WorldWideScience

Sample records for hastelloy c

  1. Cavitation erosion behavior of Hastelloy C-276 nickel-based alloy

    Energy Technology Data Exchange (ETDEWEB)

    Li, Zhen [State Key Laboratory of Solid Lubrication, Lanzhou Institute of Chemical Physics, Chinese Academy of Sciences, Lanzhou 730000 (China); University of Chinese Academy of Sciences, Beijing 100039 (China); Han, Jiesheng; Lu, Jinjun [State Key Laboratory of Solid Lubrication, Lanzhou Institute of Chemical Physics, Chinese Academy of Sciences, Lanzhou 730000 (China); Chen, Jianmin, E-mail: chenjm@lzb.ac.cn [State Key Laboratory of Solid Lubrication, Lanzhou Institute of Chemical Physics, Chinese Academy of Sciences, Lanzhou 730000 (China)

    2015-01-15

    Highlights: • Cavitation erosion behavior of Hastelloy C-276 was studied by ultrasonic apparatus. • The cavitation-induced precipitates formed in the eroded surface for Hastelloy C-276. • The selective cavitation erosion was found in Hastelloy C-276 alloy. - Abstract: The cavitation erosion behavior of Hastelloy C-276 alloy was investigated using an ultrasonic vibratory apparatus and compared with that of 316L stainless steel. The mean depth of erosion (MDE) and erosion rate (ER) curves vs. test time were attained for Hastelloy C-276 alloy. Morphology and microstructure evolution of the eroded surface were observed by scanning electron microscopy (SEM) and field emission scanning electron microscopy (FESEM) and the predominant erosion mechanism was also discussed. The results show that the MDE is about 1/6 times lower than that of the stainless steel after 9 h of testing. The incubation period of Hastelloy C-276 alloy is about 3 times longer than that of 316L stainless steel. The cavitation-induced nanometer-scaled precipitates were found in the local zones of the eroded surface for Hastelloy C-276. The selective cavitation erosion was found in Hastelloy C-276 alloy. The formation of nanometer-scaled precipitates in the eroded surface may play a significant role in the cavitation erosion resistance of Hastelloy C-276.

  2. Cavitation erosion behavior of Hastelloy C-276 nickel-based alloy

    International Nuclear Information System (INIS)

    Li, Zhen; Han, Jiesheng; Lu, Jinjun; Chen, Jianmin

    2015-01-01

    Highlights: • Cavitation erosion behavior of Hastelloy C-276 was studied by ultrasonic apparatus. • The cavitation-induced precipitates formed in the eroded surface for Hastelloy C-276. • The selective cavitation erosion was found in Hastelloy C-276 alloy. - Abstract: The cavitation erosion behavior of Hastelloy C-276 alloy was investigated using an ultrasonic vibratory apparatus and compared with that of 316L stainless steel. The mean depth of erosion (MDE) and erosion rate (ER) curves vs. test time were attained for Hastelloy C-276 alloy. Morphology and microstructure evolution of the eroded surface were observed by scanning electron microscopy (SEM) and field emission scanning electron microscopy (FESEM) and the predominant erosion mechanism was also discussed. The results show that the MDE is about 1/6 times lower than that of the stainless steel after 9 h of testing. The incubation period of Hastelloy C-276 alloy is about 3 times longer than that of 316L stainless steel. The cavitation-induced nanometer-scaled precipitates were found in the local zones of the eroded surface for Hastelloy C-276. The selective cavitation erosion was found in Hastelloy C-276 alloy. The formation of nanometer-scaled precipitates in the eroded surface may play a significant role in the cavitation erosion resistance of Hastelloy C-276

  3. FINITE ELEMENT ANALYSIS OF HASTELLOY C-22HS IN END MILLING

    Directory of Open Access Journals (Sweden)

    K. Kadirgama

    2011-12-01

    Full Text Available This paper presents a finite element analysis of the stress distribution in the end milling operation of nickel-based superalloy HASTELLOY C-2000. Commercially available finite element software was used to develop the model and analyze the distribution of stress components in the machined surface of HASTELLOY C-22HS following end milling with coated carbide tools. The friction interaction along the tool-chip interface was modeled using the Coulomb friction law. It was found that the stress had lower values under the cut surface and that it increased gradually near the cutting edge.

  4. Composition of eta carbide in Hastelloy N after aging 10,000 hr at 8150C

    International Nuclear Information System (INIS)

    Leitnaker, J.M.; Potter, G.A.; Bradley, D.J.; Franklin, J.C.; Laing, W.R.

    1977-11-01

    The composition of the eta carbide in Hastelloy N containing 0.7 wt percent Si in the alloy approaches M 12 C, rather than M 6 C as indicated in the alloy literature. The silicon content of the eta phase in this case was about 25 at. percent, much higher than has been observed in less highly alloyed material. The data do not permit a definition of the limiting compositions of the phases

  5. Oxidation in air of two refractory alloys (Nicral D and Hastelloy X) at 900 and 1100 deg. C

    International Nuclear Information System (INIS)

    Sannier, J.; Dominget, R.; Darras, R.

    1960-01-01

    The oxidation in air of two refractory alloys (Nicral D and Hastelloy X) has been studied at 900 and 1100 deg. C, by means of recording thermo-balances and microscopic cross section examination. At 900 deg. C, the surface oxidation rates of the two alloys are quite similar, but at 1100 deg. C the alloy Nicral D oxidizes faster than the alloy Hastelloy X. On the other hand, after heating at 1100 deg. C for 150 hours, Nicral D shows both intergranular oxidation and a small amount of internal oxidation, whereas Hastelloy X is especially subject to internal oxidation. In addition, two descaling methods were compared: an electrolytic method, in a sodium hydroxide-sodium carbonate bath, and a chemical method using a sodium nitrate-sodium peroxide bath; the latter appears suitable only for Hastelloy X. Reprint of a paper published in Journal of nuclear materials, 3, p. 213-225, 1959 [fr

  6. Microstructures, mechanical properties and corrosion resistance of Hastelloy C22 coating produced by laser cladding

    International Nuclear Information System (INIS)

    Wang, Qin-Ying; Zhang, Yang-Fei; Bai, Shu-Lin; Liu, Zong-De

    2013-01-01

    Highlights: ► Hastelloy C22 coatings were prepared by diode laser cladding technique. ► Higher laser speed resulted in smaller grain size. ► Size-effect played the key role in the hardness measurements by different ways. ► Coating with higher laser scanning speed displayed higher nano-scratch resistance. ► Small grain size was beneficial for improvement of coating corrosion resistance. -- Abstract: The Hastelloy C22 coatings H1 and H2 were prepared by laser cladding technique with laser scanning speeds of 6 and 12 mm/s, respectively. Their microstructures, mechanical properties and corrosion resistance were investigated. The microstructures and phase compositions were studied by metallurgical microscope, scanning electron microscope and X-ray diffraction analysis. The hardness and scratch resistance were measured by micro-hardness and nanoindentation tests. The polarization curves and electrochemical impedance spectroscopy were tested by electrochemical workstation. Planar, cellular and dendritic solidifications were observed in the coating cross-sections. The coatings metallurgically well-bonded with the substrate are mainly composed of primary phase γ-nickel with solution of Fe, W, Cr and grain boundary precipitate of Mo 6 Ni 6 C. The hardness and corrosion resistance of steel substrate are significantly improved by laser cladding Hastelloy C22 coating. Coating H2 shows higher micro-hardness than that of H1 by 34% and it also exhibits better corrosion resistance. The results indicate that the increase of laser scanning speed improves the microstuctures, mechanical properties and corrosion resistance of Hastelloy C22 coating

  7. Corrosion tests of 316L and Hastelloy C-22 in simulated tank waste solutions

    International Nuclear Information System (INIS)

    Danielson, M.J.; Pitman, S.G.

    2000-01-01

    Both the 316L stainless steel and Hastelloy C-22 gave satisfactory corrosion performance in the simulated test environments. They were subjected to 100 day weight loss corrosion tests and electrochemical potentiodynamic evaluation. This activity supports confirmation of the design basis for the materials of construction of process vessels and equipment used to handle the feed to the LAW-melter evaporator. BNFL process and mechanical engineering will use the information derived from this task to select material of construction for process vessels and equipment

  8. Creep curve formularization at 950degC for Hastelloy XR

    International Nuclear Information System (INIS)

    Kaji, Yoshiyuki; Muto, Yasushi

    1991-03-01

    Creep tests under constant stress were conducted on a nickel-base heat-resistant alloy, Hastelloy XR, in air at 950degC. Minimum creep strain rate, time to the onset of tertiary creep and time to rupture were obtained as a function of applied stress. Then, a creep constitutive equation was made based on the Garofalo formula for primary and secondary creep and based on the Kachanov-Rabotnov formula for tertiary creep, which could represent fairly well the experimental creep deformation curves under the constant stress conditions. The creep deformation under the constant load condition corresponding to the stress increment was analysed using the creep constitutive equation and strain hardening law. Then the calculated creep strain showed slightly higher value than the experimental creep strain, and the calculated life was shorter than the experimental one. (author)

  9. A possibility of enhancing Jc in MgB2 film grown on metallic hastelloy tape with the use of SiC buffer layer

    International Nuclear Information System (INIS)

    Putri, W. B. K.; Kang, B.; Ranot, M.; Lee, J. H.; Kang, W. N.

    2014-01-01

    We have grown MgB 2 on SiC buffer layer by using metallic Hastelloy tape as the substrate. Hastelloy tape was chosen for its potential practical applications, mainly in the power cable industry. SiC buffer layers were deposited on Hastelloy tapes at 400, 500, and 600 degrees C by using a pulsed laser deposition method, and then by using a hybrid physical-chemical vapor deposition technique, MgB 2 films were grown on the three different SiC buffer layers. An enhancement of critical current density values were noticed in the MgB 2 films on SiC/Hastelloy deposited at 500 and 600 degrees C. From the surface analysis, smaller and denser grains of MgB 2 tapes are likely to cause this enhancement. This result infers that the addition of SiC buffer layers may contribute to the improvement of superconducting properties of MgB 2 tapes.

  10. The anti-corrosion behavior under multi-factor impingement of Hastelloy C22 coating prepared by multilayer laser cladding

    Science.gov (United States)

    Chen, Lin; Bai, Shu-Lin

    2018-04-01

    Hastelloy C22 coating was prepared on substrate of Q235 steel by high power multilayer laser cladding. The microstructure, hardness and anti-corrosion properties of coating were investigated. The corrosion tests in 3.5% NaCl solution were carried out with variation of impingement angle and velocity, and vibration frequency of sample. The microstructure of coating changes from equiaxed grain at the top surface to dendrites oriented at an angle of 60° to the substrate inside the coating. The corrosion rate of coating increases with the increase of impingement angle and velocity, and vibrant frequency of sample. Corrosion mechanisms relate to repassivation and depassivation of coating according to electrochemical measurements. Above results show that multilayer laser cladding can endow Hastelloy C22 coating with fine microstructures, high hardness and good anti-corrosion performances.

  11. Laser texturing of Hastelloy C276 alloy surface for improved hydrophobicity and friction coefficient

    Science.gov (United States)

    Yilbas, B. S.; Ali, H.

    2016-03-01

    Laser treatment of Hastelloy C276 alloy is carried out under the high pressure nitrogen assisting gas environment. Morphological and metallurgical changes in the laser treated layer are examined using the analytical tools including, scanning electron and atomic force microscopes, X-ray diffraction, energy dispersive spectroscopy, and Fourier transform infrared spectroscopy. Microhardness is measured and the residual stress formed in the laser treated surface is determined from the X-ray data. The hydrophibicity of the laser treated surface is assessed using the sessile drop method. Friction coefficient of the laser treated layer is obtained incorporating the micro-tribometer. It is found that closely spaced laser canning tracks create a self-annealing effect in the laser treated layer and lowers the thermal stress levels through modifying the cooling rates at the surface. A dense structure, consisting of fine size grains, enhances the microhardness of the surface. The residual stress formed at the surface is compressive and it is in the order of -800 MPa. Laser treatment improves the surface hydrophobicity significantly because of the formation of surface texture composing of micro/nano-pillars.

  12. Response Surface Design Model to Predict Surface Roughness when Machining Hastelloy C-2000 using Uncoated Carbide Insert

    International Nuclear Information System (INIS)

    Razak, N H; Rahman, M M; Kadirgama, K

    2012-01-01

    This paper presents to develop of the response surface design model to predict the surface roughness for end-milling operation of Hastelloy C-2000 using uncoated carbide insert. Mathematical model is developed to study the effect of three input cutting parameters includes the feed rate, axial depth of cut and cutting speed. Design of experiments (DOE) was implemented with the aid of the statistical software package. Analysis of variance (ANOVA) has been performed to verify the fit and adequacy of the developed mathematical model. The result shows that the feed rate gave the more effect on the both prediction values of Ra compared to the cutting speed and axial depth of cut. SEM and EDX analyses were performed in different cutting conditions. It can be concluded that the feed rate and cutting force give the higher impact to influence the machining characteristics of surface roughness. Thus, the optimizing the cutting conditions are essential in order to improve the surface roughness in machining of Hastlelloy C-2000.

  13. Relaxation characteristics of hastelloy X

    International Nuclear Information System (INIS)

    Suzuki, Kazuhiko

    1980-02-01

    Relaxation diagrams of Hastelloy X (relaxation curves, relaxation design diagrams, etc.) were generated from the creep constitutive equation of Hastelloy X, using inelastic stress analysis code TEPICC-J. These data are in good agreement with experimental relaxation data of ORNL-5479. Three typical inelastic stress analyses were performed for various relaxation behaviors of the high-temperature structures. An attempt was also made to predict these relaxation behaviors by the relaxation curves. (author)

  14. Application of the Taguchi technique for the optimization of surface roughness and tool life during the milling of Hastelloy C22

    International Nuclear Information System (INIS)

    Kivak, Turgay; Mert, Senol

    2017-01-01

    In this study, the effects of machining parameters on surface roughness (Ra) and tool life (Tl) were investigated in the milling of Hastelloy C22 alloy with TiAlN-coated carbide inserts. A number of milling experiments were conducted using the L_2_7 (3"3) Taguchi orthogonal array on a CNC milling machine under different cutting conditions (dry, compressed air and wet). The cutting condition, cutting speed and feed rate were determined as the essential machining parameters. Analysis of variance (ANOVA) and signal-to-noise (S/N) ratio were employed to evaluate the effects of the machining parameters on Ra and Tl, and prediction models were created using quadratic regression analyses. The results revealed that the feed rate and cutting condition were the most influential factors on surface roughness and flank wear. The maximum tool life was achieved under wet cutting condition using a cutting speed of 30 x min"-"1 and a feed rate of 0.08 mm x rev"-"1, while the minimum surface roughness value was obtained under wet cutting condition using a cutting speed of 50 m x min"-"1 and the same feed rate. Using the optimum cutting parameters for Tl (30 m x min"-"1, 0.08 mm x rev"-"1), increases of 234 % and 67 % in tool life were observed under wet and compressed air cutting conditions, respectively, compared to the dry cutting condition.

  15. Application of the Taguchi technique for the optimization of surface roughness and tool life during the milling of Hastelloy C22

    Energy Technology Data Exchange (ETDEWEB)

    Kivak, Turgay; Mert, Senol [Duezce Univ. (Turkey). Dept. of Manufacturing Engineering

    2017-02-01

    In this study, the effects of machining parameters on surface roughness (Ra) and tool life (Tl) were investigated in the milling of Hastelloy C22 alloy with TiAlN-coated carbide inserts. A number of milling experiments were conducted using the L{sub 27} (3{sup 3}) Taguchi orthogonal array on a CNC milling machine under different cutting conditions (dry, compressed air and wet). The cutting condition, cutting speed and feed rate were determined as the essential machining parameters. Analysis of variance (ANOVA) and signal-to-noise (S/N) ratio were employed to evaluate the effects of the machining parameters on Ra and Tl, and prediction models were created using quadratic regression analyses. The results revealed that the feed rate and cutting condition were the most influential factors on surface roughness and flank wear. The maximum tool life was achieved under wet cutting condition using a cutting speed of 30 x min{sup -1} and a feed rate of 0.08 mm x rev{sup -1}, while the minimum surface roughness value was obtained under wet cutting condition using a cutting speed of 50 m x min{sup -1} and the same feed rate. Using the optimum cutting parameters for Tl (30 m x min{sup -1}, 0.08 mm x rev{sup -1}), increases of 234 % and 67 % in tool life were observed under wet and compressed air cutting conditions, respectively, compared to the dry cutting condition.

  16. One new route to optimize the oxidation resistance of TiC/hastelloy (Ni-based alloy) composites applied for intermediate temperature solid oxide fuel cell interconnect by increasing graphite particle size

    Science.gov (United States)

    Qi, Qian; Liu, Yan; Wang, Lujie; Zhang, Hui; Huang, Jian; Huang, Zhengren

    2017-09-01

    TiC/hastelloy composites with suitable thermal expansion and excellent electrical conductivity are promising candidates for IT-SOFC interconnect. In this paper, the TiC/hastelloy composites are fabricated by in-situ reactive infiltration, and the oxidation resistance of composites is optimized by increasing graphite particle size. Results show that the increase of graphite particles size from 1 μm to 40 μm reduces TiC particle size from 2.68 μm to 2.22 μm by affecting the formation process of TiC. Moreover, the decrease of TiC particles size accelerates the fast formation of dense and continuous TiO2/Cr2O3 oxide layer, which bring down the mass gain (800 °C/100 h) from 2.03 mg cm-2 to 1.18 mg cm-2. Meanwhile, the coefficient of thermal expansion decreases from 11.15 × 10-6 °C-1 to 10.80 × 10-6 °C-1, and electrical conductivity maintains about 5800 S cm-1 at 800 °C. Therefore, the decrease of graphite particle size is one simple and effective route to optimize the oxidation resistance of composites, and meantime keeps suitable thermal expansion and good electrical conductivity.

  17. Influence of temperature, environment, and thermal aging on the continuous cycle fatigue behavior of Hastelloy X and Inconel 617

    International Nuclear Information System (INIS)

    Strizak, J.P.; Brinkman, C.R.; Booker, M.K.; Rittenhouse, P.L.

    1982-04-01

    Results are presented for strain-controlled fatigue and tensile tests for two nickel-base, solution-hardened reference structural alloys for use in several High-Temperature Gas-Cooled Reactor (HTGR) concepts. These alloys, Hastelloy X and Inconel 617, were tested from room temperature to 871 0 C in air and impure helium. Materials were tested in both the solution-annealed and the preaged conditios, in which aging consisted of isothermal exposure at one of several temperatures for periods of up to 20,000 h. Comparisons are given between the strain-controlled fatigue lives of these and several other commonly used alloys, all tested at 538 0 C. An analysis is also presented of the continuous cycle fatigue data obtained from room temperature to 427 0 C for Hastelloy G, Hastelloy X, Hastelloy C-276, and Hastelloy C-4, an effort undertaken in support of ASME code development

  18. Creep properties of Hastelloy X in a carburizing helium environment

    International Nuclear Information System (INIS)

    Nakanishi, T.; Kawakami, H.

