bit or 64-bit memory addressing. This study demonstrates how programmer choices can reduce runtimes by 75 percent or more, even after compiler optimizations. Ten points of practical advice for faster processing of two-dimensional arrays are offered to C and C++ programmers. Further study and the development of a C and C++ software test suite are recommended.Key words: array processing, C, C++, compiler, computational speed, land-change modeling, raster-graphic image, two-dimensional array, software efficiency

Dicty_cDB: SLA508 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available e-101 SLD569 (SLD569Q) /CSM/SL/SLD5-C/SLD569Q.Seq.d/ 250 1e-65 SLD492 (SLD492Q) /CSM/SL/SLD4-D/SLD492...oideum slug cDNA, clone SLD569. 250 2e-62 1 ( AU052538 ) Dictyostelium discoideum slug cDNA, clone SLD492. 7

Boron-Based Catalysts for C-C Bond-Formation Reactions.

Science.gov (United States)

Rao, Bin; Kinjo, Rei

2018-05-02

Because the construction of the C-C bond is one of the most significant reactions in organic chemistry, the development of an efficient strategy has attracted much attention throughout the synthetic community. Among various protocols to form C-C bonds, organoboron compounds are not just limited to stoichiometric reagents, but have also made great achievements as catalysts because of the easy modification of the electronic and steric impacts on the boron center. This review presents recent developments of boron-based catalysts applied in the field of C-C bond-formation reactions, which are classified into four kinds on the basis of the type of boron catalyst: 1) highly Lewis acidic borane, B(C 6 F 5 ) 3 ; 2) organoboron acids, RB(OH) 2 , and their ester derivatives; 3) borenium ions, (R 2 BL)X; and 4) other miscellaneous kinds. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

Synthesis of [3-14C]- and [phenyl-U-14C] olaquindox

International Nuclear Information System (INIS)

Maul, W.; Scherling, D.; Seng, F.

1981-01-01

Olaquindox is a new feed additive. [ 14 C]Olaquindox, labelled in different positions, was needed for tracer-studies of pharmacokinetics, biotransformation and residues in several species of animals. 2-[N-(2-hydroxethyl)-carbamoyl]-3-methyl-[3- 14 C]quinoxaline-1,4-dioxide([3- 14 C]Olaquindox) was synthesized from barium[ 14 C]carbonate (22 mmoles; 1.15 Ci) via [1- 14 C]acetic acid, sodium[1- 14 C]acetate, [1- 14 C]acetylchloride, ethyl[3- 14 C]acetoacetate and 2-carbethoxy-3-methyl-[3- 14 C]quinoxaline-1,4-dioxide with an overall yield of 10%, based on barium[ 14 C]carbonate. The radiochemical purity was better than 98% (tlc). The specific activities of three preparations were 10.5, 8.4 and 5.45 μCi/mg respectively. [phenyl-U- 14 C]Olaquindox was synthesized starting from [U- 14 C]aniline (19.8 mmoles; 284.4 mCi). Intermediate products were N-acetyl[U- 14 C]aniline, 2-nitro-N-acetyl[U- 14 C]aniline, 2-nitro[U- 14 C]aniline and [U- 14 C]benzofurazanoxide. The total yield was 50% as calculated for [U- 14 C]aniline. At calibration samples of two preparations showed specific activities of 49.5 and 11.1 μCi/mg respectively. The radiochemical purity was checked by tlc and exceeded 98%. (author)

Rapid radioimmunoassay of human apolipoproteins C-II and C-III

Energy Technology Data Exchange (ETDEWEB)

Gustafson, S; Oestlund-Lindqvist, A M; Vessby, B [Uppsala Univ. (Sweden)

1984-06-01

Apolipoprotein (apo) C-II is an activator of lipoprotein lipase, while apo C-III has the ability to inhibit apo C-II activated lipolysis. In order to study further the relationship between lipoprotein lipase mediated hydrolysis and the serum concentrations of apo C-II and apo C-III radioimmunoassays for these apolipoproteins have been developed. Formalin-treated Staphylococcus aureus Cowan I was used for immunoprecipitation and were shown to give rapid uptake of immune complexes that could easily be harvested by centrifugation. The assays were shown to be sensitive (10 ..mu..g/1), specific, precise (inter- and intra-assay coefficients of variation below 10%), rapid (completed in less than 6 h) and simple to perform. Delipidation of serum and lipoproteins had no effect on the results, indicating that the immunologically active sites of apo C-II and apo C-III are exposed to the aqueous environment under assay conditions. Serum apo C-II and apo C-III levels of normolipidaemic subjects were approximately 25 mg/1 and 110 mg/1, respectively. Highly significant positive correlations were found between VLDL apo C-II and VLDL apo C-III, respectively, and VLDL triglycerides, VLDL cholesterol and total serum TG. There was also a highly significant correlation between the HDL cholesterol concentration and the HDL apo C-III concentration.

Direct approaches to nitriles via highly efficient nitrogenation strategy through C-H or C-C bond cleavage.

Science.gov (United States)

Wang, Teng; Jiao, Ning

2014-04-15

Because of the importance of nitrogen-containing compounds in chemistry and biology, organic chemists have long focused on the development of novel methodologies for their synthesis. For example, nitrogen-containing compounds show up within functional materials, as top-selling drugs, and as bioactive molecules. To synthesize these compounds in a green and sustainable way, researchers have focused on the direct functionalization of hydrocarbons via C-H or C-C bond cleavage. Although researchers have made significant progress in the direct functionalization of simple hydrocarbons, direct C-N bond formation via C-H or C-C bond cleavage remains challenging, in part because of the unstable character of some N-nucleophiles under oxidative conditions. The nitriles are versatile building blocks and precursors in organic synthesis. Recently, chemists have achieved the direct C-H cyanation with toxic cyanide salts in the presence of stoichiometric metal oxidants. In this Account, we describe recent progress made by our group in nitrile synthesis. C-H or C-C bond cleavage is a key process in our strategy, and azides or DMF serve as the nitrogen source. In these reactions, we successfully realized direct nitrile synthesis using a variety of hydrocarbon groups as nitrile precursors, including methyl, alkenyl, and alkynyl groups. We could carry out C(sp(3))-H functionalization on benzylic, allylic, and propargylic C-H bonds to produce diverse valuable synthetic nitriles. Mild oxidation of C═C double-bonds and C≡C triple-bonds also produced nitriles. The incorporation of nitrogen within the carbon skeleton typically involved the participation of azide reagents. Although some mechanistic details remain unclear, studies of these nitrogenation reactions implicate the involvement of a cation or radical intermediate, and an oxidative rearrangement of azide intermediate produced the nitrile. We also explored environmentally friendly oxidants, such as molecular oxygen, to make our

Electronic structure and static dipole polarizability of C60-C240

International Nuclear Information System (INIS)

Zope, Rajendra R

2008-01-01

The electronic structure of C 60 -C 240 and its first-order response to a static electric field is studied by an all-electron density functional theory calculation using large polarized Gaussian basis sets. Our results show that the outer C 240 shell almost completely shields the inner C 60 as inferred from the practically identical values of dipole polarizability of the C 60 -C 240 onion (449 A 3 ) and that of the isolated C 240 fullerene (441 A 3 ). The C 60 -C 240 is thus a near-perfect Faraday cage

Dicty_cDB: VSA784 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available tula EST MtBC39A08F1 : T3 end of clone MtBC39A08 of cDNA library MtBC from arbuscular mycorrhiza of cultivar...C10B03F1 : T3 end of clone MtBC10B03 of cDNA library MtBC from arbuscular mycorrh... cDNA library MtBC from arbuscular mycorrhiza of cultivar Jemalong of Medicago truncatula (barrel medic). 62...13 |AL382813.1 Medicago truncatula EST MtBC10B03R1 : T7 end of clone MtBC10B03 of

Dicty_cDB: Contig-U12612-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ... 50 2e-14 5 ( DW406140 ) EST000561 Trichophyton rubrum cDNA library Tricho... 50 2e-14 5 ( C... CAPH Naegleria gruberi amoeba stage ... 48 2e-15 6 ( DW703626 ) EST027107 Trichophyton rubrum cDNA library 7 Tric...... 50 7e-15 5 ( DW405704 ) EST000125 Trichophyton rubrum cDNA library Tric...ho... 50 1e-14 5 ( DW683765 ) EST007246 Trichophyton rubrum cDNA library 1 Tric... 50 1e-14 5 ( DW678803 ) EST002284 Tric...hophyton rubrum cDNA library 0 Tric... 50 1e-14 5 ( DW697736 ) EST021217 Trichophyton rubrum cDNA library 6 Tric

Dicty_cDB: Contig-U15176-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available m... 52 0.039 1 ( CX098067 ) EHAHG37TR E. histolytica Normalized cDNA library ... 52 0.039 1 ( CX097486 ) EHAH754TR E. histolytic...a Normalized cDNA library ... 52 0.039 1 ( CX097433 ) EHAH676TR E. histolytica Normalized cDNA library... ... 52 0.039 1 ( CX097412 ) EHAH643TR E. histolytica Normalized cDNA library... ... 52 0.039 1 ( CX097231 ) EHAH379TR E. histolytica Normalized cDNA library ... 52 0.039 1 ( CX...096775 ) EHAGX23TR E. histolytica Normalized cDNA library ... 52 0.039 1 ( CX096109 ) EHAGN19TR E. histolytica Normalized cDNA librar

Dicty_cDB: SFC593 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available IIIIIIIIIXXHXHX A Frame B: ---sssssssssssssssssssssssssssssssssssssssssssssssssssvxixix l Frame C: ---hhhh...hhhhhhhxhxhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhxssssss s Homology vs CSM-cDNA *****

Vitamin C

Science.gov (United States)

... values to calculate your total daily recommended amount. What foods provide vitamin C? Fruits and vegetables are the ... lessen cooking losses. Fortunately, many of the best food sources of vitamin C, ... raw. What kinds of vitamin C dietary supplements are available? ...

Hepatitis C

Science.gov (United States)

... an inflammation of the liver. One type, hepatitis C, is caused by the hepatitis C virus (HCV). It usually spreads through contact with ... childbirth. Most people who are infected with hepatitis C don't have any symptoms for years. If ...

Application of C/C composites to the combustion chamber of rocket engines. Part 1: Heating tests of C/C composites with high temperature combustion gases

Science.gov (United States)

Tadano, Makoto; Sato, Masahiro; Kuroda, Yukio; Kusaka, Kazuo; Ueda, Shuichi; Suemitsu, Takeshi; Hasegawa, Satoshi; Kude, Yukinori

1995-04-01

Carbon fiber reinforced carbon composite (C/C composite) has various superior properties, such as high specific strength, specific modulus, and fracture strength at high temperatures of more than 1800 K. Therefore, C/C composite is expected to be useful for many structural applications, such as combustion chambers of rocket engines and nose-cones of space-planes, but C/C composite lacks oxidation resistivity in high temperature environments. To meet the lifespan requirement for thermal barrier coatings, a ceramic coating has been employed in the hot-gas side wall. However, the main drawback to the use of C/C composite is the tendency for delamination to occur between the coating layer on the hot-gas side and the base materials on the cooling side during repeated thermal heating loads. To improve the thermal properties of the thermal barrier coating, five different types of 30-mm diameter C/C composite specimens constructed with functionally gradient materials (FGM's) and a modified matrix coating layer were fabricated. In this test, these specimens were exposed to the combustion gases of the rocket engine using nitrogen tetroxide (NTO) / monomethyl hydrazine (MMH) to evaluate the properties of thermal and erosive resistance on the thermal barrier coating after the heating test. It was observed that modified matrix and coating with FGM's are effective in improving the thermal properties of C/C composite.

Studies on 14C-extractable residue, 14C-bound residue and mineralization of 14C-labeled chlorsulfuron in soils

International Nuclear Information System (INIS)

Ye Qingfu; Sun Jinhe; Qi Wenyuan; Wu Jianmin

2003-01-01

The purpose of the present study was to investigate 14 C-extractable residue ( 14 C-ER), 14 C-bound residue ( 14 C-BR) and mineralization of 14 C-labeled chlorsulfuron in soils by using isotope technique. The main factors affecting 14 C-BR formation and the distribution pattern of 14 C-BR in humus were also discussed in details. The results were as follows: (1) The 14 C-ER content of 14 C-chlorsulfuron in seven kinds of soil was positively related to soil pH and negatively related to clay content and organic matter content significantly. Moreover. the decrease rate of 14 C-chlorsulfuron parent compound derived from 14 C-ER in soils followed the first order rate reaction, the half-life in Soil 1-Soil 7 were 13.0, 13.1, 17.7, 133.3, 21.8, 22.1, 33.2 days, respectively. It was concluded that soil pH was the main factor affecting the degradation of 14 C-chlorsulfuron. (2) The 14 C-BR content of 14 C-chlorsulfuron in soils increased sharply with the incubation time during the initial 20 days, then changed slowly with time. However, 14 C-BR content during the whole incubation depended on soil types. The order of 14 C-BR content followed Soil 1 > Soil 2, Soil 5 and Soil 6 > Soil 3 > Soil 7 > Soil 4. The maximum values of 14 C-BR content of 14 C-chlorsulfuron in Soil 1-Soil 7 were 53.3%, 40.9%, 37.8%, 16.4%, 42.5%, 41.0% and 31.3% of applied amount. In addition, the 14 C-BR content of 14 C-chlorsulfuron in soils was negatively related to soil pH significantly, and positively related to the clay content. The soil pH was found to be the main factor affecting BR formation of 14 C-chlorsulfuron among the basic properties of soil. (3) During the whole periods of the incubation, the 14 C-BR of 14 C-chlorsulfuron in soils was mainly distributed in fulvic acid and humin. The relative percent of 14 C-BR in fulvic acid was higher than in humin. While the relative percentage of the 14 C-BR in humic acid only account for 2%. It was suggested that fulvic acid played an important role