    1982-01-01

    In this work, we investigate the environmental effect on the creep behavior of Hastelloy X at 900 0 C in helium and air. Since helium coolant in HTGR is expected to be carburizing and very weakly oxidizing for most metals, testings were focused on the effect of carburizing and slight oxidation. Carburization decreases secondary creep strain rate and delays tertiary creep initiation. On the other hand, the crack growth rate on the specimen surface is enhanced due to very weak oxidation in helium, therefore the tertiary creep strain rate becomes larger than that in air. The rupture time of Hastelloy X was shorter in helium when compared with in air. Stress versus rupture time curves for both environments do not deviate with each other during up to 5000 hours test, and a ratio of rupture stress in helium to that in air was about 0.9

  19. Study on the creep constitutive equation of Hastelloy X, (1)

    International Nuclear Information System (INIS)

    Suzuki, Kazuhiko; Mutoh, Yasushi

    1983-01-01

    In order to carry out the structural design of high temperature pipings, intermediate heat exchangers and isolating valves for a multipurpose high temperature gas-cooled reactor, in which coolant temperature reaches 1000 deg C, the creep characteristics of Hastelloy X used as the heat resistant material must be clarified. In addition to usual creep rupture life and the time to reach a specified creep strain, the dependence of creep strain curves on time, temperature and stress must be determined and expressed with equations. Therefore, using the creep data of Hastelloy X given in the literatures, the creep constitutive equation was made. Since the creep strain curves under the same test condition were different according to heats, the sensitivity analysis of the creep constitutive equation was performed. The form of the creep constitutive equation was determined to be Garofalo type. The result of the sensitivity analysis is reported. (Kako, I.)

  20. High temperature strength of Hastelloy XR under biaxial stress states

    International Nuclear Information System (INIS)

    Muto, Yasushi; Hada, Kazuhiko; Koikegami, Hajime; Ohno, Nobutada.

    1991-01-01

    Biaxial(tension/torsion) creep and creep-fatigue tests were conducted on Hastelloy XR at 950degC in air. Hastelloy XR is a nickel base solution-annealed heat resistant alloy. Thin-walled tubular test specimens were employed. As results of the creep tests, the von Mises' flow rule was revealed to be applicable very well. Under the torsion load, sufficient growth of voids was necessary to initiate the fracture and this resulted in longer life time compared with that under the tension load. Only a few number of small voids could be observed and very long life times were attained under the compression load. The creep-fatigue tests revealed that superposition of constant torsion load on a cyclic axial load reduced the cycles to failure significantly and the amount of reduction was consistent with the prediction by the linear life fraction rule. (author)

  1. Applicability of creep damage rules to a nickel-base heat-resistant alloy Hastelloy XR

    International Nuclear Information System (INIS)

    Tsuji, Hirokazu; Nakajima, Najime; Tanabe, Tatsuhiko; Nakasone, Yuji

    1992-01-01

    A series of constant load and temperature creep rupture tests and varying load and/or temperature creep rupture tests was carried out on a nickel-base heat-resistant alloy Hastelloy XR, which was developed for applications in the High-Temperature Engineering Test Reactor, at temperatures ranging from 850 to 1000deg C in order to examine the applicability of the conventional creep damage rules, i.e., the life fraction, the strain fraction and their mixed rules. The life fraction rule showed the best applicability of these three criteria. The good applicability of the rule was considered to result from the fact that the creep strength of Hastelloy XR was not strongly affected by the change of the chemical composition and/or the microstructure during exposure to the high-temperature simulated HTGR helium environment. In conclusion the life fraction rule is applicable in engineering design of high-temperature components made of Hastelloy XR. (orig.)

  2. Long-term corrosion behaviors of Hastelloy-N and Hastelloy-B3 in moisture-containing molten FLiNaK salt environments

    International Nuclear Information System (INIS)

    Ouyang, Fan-Yi; Chang, Chi-Hung; Kai, Ji-Jung

    2014-01-01

    Highlights: •Corrosion behaviors of Hastelloy-N and -B3 in molten FLiNaK salt at 700 °C. •The alleviated corrosion rate of alloys was observed after long-hour immersion. •Long-term corrosion rate was limited by diffusion from matrix to alloy surface. •Corrosion pattern transferred from intergranular corrosion into general corrosion. •Presence of minor H 2 O did not greatly influence the long-term corrosion behavior. -- Abstract: This study investigated long-term corrosion behaviors of Ni-based Hastelloy-N and Hastelloy-B3 under moisture-containing molten alkali fluoride salt (LiF–NaF–KF: 46.5–11.5–42%) environment at an ambient temperature of 700 °C. The Hastelloy-N and Hastelloy-B3 experienced similar weight losses for tested duration of 100–1000 h, which was caused by aggregate dissolution of Cr and Mo into FLiNaK salts. The corrosion rate of both alloys was high initially, but then reduced during the course of the test. The alleviated corrosion rate was due to the depletion of Cr and Mo near surface of the alloys and thus the long-term corrosion rate was controlled by diffusion of Cr and Mo outward to the alloy surface. The results of microstructural characterization revealed that the corrosion pattern for both alloys tended to be intergranular corrosion at early stage of corrosion test, and then transferred to general corrosion for longer immersion hours

  3. Design fatigue curve for Hastelloy-X

    International Nuclear Information System (INIS)

    Nishiguchi, Isoharu; Muto, Yasushi; Tsuji, Hirokazu

    1983-12-01

    In the design of components intended for elevated temperature service as the experimental Very High-Temperature gas-cooled Reactor (VHTR), it is essential to prevent fatigue failure and creep-fatigue failure. The evaluation method which uses design fatigue curves is adopted in the design rules. This report discussed several aspects of these design fatigue curves for Hastelloy-X (-XR) which is considered for use as a heat-resistant alloy in the VHTR. Examination of fatigue data gathered by a literature search including unpublished data showed that Brinkman's equation is suitable for the design curve of Hastelloy-X (-XR), where total strain range Δ epsilon sub(t) is used as independent variable and fatigue life Nsub(f) is transformed into log(log Nsub(f)). (author)

  4. Creep properties of 20% cold-worked Hastelloy XR

    International Nuclear Information System (INIS)

    Kurata, Y.

    1996-01-01

    The creep properties of Hastelloy XR, in solution-treated and in 20% cold-worked conditions, were studied at 800, 900 and 1000 C. At 800 C, the steady-state creep rate and rupture ductility decrease, while rupture life increases after cold work to 20%. Although the steady-state creep rate and ductility also decrease at 900 C, the beneficial effect on rupture life disappears. Cold work to 20% enhan ces creep resistance of this alloy at 800 and 900 C due to a high density of dislocations introduced by the cold work. Rupture life of the 20% cold-worked alloy becomes shorter and the steady-state creep rate larger at 1000 C during creep of the 20% cold-worked alloy. It is emphasized that these cold work effects should be taken into consideration in design and operation of high-temperature structural components of high-temperature gas-cooled reactors. (orig.)

  5. Creep properties of Hastelloy X and their application to structural design

    International Nuclear Information System (INIS)

    Kiyoshige, Masanori; Murase, Koichi; Fujioka, Junzo; Shimizu, Shigeki; Satoh, Keisuke

    1977-01-01

    Creep and stress rupture tests on three heats of Hastelloy X differing in the manufacturing process were carried out at 800 0 C, 900 0 C and 1000 0 C. Interpretation of the observed creep properties was made, and a method for predicting necessary design data from the experimentally obtained results was discussed. The results are as follows. (1) It was difficult to separate the primary, secondary and tertiary creep stages in the creep curve of Hastelloy X of the present tests. However, those were made distinguishable by plotting the results in a double-logarithmic coordinates. From these creep rate curves, the primary and secondary creep rates and the times to the initiation of secondary and tertiary creeps were derived. (2) It is considered that the same stress and temperature dependences between the primary and secondary creep rates exist in the creep behaviour of Hastelloy X of the present tests. (3) All the creep data, except the isochronous stress-strain curve, required for the design such as stress vs. rupture time, stress vs. secondary creep rate and stress vs. time to initiation of tertiary creep could be arranged through the Larson-Miller parameter. On the other hand, the isochronous stress-strain curve was figured out by estimating creep curves. The constitutive equations of creep for a heat of Hastelloy X proposed in this paper and the isochronous stress-strain curves derived from these constitutive equations were consistent with the experimental data obtained for the corresponding material. (auth.)

  6. Creep properties of base metal and welded joint of Hastelloy XR produced for High-Temperature Engineering Test Reactor in simulated primary coolant helium

    International Nuclear Information System (INIS)

    Kurata, Yuji; Tsuji, Hirokazu; Shindo, Masami; Suzuki, Tomio; Tanabe, Tatsuhiko; Mutoh, Isao; Hiraga, Kenjiro

    1999-01-01

    Creep tests of base metal, weld metal and welded joint of Hastelloy XR, which had the same chemical composition as Hastelloy XR produced for an intermediate heat exchanger of the High-Temperature Engineering Test Reactor, were conducted in simulated primary coolant helium. The weld metal and welded joint showed almost equal to or longer rupture time than the base metal of Hastelloy XR at 850 and 900degC, although they gave shorter rupture time at 950degC under low stress and at 1,000degC. The welded joint of Hastelloy XR ruptured at the base metal region at 850 and 900degC. On the other hand, it ruptured at the weld metal region at 950 and 1,000degC. The steady-state creep rate of weld metal of Hastelloy XR was lower than that of base metal at 850, 900 and 950degC. The creep rupture strengths of base metal, weld metal and welded joint of Hastelloy XR obtained in this study were confirmed to be much higher than the design allowable creep-rupture stress (S R ) of the Design Allowable Limits below 950degC. (author)

  7. Corrosion characteristics of Hastelloy N alloy after He+ ion irradiation

    International Nuclear Information System (INIS)

    Lin Jianbo; Yu Xiaohan; Li Aiguo; He Shangming; Cao Xingzhong; Wang Baoyi; Li Zhuoxin

    2014-01-01

    With the goal of understanding the invalidation problem of irradiated Hastelloy N alloy under the condition of intense irradiation and severe corrosion, the corrosion behavior of the alloy after He + ion irradiation was investigated in molten fluoride salt at 700 °C for 500 h. The virgin samples were irradiated by 4.5 MeV He + ions at room temperature. First, the virgin and irradiated samples were studied using positron annihilation lifetime spectroscopy (PALS) to analyze the influence of irradiation dose on the vacancies. The PALS results showed that He + ion irradiation changed the size and concentration of the vacancies which seriously affected the corrosion resistance of the alloy. Second, the corroded samples were analyzed using synchrotron radiation micro-focused X-ray fluorescence, which indicated that the corrosion was mainly due to the dealloying of alloying element Cr in the matrix. Results from weight-loss measurement showed that the corrosion generally correlated with the irradiation dose of the alloy. (author)

  8. Hastelloy X fuel element creep relaxation and residual effects

    International Nuclear Information System (INIS)

    Castle, R.A.

    1971-01-01

    A worst case, seven element, asymmetric fuel, thermal environment was assumed and a creep relaxation analysis generated. The fuel element clad is .020 inch Hastelloy X. The contact load decreased from 11.6 pounds to 5.87 pounds in 100,000 hours. The residual stresses were then computed for various shutdown times. (U.S.)

  9. Corrosion of Inconel-625, Hastelloy-X280 and Incoloy-800 in 550 - 750°C superheated steam. Influence of alloy heat treatment, surface treatment, steam temperature and steam velocity. Part I: Results up to 6000 hours exposure time. RCN Report

    International Nuclear Information System (INIS)

    Tilborg, P.J. van; Linde, A. van der

    1969-10-01

    Sheet samples of Inconel-625, Hastelloy-X280 and Incoloy-800 were tested, in the solution annealed and in the solution annealed + 20% cold worked + 800°C tempered condition, in steam with a velocity of 5 m/sec. at 550, 650 and 750°C and in steam with a volocity of 15 and 85 m/sec. at 550°C. At 550°C and 750°C the samples were tested in the heat treated, annealed or tempered and the heat treated + electropolished condition. At 650°C moreover as heat treated + ground and pickled samples were tested. Post-corrosion sample investigations involved measurement of the adherent oxide thickness, the total amount of corroded metal, the metal loss to system, and the metallographic and microprobe investigation of the adherent oxide film and adjacent diffusion disturbed alloy layer. The results obtained up to 6000 hours exposure time showed that the surface treatment has a decisive influence on the corrosion behaviour of all three alloys tested. The differences in the corrosion data for the two heat treatment conditions are small. The influence of the steam velocity, as tested at 550°C, on the initial corrosion rate was surprisingly high, while the long-term linear corrosion rates are only slightly influenced by the gas velocity. In general the linear corrosion rates were low, 1-5 mg/dm 2 month, and not consistently affected by the test-temperature. The metal loss to system values were 2 <15 mg/dm 2 in the low velocity steam at all three test temperatures and <30 mg/dm 2 in the high velocity steam at 550°C. The metallographic and microprobe examinations revealed no remarkable results, as compared with the results of analogous tests reported in literature. (author)

  10. Relationship between carburization and zero-applied-stress creep dilation in Alloy 800H and Hastelloy X

    International Nuclear Information System (INIS)

    Inouye, H.; Rittenhouse, P.L.

    1981-01-01

    Typical HTGR candidate alloys can carburize when exposed to simulated service environments. The carbon concentration gradients so formed give rise to internal stresses which could cause dilation. Studies performed with Hastelloy X and Alloy 800H showed that dilations of up to almost 1% can occur at 1000 0 C when carbon pickup is high. Dilation was normally observed only when the carbon increase was >1000 μg/cm 2 and ceased when diffusing carbon reached the center of the specimen. (Auth.)

  11. ERDA, RBS, TEM and SEM characterization of microstructural evolution in helium-implanted Hastelloy N alloy

    Energy Technology Data Exchange (ETDEWEB)

    Gao, Jie [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); School of Physical Sciences, University of Chinese Academy of Sciences, Beijing 100049 (China); Bao, Liangman [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); Huang, Hefei, E-mail: huanghefei@sinap.ac.cn [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); Li, Yan, E-mail: liyan@sinap.ac.cn [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); Lei, Qiantao [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); Institute of Modern Physics, Fudan University, Shanghai 200433 (China); Deng, Qi [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); Liu, Zhe; Yang, Guo [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); School of Physical Sciences, University of Chinese Academy of Sciences, Beijing 100049 (China); Shi, Liqun [Institute of Modern Physics, Fudan University, Shanghai 200433 (China)

    2017-05-15

    Hastelloy N alloy was implanted with 30 keV, 5 × 10{sup 16} ions/cm{sup 2} helium ions at room temperature, and subsequent annealed at 600 °C for 1 h and further annealed at 850 °C for 5 h in vacuum. Using elastic recoil detection analysis (ERDA) and transmission electron microscopy (TEM), the depth profiles of helium concentration and helium bubbles in helium-implanted Hastelloy N alloy were investigated, respectively. The diffusion of helium and molybdenum elements to surface occurred during the vacuum annealing at 850 °C (5 h). It was also observed that bubbles in molybdenum-enriched region were much larger in size than those in deeper region. In addition, it is worth noting that plenty of nano-holes can be observed on the surface of helium-implanted sample after high temperature annealing by scanning electron microscope (SEM). This observation provides the evidence for the occurrence of helium release, which can be also inferred from the results of ERDA and TEM analysis.

  12. Comparison of creep behavior under varying load/temperature conditions between Hastelloy XR alloys with different boron content levels

    International Nuclear Information System (INIS)

    Tsuji, Hirokazu; Nakajima, Hajime; Shindo, Masami; Tanabe, Tatsuhiko; Nakasone, Yuji.

    1996-01-01

    In the design of the high-temperature components, it is often required to predict the creep rupture life under the conditions in which the stress and/or temperature may vary by using the data obtained with the constant load and temperature creep rupture tests. Some conventional creep damage rules have been proposed to meet the above-mentioned requirement. Currently only limited data are available on the behavior of Hastelloy XR, which is a developed alloy as the structural material for high-temperature components of the High-Temperature Engineering Test Reactor (HTTR), under varying stress and/or temperature creep conditions. Hence a series of constant load and temperature creep rupture tests as well as varying load and temperature creep rupture tests was carried out on two kinds of Hastelloy XR alloys whose boron content levels are different, i.e., below 10 and 60 mass ppm. The life fraction rule completely fails in the prediction of the creep rupture life of Hastelloy XR with 60 mass ppm boron under varying load and temperature conditions though the rule shows good applicability for Hastelloy XR with below 10 mass ppm boron. The change of boron content level of the material during the tests is the most probable source of impairing the applicability of the life fraction rule to Hastelloy XR whose boron content level is 60 mass ppm. The modified life fraction rule has been proposed based on the dependence of the creep rupture strength on the boron content level of the alloy. The modified rule successfully predicts the creep rupture life under the two stage creep test conditions from 1000 to 900degC. The trend observed in the two stage creep tests from 900 to 1000degC can be qualitatively explained by the mechanism that the oxide film which is formed during the prior exposure to 900degC plays the role of the protective barrier against the boron dissipation into the environment. (J.P.N.)

  13. Application of Hastelloy X in gas-cooled reactor systems

    International Nuclear Information System (INIS)

    Brinkman, C.R.; Rittenhouse, P.L.; Corwin, W.R.; Strizak, J.P.; Lystrup, A.; DiStefano, J.R.

    1976-10-01

    Hastelloy X, an Ni--Cr--Fe--Mo alloy, may be an important structural alloy for components of gas-cooled reactor systems. Expected applications of this alloy in the High-Temperature Gas-Cooled Reactor (HTGR) are discussed, and the development of interim mechanical properties and supporting data are reported. Properties of concern include tensile, creep, creep-rupture, fatigue, creep-fatigue interaction, subcritical crack growth, thermal stability, and the influence of helium environments with controlled amounts of impurities on these properties. In order to develop these properties in helium environments that are expected to be prototypic of HTGR operating conditions, it was necessary to construct special environmental test systems. Details of construction and operating parameters are described. Interim results from tests designed to determine the above properties are presented. To date a fairly extensive amount of information has been generated on this material at Oak Ridge National Laboratory and elsewhere concerning behavior in air, which is reviewed. However, only limited data are available from tests conducted in helium. Comparisons of the fatigue and subcritical growth behavior in air between Hastelloy X and a number of other structural alloys are given

  14. Effect of grain size and cold working on high temperature strength of Hastelloy X

    International Nuclear Information System (INIS)

    Fujioka, J.; Murase, H.; Matsuda, S.

    1980-01-01

    Effect of grain size and cold working on creep, creep rupture, low cycle fatigue and tensile strengths of Hastelloy X were studied at temperatures ranging from 800 to 1000 0 C. In order to apply these data to design, the allowable design stresses were estimated by expanding the criteria of ASME Code Case 1592 to such a high temperature range. The allowable design stress increased, on the other hand, the low cycle fatigue life decreased with increasing grain size. Cold working up to a ratio of 5 per cent may not be a serious problem in design, because the allowable design stress and the fatigue life were little affected. The cause of these variations in strength was discussed by examining the initiation and growth of cracks, and the microstructures. (author)

  15. Creep curve modeling of hastelloy-X alloy by using the theta projection method

    International Nuclear Information System (INIS)

    Woo Gon, Kim; Woo-Seog, Ryu; Jong-Hwa, Chang; Song-Nan, Yin

    2007-01-01

    To model the creep curves of the Hastelloy-X alloy which is being considered as a candidate material for the VHTR (Very High Temperature gas-cooled Reactor) components, full creep curves were obtained by constant-load creep tests for different stress levels at 950 C degrees. Using the experimental creep data, the creep curves were modeled by applying the Theta projection method. A number of computing processes of a nonlinear least square fitting (NLSF) analysis was carried out to establish the suitably of the four Theta parameters. The results showed that the Θ 1 and Θ 2 parameters could not be optimized well with a large error during the fitting of the full creep curves. On the other hand, the Θ 3 and Θ 4 parameters were optimized well without an error. For this result, to find a suitable cutoff strain criterion, the NLSF analysis was performed with various cutoff strains for all the creep curves. An optimum cutoff strain range for defining the four Theta parameters accurately was found to be a 3% cutoff strain. At the 3% cutoff strain, the predicted curves coincided well with the experimental ones. The variation of the four Theta parameters as the function of a stress showed a good linearity, and the creep curves were modeled well for the low stress levels. Predicted minimum creep rate showed a good agreement with the experimental data. Also, for a design usage of the Hastelloy-X alloy, the plot of the log stress versus log the time to a 1% strain was predicted, and the creep rate curves with time and a cutoff strain at 950 C degrees were constructed numerically for a wide rang of stresses by using the Theta projection method. (authors)

  16. Compatibility of aluminide-coated Hastelloy x and Inconel 617 in a simulated gas-cooled reactor environment

    International Nuclear Information System (INIS)

    Chin, J.; Johnson, W.R.; Chen, K.

    1982-03-01

    Commercially prepared aluminide coatings on Hastelloy X and Inconel 617 substrates were exposed to controlled-impurity helium at 850 0 and 950 0 C for 3000 h. Optical and scanning electron (SEM) microscopy, electron microprobe profiles, and SEM X-ray mapping were used to evaluate and compare exposed and unexposed control samples. Four coatings were evaluated: aluminide, aluminide with platinum, aluminide with chromium, and aluminide with rhodium. With extended time at elevated temperature, nickel diffused into the aluminide coatings to form epsilon-phase (Ni 3 Al). This diffusion was the primary cause of porosity formation at the aluminide/alloy interface

  17. Evaluation of creep and relaxation data for hastelloy alloy x sheet

    International Nuclear Information System (INIS)

    Booker, M.K.

    1979-02-01

    Hastelloy alloy X has been a successful high-temperature structural material for more than two decades. Recently, Hastelloy alloy X sheet has been selected as a prime structural material for the proposed Brayton Isotope Power System (BIPS). The material also sees extensive application in the High-Temperature Gas-Cooled Reactor (HTGR). Design of these systems requires a detailed consideration of the high-temperature creep properties of this material. Therefore, available creep, creep-rupture, and relaxation data for Hastelloy alloy X were collected and analyzed to yield mathematical representations of the behavior for design use

  18. Study on the creep constitutive equation of Hastelloy X, (1)

    International Nuclear Information System (INIS)

    Hada, Kazuhiko; Mutoh, Yasushi

    1983-01-01

    A creep constitutive equation of Hastelloy X was obtained from available experimental data. A sensitivity analysis of this creep constitutive equation was carried out. As the result, the following were revealed: (i) Variations in creep behavior with creep constitutive equation are not small. (ii) In a simpler stress change pattern, variations in creep behavior are similar to those in the corresponding fundamental creep characteristics (creep strain curve, stress relaxation curve, etc.). (iii) Cumulative creep damage estimated in accordance with ASME Boiler and Pressure Vessel Code Case N-47 from a stress history predicted by ''the standard creep constitutive equation'' which predicts the average behavior of creep strain curve data is not thought to be on the safe side on account of uncertainties in creep damage caused by variations in creep strain curve. (author)

  19. Temperature dependence of creep properties of cold-worked Hastelloy XR

    International Nuclear Information System (INIS)

    Kurata, Yuji; Nakajima, Hajime

    1995-01-01

    The creep properties of Hastelloy XR, in a solution treated, 10% or 20% cold-worked condition, were investigated at temperatures from 800 to 1,000degC for the duration of creep tests up to about 2,500 ks. At 800 and 850degC, the steady-state creep rate and rupture ductility decreased and the rupture life increased after cold work of 10% or 20%. Although the rupture life of the 10% cold-worked alloy was longer at 900degC than that of the solution treated one, the rupture lives of the 10% cold-worked and solution treated alloys were almost equal at 950degC, which is the highest helium temperature in an intermediate heat exchanger of the High Temperature Engineering Test Reactor (HTTR). The beneficial effect of 10% cold work on the rupture life and the steady-state creep rate disappeared at 1,000degC. The beneficial effect of 20% cold work disappeared at 950degC because significant dynamic recrystallization occurred during creep. While rupture ductility of this alloy decreased after cold work of 10% or 20%, it recovered to a considerable extend at 1,000degC. It is emphasized that these cold work effects should be taken into consideration in design, operation and residual life estimation of high temperature components of the HTTR. (author)

  20. Evaluation on materials performance of Hastelloy Alloy XR for HTTR uses-5 (Creep properties of base metal and weldment in air)

    International Nuclear Information System (INIS)

    Watanabe, Katsutoshi; Nakajima, Hajime; Koikegami, Hajime; Higuchi, Makoto; Nakanishi, Tsuneo; Saitoh, Teiichiro; Takatsu, Tamao.

    1994-01-01

    Creep properties of weldment made from Hastelloy Alloy XR base metals and filler metals for the High Temperature Engineering Test Reactor (HTTR) components were examined by means of creep and creep rupture tests at 900 and 950degC in air. The results obtained are as follows: creep rupture strength was nearly equal or higher than that of Hastelloy Alloy XR master curve and was much higher than design creep rupture strength [S R ]. Furthermore, creep rupture strength and ductility of the present filler metal was in the data band in comparison with those of the previous filler metals. It is concluded from these reasons that this filler metal has fully favorable properties for HTTR uses. (author)

  1. The corrosion behavior of molybdenum and Hastelloy B in sulfur and sodium polysulfides at 623 K

    International Nuclear Information System (INIS)

    Brown, A.P.

    1987-01-01

    An experimental study was completed to determine the corrosion behavior of molybdenum and Hastelloy B, a nickel-based alloy with high molybdenum content, in sulfur and sodium polysulfides (Na/sub 2/S/sub 3/,Na/sub 2/S/sub 4/, Na/sub 2/S/sub 5/) at 623 K. In sulfur, molybdenum corrodes very slowly, with a parabolic rate constant of 3.6 x 10/sup -9/ cm s/sup -1/2/. Hastelloy B shows no measurable corrosion after 100h of exposure to sulfur. The corrosion reaction of molybdenum in Na/sub 2/S/sub 3/ is characterized by the formation of a protective film that effectively eliminates further corrosion after the first 100h of exposure. Hastelloy B, however, corrodes rapidly in Na/sub 2/S/sub 3/, with corrosion rates approaching those of pure nickel under the same conditions. After the first 4h of exposure, the kinetics for the corrosion of Hastelloy B in Na/sub 2/S/sub 3/ follows a linear rate law. The scale morphology has multiple spalled layers of NiS/sub 2/, with some crystallites of NiS/sub 2/ appearing on the leading face of the scale and between the individual scale layers. This spalling causes smaller coupons of the Hastelloy B to corrode faster than larger coupons

  2. Creep properties of EB welded joint on Hastelloy X

    International Nuclear Information System (INIS)

    Arata, Yoshiaki; Susei, Shuzo; Shimizu, Shigeki; Satoh, Keisuke; Nagai, Hiroyoshi.

    1980-01-01

    In order to clarify the creep properties of EB welds on Hastelloy X which is one of the candidate alloys for components of VHTR, creep tests on EB weld metal and welded joint were carried out. The results were discussed in comparison with those of base metal and TIG welds. Further, EB welds were evaluated from the standpoint of high temperature structural design. The results obtained are summarized as follows. 1) Both creep rupture strengths of EB weld metal and EB welded joint are almost equal to that of base metal, but those of TIG welds are lower than base metal. As for the secondary creep rate, EB weld metal is higher and TIG weld metal is lower than base metal. As for the time to onset of tertiary creep, no remarkable difference among base metal, EB weld metal and TIG weld metal is observed. 2) In case of EB weld metal, although anisotropy is slightly observed, the ductility is same or more as compared with base metal. In case of TIG weld metal, on the contrary, anisotropy is not observed and the ductility is essentially low. 3) Such rupture morphology of EB weld metal as appears to have resulted from interconnection of voids which occurred at grain boundary is similar to base metal. In case of TIG weld metal, however, many cracks with sharp tips are observed at grain boundary, and the rupture appears to have occurred in brittle by propagation and connection of the cracks. 4) It can be said from the standpoint of high temperature structural design that EB welding is very suitable to welding for structure where creep effects are significant, because both of the creep ductility and the rupture strength are almost equal to those of base metal. (author)

  3. Status of tellurium--hastelloy N studies in molten fluoride salts

    International Nuclear Information System (INIS)

    Keiser, J.R.

    1977-10-01

    Tellurium, which is a fission product in nuclear reactor fuels, can embrittle the surface grain boundaries of nickel-base structural materials. This report summarizes results of an experimental investigation conducted to understand the mechanism and to develop a means of controlling this embrittlement in the alloy Hastelloy N. The addition of a chromium telluride to salt can be used to provide small partial pressures of tellurium simulating a reactor environment where tellurium appears as a fission product. The intergranular embrittlement produced in Hastelloy N when exposed to this chromium telluride-salt mixture can be reduced by adding niobium to the Hastelloy N or by controlling the oxidation potential of the salt in the reducing range

  4. Creep properties of hastelloy x and their application to the structural design

    International Nuclear Information System (INIS)

    Kiyoshige, Masanori; Murase, Hirokazu; Fujioka, Junzo; Shimizu, Shigeki; Satoh, Keisuke.

    1978-01-01

    In the creep curve of Hastelloy X, it was difficult to divide it into the three stages of creep. However, these stages were made distinguishable by plotting the relationship between creep rates and time in double-logarithmic coordinates. All the creep data of Hastelloy X, except the isochronous stress-strain curves, required for determining the design stress intensities S sub(o) and S sub(t) were arranged through the Larson-Miller parameter. The isochronous stress-strain curves for a heat of Hastelloy X were derived from the constitutive equations obtained from short-term data. A fairly good agreement between the predicted data and the experimental data was obtained. (auth.)

  5. Effect of temperature upon the fatigue-crack propagation behavior of Hastelloy X-280

    International Nuclear Information System (INIS)

    James, L.A.

    1976-05-01

    The techniques of linear-elastic fracture mechanics were employed to characterize the effect of temperature upon the fatigue-crack propagation behavior of Hastelloy X-280 in an air environment. Also included in this study are survey tests to determine the effects of thermal aging and stress ratio upon crack growth behavior in this alloy

  6. Compatibility studies of type 316 stainless steel and Hastelloy N in KNO3--NaNO2--NaNO3

    International Nuclear Information System (INIS)

    Devan, J.H.; Keiser, J.R.

    1978-01-01

    The nitrate-based fused salt mixture KNO 3 --NaNO 2 --NaNO 3 (44--49--7 mol %) has been widely used as a heat transport fluid and for metallurgical heat-treating. We have measured the corrosion rate of this salt in the presence of a temperature gradient for an iron-base material, type 316 stainless steel, and a nickel-base material, Hastelloy N. Corrosion rates were measured with maximum loop temperatures of 431 and 504 0 C. Measured corrosion rates were in all cases less than 8 μm/year

  7. Creep-rupture behavior of 2-1/4 Cr-1 Mo steel, Alloy 800H and Hastelloy Alloy X in a simulated HTGR helium environment

    International Nuclear Information System (INIS)

    Lai, G.Y.; Wolwowicz, R.J.

    1979-12-01

    Creep-rupture testing was conducted on 1 1/4 Cr-1 Mo steel, Alloy 800H and Hastelloy Alloy X in flowing helium containing nominal concentration of following gases: 1500 μatm H 2 , 450 μatm CO, 50 μatm CH 4 , 50 μatm H 2 O and 5 μatm CO 2 . This environment is believed to represent maximum permissible levels of impurities in the primary coolant for the steam-cycle system of a high-temperature gas-cooled reactor (HTGR) when it is operating continuously with a water and/or steam leak at technical specification limits. Two or three heats of material for each alloy were investigated. Tests were conducted at 482 0 C and 760 0 C (1200 0 F and 1400 0 F) for Alloy 800H, and at 760 0 C and 871 0 C (1400 0 F and 1600 0 F) for Hastelloy Alloy X for times up to 10,000 h. Selected tests were performed on same heat of material in both air and helium environments to make a direct comparison of creep-rupture behaviors between two environments. Metallurgical evaluation was performed on selected post test specimens with respect to gas-metal interactions which included oxidation, carburization and/or decarburization. Correlation between gaseous corrosion and creep-rupture behavior was attempted. Limited tests were also performed to investigate the specimen size effects on creep-rupture behavior in the helium environment

  8. Weldability and weld performance of a special grade Hastelloy-X modified for high-temperature gas-cooled reactors

    International Nuclear Information System (INIS)

    Shimizu, S.; Mutoh, Y.

    1984-01-01

    The characteristics of weld defects in the electron beam (EB) welding and the tungsten inert gas (TIG) arc welding for Hastelloy-XR, a modified version of Hastelloy-X, are clarified through the bead-on-plate test and the Trans-Varestraint test. Based on the results, weldabilities on EB and TIG weldings for Hastelloy-XR are discussed and found to be almost the same as Hastelloy-X. The creep rupture behaviors of the welded joints are evaluated by employing data on creep properties of the base and the weld metals. According to the evaluation, the creep rupture strength of the EB-welded joint may be superior to that of the TIG-welded joint. The corrosion test in helium containing certain impurities is conducted for the weld metals. There is no significant difference of such corrosion characteristics as weight gain, internal oxidation, depleted zone, and so on between the base and the weld metals. Those are superior to Hastelloy-X

  9. Metallurgical and environmental factors influencing creep behaviour of hastelloy-X

    International Nuclear Information System (INIS)

    Kiuchi, Kiyoshi; Kondo, Tatsuo

    1979-03-01

    Creep and rupture behaviours of Hastelloy-X and its modified version were examined with special reference to the effect of different test environments; i.e. air, high vacuum and the simulated HTR helium coolant. The respective environments showed different effects. The vacuum environment of about 10 -8 torr. gave best reproducible behaviour with essentially no surface-to-volume ratio effect. Such size effect was significant in the other two environments. The simulated HTR environment was characterized in its potentiality of both oxidizing selected alloy constituents and carburization. The observed behaviour was attributed to the depletion of strengthning solute elements caused by the surface reactions and the associated solid state reactions. (author)

  10. Etude expérimentale du soudage par laser YAG de l'alliage base nickel Hastelloy X Experimental study of YAG laser welding of nickel base alloy Hastelloy X

    Directory of Open Access Journals (Sweden)

    Graneix Jérémie

    2013-11-01

    Full Text Available Le procédé de soudage laser YAG est envisagé pour remplacer le procédé de soudage TIG manuel pour la réalisation de pièces de turboréacteur en alliage nickel-chrome-molybdène Hastelloy X. Cette étude expérimentale a permis de définir un domaine de soudabilité de cet alliage répondant aux critères spécifiques du secteur aéronautique. The YAG laser welding process is contemplated to replace the manual TIG welding process for the production of parts of turbojet in Hastelloy X. This experimental study has identified the field of weldability of this alloy to meet the specific requirements of the aerospace industry.

  11. Weldability of the superalloys Haynes 188 and Hastelloy X by Nd:YAG

    Directory of Open Access Journals (Sweden)

    Graneix Jérémie

    2014-01-01

    Full Text Available The requirements for welded aircraft parts have become increasingly severe, especially in terms of the reproducibility of the geometry and metallurgical grade of the weld bead. Laser welding is a viable method of assembly to meet these new demands, because of automation, to replace the manual TIG welding process. The purpose of this study is to determine the weldability of Hastelloy X and Haynes 188 alloys by the butt welding process with a Nd:YAG laser. To identify the influential parameters of the welding process (laser power, feed rate, focal diameter and flow of gas while streamlining testing, an experimental design was established with the CORICO software using the graphic correlation method. The position of the focal point was fixed at 1/3 of the thickness of the sheet. The gas flow rate and the power of the beam have a major effect on the mechanical properties and geometry of the weld. The strength of the weld is comparable to that of the base metal. However, there is a significant decrease in the elongation at break of approximately 30%. The first observations of the cross section of the weld by scanning electron microscopy coupled with EBSD analysis show a molten zone presenting dendritic large grains compared to the equiaxed grains of the base metals without a heat affected zone.

  12. Ion irradiation-induced swelling and hardening effect of Hastelloy N alloy

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, S.J. [Key Laboratory of Artificial Micro-and Nano-structures of Ministry of Education, School of Physics and Technology, Wuhan University, Wuhan 430072 (China); Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); Li, D.H.; Chen, H.C.; Lei, G.H.; Huang, H.F.; Zhang, W.; Wang, C.B. [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); Yan, L., E-mail: yanlong@sinap.ac.cn [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); Fu, D.J. [Key Laboratory of Artificial Micro-and Nano-structures of Ministry of Education, School of Physics and Technology, Wuhan University, Wuhan 430072 (China); Tang, M. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States)

    2017-06-15

    The volumetric swelling and hardening effect of irradiated Hastelloy N alloy were investigated in this paper. 7 MeV and 1 MeV Xe ions irradiations were performed at room temperature (RT) with irradiation dose ranging from 0.5 to 27 dpa. The volumetric swelling increases with increasing irradiation dose, and reaches up to 3.2% at 27 dpa. And the irradiation induced lattice expansion is also observed. The irradiation induced hardening initiates at low ion dose (≤1dpa) then saturates with higher ion dose. The irradiation induced volumetric swelling may be ascribed to excess atomic volume of defects. The irradiation induced hardening may be explained by the pinning effect where the defects can act as obstacles for the free movement of dislocation lines. And the evolution of the defects' size and number density could be responsible for the saturation of hardness. - Highlights: •Irradiation Swelling: The irradiation induced volumetric swelling increases with ion dose. •Irradiation Hardening: The irradiation hardening initiates below 1 dpa, then saturates with higher ion dose (1–10 dpa). •Irradiation Mechanism: The irradiation phenomena are ascribed to the microstructural evolution of the irradiation defects.

  13. Creep strength of hastelloy X TIG-welded cylinder under internal pressure at elevated temperature

    International Nuclear Information System (INIS)

    Udoguchi, Teruyoshi; Indo, Hirosato; Isomura, Kazuyuki; Kobatake, Kiyokazu; Nakanishi, Tsuneo.

    1981-01-01

    Creep tests on circumferentially TIG-welded Hastelloy x cylinders were carried out under internal pressure for the investigation of structural behavior of welded components in high temperature environment. The creep rupture strength of TIG-welded cylinders was much lower than that of non-welded cylinders, while such reduction was not found in uniaxial creep tests on TIG-welded bars. It was deduced that the reduction was due to the low ductility (ranging from 1 to 5%) of the weld metal to which enhanced creep was induced by the adjacent base metal whose creep strain rate was much higher than that of the weld metal. Therefore, uniaxial creep tests on bar specimens is not sufficient for proper assessment of the creep rupture strength of welded components. Both creep strain rate and creep ductility should be concerned for the assessment. Creep tests by using components such as cylinder under internal pressure are recommendable for the confirmation of creep strength of welded structures and components. (author)

  14. Effects of product form and boron addition on the creep damage in the modified Hastelloy X alloys in a simulated HTGR helium gas environment

    International Nuclear Information System (INIS)

    Nakasone, Yuji; Tanabe, Tatsuhiko; Tsuji, Hirokazu; Nakajima, Hajime.