Elevated c-Src and c-Yes expression in malignant skin cancers

Directory of Open Access Journals (Sweden)

Lee Jang

2010-08-01

Full Text Available Abstracts Background Src family kinases (SFKs play an important role in cancer proliferation, survival, motility, invasiveness, metastasis, and angiogenesis. Among the SFKs, c-Src and c-Yes are particularly over-expressed or hyper-activated in many human epithelial cancers. However, only a few studies have attempted to define the expression and role of c-Src and c-Yes in cutaneous carcinomas. Objectives To investigate the expression of c-Src and c-Yes in cutaneous carcinomas to include malignant melanoma (MM, squamous cell carcinoma (SCC and basal cell carcinoma (BCC. Methods We examined 6 normal skin tissues and 18 malignant skin tumor tissues using western blotting for the expression of c-Src and c-Yes. In another set, 16 specimens of MM, 16 SCCs and 16 BCCs were analyzed for the expression of c-Src and c-Yes using immunohistochemical staining. Results Western blotting showed that c-Src was expressed in all malignant skin tumors, but not in normal skin, while c-Yes was expressed in MM and SCC, but not in BCC and normal skin. Immunohistochemical staining results of c-Src and c-Yes in MM, SCC, and BCC mirrored those of the western blot analysis. Conclusions c-Src, rather than c-Yes, plays a key role in the proliferation and progression of malignant skin cancers.

Carburization of austenitic alloys by gaseous impurities in helium

International Nuclear Information System (INIS)

Lai, G.Y.; Johnson, W.R.

1980-03-01

The carburization behavior of Alloy 800H, Inconel Alloy 617 and Hastelloy Alloy X in helium containing various amounts of H 2 , CO, CH 4 , H 2 O and CO 2 was studied. Corrosion tests were conducted in a temperature range from 649 to 1000 0 C (1200 to 1832 0 F) for exposure time up to 10,000 h. Four different helium environments, identified as A, B, C, and D, were investigated. Concentrations of gaseous impurities were 1500 μatm H 2 , 450 μatm CO, 50 μatm CH 4 and 50 μatm H 2 O for Environment A; 200 μatm H 2 , 100 μatm CO, 20 μatm CH 4 , 50 μatm H 2 O and 5 μatm CO 2 for Environment B; 500 μatm H 2 , 50 μatm CO, 50 μatm CH 4 and 2 O for Environment C; and 500 μatm H 2 , 50 μatm CO, 50 μatm CH 4 and 1.5 μatm H 2 O for Environment D. Environments A and B were characteristic of high-oxygen potential, while C and D were characteristic of low-oxygen potential. The results showed that the carburization kinetics in low-oxygen potential environments (C and D) were significantly higher, approximately an order of magnitude higher at high temperatures, than those in high-oxygen potential environments (A and B) for all three alloys. Thermodynamic analyses indicated no significant differences in the thermodynamic carburization potential between low- and high-oxygen potential environments. It is thus believed that the enhanced carburization kinetics observed in the low-oxygen potential environments were related to kinetic effects. A qualitatively mechanistic model was proposed to explain the enhanced kinetics. The present results further suggest that controlling the oxygen potential of the service environment can be an effective means of reducing carburization of alloys

Effects of low atmospheric CO2 and elevated temperature during growth on the gas exchange responses of C3, C3-C4 intermediate, and C4 species from three evolutionary lineages of C4 photosynthesis.

Science.gov (United States)

Vogan, Patrick J; Sage, Rowan F

2012-06-01

This study evaluates acclimation of photosynthesis and stomatal conductance in three evolutionary lineages of C(3), C(3)-C(4) intermediate, and C(4) species grown in the low CO(2) and hot conditions proposed to favo r the evolution of C(4) photosynthesis. Closely related C(3), C(3)-C(4), and C(4) species in the genera Flaveria, Heliotropium, and Alternanthera were grown near 380 and 180 μmol CO(2) mol(-1) air and day/night temperatures of 37/29°C. Growth CO(2) had no effect on photosynthetic capacity or nitrogen allocation to Rubisco and electron transport in any of the species. There was also no effect of growth CO(2) on photosynthetic and stomatal responses to intercellular CO(2) concentration. These results demonstrate little ability to acclimate to low CO(2) growth conditions in closely related C(3) and C(3)-C(4) species, indicating that, during past episodes of low CO(2), individual C(3) plants had little ability to adjust their photosynthetic physiology to compensate for carbon starvation. This deficiency could have favored selection for more efficient modes of carbon assimilation, such as C(3)-C(4) intermediacy. The C(3)-C(4) species had approximately 50% greater rates of net CO(2) assimilation than the C(3) species when measured at the growth conditions of 180 μmol mol(-1) and 37°C, demonstrating the superiority of the C(3)-C(4) pathway in low atmospheric CO(2) and hot climates of recent geological time.

Dicty_cDB: SLH810 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available frhfsdcriwlfwfcfinshtvsfflrisck*CFSFFFWTSGFSIRYLIYCNHLI ILIILCFVIISLFVTFL Translated Amino Acid sequence (Al...rame C: *fncyfrhfsdcriwlfwfcfinshtvsfflrisck*CFSFFFWTSGFSIRYLIYCNHLI ILIILCFVIISLFVTFL Homology vs CSM-cDNA

Neutron tolerance of advanced SiC-fiber/CVI-SiC composites

International Nuclear Information System (INIS)

Katoh, Y.; Kohyama, A.; Snead, L.L.; Hinoki, T.; Hasegawa, A.

2003-01-01

Fusion blankets employing a silicon carbide (SiC) fiber-reinforced SiC matrix composite (SiC/SiC composite) as the structural material provide attractive features represented by high cycle efficiency and extremely low induced radioactivity. Recent advancement in processing and utilization techniques and application studies in ceramic gas turbine and advanced transportation systems, SiC/SiC composites are steadily getting matured as industrial materials. Reference SiC/SiC composites for fusion structural applications have been produced by a forced-flow chemical vapor infiltration (FCVI) method using conventional and advanced near-stoichiometric SiC fibers and extensively evaluated primarily in Japan-US collaborative JUPITER program. In this work, effect of neutron irradiation at elevated temperatures on mechanical property of these composites is characterized. Unlike in conventional SiC/SiC composites, practically no property degradation was identified in advanced composites with a thin carbon interphase by a neutron fluence level of approximately 8dpa at 800C. (author)

Dicty_cDB: Contig-U16006-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ne 01 Psig64s-55C regio... 50 0.22 1 ( EU648429 ) Psiguria umbrosa clone 05 Psig6...4s-55C region geno... 50 0.22 1 ( EU648428 ) Psiguria umbrosa clone 04 Psig64s-55C region geno... 50 0.22 1 ( EU648427 ) Psiguri...a umbrosa clone 03 Psig64s-55C region geno... 50 0.22 1 ( EU648426 ) Psiguria umbrosa cl...one 02 Psig64s-55C region geno... 50 0.22 1 ( EU648425 ) Psiguria umbrosa clone 0...1 Psig64s-55C region geno... 50 0.22 1 ( EU648423 ) Psiguria pedata clone 07 Psig64s-55C region genom... 50

Dicty_cDB: Contig-U02963-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 3 ( CK246139 ) EST729776 potato callus cDNA library, normalized ... 36 0.066 2 ( CK260957 ) EST707035 potato abiotic stress cDNA libr...ary Sola... 36 0.066 2 ( CK264509 ) EST710587 potato abiotic stress cDNA library So...la... 36 0.066 2 ( CK270438 ) EST716516 potato abiotic stress cDNA library Sola.....e-12 3 ( FD432325 ) Atr01b_127_E02_C010.g1 FGP Male Amborella trichop... 50 4e-09 2 ( CF450348 ) EST686693 normalized cDNA library...GE498851 ) CCFT1427.b1_E22.ab1 CCF(STU) sunflower Helianthus... 42 0.005 2 ( DV105288 ) chiou01187 Subtractive cDNA library

Thermodynamic description of the C-Ge and C-Mg systems

Directory of Open Access Journals (Sweden)

Hu B.