    1992-01-01

    The present paper investigates early-stage-creep damage of Hastelloy XR and XR-II alloys, modified versions of Hastelloy X alloy, which have been developed in Japan as most promising candidate structural alloys for Japanese high-temperature gas-cooled reactors (HTGRs). Creep tests were made on Hastelloy XR forging, tube and XR-II tube at 1,123 to 1,273 K in a simulated HTGR helium gas environment. The tests were interrupted at different strain levels of up to 5 % in order to evaluate creep damage via intergranular voids. The void sizes along grain boundaries and the A-parameter, the ratio of the number of damaged grain boundaries, on which one or more voids are found, to that of the total grain boundaries observed are used in order to evaluate creep damage. Statistical analysis of the A-parameter as well as the void sizes reveals that the values of the parameter show wide variations and follow the Weibull distribution, reflecting spatial randomness of the voids. The void sizes along grain boundaries, on the other hand, follow the log-normal distribution. The maximum void size d max and the mean value of the A-parameter A m are calculated and plotted against interruption creep strain ε int . The resultant d max vs. ε int and A m vs. ε int diagrams show that Hastelloy XR forging had suffered more damage than Hastelloy XR tube; nevertheless, the forging has longer interruption life, or the time to reach a given interruption creep strain. The result indicates that grains may have been deformed more easily in Hastelloy XR in the form of tube than in the form of forging. The diagrams also imply that the addition of boron has suppressed the nucleation as well as the growth of voids and thus has brought about longer interruption life of Hastelloy XR-II. (author)

  15. Electrochemical impedance spectrometry using 316L steel, hastelloy, maraging, Inconel 600, Elgiloy, carbon steel, TiN and NiCr. Simulation in tritiated water. 2 volumes

    International Nuclear Information System (INIS)

    Bellanger, G.

    1994-03-01

    Polarization and electrochemical impedance spectrometry curves are presented and discussed. These curves make it possible to ascertain the corrosion domains and to compare the slow and fast kinetics (voltammetry) of different stainless steel alloys. These corrosion kinetics, the actual or simulated tritiated water redox potentials, and the corrosion potentials provide a classification of the steels studied here: 316L, Hastelloy, Maraging, Inconel 600, Elgiloy, carbon steel and TiN and NiCr deposits. From the results it can be concluded that Hastelloy and Elgiloy have the best corrosion resistance. (author). 49 refs., 695 figs., tabs

  16. Creep-Rupture Properties and Corrosion Behaviour of 21/4 Cr-1 Mo Steel and Hastelloy X-Alloys in Simulated HTGR Environment

    DEFF Research Database (Denmark)

    Lystrup, Aage; Rittenhouse, P. L.; DiStefano, J. R.

    Hastelloy X and 2/sup 1///sub 4/ Cr-1 Mo steel are being considered as structural alloys for components of a High-Temperature Gas-Cooled Reactor (HTGR) system. Among other mechanical properties, the creep behavior of these materials in HTGR primary coolant helium must be established to form part...

  17. Collect Available Creep-Fatigue Data and Study Existing Creep-Fatigue Evaluation Procedures for Grade 91 and Hastelloy XR

    International Nuclear Information System (INIS)

    Asayama, Tai; Tachibana, Yukio

    2007-01-01

    This report describes the results of investigation on Task 5 of DOE/ASME Materials Project based on a contract between ASME Standards Technology, LLC (ASME ST-LLC) and Japan Atomic Energy Agency (JAEA). Task 5 is to collect available creep-fatigue data and study existing creep-fatigue evaluation procedures for Grade 91 steel and Hastelloy XR. Part I of this report is devoted to Grade 91 steel. Existing creep-fatigue data were collected (Appendix A) and analyzed from the viewpoints of establishing a creep-fatigue procedure for VHTR design. A fair amount of creep-fatigue data has been obtained and creep-fatigue phenomena have been clarified to develop design standards mainly for fast breeder reactors. Following this, existing creep-fatigue procedures were studied and it was clarified that the creep-fatigue evaluation procedure of the ASME-NH has a lot of conservatisms and they were analyzed in detail from the viewpoints of the evaluation of creep damage of material. Based on the above studies, suggestions to improve the ASME-NH procedure along with necessary research and development items were presented. Part II of this report is devoted to Hastelloy XR. Existing creep-fatigue data used for development of the high temperature structural design guideline for High Temperature Gas-cooled Reactor (HTGR) were collected. Creep-fatigue evaluation procedure in the design guideline and its application to design of the intermediate heat exchanger (IHX) for High Temperature Engineering Test Reactor (HTTR) was described. Finally, some necessary research and development items in relation to creep-fatigue evaluation for Gen IV and VHTR reactors were presented.

  18. Electrochemical impedance spectrometry using 316L steel, hastelloy, maraging, Inconel 600, Elgiloy, carbon steel, TiN and NiCr. Simulation in tritiated water. 2 volumes; Spectrometrie d`impedance electrochimique sur acier 316L, hastelloy, maraging inconel 600, elgiloy, acier au carbone, TiN, NiCr. Simulations en eau tritiee. 2 volumes

    Energy Technology Data Exchange (ETDEWEB)

    Bellanger, G.

    1994-03-01

    Polarization and electrochemical impedance spectrometry curves are presented and discussed. These curves make it possible to ascertain the corrosion domains and to compare the slow and fast kinetics (voltammetry) of different stainless steel alloys. These corrosion kinetics, the actual or simulated tritiated water redox potentials, and the corrosion potentials provide a classification of the steels studied here: 316L, Hastelloy, Maraging, Inconel 600, Elgiloy, carbon steel and TiN and NiCr deposits. From the results it can be concluded that Hastelloy and Elgiloy have the best corrosion resistance. (author). 49 refs., 695 figs., tabs.

  19. Analyzing the effect of cutting parameters on surface roughness and tool wear when machining nickel based hastelloy - 276

    International Nuclear Information System (INIS)

    Khidhir, Basim A; Mohamed, Bashir

    2011-01-01

    Machining parameters has an important factor on tool wear and surface finish, for that the manufacturers need to obtain optimal operating parameters with a minimum set of experiments as well as minimizing the simulations in order to reduce machining set up costs. The cutting speed is one of the most important cutting parameter to evaluate, it clearly most influences on one hand, tool life, tool stability, and cutting process quality, and on the other hand controls production flow. Due to more demanding manufacturing systems, the requirements for reliable technological information have increased. For a reliable analysis in cutting, the cutting zone (tip insert-workpiece-chip system) as the mechanics of cutting in this area are very complicated, the chip is formed in the shear plane (entrance the shear zone) and is shape in the sliding plane. The temperature contributed in the primary shear, chamfer and sticking, sliding zones are expressed as a function of unknown shear angle on the rake face and temperature modified flow stress in each zone. The experiments were carried out on a CNC lathe and surface finish and tool tip wear are measured in process. Machining experiments are conducted. Reasonable agreement is observed under turning with high depth of cut. Results of this research help to guide the design of new cutting tool materials and the studies on evaluation of machining parameters to further advance the productivity of nickel based alloy Hastelloy - 276 machining.

  20. Influence of the brazing parameters on microstructure and mechanical properties of brazed joints of Hastelloy B2 nickel base alloy; Influencia de los parametros de soldeo fuerte en la microestructura y propiedades mecanicas de la union de la aleacion base niquel Hastelloy B2

    Energy Technology Data Exchange (ETDEWEB)

    Sotelo, J. C.; Gonzalez, M.; Porto, E.

    2014-07-01

    A study of the high vacuum brazing process of solid solution strengthened Hastelloy B2 nickel alloy has been done. A first stage of research has focused on the selection of the most appropriate brazing filler metal to the base material and vacuum furnace brazing process. The influence of welding parameters on joint microstructure constituents, relating the microstructure of the joint to its mechanical properties, has been evaluated. Two gaps of 50 and 200 micrometers, and two dwell times at brazing temperature of 10 and 90 minutes were studied. The braze joint mainly consists of the nickel rich matrix, nickel silicide and ternary compounds. Finally, the results of this study have shown the high bond strength for small gaps and increased dwell times of 90 minutes. (Author)

  1. Material design data of 2.25Cr-1Mo steel and hastelloy-x for the experimental multi-purpose very-high temperature gas-cooled reactor

    International Nuclear Information System (INIS)

    Kodaira, Tsuneo; Suzuki, Michiaki; Uga, Takeo

    1975-08-01

    The preliminary structural design guidelines for the experimental multi-purpose very-high temperature gas-cooled reactor have recently been prepared. The components of the primary system operating at temperatures of creep dominant range are grouped in those of pressure and temperature boundaries respectively. In the material selection, 2 1/4Cr-1Mo steel is chosen for the former and Hastelloy-X for the latter taking into account of material properties at operating temperature. Deriving from the literature in the field, material design data of the alloys are established in design forms such as Sy, So, Sm, St, 100% of minimum stress to rupture, design fatigue curves, isochronous stress-strain curves, creep-fatigue interaction damage factor and so on, which are defined in ASME Code Section III, Code Case 1592. (auth.)

  2. Influencia de los parámetros de soldeo fuerte en la microestructura y propiedades mecánicas de la unión de la aleación base níquel Hastelloy B2

    Directory of Open Access Journals (Sweden)

    Sotelo, José Carlos

    2014-09-01

    Full Text Available A study of the high vacuum brazing process of solid solution strengthened Hastelloy B2 nickel alloy has been done. A first stage of research has focused on the selection of the most appropriate brazing filler metal to the base material and vacuum furnace brazing process. The influence of welding parameters on joint microstructure constituents, relating the microstructure of the joint to its mechanical properties, has been evaluated. Two gaps of 50 and 200 micrometers, and two dwell times at brazing temperature of 10 and 90 minutes were studied. The braze joint mainly consists of the nickel rich matrix, nickel silicide and ternary compounds. Finally, the results of this study have shown the high bond strength for small gaps and increased dwell times of 90 minutes.Se realizó un estudio pormenorizado del proceso de soldeo fuerte en horno de alto vacío de la aleación base níquel Hastelloy B2 fortalecida por solución sólida. En una primera fase del trabajo se seleccionó el material de aporte acorde al material objeto de unión y a la fuente de calentamiento seleccionada. Posteriormente, se evaluó la influencia del gap (50 y 200 micrómetros y tiempo de permanencia a temperatura de soldeo (10 y 90 minutos sobre los microconstituyentes de la unión, relacionando la microestructura con las propiedades mecánicas de la junta. Los análisis metalográficos mostraron una unión constituida por una matriz rica en níquel, siliciuros de níquel y compuestos ternarios. Finalmente, los resultados de los ensayos mecánicos a esfuerzos cortantes mostraron una elevada resistencia para gaps de 50 micrómetros y tiempos de permanencia de 90 minutos.

  3. Effect of long-term aging at 8150C on the tensile properties and microstructural stability of four cobalt- and nickel-base superalloys

    International Nuclear Information System (INIS)

    Hammond, J.P.

    1976-08-01

    Two heats of Haynes alloy 25 and one heat each of Haynes alloy 188, Hastelloy N, and Inconel 625 were tensile tested after aging for 11,000 h at 816 0 C. Yield strength, ultimate tensile strength, and elongation were determined 24, 316, 760, and 982 0 C and compared with typical properties for these materials in the solution annealed condition. Toughness values were determined for these materials from their engineering stress-strain curves. The long-term aging treatment degraded ductility and toughness at room temperature but, contrary to behavior expected for overaging, enhanced them over those for the solution annealed condition in tests at 760 0 C. The tensile properties of the aged superalloys were correlated with mode of fracture and the amounts, identity, and morphology of the precipitates. Aging substantially depleted the hardener tungsten from the matrix in the cobalt-base alloys

  4. Compatibility of graphite with a martensitic-ferritic steel, an austenitic stainless steel and a Ni-base alloy up to 1250 C

    International Nuclear Information System (INIS)

    Hofmann, P.

    1994-08-01

    To study the chemical interactions between graphite and a martensitic-ferritic steel (1.4914), an austenitic stainless steel (1.4919; AISI 316), and a Ni-base alloy (Hastelloy X) isothermal reaction experiments were performed in the temperature range between 900 and 1250 C. At higher temperatures a rapid and complete liquefaction of the components occurred as a result of eutectic interactions. The chemical interactions are diffusion-controlled processes and can be described by parabolic rate laws. The reaction behavior of the two steels is very similar. The chemical interactions of the steels with graphite are much faster above 1100 C than those for the Ni-base alloy. Below 1000 C the effect is opposite. (orig.) [de

  5. Corrosion of several metals in supercritical steam at 5380C

    International Nuclear Information System (INIS)

    McCoy, H.E.; McNabb, B.

    1977-05-01

    The corrosion of several iron- and nickel-base alloys in supercritical steam at 24.1 MPa (3500 psi) and 538 0 C was measured to 7.92 x 10 7 s (22,000 h). The experiments were carried out in TVA's Bull Run Steam Plant. Corrosion was measured almost entirely by weight change and visual appearance; a few samples were evaluated by more descriptive analytical techniques. The corrosion rates of low-alloy ferritic steels containing from 1.1 to 8.7 percent Cr and 0.5 to 1.0 percent Mo differed by less than a factor of 2 in steam. Several modified compositions of Hastelloy N were evaluated and found to corrode at about equivalent rates. Of the alloys studied, the lowest weight gain in 3.6 x 10 7 sec (10,000 hr) was 0.01 mg/cm 2 for Inconel 718 and the highest 10 mg/cm 2 for the low-alloy ferritic steels. 25 figures, 3 tables

  6. The ''C'' family of Ni-Cr-Mo allloys' partnership with the chemical process industry: the last 70 years

    International Nuclear Information System (INIS)

    Agarwal, D.C.; Herda, W.R.

    1997-01-01

    The ''C'' family of alloys, the original being Hastelloy trademark alloy C (1930's) was an innovative optimization of Ni-Cr alloys having good resistance to oxidizing corrosive media and Ni-Mo alloys with superior resistance to reducing corrosive media. This combination resulted in the most versatile corrosion resistant alloy in the ''Ni-Cr-Mo'' alloy family, with exceptional corrosion resistance in a wide variety of severe corrosive environments typically encountered in CPI and other industries. The alloy also exhibited excellent resistance to pitting and crevice corrosion attack in low pH, high chloride oxidizing environments and had virtual immunity to chloride stress corrosion cracking. These properties allowed this alloy to serve the industrial needs for many years, although it had some limitations. The decades of the 1960's (alloy C-276), 1970's (alloy C-4), 1980's (alloy C-22 and 622) and 1990's (alloy 59, alloy 686 and alloy C-2000) saw newer alloy developments with improvements in corrosion resistance, which not only overcame the limitations of alloy C, but further expanded the horizons of applications as the needs of the CPI became more critical, severe and demanding. Today the originally alloy ''C'' of the 1930's is practically obsolete except for some usage in form of castings. This paper presents a chronology of the various corrosion resistant alloy developments during this century, with special emphasis on the last 70 years evolution in the ''C'' family of Ni-Cr-Mo alloys and their applications. (orig.)

  7. Development of plate-fin heat exchanger for intermediate heat exchanger of high-temperature gas cooled reactor. Fabrication process, high-temperature strength and creep-fatigue life prediction of plate-fin structure made of Hastelloy X

    International Nuclear Information System (INIS)

    Mizokami, Yorikata; Igari, Toshihide; Nakashima, Keiichi; Kawashima, Fumiko; Sakakibara, Noriyuki; Kishikawa, Ryouji; Tanihira, Masanori

    2010-01-01

    The helium/helium heat exchanger (i.e., intermediate heat exchanger: IHX) of a high-temperature gas-cooled reactor (HTGR) system with nuclear heat applications is installed between a primary system and a secondary system. IHX is operated at the highest temperature of 950degC and has a high capacity of up to 600 MWt. A plate-fin-type heat exchanger is the most suitable for IHX to improve construction cost. The purpose of this study is to develop an ultrafine plate-fin-type heat exchanger with a finer pitch fin than a conventional technology. In the first step, fabrication conditions of the ultrafine plate fin were optimized by press tests. In the second step, a brazing material was selected from several candidates through brazing tests of rods, and brazing conditions were optimized for plate-fin structures. In the third step, tensile strength, creep rupture, fatigue, and creep-fatigue tests were performed as typical strength tests for plate-fin structures. The obtained data were compared with those of the base metal and plate-fin element fabricated from SUS316. Finally, the accuracy of the creep-fatigue life prediction using both the linear cumulative damage rule and the equivalent homogeneous solid method was confirmed through the evaluation of creep-fatigue test results of plate-fin structures. (author)

  8. Hot corrosion behavior of Ni-Cr-W-C alloys in impure helium gas

    International Nuclear Information System (INIS)

    Ohmura, Taizo; Sahira, Kensho; Sakonooka, Akihiko; Yonezawa, Noboru

    1976-01-01

    Influence of the minor alloy constituents such as Al, Mn and Si on the hot corrosion behavior of Ni-20Cr-20W-0.07C alloy was studied in 99.995% helium gas at 1000 0 C, comparing with that behavior of commercial Ni-base superalloys (Hastelloy X and Inconel 617). The low oxidizing potential in the impure helium gas usually causes selective oxidation of these elements and the growth of oxide whiskers on the surface of specimen at elevated temperature. The intergranular attack was caused by selective oxidation of Al, Si and Mn. The spalling of oxide film was restrained by addition of Mn and Si, providing tough spinel type oxide film on the surface and 'Keyes' on the oxide-matrix interface respectively. The amount and the morphology of the oxide whiskers depended on Si and Mn content. More than 0.29% of Si content without Mn always caused the growth of rather thinner whiskers with smooth surface, and the whiskers analyzed by electron diffraction patterns and EPMA to be Cr 2 O 3 containing Si. Mn addition changed the whiskers to thicker ones of spinel type oxide (MnCr 2 O 1 ) with rough surface. On the basis of these results, the optimum content of Al, Mn and Si to minimize the growth of whiskers, the intergranular attack and the spalling of oxide film was discussed. (auth.)

  9. Hot corrosion behavior of Ni-Cr-W-C alloys in impure He gas

    International Nuclear Information System (INIS)

    Ohmura, Taizo; Sahira, Kensho; Sakonooka, Akihiko; Yonezawa, Noboru

    1977-01-01

    Influence of the minor alloy constituents such as Al, Mn and Si on the hot corrosion behavior of Ni-20Cr-20W-0.07C alloy was studied in 99.995%He gas at 1,000 0 C, in comparison with the behavior of commercial Ni-base superalloys (Hastelloy X and Inconel 617). The low oxidizing potential in the impure He gas usually causes selective oxidation of the elements described above and the growth of oxide whiskers on the surface of specimen at elevated temperatures. The intergranular attack was caused by selective oxidation of Al, Si and Mn. The spalling of oxide film was restrained by additions of Mn and Si, providing tough spinel type oxide film on the surface and 'keys' on the oxide-matrix interface respectively. The amount and morphology of the oxide whiskers depended on Si and Mn contents. Si of more than 0.29% without Mn always caused the growth of rather thinner whiskers with smooth surface, and the whiskers analyzed by electron diffraction patterns and EPMA to be Cr 2 O 3 containing Si. Mn addition changes the whiskers to thicker ones of spinel type oxide (MnCr 2 O 4 ) with rough surface. On the basis of these results, the optimum contents of Al, Mn and Si to minimize the growth of whiskers, the intergranular attack, and the spalling of oxide film were discussed. (auth.)

  10. Mechanical characterization of superalloys for space reactors

    International Nuclear Information System (INIS)

    Duchesne, J.

    1989-01-01

    The aim of this work is the selection of structural materials that can be used in the temperature range 600-900 0 C for a gas cooled space reactor producing electricity. Superalloys fit best the temperature range required. Five nickel base alloys are chosen for their good mechanical behaviour: HAYNES 230, HASTELLOY S, HASTELLOY X, HASTELLOY XR and PYRAD 38D. Metallography, tensile and hardness tests are realized. Sample contraction is evidenced for some creep tests, under low stress: 20MPa at 800 0 C, on HAYNES 230 and HASTELLOY X, probably related to the structural evolution of these materials corresponding to a decrease of the crystal parameter [fr

  11. C r C =

    Indian Academy of Sciences (India)

    Administrator

    C r. C. = CTPPY: concentration of TPPY; CAuNPs: concentration of Au NPs. The concentration of the Au NPs is calculated as follows: (1) The weight of Au (WAu) produced from the complete reduction of HAuCl4 is calculated by multiplying the mole of added HAuCl4 (weight of added. HAuCl4·4H2O divided by molecular ...

  12. Hepatite C Hepatitis C

    Directory of Open Access Journals (Sweden)

    Edna Strauss

    2001-02-01

    Full Text Available Estima-se que cerca de 3% da população mundial esteja infectada pelo vírus da hepatite C. Todos os que receberam transfusão de sangue ou seus componentes e os usuários de drogas podem estar infectados. Procedimentos odontológicos, médicos, tatuagem ou acupuntura também constituem fatores de risco. A infecção se cronifica em até 85% dos indivíduos, com evolução assintomática durante anos ou décadas e apresentação clínica variada. Para o diagnóstico, a determinação do anti-VHC revela-se muito sensível e a confirmação se faz pela determinação do RNA-VHC no sangue; o estadiamento da doença e a avaliação da atividade inflamatória pela biópsia hepática. O tratamento objetiva deter a progressão da doença hepática através da inibição da replicação viral. Devido à baixa eficácia terapêutica aliada a importantes efeitos colaterais do interferon e da ribavirina, esses medicamentos encontram indicações e contra-indicações específicas. Vários fatores preditivos de resposta ao tratamento, principalmente a carga viral e o genótipo do VHC, mostram-se úteis na avaliação dos pacientes.It has been estimated that 3% of the world population is infected with the hepatitis C virus. Those who are blood product recipients or have been illicit drug users are at risk. Dental and medical procedures as well as tattooing and acupuncture are also risk factors. Chronic infection occurs in up to 85% of infected cases but they may remain without symptoms during years or even decades, and clinical presentation varies. Determination of anti-HCV in sera is a fairly sensitive tool for the diagnosis, and confirmation requires the identification of HCV-RNA. Staging of the liver disease as well as definition of its present activity can be graded by liver biopsy. The aim of treatment is to stop the progression of the hepatic disease by inhibiting viral replication. Due to the low therapeutic efficacy combined with important side

  13. Beginning C

    CERN Document Server

    Horton, Ivor

    2013-01-01

    Beginning C, 5th Edition teaches you how to program using the widely-available C language. You'll begin from first-principles and progress through step-by-step examples to become a competent, C-language programmer. All you need are this book and any of the widely available free or commercial C or C++ compilers, and you'll soon be writing real C programs. C is a foundational language that every programmer ought to know. C is the basis for C# used in Microsoft .NET programming. It is the basis for Objective-C used in programming for the iPhone, the iPad, and other Apple devices. It is the basis

  14. C Borges

    Indian Academy of Sciences (India)

    C Borges. Articles written in Pramana – Journal of Physics. Volume 60 Issue 4 April 2003 pp 817-828. Study of deconfinement in NA50 · Paula bordalo M C Abreu B Alessandro C Alexa R Arnaldi M Atayan C Baglin A Baldit M Bedjidian S Beolé V Boldea Paula Bordalo S R Borenstein C Borges A Bussiére L Capelli C ...

  15. Vitamin C

    Science.gov (United States)

    ... body needs to grow and develop normally. Vitamin C is an antioxidant. It is important for your ... healing and helps the body absorb iron. Vitamin C comes from fruits and vegetables. Good sources include ...

  16. Hepatitis C

    Science.gov (United States)

    ... an inflammation of the liver. One type, hepatitis C, is caused by the hepatitis C virus (HCV). It usually spreads through contact with ... childbirth. Most people who are infected with hepatitis C don't have any symptoms for years. If ...

  17. Vitamin C

    Science.gov (United States)

    ... values to calculate your total daily recommended amount. What foods provide vitamin C? Fruits and vegetables are the ... lessen cooking losses. Fortunately, many of the best food sources of vitamin C, ... raw. What kinds of vitamin C dietary supplements are available? ...

  18. C Dutta

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C Dutta. Articles written in Bulletin of Materials Science. Volume 23 Issue 1 February 2000 pp 47-49 Composites. Role of work hardening characteristics of matrix alloys in the strengthening of metal matrix composites · K T Kashyap C Ramachandra C Dutta B Chatterji.

  19. Professional C++

    CERN Document Server

    Gregoire, Marc; Kleper, Scott J

    2011-01-01

    Essential reading for experienced developers who are determined to master the latest release of C++ Although C++ is often the language of choice from game programming to major commercial software applications, it is also one of the most difficult to master. With this no-nonsense book, you will learn to conquer the latest release of C++. The author deciphers little-known features of C++, shares detailed code examples that you can then plug into your own code, and reveals the significant changes to C++ that accompany the latest release. You'll discover how to design and build applications that

  20. Professional C++

    CERN Document Server

    Gregoire, Marc

    2014-01-01

    Master complex C++ programming with this helpful, in-depth resource From game programming to major commercial software applications, C++ is the language of choice. It is also one of the most difficult programming languages to master. While most competing books are geared toward beginners, Professional C++, Third Edition, shows experienced developers how to master the latest release of C++, explaining little known features with detailed code examples users can plug into their own codes. More advanced language features and programming techniques are presented in this newest edition of the book,

  1. C++ Cookbook

    CERN Document Server

    Stephens, D Ryan; Turkanis, Jonathan; Cogswell, Jeff

    2006-01-01

    Despite its highly adaptable and flexible nature, C++ is also one of the more complex programming languages to learn. Once mastered, however, it can help you organize and process information with amazing efficiency and quickness. The C++ Cookbook will make your path to mastery much shorter. This practical, problem-solving guide is ideal if you're an engineer, programmer, or researcher writing an application for one of the legions of platforms on which C++ runs. The algorithms provided in C++ Cookbook will jump-start your development by giving you some basic building blocks that you don't

  2. C Ghosh

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C Ghosh. Articles written in Bulletin of Materials Science. Volume 36 Issue 7 December 2013 pp 1323-1329. Structural characterization of electrodeposited boron · Ashish Jain C Ghosh T R Ravindran S Anthonysamy R Divakar E Mohandas G S Gupta · More Details Abstract ...

  3. C Shivakumara

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C Shivakumara. Articles written in Bulletin of Materials Science. Volume 29 Issue 4 August 2006 pp 339-345 Ceramics and Glasses. Solution-combustion synthesis of Bi1–LnO1.5 (Ln = Y and La–Yb) oxide ion conductors · Manjunath B Bellakki A S Prakash C Shivakumara ...

  4. C Ramakrishnan

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. C Ramakrishnan. Articles written in Resonance – Journal of Science Education. Volume 6 Issue 10 October 2001 pp 48-56 General Article. Ramachandran and his Map · C Ramakrishnan · More Details Fulltext PDF. Volume 13 Issue 1 January 2008 pp 89-98 ...

  5. C Balaji

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science. C Balaji. Articles written in Journal of Earth System Science. Volume 118 Issue 4 August 2009 pp 331-343. Polarized microwave forward model simulations for tropical storm Fanoos · C Balaji M Deiveegan S P Venkateshan R M Gairola A Sarkar V K Agarwal · More Details ...

  6. C Ramachandra

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C Ramachandra. Articles written in Bulletin of Materials Science. Volume 23 Issue 1 February 2000 pp 39-45 Metallic Materials. Role of diffusional coherency strain theory in the discontinuous precipitation in Mg–Al alloy · K T Kashyap C Ramachandra M Sujatha B Chatterji.

  7. C++ evolves!

    International Nuclear Information System (INIS)

    Naumann, Axel

    2014-01-01

    C++ is used throughout High Energy Physics. CERN participates in the development of its standard. There has been a major shift in standardization procedures that will be visible starting 2014 with an increase rate of new standardized features. Already the current C++11 has major improvements, also for coding novices, related to simplicity, expressiveness, performance and robustness. Other major improvements are in the area of concurrency, where C++ is now on par with most other high level languages. To benefit from these language improvements and from the massive improvements in compiler technology for instance in usability, access to current compilers is crucial. Use of current C++ compiled with current compilers can considerably improve C++ for the HEP physicist community.

  8. Why Y-c.c

    Czech Academy of Sciences Publication Activity Database

    Chodounský, David; Zapletal, Jindřich

    2015-01-01

    Roč. 166, č. 11 (2015), s. 1123-1149 ISSN 0168-0072 R&D Projects: GA ČR(CZ) GF15-34700L Institutional support: RVO:67985840 Keywords : c.c.c. partitions * proper forcing * forcing axiom Subject RIV: BA - General Mathematics Impact factor: 0.582, year: 2015 http://www.sciencedirect.com/science/article/pii/S0168007215000664

  9. Advanced C and C++ compiling

    CERN Document Server

    Stevanovic, Milan

    2014-01-01

    Learning how to write C/C++ code is only the first step. To be a serious programmer, you need to understand the structure and purpose of the binary files produced by the compiler: object files, static libraries, shared libraries, and, of course, executables.Advanced C and C++ Compiling explains the build process in detail and shows how to integrate code from other developers in the form of deployed libraries as well as how to resolve issues and potential mismatches between your own and external code trees.With the proliferation of open source, understanding these issues is increasingly the res

  10. Hall C

    Data.gov (United States)

    Federal Laboratory Consortium — Hall C's initial complement of equipment (shown in the figure), includes two general-purpose magnetic spectrometers. The High Momentum Spectrometer (HMS) has a large...

  11. Hepatitis C

    Science.gov (United States)

    ... viral load (the amount of HCV in your blood), imaging tests, and biopsy results. Treatment is especially important for people who are showing signs liver fibrosis or scarring. Medicines used to treat hepatitis C ...

  12. Hepatitis C

    Science.gov (United States)

    ... Workshops Follow Us Home Health Information Liver Disease Hepatitis (Viral) Hepatitis C Related Topics English English Español Section Navigation Hepatitis (Viral) What Is Viral Hepatitis? Hepatitis A Hepatitis B ...

  13. C Ranganathaiah

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C Ranganathaiah. Articles written in Bulletin of Materials Science. Volume 30 Issue 1 February 2007 pp 37-41 Catalysis. Photocatalytic degradation of indigo carmine dye using TiO2 impregnated activated carbon · A K Subramani K Byrappa S Ananda K M Lokanatha Rai C ...

  14. C, Adigwe

    African Journals Online (AJOL)

    C, Adigwe. Vol 30, No 1-2 (2015) - Articles Honey Attenuates the Detrimental Effects of Nicotine on Testicular Functions in Nicotine Treated Wistar Rats Abstract PDF. ISSN: 0794-859X. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's ...

  15. C Thangaraja

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences. C Thangaraja. Articles written in Journal of Chemical Sciences. Volume 116 Issue 4 June 2004 pp 209-213 Full Papers. A new Mannich base and its transition metal (II) complexes - Synthesis, structural characterization and electrochemical study · N Raman S Esthar C ...

  16. Practical C++ programming

    National Research Council Canada - National Science Library

    Oualline, Steve

    2003-01-01

    ... . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . xv Part I. The Basics 1. What Is C++? A Brief History of C++ C++ Organization How to Learn C++...

  17. Absorption of molten fluoride salts in glassy carbon, pyrographite and Hastelloy B

    Czech Academy of Sciences Publication Activity Database

    Vacík, Jiří; Naramoto, H.; Červená, Jarmila; Hnatowicz, Vladimír; Peka, I.; Fink, D.

    2001-01-01

    Roč. 289, č. 3 (2001), s. 308-314 ISSN 0022-3115 R&D Projects: GA ČR GA202/96/0077; GA ČR GV202/97/K038; GA AV ČR KSK1010104 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.366, year: 2001

  18. Fatigue performance of TBCs on Hastelloy X substrate during cyclic bending

    Czech Academy of Sciences Publication Activity Database

    Mušálek, Radek; Kovářík, O.; Tomek, L.; Medřický, Jan; Pala, Zdeněk; Haušild, P.; Čapek, J.; Kolařík, K.; Curry, N.; Bjorklund, S.

    2016-01-01

    Roč. 25, 1-2 (2016), s. 231-243 ISSN 1059-9630. [ITSC 2015: International Thermal Spray Conference and Exposition. Long Beach, California, 11.05.2015-14.05.2015] R&D Projects: GA ČR GB14-36566G Institutional support: RVO:61389021 Keywords : atmospheric plasma spray * failure mechanism * fatigue * HVAF * NiCoCrAlY * thermal barrier coatings * yttria-stabilized zirconia Subject RIV: JK - Corrosion ; Surface Treatment of Materials Impact factor: 1.488, year: 2016 http://link.springer.com/article/10.1007%2Fs11666-015-0321-4

  19. Correlation between the 12C+12C, 12C+13C, and 13C+13C fusion cross sections

    Science.gov (United States)

    Notani, M.; Esbensen, H.; Fang, X.; Bucher, B.; Davies, P.; Jiang, C. L.; Lamm, L.; Lin, C. J.; Ma, C.; Martin, E.; Rehm, K. E.; Tan, W. P.; Thomas, S.; Tang, X. D.; Brown, E.

    2012-01-01

    The fusion cross section for 12C+13C has been measured down to Ec.m.=2.6 MeV, at which the cross section is of the order of 20 nb. By comparing the cross sections for the three carbon isotope systems, 12C+12C, 12C+13C, and 13C+13C, it is found that the cross sections for 12C+13C and 13C+13C provide an upper limit for the fusion cross section of 12C+12C over a wide energy range. After calibrating the effective nuclear potential for 12C+12C using the 12C+13C and 13C+13C fusion cross sections, it is found that a coupled-channels calculation with the ingoing wave boundary condition (IWBC) is capable of predicting the major peak cross sections in 12C+12C. A qualitative explanation for this upper limit is provided by the Nogami-Imanishi model and by level density differences among the compound nuclei. It is found that the strong resonance found at 2.14 MeV in 12C+12C exceeds this upper limit by a factor of more than 20. The preliminary result from the most recent measurement shows a much smaller cross section at this energy, which agrees with our predicted upper limit.

  20. HfC plasma coating of C/C composites

    International Nuclear Information System (INIS)

    Boncoeur, M.; Schnedecker, G.; Lulewicz, J.D.

    1992-01-01

    The surface properties of C/C composites such as hardness and corrosion or erosion resistance can be modified by a ceramic coating applied by plasma torch. The technique of plasma spraying in controlled temperature and atmosphere, that was developed and patented by the CEA, makes it possible to apply coatings to the majority of metals and ceramics without affecting the characteristics of the composite. An example of hard deposit of HfC on a C/C composite is described. The characteristics of the deposit and of the bonding with the C/C composite were studied before and after a heat treatment under vacuum for 2 hours at 1000 C. 2 refs

  1. Excitation functions of the systems 12C+14C and 13C+12C

    International Nuclear Information System (INIS)

    Haindl, E.

    1975-01-01

    The excitation functions of the systems 12 C+ 14 C and 13 C+ 12 C are investigated for different exit channels. The excitation functions measured do not show correlated structures as in the system 12 C+ 12 C. (WL/AK) [de

  2. Accelerated C# 2010

    CERN Document Server

    Nash, Trey

    2010-01-01

    C# 2010 offers powerful new features, and this book is the fastest path to mastering them-and the rest of C#-for both experienced C# programmers moving to C# 2010 and programmers moving to C# from another object-oriented language. Many books introduce C#, but very few also explain how to use it optimally with the .NET Common Language Runtime (CLR). This book teaches both core C# language concepts and how to wisely employ C# idioms and object-oriented design patterns to exploit the power of C# and the CLR. This book is both a rapid tutorial and a permanent reference. You'll quickly master C# sy

  3. Phase diagrams for pseudo-binary carbide systems TiC-NbC, TiC-TaC, ZrC-NbC, ZrC-TaC and HfC-TaC

    International Nuclear Information System (INIS)

    Gusev, A.I.

    1985-01-01

    Parameters of interaction and energy of mutual exchange in the liquid and solid phases of pseudobinary TiC-NbC, TiC-TaC, ZrC-NbC, ZrC-TaC, HfC-TaC systems are calculated with account of dependence on composition and temperature. Positions of liquidus-solidus phase boundaries on the phase diagrams of the mentioned systems are calculated on the basis of the determined mutual exchange energies in approximati.on of subregular solutions. The existance of latent decomposition ranges in the solid phase on the phase diagrams of the investgated systems is established

  4. Facts about Vitamin C

    Science.gov (United States)

    ... milligrams of vitamin C every day. Three large strawberries provide 33 milligrams of vitamin C. Figure 1. ... and citrus fruit juices, sweet peppers, papayas, and strawberries. Table 2. Food sources of vitamin C. Food ...

  5. Travelers' Health: Hepatitis C

    Science.gov (United States)

    ... Chapter 3 - Hepatitis B Chapter 3 - Hepatitis E Hepatitis C Deborah Holtzman INFECTIOUS AGENT Hepatitis C virus ( ... mother to child. Map 3-05. Prevalence of hepatitis C virus infection 1 PDF Version (printable) 1 ...

  6. Hepatitis C: Treatment

    Science.gov (United States)

    ... Public Home » Hepatitis C » Hepatitis C Treatment Viral Hepatitis Menu Menu Viral Hepatitis Viral Hepatitis Home For ... Enter ZIP code here Enter ZIP code here Hepatitis C Treatment for Veterans and the Public Treatment ...

  7. Hemoglobin C disease

    Science.gov (United States)

    Clinical hemoglobin C ... Hemoglobin C is an abnormal type of hemoglobin, the protein in red blood cells that carries oxygen. It is ... Americans. You are more likely to have hemoglobin C disease if someone in your family has had ...

  8. Hepatitis C: Mental Health

    Science.gov (United States)

    ... the Public Home Hepatitis A Hepatitis B Hepatitis C Hepatitis C Home Getting Tested Just Diagnosed Treatment Choice Program ... Pain Mental Health Sex and Sexuality (for Hepatitis C) Success Stories FAQs For Health Care Providers Provider ...

  9. C. difficile Infection

    Science.gov (United States)

    ... Patients Home / Digestive Health Topic / C. Difficile Infection C. Difficile Infection Basics Overview Diarrhea is a frequent ... that change the normal colon bacteria allowing the C. difficile bacteria to grow and produce its toxins. ...

  10. Stool C difficile toxin

    Science.gov (United States)

    ... toxin; Colitis - toxin; Pseudomembranous - toxin; Necrotizing colitis - toxin; C difficile - toxin ... be analyzed. There are several ways to detect C difficile toxin in the stool sample. Enzyme immunoassay ( ...