2010-01-01

Full Text Available The thermodynamic modeling for the C-Ge and C-Mg systems is performed by the CALPHAD method. The enthalpy of formation for Mg2C3, the experimental value of which is not available in the literature, is obtained via first-principles calculation to refine the thermodynamic modeling of the C-Mg system. A comparison of the thermodynamic calculations with the available literature data shows that the presently obtained two sets of thermodynamic parameters for the C-Ge and C-Mg systems can well describe the these two systems.

Dicty_cDB: Contig-U03055-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available -67 2 ( FG284490 ) 1108770671670 New World Screwworm Egg 9261 ESTs C... 143 7e-67... 3 ( FG286862 ) 1108770727001 New World Screwworm Egg 9261 ESTs C... 143 9e-67 3 ( FG284489 ) 1108770671669 New World...ld Screwworm Egg 9261 ESTs C... 143 1e-66 3 ( FG286245 ) 1108770714398 New World... Screwworm Egg 9261 ESTs C... 143 1e-66 3 ( FG290225 ) 1108793315348 New World Screw...T1 Hydractinia echinata cD... 147 1e-64 4 ( FG285211 ) 1108770694495 New World Screwworm Egg 9261 ESTs C...

C++ evolves!

International Nuclear Information System (INIS)

Naumann, Axel

2014-01-01

C++ is used throughout High Energy Physics. CERN participates in the development of its standard. There has been a major shift in standardization procedures that will be visible starting 2014 with an increase rate of new standardized features. Already the current C++11 has major improvements, also for coding novices, related to simplicity, expressiveness, performance and robustness. Other major improvements are in the area of concurrency, where C++ is now on par with most other high level languages. To benefit from these language improvements and from the massive improvements in compiler technology for instance in usability, access to current compilers is crucial. Use of current C++ compiled with current compilers can considerably improve C++ for the HEP physicist community.

High thermal conductivity SiC/SiC composites for fusion applications -- 2

International Nuclear Information System (INIS)

Kowbel, W.; Tsou, K.T.; Withers, J.C.; Youngblood, G.E.

1998-01-01

This report covers material presented at the IEA/Jupiter Joint International Workshop on SiC/SiC Composites for Fusion Structural Applications held in conjunction with ICFRM-8, Sendai, Japan, Oct. 23--24, 1997. An unirradiated SiC/SiC composite made with MER-developed CVR SiC fiber and a hybrid PIP/CVI SiC matrix exhibited room temperature transverse thermal conductivity of 45 W/mK. An unirradiated SiC/SiC composite made from C/C composite totally CVR-converted to a SiC/SiC composite exhibited transverse thermal conductivity values of 75 and 35 W/mK at 25 and 1000 C, respectively. Both types of SiC/SiC composites exhibited non-brittle failure in flexure testing

Dicty_cDB: VSG286 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VS (Link to library) VSG286 (Link to dictyBase) - - - Contig-U16209-1 VSG286E (Link... Clone ID VSG286 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16209-1 Original site URL http://dict...846 |BQ096846.1 IfHdk00487 Ictalurus furcatus head kidney cDNA library Ictalurus furcatus cDNA 5' similar to... Ribosomal protein Sa (laminin receptor 1), mRNA sequence. 46 2e-11 4 CK406973 |CK406973.1 AUF_IfLvr_212_m02 Ict...alurus furcatus liver cDNA library Ictalurus furcatus cDNA 5' similar to lami

Dicty_cDB: CHJ796 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CH (Link to library) CHJ796 (Link to dictyBase) - - - - - (Link to Original site) -... - CHJ796Z 123 - - - - Show CHJ796 Library CH (Link to library) Clone ID CHJ796 (Link to dictyBase) Atlas ID - NBRP ID - dic...ssues normalized and once-subtracted cDNA library (gcal) clone gcal0009c.b.04, 5prim end (...ed and once-subtracted cDNA library (gcal) clone gcal0009c.b.04, 3prim end (M13F primer). 36 0.47 2 AF239838...0804 |pid:none) Roseiflexus castenholzii DSM 139... 33 2.3 AY714838_16( AY714838 |pid:none) Uncultured archa

Dicty_cDB: SLC455 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SL (Link to library) SLC455 (Link to dictyBase) - - - Contig-U16584-1 SLC455Z (Link... to Original site) - - SLC455Z 379 - - - - Show SLC455 Library SL (Link to library) Clone ID SLC455 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-C/SLC455Q.Seq.d/ Representative seq. ID SLC45...5Z (Link to Original site) Representative DNA sequence >SLC455 (SLC455Q) /CSM/SL/SLC4-C/SLC455Q.Seq.d/ XXXXX...57 ) Dictyostelium discoideum slug cDNA, clone SLC469. 468 e-177 3 ( AU034549 ) Dictyostelium discoideum slug cDNA, clone SLC4

Thermal stability of nanocomposite CrC/a-C:H thin films

International Nuclear Information System (INIS)

Gassner, G.; Mayrhofer, P.H.; Patscheider, J.; Mitterer, C.

2007-01-01

The thermal stability of low-friction Me-C/a-C:H coatings is important for their potential applications in the tool and automotive industry. Recently we showed that CrC x /a-C:H coatings prepared by unbalanced magnetron sputtering of a Cr target in Ar + CH 4 glow discharges exhibit a nanocomposite structure where metastable fcc CrC nanocrystals are encapsulated by an a-C:H phase. Here, we present the structural evolution of these nanocomposite CrC/a-C:H coatings during annealing. High-temperature X-ray diffraction in vacuum and differential scanning calorimetry (DSC) combined with thermo-gravimetric analysis in Ar atmosphere indicate decomposition of the formed metastable fcc CrC phase and subsequent formation of Cr 3 C 2 and Cr 7 C 3 and structural transformation of the a-C:H matrix phase towards higher sp 2 bonding contents at temperatures above 450 deg. C. Combined DSC and mass spectrometer analysis as well as elemental profiling after annealing in vacuum by elastic recoil detection analysis relate this transformation to the loss of bonded hydrogen at temperatures above 200 deg. C. Due to these structural changes the coefficient of friction depends on the annealing temperature of the nanocomposite a-C:H coatings and shows a minimum of ∼ 0.13 for T = 200 deg. C. The more complex tribochemical reactions, influenced by the hydrogen loss from the coating during in-situ high temperatures ball-on disc tests, result in coefficient of friction values below 0.05 for T < 120 deg. C

Cyclic voltammetric analysis of C 1-C 4 alcohol electrooxidations with Pt/C and Pt-Ru/C microporous electrodes

Science.gov (United States)

Lee, Choong-Gon; Umeda, Minoru; Uchida, Isamu

The effect of temperature on methanol, ethanol, 2-propanol, and 2-butanol electrooxidation is investigated with Pt/C and Pt-Ru/C microporous electrodes. Cyclic voltammetry is employed in temperatures ranging from 25 to 80 °C to provide quantitative and qualitative information on the kinetics of alcohol oxidation. Methanol displays the greatest activity atom alcohols. The addition of ruthenium reduces the poisoning effect, although it is ineffective with secondary alcohols. Secondary alcohols undergo a different oxidation mechanism at higher temperatures. Microporous electrodes provide detailed information on alcohol oxidation.

Practical C++ programming

National Research Council Canada - National Science Library

Oualline, Steve

2003-01-01

... . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . xv Part I. The Basics 1. What Is C++? A Brief History of C++ C++ Organization How to Learn C++...

Rhenium-Promoted C-C Bond-Cleavage Reactions of Internal Propargyl Alcohols.

Science.gov (United States)

Lee, Kui Fun; Bai, Wei; Sung, Herman H Y; Williams, Ian D; Lin, Zhenyang; Jia, Guochen

2018-06-07

The first examples of C-C bond cleavage reactions of internal propargyl alcohols to give vinylidene complexes are described. Treatment of [Re(dppm) 3 ]I with RC≡CC(OH)R'R'' (R=aryl, alkyl; C(OH)R'R''=C(OH)Ph 2, C(OH)Me 2 , C(OH)HPh, C(OH)H 2 ) produced the vinylidene complexes ReI(=C=CHR)(dppm) 2 with the elimination of C(O)R'R''. Computational studies support that the reactions proceed through a β-alkynyl elimination of alkoxide intermediates Re{OC(R')(R'')C≡CR}(dppm) 2 . © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

C anti c q anti q states

Energy Technology Data Exchange (ETDEWEB)

Chao, K T [Oxford Univ. (UK). Dept. of Theoretical Physics; Science Research Council, Chilton (UK). Rutherford and Appleton Labs.)

1980-07-01

Taking account of the colour magnetic and electric forces, we discuss the spectroscopy of various types of c anti c q anti q states. Their decay, hadronic production, production in e/sup +/e/sup -/ annihilation as well as photoproduction are also studied.

Dicty_cDB: AFH538 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available e-165 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequence. 7...ge Tetrahymena thermophila cDNA, mRNA sequence. 74 3e-09 1 CN206834 |CN206834.1 Tor7258 Gametophyte rehydr...ation Library Tortula ruralis cDNA, mRNA sequence. 70 5e-08 1 CK030146 |CK030146.1

Dicty_cDB: SLJ419 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available |CB367289.1 E38 early-oocyst library Plasmodium berghei/Anopheles stephensi mixe...7 |CB367287.1 E830 early-oocyst library Plasmodium berghei/Anopheles stephensi mixed EST library cDNA clone ...oocyst library Plasmodium berghei/Anopheles stephensi mixed EST library cDNA clon...ly-oocyst library Plasmodium berghei/Anopheles stephensi mixed EST library cDNA clone E3015 similar to Plasm

Fabrication of SiC Composites with Synergistic Toughening of Carbon Whisker and In Situ 3C-SiC Nanowire

Directory of Open Access Journals (Sweden)

Zhang Yunlong

2016-01-01

Full Text Available The SiC composites with synergistic toughening of carbon whisker and in situ 3C-SiC nanowire have been fabricated by hot press sinter technology and annealed treatment technology. Effect of annealed time on the morphology of SiC nanowires and mechanical properties of the Cw/SiC composites was surveyed in detail. The appropriate annealed time improved mechanical properties of the Cw/SiC composites. The synergistic effect of carbon whisker and SiC nanowire can improve the fracture toughness for Cw/SiC composites. The vapor-liquid-solid growth (VLS mechanism was proposed. TEM photo showed that 3C-SiC nanowire can be obtained with preferential growth plane ({111}, which corresponded to interplanar spacing about 0.25 nm.

Activated Integrin-Linked Kinase Negatively Regulates Muscle Cell Enhancement Factor 2C in C2C12 Cells

Directory of Open Access Journals (Sweden)

Zhenguo Dong

2015-01-01

Full Text Available Our previous study reported that muscle cell enhancement factor 2C (MEF2C was fully activated after inhibition of the phosphorylation activity of integrin-linked kinase (ILK in the skeletal muscle cells of goats. It enhanced the binding of promoter or enhancer of transcription factor related to proliferation of muscle cells and then regulated the expression of these genes. In the present investigation, we explored whether ILK activation depended on PI3K to regulate the phosphorylation and transcriptional activity of MEF2C during C2C12 cell proliferation. We inhibited PI3K activity in C2C12 with LY294002 and then found that ILK phosphorylation levels and MEF2C phosphorylation were decreased and that MCK mRNA expression was suppressed significantly. After inhibiting ILK phosphorylation activity with Cpd22 and ILK-shRNA, we found MEF2C phosphorylation activity and MCK mRNA expression were increased extremely significantly. In the presence of Cpd22, PI3K activity inhibition increased MEF2C phosphorylation and MCK mRNA expression indistinctively. We conclude that ILK negatively and independently of PI3K regulated MEF2C phosphorylation activity and MCK mRNA expression in C2C12 cells. The results provide new ideas for the study of classical signaling pathway of PI3K-ILK-related proteins and transcription factors.

P-wave excited {B}_{c}^{* * } meson photoproduction at the LHeC

Science.gov (United States)

Kai, He; Huan-Yu, Bi; Ren-You, Zhang; Xiao-Zhou, Li; Wen-Gan, Ma

2018-05-01

As an important sequential work of the S-wave {B}c(* ) ({}1{S}0({}3{S}1) ) meson production at the large hadron electron collider (LHeC), we investigate the production of the P-wave excited {B}c* * states (1 P 1 and 3 P J with J = 0, 1, 2) via photoproduction mechanism within the framework of nonrelativistic QCD at the LHeC. Generally, the {e}-+P\\to γ +g\\to {B}c* * +b+\\bar{c} process is considered as the main production mechanism at an electron–proton collider due to the large luminosity of the gluon. However, according to our experience on the S-wave {B}c(* ) meson production at the LHeC, the extrinsic production mechanism, i.e., {e}-+P\\to γ +c\\to {B}c* * +b and {e}-+P\\to γ +\\bar{b} \\to {B}c* * +\\bar{c}, could also provide dominating contributions at low p T region. A careful treatment between these channels is performed and the results on total and differential cross sections, together with main uncertainties are discussed. Taking the quark masses m b = 4.90 ± 0.40 GeV and m c = 1.50 ± 0.20 GeV into account and summing up all the production channels, we expect to accumulate ({2.48}-1.75+3.55)× {10}4 {B}c* * ({}1{P}1), ({1.14}-0.82+1.49)× {10}4 {B}c* * ({}3{P}0),({2.38}-1.74+3.39)× {10}4 {B}c* * ({}3{P}1) and ({5.59}-3.93+7.84)× {10}4 {B}c* * ({}3{P}2) events at the \\sqrt{S}=1.30 {{T}}{{e}}{{V}} LHeC in one operation year with luminosity { \\mathcal L }={10}33 cm‑2 s‑1. With such sizable events, it is worth studying the properties of excited P-wave {B}c* * states at the LHeC.