  11. C anti c q anti q states

    Energy Technology Data Exchange (ETDEWEB)

    Chao, K T [Oxford Univ. (UK). Dept. of Theoretical Physics; Science Research Council, Chilton (UK). Rutherford and Appleton Labs.)

    1980-07-01

    Taking account of the colour magnetic and electric forces, we discuss the spectroscopy of various types of c anti c q anti q states. Their decay, hadronic production, production in e/sup +/e/sup -/ annihilation as well as photoproduction are also studied.

  12. C and C* among intermediate rings

    NARCIS (Netherlands)

    Sack, J.; Watson, S.

    2014-01-01

    Given a completely regular Hausdorff space X, an intermediate ring A(X) is a ring of real valued continuous functions between C*(X) and C(X). We discuss two correspondences between ideals in A(X) and z-filters on X, both reviewing old results and introducing new results. One correspondence, ZA,

  13. Seminario C++, parte 1

    OpenAIRE

    Cachero Castro, Cristina; Ponce de León Amador, Pedro José

    2007-01-01

    Este seminario trata sobre principios de orientación a objetos con C++. Para comprender mejor sus contenidos, se debe tener un conocimiento básico sobre programación estructurada con C++ o C. Clases en C++. Operaciones set/get/is. Tipo Referencia (&). El puntero 'this'. Los constructores. El destructor.

  14. C59N+ and C69N+: isoelectronic heteroanalogues of C60 and C70

    International Nuclear Information System (INIS)

    Lamparth, I.; Nuber, B.; Schick, G.; Skiebe, A.; Groesser, T.; Hirsch, A.

    1995-01-01

    Fragmentation reactions in the mass spectrometer were used to generate the first characterized nitrogen heterofullerene ions C 59 N + and C 69 N + from regioselectively synthesized oligoiminofullerenes. During this process one carbon atom in the fullerene core is removed and replaced with a nitrogen atom. C 59 N + has almost the same structure as the isoelectronic C 60 . (orig.)

  15. Operational Aspects of C/C++ Concurrency

    OpenAIRE

    Podkopaev, Anton; Sergey, Ilya; Nanevski, Aleksandar

    2016-01-01

    In this work, we present a family of operational semantics that gradually approximates the realistic program behaviors in the C/C++11 memory model. Each semantics in our framework is built by elaborating and combining two simple ingredients: viewfronts and operation buffers. Viewfronts allow us to express the spatial aspect of thread interaction, i.e., which values a thread can read, while operation buffers enable manipulation with the temporal execution aspect, i.e., determining the order in...

  16. Exploring C++ 11

    CERN Document Server

    Lischner, Ray

    2014-01-01

    Exploring C++ divides C++ up into bite-sized chunks that will help you learn the language one step at a time. Assuming no familiarity with C++, or any other C-based language, you'll be taught everything you need to know in a logical progression of small lessons that you can work through as quickly or as slowly as you need.C++ can be a complicated language. Writing even the most straight-forward of programs requires you to understand many disparate aspects of the language and how they interact with one another. C++ doesn't lend itself to neat compartmentalization the way other languages do. Rat

  17. Practical C++ Programming

    CERN Document Server

    Oualline, Steve

    2003-01-01

    C++ is a powerful, highly flexible, and adaptable programming language that allows software engineers to organize and process information quickly and effectively. But this high-level language is relatively difficult to master, even if you already know the C programming language. The 2nd edition of Practical C++ Programming is a complete introduction to the C++ language for programmers who are learning C++. Reflecting the latest changes to the C++ standard, this 2nd edition takes a useful down-to-earth approach, placing a strong emphasis on how to design clean, elegant code. In short, to-th

  18. Objective-C

    CERN Document Server

    DeVoe, Jiva

    2011-01-01

    A soup-to-nuts guide on the Objective-C programming language. Objective-C is the language behind Cocoa and Cocoa Touch, which is the Framework of applications written for the Macintosh, iPod touch, iPhone, and iPad platforms. Part of the Developer Reference series covering the hottest Apple topics, this book covers everything from the basics of the C language to advanced aspects of Apple development. You'll examine Objective-C and high-level subjects of frameworks, threading, networking, and much more.: Covers the basics of the C language and then quickly moves onto Objective-C and more advanc

  19. C++ Programming Language

    Science.gov (United States)

    Shaykhian, Gholam Ali

    2007-01-01

    C++ Programming Language: The C++ seminar covers the fundamentals of C++ programming language. The C++ fundamentals are grouped into three parts where each part includes both concept and programming examples aimed at for hands-on practice. The first part covers the functional aspect of C++ programming language with emphasis on function parameters and efficient memory utilization. The second part covers the essential framework of C++ programming language, the object-oriented aspects. Information necessary to evaluate various features of object-oriented programming; including encapsulation, polymorphism and inheritance will be discussed. The last part of the seminar covers template and generic programming. Examples include both user defined and standard templates.

  20. C++ for dummies

    CERN Document Server

    Davis , Stephen R

    2014-01-01

    The best-selling C++ For Dummies book makes C++ easier! C++ For Dummies, 7th Edition is the best-selling C++ guide on the market, fully revised for the 2014 update. With over 60% new content, this updated guide reflects the new standards, and includes a new Big Data focus that highlights the use of C++ among popular Big Data software solutions. The book provides step-by-step instruction from the ground up, helping beginners become programmers and allowing intermediate programmers to sharpen their skills. The companion website provides all code mentioned in the text, an updated GNU_C++, the new

  1. Hepatitis C and Incarceration

    Science.gov (United States)

    ... Hepatitis Cdo to take care of their liver? People with Hepatitis C should not use alcohol or street drugs, as these can hurt the liver. Some other products can also hurt people with Hepatitis C, even if they appear to ...

  2. Cryptococcosis (C. neoformans)

    Science.gov (United States)

    ... Foodborne, Waterborne, and Environmental Diseases Mycotic Diseases Branch C. neoformans Infection Recommend on Facebook Tweet Share Compartir ... throughout the world. People can become infected with C. neoformans after breathing in the microscopic fungus, although ...

  3. Hepatitis C: Clinical Trials

    Science.gov (United States)

    ... and Public Home » Hepatitis C » Treatment Decisions Viral Hepatitis Menu Menu Viral Hepatitis Viral Hepatitis Home For ... can I find out about participating in a hepatitis C clinical trial? Many trials are being conducted ...

  4. Hepatitis C: Managing Pain

    Science.gov (United States)

    ... Pain: Entire Lesson Viral Hepatitis Menu Menu Viral Hepatitis Viral Hepatitis Home For Veterans and the Public Veterans and the Public Home Hepatitis A Hepatitis B Hepatitis C Hepatitis C Home Getting ...

  5. Cryptococcosis (C. gattii)

    Science.gov (United States)

    ... Foodborne, Waterborne, and Environmental Diseases Mycotic Diseases Branch C. gattii Infection Recommend on Facebook Tweet Share Compartir ... as British Columbia and the U.S. Pacific Northwest. C. gattii cryptococcosis is a rare infection that people ...

  6. S-C Mylonites

    NARCIS (Netherlands)

    Lister, G.S.; Snoke, A.W.

    1984-01-01

    Two types of foliations are commonly developed in mylonites and mylonitic rocks: (a) S-surfaces related to the accumulation of finite strain and (b) C-surfaces related to displacement discontinuities or zones of relatively high shear strain. There are two types of S-C mylonites. Type I S-C

  7. K C Bhamu

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. K C BHAMU. Articles written in Pramana – Journal of Physics. Volume 89 Issue 1 July 2017 pp 11 Research Article. Density functional study of A g S c O 2 : Electronic and optical properties · K C BHAMU JAGRATI SAHARIYA RISHI VYAS K R PRIOLKAR · More Details ...

  8. K C Sajjan

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. K C Sajjan. Articles written in Bulletin of Materials Science. Volume 34 Issue 7 December 2011 pp 1557-1561. Synthesis, characterization and magnetic properties of polyaniline/-Fe2O3 composites · Syed Khasim S C Raghavendra M Revanasiddappa K C Sajjan Mohana ...

  9. C P Gopalakrishnan

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. C P Gopalakrishnan. Articles written in Resonance – Journal of Science Education. Volume 9 Issue 6 June 2004 pp 74-85 Classroom. The Real Effects of Pseudo Forces · P Chaitanya Das G Srinivasa Murthy C P Gopalakrishnan P C Deshmukh · More Details ...

  10. c p chaudhari

    Indian Academy of Sciences (India)

    C P CHAUDHARI. Articles written in Bulletin of Materials Science. Volume 41 Issue 1 February 2018 pp 24. A logical explanation of structurally unfit X-ray diffraction peaks in nanoferroelectrics · C M DUDHE B K SAKHARE S S PANCHBHAI S J KHAMBADKAR N V DHOKE C P CHAUDHARI U A PALIKUNDWAR.

  11. C P Anil Kumar

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science. C P Anil Kumar. Articles written in Journal of Earth System Science. Volume 124 Issue 8 December 2015 pp 1721-1733. Variation of surface electric field during geomagnetic disturbed period at Maitri, Antarctica · N Jeni Victor C Panneerselvam C P Anil Kumar.

  12. Total Synthesis of Zoanthamine Alkaloids, Part 2. Construction of the C1-C5, C6-C10 and C11-C24 Fragments of Zoanthamine

    DEFF Research Database (Denmark)

    Tanner, David Ackland; Tedenborg, Lars; Somfai, Peter

    1997-01-01

    This paper describes the construction of three key intermediates for a projected total synthesis of the marine alkaloid zoanthamine. These building blocks, corresponding to the C1-C5, C6-C10 and C11-C24 fragments of the target molecule, are synthesised efficiently form (R)-hydroxymethyl-butyrolac......This paper describes the construction of three key intermediates for a projected total synthesis of the marine alkaloid zoanthamine. These building blocks, corresponding to the C1-C5, C6-C10 and C11-C24 fragments of the target molecule, are synthesised efficiently form (R...

  13. Head first C#

    CERN Document Server

    Stellman, Andrew

    2008-01-01

    Head First C# is a complete learning experience for object-oriented programming, C#, and the Visual Studio IDE. Built for your brain, this book covers C# 3.0 and Visual Studio 2008, and teaches everything from language fundamentals to advanced topics including garbage collection, extension methods, and double-buffered animation. You'll also master C#'s hottest and newest syntax, LINQ, for querying SQL databases, .NET collections, and XML documents. By the time you're through, you'll be a proficient C# programmer, designing and coding large-scale applications. Every few chapters you will come

  14. TMS320C31

    International Nuclear Information System (INIS)

    Park, Gwi Tae; Lee, Sang Rak

    1998-01-01

    This book is divided into four parts, which introduces TMS320C31 with C language. The first part deals with digital signal processor on what is DPS?, types of DPS and structure of TMS320C31. The second part introduces program development by C language, cstartup cord and C compiler. The third part describes OS30, Emile 30 and BIOS. The last part is for application board design of T31 and test examples of T31 board : external flag test, ram test, external read port test and communication test.

  15. Using C-Kermit

    CERN Document Server

    da Cruz, Frank

    2014-01-01

    An introduction and tutorial as well as a comprehensive reference Using C-Kermit describes the new release, 5A, of Columbia University's popular C-Kermit communication software - the most portable of all communication software packages. Available at low cost on a variety of magnetic media from Columbia University,C-Kermit can be used on computers of all sizes - ranging from desktop workstations to minicomputers to mainframes and supercomputers. The numerous examples, illustrations, and tables in Using C-Kermit make the powerful and versatile C-Kermit functionsaccessible for new and experienced

  16. Detecting C Program Vulnerabilities

    OpenAIRE

    Anton, Ermakov; Natalia, Kushik

    2011-01-01

    C/C++ language is widely used for developing tools in various applications, in particular, software tools for critical systems are often written in C language. Therefore, the security of such software should be thoroughly tested, i.e., the absence of vulnerabilities has to be confirmed. When detecting C program vulnerabilities static source code analysis can be used. In this paper, we present a short survey of existing software tools for such analysis and show that for some kinds of C code vu...

  17. Vitamin C and Infections.

    Science.gov (United States)

    Hemilä, Harri

    2017-03-29

    In the early literature, vitamin C deficiency was associated with pneumonia. After its identification, a number of studies investigated the effects of vitamin C on diverse infections. A total of 148 animal studies indicated that vitamin C may alleviate or prevent infections caused by bacteria, viruses, and protozoa. The most extensively studied human infection is the common cold. Vitamin C administration does not decrease the average incidence of colds in the general population, yet it halved the number of colds in physically active people. Regularly administered vitamin C has shortened the duration of colds, indicating a biological effect. However, the role of vitamin C in common cold treatment is unclear. Two controlled trials found a statistically significant dose-response, for the duration of common cold symptoms, with up to 6-8 g/day of vitamin C. Thus, the negative findings of some therapeutic common cold studies might be explained by the low doses of 3-4 g/day of vitamin C. Three controlled trials found that vitamin C prevented pneumonia. Two controlled trials found a treatment benefit of vitamin C for pneumonia patients. One controlled trial reported treatment benefits for tetanus patients. The effects of vitamin C against infections should be investigated further.

  18. Vitamin C and Infections

    Directory of Open Access Journals (Sweden)

    Harri Hemilä

    2017-03-01

    Full Text Available In the early literature, vitamin C deficiency was associated with pneumonia. After its identification, a number of studies investigated the effects of vitamin C on diverse infections. A total of 148 animal studies indicated that vitamin C may alleviate or prevent infections caused by bacteria, viruses, and protozoa. The most extensively studied human infection is the common cold. Vitamin C administration does not decrease the average incidence of colds in the general population, yet it halved the number of colds in physically active people. Regularly administered vitamin C has shortened the duration of colds, indicating a biological effect. However, the role of vitamin C in common cold treatment is unclear. Two controlled trials found a statistically significant dose–response, for the duration of common cold symptoms, with up to 6–8 g/day of vitamin C. Thus, the negative findings of some therapeutic common cold studies might be explained by the low doses of 3–4 g/day of vitamin C. Three controlled trials found that vitamin C prevented pneumonia. Two controlled trials found a treatment benefit of vitamin C for pneumonia patients. One controlled trial reported treatment benefits for tetanus patients. The effects of vitamin C against infections should be investigated further.

  19. A life evaluation under creep-fatigue-environment interaction of Ni-base wrought alloys

    International Nuclear Information System (INIS)

    Hattori, Hiroshi; Kitagawa, Masaki; Ohtomo, Akira; Itoh, Mitsuyoshi

    1986-01-01

    In order to determine a failure criteria under cyclic loading and affective environment for HTGR systems, a series of strain controlled low-cycle fatigue tests were carried out at HTGR maximum gas temperatures in air, in vacuum and in HTGR helium environments on two nickel-base wrought alloys, namely Inconel 617 and Hastelloy XR. This paper first describes the creep-fatigue-environment properties of these alloys followed by a proposal of an evaluation method of creep-fatigue-environment interaction based on the experimental data to define the more reasonable design criteria, which is a modification of the linear damage summation rule. Second, the creep-fatigue properties of Hastelloy XR at 900 deg C and the result evaluated by this proposed method are shown. This criterion is successfully applied to the life prediction at 900 deg C. In addition, the creep-fatigue properties of Hastelloy XR-II are discussed. (author)

  20. Mechanical characterization of metallic materials for high-temperature gas-cooled reactors in air and in helium environments

    International Nuclear Information System (INIS)

    Sainfort, G.; Cappelaere, M.; Gregoire, J.; Sannier, J.

    1984-01-01

    In the French R and D program for high-temperature gas-cooled reactors (HTGRs), three metallic alloys were studied: steel Chromesco-3 with 2.25% chromium, alloy 800H, and Hastelloy-X. The Chromesco-3 and alloy 800H creep behavior is the same in air and in HTGR atmosphere (helium). The tensile tests of Hastelloy-X specimens reveal that aging has embrittlement and hardening effects up to 700 0 C, but the creep tests at 800 0 C show opposite effects. This particular behavior could be due to induced precipitation by aging and the depletion of hardening elements from the matrix. Tests show a low influence of cobalt content on mechanical properties of Hastelloy-X

  1. Total Synthesis of Zoanthamine Alkaloids, Part 2. Construction of the C1-C5, C6-C10 and C11-C24 Fragments of Zoanthamine

    DEFF Research Database (Denmark)

    Tanner, David Ackland; Tedenborg, Lars; Somfai, Peter

    1997-01-01

    This paper describes the construction of three key intermediates for a projected total synthesis of the marine alkaloid zoanthamine. These building blocks, corresponding to the C1-C5, C6-C10 and C11-C24 fragments of the target molecule, are synthesised efficiently form (R...

  2. Parylene C Aging Studies.

    Energy Technology Data Exchange (ETDEWEB)

    Achyuthan, Komandoor; Sawyer, Patricia Sue.; Mata, Guillermo Adrian; White II, Gregory Von; Bernstein, Robert

    2014-09-01

    Parylene C is used in a device because of its conformable deposition and other advantages. Techniques to study Parylene C aging were developed, and "lessons learned" that could be utilized for future studies are the result of this initial study. Differential Scanning Calorimetry yielded temperature ranges for Parylene C aging as well as post-deposition treatment. Post-deposition techniques are suggested to improve Parylene C performance. Sample preparation was critical to aging regimen. Short-term (%7E40 days) aging experiments with free standing and ceramic-supported Parylene C films highlighted "lessons learned" which stressed further investigations in order to refine sample preparation (film thickness, single sided uniform coating, machine versus laser cutting, annealing time, temperature) and testing issues ("necking") for robust accelerated aging of Parylene C.

  3. Hemoglobin C, S-C, and E Diseases

    Science.gov (United States)

    ... quickly than others, resulting in chronic anemia. Hemoglobin C disease Hemoglobin C disease occurs mostly in blacks. ... a common complication of hemoglobin C disease. Hemoglobin S-C disease Hemoglobin S-C disease occurs in people who ...

  4. Scurvy and Vitamin C

    OpenAIRE

    Mayberry, Jason A.

    2004-01-01

    This paper outlines the history of scurvy and vitamin C. The first section of the paper outlines the science of vitamin C. The second discusses outlines the medical progression of vitamin C deficiency and scurvy. The third section gives a brief timeline of scurvy throughout human history. The fourth section discusses the conditions during the age of sail that combined to make scurvy the greatest killer of sailors. The final section follows the scientific drive to find a cure and eventual elim...

  5. Linear ketenimines. Variable structures of C,C-dicyanoketenimines and C,C-bis-sulfonylketenimines.

    Science.gov (United States)

    Finnerty, Justin; Mitschke, Ullrich; Wentrup, Curt

    2002-02-22

    C,C-dicyanoketenimines 10a-c were generated by flash vacuum thermolysis of ketene N,S-acetals 9a-c or by thermal or photochemical decomposition of alpha-azido-beta-cyanocinnamonitrile 11. In the latter reaction, 3,3-dicyano-2-phenyl-1-azirine 12 is also formed. IR spectroscopy of the keteniminines isolated in Ar matrixes or as neat films, NMR spectroscopy of 10c, and theoretical calculations (B3LYP/6-31G) demonstrate that these ketenimines have variable geometry, being essentially linear along the CCN-R framework in polar media (neat films and solution), but in the gas phase or Ar matrix they are bent, as is usual for ketenimines. Experiments and calculations agree that a single CN substituent as in 13 is not enough to enforce linearity, and sulfonyl groups are less effective that cyano groups in causing linearity. C,C-bis(methylsulfonyl)ketenimines 4-5 and a C-cyano-C-(methylsulfonyl)ketenimine 15 are not linear. The compound p-O2NC6H4N=C=C(COOMe)2 previously reported in the literature is probably somewhat linearized along the CCNR moiety. A computational survey (B3LYP/6-31G) of the inversion barrier at nitrogen indicates that electronegative C-substituents dramatically lower the barrier; this is also true of N-acyl substituents. Increasing polarity causes lower barriers. Although N-alkylbis(methylsulfonyl)ketenimines are not calculated to be linear, the barriers are so low that crystal lattice forces can induce planarity in N-methylbis(methylsulfonyl)ketenimine 3.