Synthesis of (5,6-/sup 13/C/sub 2/, 1-/sup 14/C)olivetolic acid, methyl (1'-/sup 13/C)olivetolate and (5,6-/sup 13/C/sub 2/, 1-/sup 14/C)cannabigerolic acid

Energy Technology Data Exchange (ETDEWEB)

Porwoll, J.P.; Leete, E. (Minnesota Univ., Minneapolis (USA). Dept. of Chemistry)

1985-03-01

Potential advanced intermediates in the biosynthesis of delta/sup 9/-tetrahydrocannabinol, the major psychoactive principle of marijuana, have been synthesized labeled with two contiguous /sup 13/C atoms and /sup 14/C. Methyl (5,6-/sup 13/C/sub 2/, 1-/sup 14/C)olivetolate was prepared from lithium (/sup 13/C/sub 2/)acetylide and dimethyl (2-/sup 14/C)malonate. Reaction with geranyl bromide afforded methyl (5,6-/sup 13/C/sub 2/, 1-/sup 14/C)cannabigerolate, and hydrolysis of these methyl esters with lithium propyl mercaptide yielded the corresponding labeled acids. The /sup 13/C-/sup 13/C couplings observable in the /sup 13/C NMR spectra of these /sup 13/C-enriched compounds and their synthetic precursors are recorded. Methyl (1'-/sup 14/C)olivetolate was prepared from /sup 13/CO/sub 2/ to confirm assignments of the /sup 13/C chemical shifts in the pentyl side chain of these compounds.

Dicty_cDB: VSJ516 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available mlhqv ntlvtllspiktmlkspvlmliltckrik*nkik*khtix*iiy Frame C: neiiisplfrscfsfpifhps...kqc*nrly*c*y*lvne*nkik*nkntpsinyl*ikkk--- ---neiiisplfrscfsfpifhpslvklwyccr*ipnyqcsirptnts*rtryhnqciry sr*nr

Assessment of Durable SiC JFET Technology for +600 C to -125 C Integrated Circuit Operation

Science.gov (United States)

Neudeck, P. G.; Krasowski, M. J.; Prokop, N. F.

2011-01-01

Electrical characteristics and circuit design considerations for prototype 6H-SiC JFET integrated circuits (ICs) operating over the broad temperature range of -125 C to +600 C are described. Strategic implementation of circuits with transistors and resistors in the same 6H-SiC n-channel layer enabled ICs with nearly temperature-independent functionality to be achieved. The frequency performance of the circuits declined at temperatures increasingly below or above room temperature, roughly corresponding to the change in 6H-SiC n-channel resistance arising from incomplete carrier ionization at low temperature and decreased electron mobility at high temperature. In addition to very broad temperature functionality, these simple digital and analog demonstration integrated circuits successfully operated with little change in functional characteristics over the course of thousands of hours at 500 C before experiencing interconnect-related failures. With appropriate further development, these initial results establish a new technology foundation for realizing durable 500 C ICs for combustion engine sensing and control, deep-well drilling, and other harsh-environment applications.

Dicty_cDB: Contig-U04229-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 9 ) HAE00002983 Home-made, regular (lib1_ha) Histiona... 44 0.001 2 ( CK888692 ) SGP160684 Atlantic salmon Liver cDNA library...2 ( DE224908 ) Trifolium pratense DNA, clone:RCG16896. 42 4e-04 2 ( CK888010 ) SGP149211 Atlantic salmon Liver cDNA library...A for TCP1 protein. 46 6e-04 2 ( CK887535 ) SGP164401 Atlantic salmon Kidney cDNA library Sal... 44 6e-04 2 ...mo salar cDNA, mRNA sequence. 44 0.001 2 ( CK889382 ) SGP161400 Atlantic salmon Liver cDNA library Salm... 4... salmon Liver cDNA library Salm... 44 0.001 2 ( CK888710 ) SGP160704 Atlantic salmon Liver cDNA library

Dicty_cDB: Contig-U01201-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available DT573931 ) EST1084571 GH_TMO Gossypium hirsutum cDNA, mRNA s... 46 2.3 1 ( DR026249 ) Osmo00116 F. cylindrus osmotic stress library...67 ) Glycine max cDNA clone: GMFL01-28-N10, 3'end. 44 9.0 1 ( BU869818 ) Q004H08 Populus flower cDNA library Populus tric...Lib... 46 2.3 1 ( DU120744 ) KBrH113B12F Brassica rapa BAC library KBrH Brassi......... 46 2.3 1 ( CB285041 ) DF1898 Dermatophagoides farinae cDNA library Derm... 46 2.3 1 ( C25513 ) Dic...rary Ictalurus... 44 9.0 1 ( CF230535 ) PtaC0009E5E0509 Poplar cDNA library from ca

Dicty_cDB: Contig-U16395-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available virus 241ext gene for puta... 41 0.060 C72174( C72174 ) D8R protein - variola minor virus (strain Garcia...rio proteasome (prosome, m... 40 0.10 C72175( C72175 ) G1R protein - variola minor virus (strain Garcia-...

Properties of container and backfill materials for the final disposal of highly radioactive fission products

International Nuclear Information System (INIS)

Mirschinka, V.

1983-11-01

The qualifications of six metallic alloys to serve as canister materials for an in-can glass smelting process were studied. These alloys are: N 6 1.4864 (X 12NiCrSi3616, Thermax 16/36), No. 2.4816 (NiCr15Fe, Inconel 600), No. 2.4610 (Hastelloy C4), No. 2.4778 (UMCO50), No. 1.5415 (15MO3), No. 1.1005 (ZSH-Spezial). The mechanical properties of any of the six materials at high temperatures were found to be sufficient. The chemical interactions between glass and metal were investigated by glass smelting tests and electron microprobe analyses, showing that chromium as an alloying element of the crucible material may affect the quality of the glass product by causing inhomogeneities and a violent blistering in the glass matrix. The resistance against corrosion by concentrated salt solutions under elevated pressure and temperature similar to final depository conditions was tested showing that the presence of a bentonite suspension in the salt solution reduces the corrosion attack of the metal significantly. Diffusion experiments of salt solutions doted with radioactive isotopes Na-22 and Cl-36 as tracer substances were made to show the retardation behaviour of salt ions in compacted bentonite. However, a long-term barrier effect of the bentonite against salt ion diffusion could not be verified. (orig./HOE)

Investigation of metallic, ceramic, and polymeric materials for engineered barrier applications in nuclear-waste packages

International Nuclear Information System (INIS)

Westerman, R.E.

1980-10-01

An effort to develop licensable engineered barrier systems for the long-term (about 1000 yr) containment of nuclear wastes under conditions of deep continental geologic disposal has been underway at Pacific Northwest Laboratory since January 1979, under the auspices of the High-Level Waste Immobilization Program. In the present work, the barrier system comprises the hard or structural elements of the package: the canister, the overpack(s), and the hole sleeve. A number of candidate metallic, ceramic, and polymeric materials were put through mechanical, corrosion, and leaching screening tests to determine their potential usefulness in barrier-system applications. Materials demonstrating adequate properties in the screening tests will be subjected to more detailed property tests, and, eventually, cost/benefit analyses, to determine their ultimate applicability to barrier-system design concepts. The following materials were investigated: two titanium alloys of Grade 2 and Grade 12; 300 and 400 series stainless steels, Inconels, Hastelloy C-276, titanium, Zircoloy, copper-nickel alloys and cast irons; total of 14 ceramic materials, including two grades of alumina, plus graphite and basalt; and polymers such as polyamide-imide, polyarylene, polyimide, polyolefin, polyphenylene sulfide, polysulfone, fluoropolymer, epoxy, furan, silicone, and ethylene-propylene terpolymer (EPDM) rubber. The most promising candidates for further study and potential use in engineered barrier systems were found to be rubber, filled polyphenylene sulfide, fluoropolymer, and furan derivatives

Dicty_cDB: AFG169 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available --LMKNLN*twllihhhc*krnrqryqrkislrrprl*s*nanccliisprkiiritrr sshhhr**tfplprsplptitlrygiswyprnhl*lhhem*c*yp*rf...rnrqryqrkislrrprl*s*nanccliisprkiiritrr sshhhr**tfplprsplptitlrygiswyprnhl*lhhem*c*yp*rfirqcrliwwyny vpryc*s

Dicty_cDB: VFL581 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available mgc*ccglvnhwflpig*c riy*lanyhlg*nyhynssclvrtiiydlss*kwwlslrclvrfnvmcntssifikiipk dfsft**fnflfky*ygprmve*yewl...gc*ccglvnhwflpig*c riy*lanyhlg*nyhynssclvrtiiydlss*kwwlslrclvrfnvmcntssifikiipk dfsft**fnflfky*ygprmve*yewla

Major alterations in transcript profiles between C3-C4 and C4 photosynthesis of an amphibious species Eleocharis baldwinii.

Science.gov (United States)

Chen, Taiyu; Zhu, Xin-Guang; Lin, Yongjun

2014-09-01

Engineering C4 photosynthetic metabolism into C3 crops is regarded as a major strategy to increase crop productivity, and clarification of the evolutionary processes of C4 photosynthesis can help the better use of this strategy. Here, Eleocharis baldwinii, a species in which C4 photosynthesis can be induced from a C3-C4 state under either environmental or ABA treatments, was used to identify the major transcriptional modifications during the process from C3-C4 to C4. The transcriptomic comparison suggested that in addition to the major differences in C4 core pathway, the pathways of glycolysis, citrate acid metabolism and protein synthesis were dramatically modified during the inducement of C4 photosynthetic states. Transcripts of many transporters, including not only metabolite transporters but also ion transporters, were dramatically increased in C4 photosynthetic state. Many candidate regulatory genes with unidentified functions were differentially expressed in C3-C4 and C4 photosynthetic states. Finally, it was indicated that ABA, auxin signaling and DNA methylation play critical roles in the regulation of C4 photosynthesis. In summary, by studying the different photosynthetic states of the same species, this work provides the major transcriptional differences between C3-C4 and C4 photosynthesis, and many of the transcriptional differences are potentially related to C4 development and therefore are the potential targets for reverse genetics studies.

Forging C-C Bonds Through Decarbonylation of Aryl Ketones.

Science.gov (United States)

Somerville, Rosie J; Martin, Ruben

2017-06-06

The ability of nickel to cleave strong σ-bonds is again in the spotlight after a recent report that demonstrates the feasibility of using nickel complexes to promote decarbonylation of diaryl ketones. This transformation involves the cleavage of two strong C-C(O) bonds and avoids the use of noble metals, hence reinforcing the potential of decarbonylation as a technique for forging C-C bonds. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

Synthesis and Isolation of the Titanium-Scandium Endohedral Fullerenes-Sc2 TiC@Ih -C80 , Sc2 TiC@D5h -C80 and Sc2 TiC2 @Ih -C80 : Metal Size Tuning of the Ti(IV) /Ti(III) Redox Potentials.

Science.gov (United States)

Junghans, Katrin; Ghiassi, Kamran B; Samoylova, Nataliya A; Deng, Qingming; Rosenkranz, Marco; Olmstead, Marilyn M; Balch, Alan L; Popov, Alexey A

2016-09-05

The formation of endohedral metallofullerenes (EMFs) in an electric arc is reported for the mixed-metal Sc-Ti system utilizing methane as a reactive gas. Comparison of these results with those from the Sc/CH4 and Ti/CH4 systems as well as syntheses without methane revealed a strong mutual influence of all key components on the product distribution. Whereas a methane atmosphere alone suppresses the formation of empty cage fullerenes, the Ti/CH4 system forms mainly empty cage fullerenes. In contrast, the main fullerene products in the Sc/CH4 system are Sc4 C2 @C80 (the most abundant EMF from this synthesis), Sc3 C2 @C80 , isomers of Sc2 C2 @C82 , and the family Sc2 C2 n (2 n=74, 76, 82, 86, 90, etc.), as well as Sc3 CH@C80 . The Sc-Ti/CH4 system produces the mixed-metal Sc2 TiC@C2 n (2 n=68, 78, 80) and Sc2 TiC2 @C2 n (2 n=80) clusterfullerene families. The molecular structures of the new, transition-metal-containing endohedral fullerenes, Sc2 TiC@Ih -C80 , Sc2 TiC@D5h -C80 , and Sc2 TiC2 @Ih -C80 , were characterized by NMR spectroscopy. The structure of Sc2 TiC@Ih -C80 was also determined by single-crystal X-ray diffraction, which demonstrated the presence of a short Ti=C double bond. Both Sc2 TiC- and Sc2 TiC2 -containing clusterfullerenes have Ti-localized LUMOs. Encapsulation of the redox-active Ti ion inside the fullerene cage enables analysis of the cluster-cage strain in the endohedral fullerenes through electrochemical measurements. © 2016 The Authors. Published by Wiley-VCH Verlag GmbH & Co. KGaA.