  6. Seminario C++, parte 3

    OpenAIRE

    Cachero Castro, Cristina; Ponce de León Amador, Pedro José

    2007-01-01

    Este seminario trata sobre principios de orientación a objetos con C++. Para comprender mejor sus contenidos, se debe tener un conocimiento básico sobre programación estructurada con C++ o C. Funciones amigas. Entrada / Salida. Sobrecarga de funciones y operadores. Gestión de memoria dinámica. Atributos y métodos de clase. Implementación de relaciones entre objetos.

  7. Seminario C++, parte 2

    OpenAIRE

    Cachero Castro, Cristina; Ponce de León Amador, Pedro José

    2007-01-01

    Este seminario trata sobre principios de orientación a objetos con C++. Para comprender mejor sus contenidos, se debe tener un conocimiento básico sobre programación estructurada con C++ o C. El compilador g++. Directivas de compilación. Make. Doxygen. Utilidad de compresión 'tar'. Introducción a UML. Ejercicio práctico.

  8. Seminario C++, parte 4

    OpenAIRE

    Cachero Castro, Cristina; Ponce de León Amador, Pedro José

    2007-01-01

    Este seminario trata sobre principios de orientación a objetos con C++. Para comprender mejor sus contenidos, se debe tener un conocimiento básico sobre programación estructurada con C++ o C. Herencia simple. El destructor abstracto. Patrón de diseño singleton. Tipos enumerados. Declaraciones forward. Conversión entre objetos (upcasting/downcasting).

  9. C# Database Basics

    CERN Document Server

    Schmalz, Michael

    2012-01-01

    Working with data and databases in C# certainly can be daunting if you're coming from VB6, VBA, or Access. With this hands-on guide, you'll shorten the learning curve considerably as you master accessing, adding, updating, and deleting data with C#-basic skills you need if you intend to program with this language. No previous knowledge of C# is necessary. By following the examples in this book, you'll learn how to tackle several database tasks in C#, such as working with SQL Server, building data entry forms, and using data in a web service. The book's code samples will help you get started

  10. Programming C# 40

    CERN Document Server

    Griffiths, Ian; Liberty, Jesse

    2010-01-01

    With its support for dynamic programming, C# 4.0 continues to evolve as a versatile language on its own. But when C# is used with .NET Framework 4, the combination is incredibly powerful. This bestselling tutorial shows you how to build web, desktop, and rich Internet applications using C# 4.0 with .NET's database capabilities, UI framework (WPF), extensive communication services (WCF), and more. In this sixth edition, .NET experts Ian Griffiths, Matthew Adams, and Jesse Liberty cover the latest enhancements to C#, as well as the fundamentals of both the language and framework. You'll learn

  11. C++ for dummies

    CERN Document Server

    Davis, Stephen Randy

    2009-01-01

    Enter the world of computer programming with this step-by-step guide to the C++ language! C++ is a great introduction to object-oriented programming, and this friendly guide covers everything you need to know and nothing you don't. You'll write your first program by the end of Chapter 1. C++ For Dummies, 6th Edition, helps you understand C++ programming from the ground up. It's full of examples to show you how things work, and it even explains "why", so you understand how the pieces fit together. And the bonus CD includes a special code editor, an update GNU compiler, and all source code from

  12. General Corrosion studies of a Titanium and Incoloy based alloys under ammoniacal medium and at 290 deg. C

    International Nuclear Information System (INIS)

    Gokhale, B.K.; Keny, S.J.; Kumbhar, A.G.; Rangarajan, S.; Bera, S.; Nuwad Jitendra; Kumar, Sanjukta A.; Wagh, D. N.; Pradhan, S.

    2012-09-01

    For their use in future PWR applications, the general corrosion behaviors of two modified alloys of titanium and Incoloy were studied at high temperature and high pressure (290 deg. C, 7400 Kpa) under ammoniated atmosphere and compared. Coupons were exposed to solutions of varying ammonia concentrations of (10, 50 and 100 ppm ) at 290 deg. C under non-deaerated conditions in a static autoclave for 20 days. Surface characteristics of exposed coupons were studied using XRF, SEM, EDAX and XPS. The solution in the autoclave was analyzed for its specific conductivity, pH and for the elemental concentrations leached from alloy. The exposed titanium based alloy showed deposition of white crystalline material (300-1000 nm size) on the surface. Depletion of Ti and increase in the oxygen concentration on the exposed surface was observed. This indicated dissolution of Ti in solution from surface at high temperature and pressure and its reaction with oxygen in solution to form oxide and its redeposition on surface. The oxide film compositions were found to change drastically between 10 and 50 ppm ammoniated solution. Ti was found to be enriched in the oxide film when the solution contained 50 ppm of ammonia whereas the opposite effect was observed at 10 ppm of ammonia. The presence Ti 4+ in oxide environment and traces of Cr 3+ were observed but no nitrogen or Zr was detected. Specific conductivity of the exposed solution was found to increase by 30 μS/cm and pH to decrease by 1.5 units. Slight leaching of Ti was observed in solution. No Zr was found in the leached solution. Presence of other elements like Al, Cr, Ni in the exposed solution indicated leaching of autoclave construction material (hastelloy). This alloy showed good resistance for corrosion under the experimental conditions. The exposed surface of Incoloy based alloy showed Ni, Cr, Cu and Mn on the surface with deposition of crystalline particles (200-300 nm size). The exposed surface also showed a decrease in Cr

  13. High temperature oxidation of carbide-carbon materials of NbC-C, NbC-TiC-C systems

    International Nuclear Information System (INIS)

    Afonin, Yu.D.; Shalaginov, V.N.; Beketov, A.R.

    1981-01-01

    The effect of titanium carbide additions on the oxidation of carbide - carbon composition NbC-TiC-C in oxygen under the pressure of 10 mm Hg and in the air at atmospheric pressure in the temperature range 800-1300 deg is studied. It is shown that the region of negative temperature coefficient during oxidation in the system NbC+C is determined by the processes of sintering and polymorphous transformation. The specific character of the oxide film, formed during oxidation of Nbsub(x)Tisub(y)C+C composites is connected with non-equilibrium nature of carbide grain in its composition. Carbon gasification takes place with the formation of carbon dioxide. Composite materials, containing titanium carbide in complex carbide up to 50-83 mol. %, are the most corrosion resisting ones [ru

  14. L C S Murthy

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. L C S Murthy. Articles written in Bulletin of Materials Science. Volume 27 Issue 3 June 2004 pp 295-301 Thin Films. Studies on tin oxide films prepared by electron beam evaporation and spray pyrolysis methods · K S Shamala L C S Murthy K Narasimha Rao · More Details ...

  15. C M Dudhe

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C M Dudhe. Articles written in Bulletin of Materials Science. Volume 38 Issue 5 September 2015 pp 1423-1427. Nucleation and evaporation of domains due to electric field at room temperature in BaTiO3 single crystals · C M Dudhe P R Arjunwadkar · More Details Abstract ...

  16. Curiosities at c=24

    International Nuclear Information System (INIS)

    Schellekens, A.N.; Yankielowicz, S.

    1989-01-01

    Two examples of c=24 holomorphic conformal field theories are given that do not correspond to Niemeier lattices or Z 2 twists of Niemeier lattices. One of these examples clarifies a recently discovered modular invariant of F 4 at level 6, which can be interpreted as the 'complement' of SU(3) level 2 within a new c=24 theory. (orig.)

  17. C M K Nair

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C M K Nair. Articles written in Bulletin of Materials Science. Volume 24 Issue 2 April 2001 pp 249-252 Crystal Growth. Thermal behaviour of strontium tartrate single crystals grown in gel · M H Rahimkutty K Rajendra Babu K Sreedharan Pillai M R Sudarsana Kumar C M K Nair.

  18. S C Raghavendra

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. S C Raghavendra. Articles written in Bulletin of Materials Science. Volume 25 Issue 1 February 2002 pp 37-39 Electrical Properties. Dielectric properties of fly ash · S C Raghavendra R L Raibagkar A B Kulkarni · More Details Abstract Fulltext PDF. This paper reports the ...

  19. Weak C* Hopf Symmetry

    OpenAIRE

    Rehren, K. -H.

    1996-01-01

    Weak C* Hopf algebras can act as global symmetries in low-dimensional quantum field theories, when braid group statistics prevents group symmetries. Possibilities to construct field algebras with weak C* Hopf symmetry from a given theory of local observables are discussed.

  20. K C Manorama Thampatti

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. K C Manorama Thampatti. Articles written in Resonance – Journal of Science Education. Volume 4 Issue 3 March 1999 pp 62-70 Feature Article. Nature Watch - Rice Bowl in Turmoil: The Kuttanad Wetland Ecosystem · K C Manorama Thampatti K G Padmakumar.

  1. Learning Boost C++ libraries

    CERN Document Server

    Mukherjee, Arindam

    2015-01-01

    If you are a C++ programmer who has never used Boost libraries before, this book will get you up-to-speed with using them. Whether you are developing new C++ software or maintaining existing code written using Boost libraries, this hands-on introduction will help you decide on the right library and techniques to solve your practical programming problems.

  2. Shekhar C Mande

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Shekhar C Mande. Articles written in Resonance – Journal of Science Education. Volume 22 Issue 9 September 2017 pp 829-833 General Article. Nobel Prize in Physiology or Medicine 2016 · Shekhar C Mande Jyoti Rao · More Details Abstract Fulltext PDF.

  3. Hepatitis C Test

    Science.gov (United States)

    ... and Prevention. Recommendations for the Identification of Chronic Hepatitis C Virus Infection Among Persons Born During 1945–1965. Prepared by ... Disease Control and Prevention. Vital Signs: Evaluation of Hepatitis C Virus Infection Testing and Reporting — Eight U.S. Sites, 2005–2011. ...

  4. Dhruv C Hoysall

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Dhruv C Hoysall. Articles written in Resonance – Journal of Science Education. Volume 13 Issue 4 April 2008 pp 378-393 Classroom. Spinning Ball Flight Under Moderate Wind · K R Y Simha Dhruv C Hoysall · More Details Fulltext PDF ...

  5. P. C. Agrawal

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy. P. C. Agrawal. Articles written in Journal of Astrophysics and Astronomy. Volume 21 Issue 1-2 June 2000 pp 29-38. X-ray Observation of XTE J2012+381 during the 1998 Outburst · S. Naik P. C. Agrawal B. Paul A. R. Rao S. Seetha Κ. Kasturirangan · More Details ...

  6. C Sacerdoti Coen

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. C Sacerdoti Coen. Articles written in Sadhana. Volume 34 Issue 1 February 2009 pp 71-144. A compact kernel for the calculus of inductive constructions · A Asperti W Ricciotti C Sacerdoti Coen E Tassi · More Details Abstract Fulltext PDF. The paper describes the new kernel for the Calculus of ...

  7. C-TOOL

    DEFF Research Database (Denmark)

    Taghizadeh-Toosi, Arezoo; Christensen, Bent Tolstrup; Hutchings, Nicholas John

    2014-01-01

    Soil organic carbon (SOC) is a significant component of the global carbon (C) cycle. Changes in SOC storage affect atmospheric CO2 concentrations on decadal to centennial timescales. The C-TOOL model was developed to simulate farm- and regional-scale effects of management on medium- to long...

  8. C S Smith

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. C S Smith. Articles written in Resonance – Journal of Science Education. Volume 11 Issue 6 June 2006 pp 79-93 Classics. Excerpts from A Search for Structure · C S Smith · More Details Fulltext PDF ...

  9. C K Maiti

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C K Maiti. Articles written in Bulletin of Materials Science. Volume 24 Issue 6 December 2001 pp 579-582 Thin Films. Metallo–organic compound-based plasma enhanced CVD of ZrO2 films for microelectronic applications · S Chatterjee S K Samanta H D Banerjee C K Maiti.

  10. VC@C

    Indian Academy of Sciences (India)

    2012-03-09

    Mar 9, 2012 ... A novel approach to the fabrication of vanadium carbide encapsulated into carbon nanotube (VC@C) core-shell .... mixed solution was transferred into a 600 mL stainless steel autoclave after the solution became suspension. An auto- clave was sealed and maintained at 180. ◦. C for 48 h and then cooled to ...

  11. C S Sanmathi

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C S Sanmathi. Articles written in Bulletin of Materials Science. Volume 27 Issue 3 June 2004 pp 243-249 Polymers. Terpolymerization of 2-ethoxy ethylmethacrylate, styrene and maleic anhydride: determination of the reactivity ratios · C S Sanmathi S Prasannakumar B S ...

  12. V C Petwal

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. V C Petwal. Articles written in Pramana – Journal of Physics. Volume 68 Issue 2 February 2007 pp 235-241. Optimization studies of photo-neutron production in high- metallic targets using high energy electron beam for ADS and transmutation · V C Petwal V K Senecha K V ...

  13. C V R Murty

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. C V R Murty. Articles written in Resonance – Journal of Science Education. Volume 9 Issue 8 August 2004 pp 75-78 Classroom. Learning Earthquake Design and Construction – 1. What causes Earthquakes? C V R Murty · More Details Fulltext PDF. Volume 9 ...

  14. k c mistri

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. K C MISTRI. Articles written in Sadhana. Volume 42 Issue 9 September 2017 pp 1459-1471. Influence of yielding base and rigid base on propagation of Rayleigh-type wave in a viscoelastic layer of Voigt type · S SAHA A CHATTOPADHYAY K C MISTRI A K SINGH · More Details Abstract Fulltext ...

  15. K C Mittal

    Indian Academy of Sciences (India)

    K C Mittal. Articles written in Sadhana. Volume 30 Issue 6 December 2005 pp 757-764. Development of a 300-kV Marx generator and its application to drive a relativistic electron beam · Y Choyal Lalit Gupta Preeti Vyas Prasad Deshpande Anamika Chaturvedi K C Mittal K P Maheshwari · More Details Abstract Fulltext PDF.

  16. K C Kumara Swamy

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. K C Kumara Swamy. Articles written in Resonance – Journal of Science Education. Volume 11 Issue 9 September 2006 pp 72-75 Feature Article. Molecule Matters - A Chromium Compound with a Quintuple Bond · K C Kumara Swamy · More Details Fulltext PDF ...

  17. K C Patil

    Indian Academy of Sciences (India)

    K C Patil. Articles written in Resonance – Journal of Science Education. Volume 9 Issue 7 July 2004 pp 92-92 Book Review. Inorganic Chemistry · K C Patil · More Details Fulltext PDF. Volume 20 Issue 5 May 2015 pp 431-444 General Article. High Energy Materials: A Brief History and Chemistry of Fireworks and Rocketry.

  18. K C Deshmukh

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. K C Deshmukh. Articles written in Sadhana. Volume 30 Issue 4 August 2005 pp 555-563. Thermal deformation in a thin circular plate due to a partially distributed heat supply · N L Khobragade K C Deshmukh · More Details Abstract Fulltext PDF. In this paper, we develop an integral transform to ...

  19. K C Mittal

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. K C Mittal. Articles written in Pramana – Journal of Physics. Volume 71 Issue 6 December 2008 pp 1279-1289 Research Articles. RF properties of 700 MHz, = 0.42 elliptical cavity for high current proton acceleration · Amitava Roy J Mondal K C Mittal · More Details Abstract ...

  20. C P Vinod

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C P Vinod. Articles written in Bulletin of Materials Science. Volume 25 Issue 3 June 2002 pp 247-249 Experimental Techniques. A method employing STM for the estimation of relative changes in the work function of modified metal tips · R B Sharma C P Vinod G U Kulkarni.

  1. Stop C. difficile Infections

    Centers for Disease Control (CDC) Podcasts

    This podcast is based on the March 2012 CDC Vital Signs report. C. difficile is a germ that causes diarrhea linked to 14,000 deaths in the US each year. This podcast helps health care professionals learn how to prevent C. difficile infections.

  2. Mol 7C/6

    International Nuclear Information System (INIS)

    Aberle, J.; Schleisiek, K.; Schmuck, I.; Schmidt, L.; Romer, O.; Weih, G.

    1995-01-01

    The Mol 7C/6 coolant blockage experiment in the Belgian BR2 reactor yielded results different from Mol 7C experiments with low burnup pins: At 10% burnup local failure is not self-limiting, but requires active systems for detection and scram. The Mol 7C series was finished in 1991. In each of the test bundles Mol 7C/4, /5 and /6, 30 Mk I pins pre-irradiated in KNK II were used. The central blockage consisted of enriched UO 2 covering 30 percent of the bundle cross-section, with a height of 40 mm. The most important system for timely detection of coolant blockages of the type studied in Mol 7C/6 is based on DND. (orig.)

  3. Cryptanalysis of C2

    DEFF Research Database (Denmark)

    Borghoff, Julia; Knudsen, Lars Ramkilde; Leander, Gregor

    2009-01-01

    We present several attacks on the block cipher C2, which is used for encrypting DVD Audio discs and Secure Digital cards. C2 has a 56 bit key and a secret 8 to 8 bit S-box. We show that if the attacker is allowed to choose the key, the S-box can be recovered in 2^24 C2 encryptions. Attacking the 56...... bit key for a known S-box can be done in complexity 2^48. Finally, a C2 implementation with a 8 to 8 bit secret S-box (equivalent to 2048 secret bits) and a 56 bit secret key can be attacked in 2^53.5 C2 encryptions on average....

  4. Creep rupture behavior of candidate materials for nuclear process heat applications

    International Nuclear Information System (INIS)

    Schubert, F.; te Heesen, E.; Bruch, U.; Cook, R.; Diehl, H.; Ennis, P.J.; Jakobeit, W.; Penkalla, H.J.; Ullrich, G.