Dicty_cDB: AFH685 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 99 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequence....dration Library Tortula ruralis cDNA, mRNA sequence. 70 4e-08 1 CK030146 |CK030146.....1 TTE00006978 Normalized large Tetrahymena thermophila cDNA, mRNA sequence. 74 3e-09 1 CN206834 |CN206834.1 Tor7258 Gametophyte rehy

Dicty_cDB: AFK467 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequenc....1 Tor7258 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequence. 70 5e-08 1 CK030146 |CK03014...55.1 TTE00006978 Normalized large Tetrahymena thermophila cDNA, mRNA sequence. 74 3e-09 1 CN206834 |CN206834

Dicty_cDB: VFH554 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available RXKXXXXXXXQRXXXXEXXXXXX--- Frame B: eledsklxgxvytkkxn*rxlxxihwxrsxxxrxrkxxx*rgxyxxxiqrxhxxxxkrsn trrxxxrxxxernxxxkgxrxxxaxxxkexxxxx...gxxga--- Frame C: s*ktrnxxgxfiqkkxirgxxhxytgqeaxxagxexaxtkexhxxtxyrxhtxxxxrgat peexxaexxxketgxxkgkggxxxxxtkxxx...ggxxxxxx--- Homology vs CSM-cDNA Score E Sequences produ

Interstellar clouds toward 3C 154 and 3C 353

International Nuclear Information System (INIS)

Federman, S.R.; Evans, N.J. II; Willson, R.F.; Falgarone, E.; Combes, F.; Texas Univ., Austin; Tufts Univ., Medford, MA; Meudon, Observatoire, France)

1987-01-01

Molecular observations of the interstellar clouds toward the radio sources 3C 154 and 3C 353 were obtained in order to elucidate the physical conditions within the clouds. Maps of (C-12)O emission in the J = 1-0 and J = 2-1 lines were compared with observations of the (C-13)O, CH, and OH molecules. The peak emission in the (C-12)O transitions does not occur in the direction of the continuum sources, and thus, an incomplete picture arises when only one line of sight in the two clouds is analyzed. The cloud toward 3C 154 appears to have a low extinction, but a relatively high CO abundance, suggesting that it is similar to high-latitude clouds and CO-rich diffuse clouds. The cloud toward 3C 353 is considerably denser than that toward 3C 154 and may be more like a dark cloud. 32 references

Development of SiC/SiC composite for fusion application

International Nuclear Information System (INIS)

Kohyama, A.; Katoh, Y.; Snead, L.L.; Jones, R.H.

2001-01-01

The recent efforts to develop SiC/SiC composite materials for fusion application under the collaboration with Japan and the USA are provided, where material performance with and without radiation damage has been greatly improved. One of the accomplishments is development of the high performance reaction sintering process. Mechanical and thermal conductivity are improved extensively by process modification and optimization with inexpensive fabrication process. The major efforts to make SiC matrix by CVI, PIP and RS methods are introduced together with the representing baseline properties. The resent results on mechanical properties of SiC/SiC under neutron irradiation are quite positive. The composites with new SiC fibers, Hi-Nicalon Type-S, did not exhibit mechanical property degradation up to 10 dpa. Based on the materials data recently obtained, a very preliminary design window is provided and the future prospects of SiC/SiC technology integration is provided. (author)

Effects of Preform Density on Structure and Property of C/C-SiC Composites Fabricated by Gaseous Silicon Infiltration

Directory of Open Access Journals (Sweden)

CAO Yu

2016-07-01

Full Text Available The 3-D needled C/C preforms with different densities deposited by chemical vapor infiltration (CVI method were used to fabricate C/C-SiC composites by gaseous silicon infiltration (GSI. The porosity and CVI C thickness of the preforms were studied, and the effects of preform density on the mechanical and thermal properties of C/C-SiC composites were analyzed. The results show that with the increase of preform density, the preform porosity decreases and the CVI C thickness increases from several hundred nanometers to several microns. For the C/C-SiC composites, as the preform density increases, the residual C content increases while the density and residual Si content decreases. The SiC content first keeps at a high level of about 40% (volume fraction, which then quickly reduces. Meanwhile, the mechanical properties increase to the highest values when the preform density is 1.085g/cm3, with the flexure strength up to 308.31MP and fracture toughness up to 11.36MPa·m1/2, which then decrease as the preform density further increases. The thermal conductivity and CTE of the composites, however, decrease with the increase of preform density. It is found that when the preform porosity is too high, sufficient infiltration channels lead to more residual Si, and thinner CVI C thickness results in the severe corrosion of the reinforcing fibers by Si and lower mechanical properties. When the preform porosity is relatively low, the contents of Si and SiC quickly reduce since the infiltration channels are rapidly blocked, resulting in the formation of large closed pores and not high mechanical properties.

Paramagnetic centers in nanocrystalline TiC/C system

International Nuclear Information System (INIS)

Guskos, N.; Bodziony, T.; Maryniak, M.; Typek, J.; Biedunkiewicz, A.

2008-01-01

Electron paramagnetic resonance is applied to study the defect centers in nanocrystalline titanium carbide dispersed in carbon matrix (TiC x /C) synthesized by the non-hydrolytic sol-gel process. The presence of Ti 3+ paramagnetic centers is identified below 120 K along with a minor contribution from localized defect spins coupled with the conduction electron system in the carbon matrix. The temperature dependence of the resonance intensity of the latter signal indicates weak antiferromagnetic interactions. The presence of paramagnetic centers connected with trivalent titanium is suggested to be the result of chemical disorder, which can be further related to the observed anomalous behavior of conductivity, hardness, and corrosion resistance of nanocrystalline TiC x /C

Dicty_cDB: VSK476 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VS (Link to library) VSK476 (Link to dictyBase) - - - Contig-U07114-1 VSK476Z (Link... to Original site) - - VSK476Z 291 - - - - Show VSK476 Library VS (Link to library) Clone ID VSK476 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U07114-1 Original site URL http://dict...239C9 in linkage group 3. 46 0.24 1 BM495069 |BM495069.1 IpCGBr1_4_C04_22 Ictalur...us punctatus Brain1 primary library Ictalurus punctatus cDNA clone IpCGBr1_4_C04_22_07Mar00_034 3', mRNA seq

Grinding, Machining Morphological Studies on C/SiC Composites

Science.gov (United States)

Xiao, Chun-fang; Han, Bing

2018-05-01

C/SiC composite is a typical material difficult to machine. It is hard and brittle. In machining, the cutting force is large, the material removal rate is low, the edge is prone to collapse, and the tool wear is serious. In this paper, the grinding of C/Si composites material along the direction of fiber distribution is studied respectively. The surface microstructure and mechanical properties of C/SiC composites processed by ultrasonic machining were evaluated. The change of surface quality with the change of processing parameters has also been studied. By comparing the performances of conventional grinding and ultrasonic grinding, the surface roughness and functional characteristics of the material can be improved by optimizing the processing parameters.

C Dutta

Indian Academy of Sciences (India)

Home; Journals; Bulletin of Materials Science. C Dutta. Articles written in Bulletin of Materials Science. Volume 23 Issue 1 February 2000 pp 47-49 Composites. Role of work hardening characteristics of matrix alloys in the strengthening of metal matrix composites · K T Kashyap C Ramachandra C Dutta B Chatterji.