    1984-01-01

    Creep and stress rupture properties are determined for the candidate materials to be used in hightemperature gas-cooled reactor (HTGR) components. The materials and test methods are briefly described based on experimental results of test durations of about20000 h. The medium creep strengths of the alloys Inconel-617, Hastelloy-X, Nimonic-86, Hastelloy-S, Manaurite-36X, IN-519, and Incoloy-800H are compared showing that Inconel-617 has the best creep rupture properties in the temperature range above 800 0 C. The rupture time of welded joints is in the lower range of the scatterband of the parent metal. The properties determined in different simulated HTGR atmospheres are within the scatterband of the properties obtained in air. Extrapolation methods are discussed and a modified minimum commitment method is favored

  5. Vitamin C revisited.

    Science.gov (United States)

    Oudemans-van Straaten, Heleen M; Spoelstra-de Man, Angelique Me; de Waard, Monique C

    2014-08-06

    This narrative review summarizes the role of vitamin C in mitigating oxidative injury-induced microcirculatory impairment and associated organ failure in ischemia/reperfusion or sepsis. Preclinical studies show that high-dose vitamin C can prevent or restore microcirculatory flow impairment by inhibiting activation of nicotinamide adenine dinucleotide phosphate-oxidase and inducible nitric oxide synthase, augmenting tetrahydrobiopterin, preventing uncoupling of oxidative phosphorylation, and decreasing the formation of superoxide and peroxynitrite, and by directly scavenging superoxide. Vitamin C can additionally restore vascular responsiveness to vasoconstrictors, preserve endothelial barrier by maintaining cyclic guanylate phosphatase and occludin phosphorylation and preventing apoptosis. Finally, high-dose vitamin C can augment antibacterial defense. These protective effects against overwhelming oxidative stress due to ischemia/reperfusion, sepsis or burn seems to mitigate organ injury and dysfunction, and promote recovery after cardiac revascularization and in critically ill patients, in the latter partially in combination with other antioxidants. Of note, several questions remain to be solved, including optimal dose, timing and combination of vitamin C with other antioxidants. The combination obviously offers a synergistic effect and seems reasonable during sustained critical illness. High-dose vitamin C, however, provides a cheap, strong and multifaceted antioxidant, especially robust for resuscitation of the circulation. Vitamin C given as early as possible after the injurious event, or before if feasible, seems most effective. The latter could be considered at the start of cardiac surgery, organ transplant or major gastrointestinal surgery. Preoperative supplementation should consider the inhibiting effect of vitamin C on ischemic preconditioning. In critically ill patients, future research should focus on the use of short-term high-dose intravenous vitamin

  6. Head first C#

    CERN Document Server

    Stellman, Andrew

    2010-01-01

    You want to learn C# programming, but you're not sure you want to suffer through another tedious technical book. You're in luck: Head First C# introduces this language in a fun, visual way. You'll quickly learn everything from creating your first program to learning sophisticated coding skills with C# 4.0, Visual Studio 2010 and .NET 4, while avoiding common errors that frustrate many students. The second edition offers several hands-on labs along the way to help you build and test programs using skills you've learned up to that point. In the final lab, you'll put everything together. From o

  7. Introducing Visual C# 2010

    CERN Document Server

    Freeman, Adam

    2010-01-01

    If you're new to C# programming, this book is the ideal way to get started. Respected author Adam Freeman guides you through the C# language by carefully building up your knowledge from fundamental concepts to advanced features. The book gradually builds up your knowledge, using the concepts you have already grasped to support those that come next. You will explore all the core areas of the C# language and the .NET Framework on which it runs. Particular attention is paid to the creation of Web and Windows applications and data access - danger zones where novice programmers often go awry in the

  8. C++ for beginners... masters

    CERN Document Server

    Asthana, Ankit

    2007-01-01

    About the Book: The purpose of this book is to provide an introductory text for understanding the C++ language and to empower the reader to write C++ programs. The book also introduces reader to the paradigm of object oriented programming. The main strength and USP of this book is that it is written by a student for students but will be equally useful for intermediate level programmers, and software development professionals. The author is in the best position to identify and address issues and areas where a student needs maximum help in understanding the C++ concepts and developing programmi

  9. Vitamin C In Neuropsychiatry

    Directory of Open Access Journals (Sweden)

    Pavlović Dragan M.

    2015-06-01

    Full Text Available Vitamins are necessary factors in human development and normal brain function. Vitamin C is a hydrosoluble compound that humans cannot produce; therefore, we are completely dependent on food intake for vitamin C. Ascorbic acid is an important antioxidative agent and is present in high concentrations in neurons and is also crucial for collagen synthesis throughout the body. Ascorbic acid has a role in modulating many essential neurotransmitters, enables neurogenesis in adult brain and protects cells against infection. While SVCT1 enables the absorption of vitamin C in the intestine, SVCT2 is primarily located in the brain.

  10. C++ multithreading cookbook

    CERN Document Server

    Ljumovic, Milos

    2014-01-01

    The book is an easy-to-follow guide for creating multi-threaded applications using C++. Each topic is thoroughly explained with multiple illustrations. Many algorithms, such as Dinning Philosophers Problem give you thorough explanations that will help you to understand and solve concurrent tasks. The book is intended for enterprise developers and programmers who wish to make use of C++ capabilities to learn the multithreaded approach. Knowledge of multithreading along with experience in C++ is an added advantage. However it is not a prerequisite.

  11. Practical C programming

    CERN Document Server

    Oualline, Steve

    1997-01-01

    There are lots of introductory C books, but this is the first one that has the no-nonsense, practical approach that has made Nutshell Handbooks® famous. C programming is more than just getting the syntax right. Style and debugging also play a tremendous part in creating programs that run well and are easy to maintain. This book teaches you not only the mechanics of programming, but also describes how to create programs that are easy to read, debug, and update. Practical rules are stressed. For example, there are fifteen precedence rules in C (&& comes before || comes before ?:). The practi

  12. Outgassing rates before, during and after bake-out for various vacuum and first wall candidate materials of a large tokamak device

    International Nuclear Information System (INIS)

    Yoshikawa, H.; Gomay, J.; Sugiyama, Y.; Mizuno, M.; Komiya, S.; Tazima, T.

    1977-01-01

    Outgassing rates of vacuum wall candidate materials; stainless steel SS-304L and YUS-170, Inconel-625 and Hastelloy-X, and first wall materials; molybdenum, pyrolytic graphite and silicon carbide are measured before, during and after a bake-out at 500 0 C. The outgassing rate from the inside wall of the cylinder made of each material is estimated from the pressure difference between before and after a calibrated orifice. The ultimate outgassing rates of SS-304L and pyrolytic graphite, and YUS-170 Inconel-625, Hastelloy-X and molybdenum are the orders of 10 -10 and 10 -11 Pa.l.s -1 cm -2 , respectively

  13. Swelling in neutron irradiated nickel-base alloys

    International Nuclear Information System (INIS)

    Brager, H.R.; Bell, W.L.

    1972-01-01

    Inconel 625, Incoloy 800 and Hastelloy X were neutron irradiated at 500 to 700 0 C. It was found that of the three alloys investigated, Inconel 625 offers the greatest swelling resistance. The superior swelling resistance of Inconel 625 relative to that of Hastelloy-X is probably related to differences in the concentrations of the minor rather than major alloy constituents, and can involve (a) enhanced recombination of defects in the Inconel 625 and (b) preferential attraction of vacancies to incoherent precipitates. (U.S.)

  14. Compatibility of heat resistant alloys with boron carbide, (4)

    International Nuclear Information System (INIS)

    Baba, Sinichi; Saruta, Toru; Ooka, Kiichi; Tanaka, Isao; Aoyama, Isao

    1985-07-01

    This paper relates to the compatibility test of control rod sheath (Hastelloy XR alloy) and neutron absorber (boronated graphite) for the VHTR, which has been researched and developed by JAERI. The irradiation was conducted by using the OGL-1 irradiation facility in the JMTR in order to study reaction behaviour between Hastelloy XR alloy and boronated graphite as well as to determine a reaction barrier performance of refractory metal foils Nb, Mo, W and Re. Irradiation conditions were as follows. Neutron dose : 4.05 x 10 22 m -2 (E 18 m -2 (E > 0.16 pJ, 1 Mev). Helium coolant : Average temperature 855 0 C, Pressure 2.94 MPa, Total impurity concentration 400 kBq/m 3 . Irradiation time : 5.0 Ms (1390 hours). Post-irradiation examinations i.e. visual inspection, dimensional inspection, weight measurement, metallography, hardness test, morphological observations by SEM and analysis of element distributions by EPMA were carried out. In the result, reaction products of Hastelloy XR alloy were observed in the ellipsoidal form locally. These results were same as those of the out-of-pile tests. Obvious irradiation effects were not detectable but a little accelarated increase in reaction depth of Hastelloy XR alloy by heat effect of specimens was observed. The refractory metal foils had a good performance of reaction barrier between Hastelloy XR alloy and boronated graphite. Furthermore, movement of Ni, Fe and Cr in the reaction area of Hastelloy XR alloy, difference in the reaction depth of B and C, irradiation effects on diffusion coefficient, lithium production and heat effect are discussed. (author)

  15. Design and qualification testing of a strontium-90 fluoride heat source

    International Nuclear Information System (INIS)

    Fullam, H.T.

    1981-12-01

    The Strontium Heat Source Development Program began at the Pacific Northwest Laboratory (PNL) in 1972 and is scheduled to be completed by the end of FY-1981. The program is currently funded by the US Department of Energy (DOE) By-Product Utilization Program. The primary objective of the program has been to develop the data and technology required to permit the licensing of power systems for terrestrial applications that utilize 90 SrF 2 -fueled radioisotope heat sources. A secondary objective of the program has been to design and qualification-test a general purpose 90 SrF 2 -fueled heat source. The effort expended in the design and testing of the heat source is described. Detailed information is included on: heat source design, licensing requirements, and qualification test requirements; the qualification test procedures; and the fabrication and testing of capsules of various materials. The results obtained in the qualification tests show that the outer capsule design proposed for the 90 SrF 2 heat source is capable of meeting current licensing requirements when Hastelloy S is used as the outer capsule material. The data also indicate that an outer capsule of Hastelloy C-4 would probably also meet licensing requirements, although Hastelloy S is the preferred material. Therefore, based on the results of this study, the general purpose 90 SrF 2 heat source will consist of a standard WESF Hastelloy C-276 inner capsule filled with 90 SrF 2 and a Hastelloy S outer capsule having a 2.375-in. inner diameter and 0.500-in. wall thickness. The end closures for this study, the general purpose 90 SrF 2 heat a Hastelloy S outer capsule having a 2.375-in. inner diameter and 0.500-in. wall thickness. The end closures for the outer capsule will utilize an interlocking joint design requiring a 0.1-in. penetration closure weld

  16. HIV and Hepatitis C

    Science.gov (United States)

    ... AIDS Drugs Clinical Trials Apps skip to content HIV and Opportunistic Infections, Coinfections, and Conditions Home Understanding ... 4 p.m. ET) Send us an email HIV and Hepatitis C Last Reviewed: July 25, 2017 ...

  17. The C++ programming language

    CERN Document Server

    Stroustrup, Bjarne

    2013-01-01

    The new C++11 standard allows programmers to express ideas more clearly, simply, and directly, and to write faster, more efficient code. Bjarne Stroustrup, the designer and original implementer of C++, has updated his definitive reference and tutorial for everyone who uses the language and needs to understand its latest version. The C++ Programming Language, Fourth Edition, delivers meticulous, richly explained, and integrated coverage of the entire language—its facilities, abstraction mechanisms, standard libraries, and key design techniques. Throughout, Stroustrup presents concise, “pure C++11” examples, which have been carefully crafted to clarify both usage and program design. To promote deeper understanding, the author provides extensive cross-references, both within the book and to the ISO standard.

  18. Beginning Objective-C

    CERN Document Server

    Dovey, James

    2012-01-01

    Objective-C is today's fastest growing programming language, at least in part due to the popularity of Apple's Mac, iPhone and iPad. Beginning Objective-C is for you if you have some programming experience, but you're new to the Objective-C programming language and you want a modern-and fast-way forwards to your own coding projects. Beginning Objective-C offers you a modern programmer's perspective on Objective-C courtesy of two of the best iOS and Mac developers in the field today, and gets you programming to the best of your ability in this important language.  It gets you rolling fast into

  19. Parallelization in Modern C++

    CERN Multimedia

    CERN. Geneva

    2016-01-01

    The traditionally used and well established parallel programming models OpenMP and MPI are both targeting lower level parallelism and are meant to be as language agnostic as possible. For a long time, those models were the only widely available portable options for developing parallel C++ applications beyond using plain threads. This has strongly limited the optimization capabilities of compilers, has inhibited extensibility and genericity, and has restricted the use of those models together with other, modern higher level abstractions introduced by the C++11 and C++14 standards. The recent revival of interest in the industry and wider community for the C++ language has also spurred a remarkable amount of standardization proposals and technical specifications being developed. Those efforts however have so far failed to build a vision on how to seamlessly integrate various types of parallelism, such as iterative parallel execution, task-based parallelism, asynchronous many-task execution flows, continuation s...

  20. LOADING SIMULATION PROGRAM C

    Science.gov (United States)

    LSPC is the Loading Simulation Program in C++, a watershed modeling system that includes streamlined Hydrologic Simulation Program Fortran (HSPF) algorithms for simulating hydrology, sediment, and general water quality

  1. LOADING SIMULATION PROGRAM C

    Data.gov (United States)

    U.S. Environmental Protection Agency — LSPC is the Loading Simulation Program in C++, a watershed modeling system that includes streamlined Hydrologic Simulation Program Fortran (HSPF) algorithms for...

  2. C-CURE

    Data.gov (United States)

    US Agency for International Development — C-CURE system manages certain aspects of the access control system, including collecting employee and contractor names and photographs. The Office of Security uses...

  3. Mishra, Dr A C

    Indian Academy of Sciences (India)

    Elected: 2009 Section: Medicine. Mishra, Dr A C . Ph.D. (Pune), FNA. Date of birth: 1 July 1950. Specialization: Human Viral Infection & Zoonotic Diseases, Public Health Address: Director, Interactive Research School of Health Affairs, Bharati Vidyapeeth University, ...

  4. TransparC

    DEFF Research Database (Denmark)

    Callesen, Ingeborg; Vesterdal, Lars; Magnussen, Andreas

    The aim of the development of a forest soil carbon simulation model was to demonstrate the slow, but yet dynamic character of the forest soil C balance. We explored the sensitivity of total forest soil carbon stocks (forest floor + 0-100 cm) to litter inputs, tree root litter distributions......, and iterated turnover rates in horizontal fixed depth soil sections to 1 meter depth. The intended use is mainly for outlier detection in resampling studies and teaching soil C dynamics. The simulation utilized repeated measurements of soil C (SINKS 2007-12) and will be validated with new data collected during...... manually in the spreadsheet to fit observed change (18 years between 1990 and 2008-10) in C concentration in each of the six layers. The cases represent classes of subsoil texture and topsoil carbon content from the SINKS resampling study (1990 and 2008-10). The sensitivity of SOC stocks to the uncertainty...

  5. Introduction to C

    DEFF Research Database (Denmark)

    Albertsen, Niels Christian

    2006-01-01

    The principles of C are very much like those of PASCAL, although the syntax differs slightly. The programs are entered in free format, which the programmer may utilise to make the text reader-friendly, and every sentence is ended with a semicolon. Comments can be entered at any point by enclosing...... them in /* and */. e.g.: /* a comment */. Note that the C compiler is case sensitive. A C program may consist of several program segments. One of them must be the main program, the rest are denoted functions. In contrast to PASCAL the concept procedure does not exist. Every segment starts with a number...... this extra complication, we will in the following consider only C programs contained in a single file....

  6. C-FERST

    Science.gov (United States)

    The Community-Focused Exposure and Risk Screening Tool (C-FERST) is an online tool which provides access to resources that can help communities learn more about their environmental issues, and explore exposure and risk reduction options.

  7. Stop C. difficile Infections

    Centers for Disease Control (CDC) Podcasts

    2012-03-06

    This podcast is based on the March 2012 CDC Vital Signs report. C. difficile is a germ that causes diarrhea linked to 14,000 deaths in the US each year. This podcast helps health care professionals learn how to prevent C. difficile infections.  Created: 3/6/2012 by Centers for Disease Control and Prevention (CDC).   Date Released: 3/6/2012.

  8. Investigation into solubility and diffusion in SiC-NbC, SiC-TiC, SiC-ZrC systems

    International Nuclear Information System (INIS)

    Safaraliev, G.K.; Tairov, Yu.M.; Tsvetkov, V.F.; Shabanov, Sh.Sh.

    1991-01-01

    An investigation is carried out which demonstrates solid-phase interaction between SiC and NbC, TiC and ZrC monocrystals. The monocrystals are subjected to hot pressing in SiC powder with dispersity of 5x10 -6 m. The pressing temperature is 2270-2570 K and pressure is varied in the range of 20-40 MPa. Element composition and the distribution profile in a thin layer near the boundary of SiC-NbC, SiC-TiC and SiC-ZrC are investigated by the Anger spectroscopy method. The obtained results permit to make the conclusion in the possibility of solid solution formation in investigated systems

  9. Bioremediation of bunker C

    International Nuclear Information System (INIS)

    Emery, D.D.

    1992-01-01

    Bioremediation works extremely well for most common hydrocarbons including aviation fuel, heating oil and diesel oil. Bunker C, a high boiling point distillate, is the most recalcitrant hydrocarbon for treatment and is the topic of this paper. Bioremediation, Inc. has had an opportunity to perform two projects involving soil contaminated with bunker C. One was at a bulk terminal site which involved predominantly diesel, but also had bunker C contamination; the other was a paper-mill site which had exclusively bunker C contamination. This paper will address the authors' experiences at the paper-mill site. Bunker C lives up to its reputation of being a very recalcitrant hydrocarbon to biodegrade. They have demonstrated, however, that the soil matrix standards at industrial sites in Washington and Oregon can be achieved using new bioremediation techniques. These techniques are necessary over those typically used to biodegrade jet fuel, heating oil and diesel oil. These extra steps, as discussed later, have been developed for their own use in their treatability laboratory

  10. césarienne

    OpenAIRE

    LABIOD, Imene; KOTBI, sarrah; ABOU ANZA, MOUAID; MOUALID, imene

    2012-01-01

    Notre travail a été réalisé au Service de Gynécologie Obstétrique du complexe mère enfant de Tlemcen Ils 'agit d'une étude rétrospective descriptive et analytique des dossiers médicaux des patientes qui ont accouché par césarienne au cours de d'une période de 8 mois allant du 1e janvier 2011 au 31 Aout 2011. Nous en avons colligé 1732 cas de césarienne sur 7083 accouchements soit un taux de 24.45%. Nous constatons ainsi une augmentation significative du taux des césariennes qui es...

  11. Hepatitis C pada Anak

    Directory of Open Access Journals (Sweden)

    Yusri Dianne Jurnalis

    2014-05-01

    Full Text Available AbstrakInfeksi virus hepatitis C saat ini masih merupakan persoalan yang serius. Penularan infeksi HCV pada anak yang utama adalah melalui transfusi darah atau produk darah yang saat ini bertanggung jawab menyebabkan kasus hepatitis C kronis. Selain itu infeksi HCV pada anak dapat disebabkan oleh transmisi perinatal (vertikal. Infeksi HCV akut dapat berakhir dengan sirosis dan karsinoma hepatoselular setelah dekade ketiga (sekitar 20%, karena progresivitas infeksi HCV lebih lambat dari infeksi hepatitis B virus. Pada umumnya infeksi HCV bersifat asimptomatik termasuk pada anak. Karena tidak ada gejala yang jelas pada infeksi HCV tersebut maka diagnosis infeksi HCV hanya dapat ditegakkan dengan pemeriksaan awal laboratorium dan uji serologi, dan bila perlu dengan uji molekuler pada pasien dengan risiko tinggi. Kebijakan kuratif khusus terhadap HCV adalah terapi antivirus berupa interferon dan ribavirin yang diberikan bila diagnosis HCV sudah ditegakkanKata kunci: Hepatitis C, diagnosis and management problem, childrenAbstractHepatitis C virus infection is still a serious problem. Transmission of HCV infection in children is a major blood transfusion or blood products that are currently responsible for causing chronic hepatitis C cases. Additionally HCV infection in children can be caused by perinatal transmission (vertical. Acute HCV infection may end up with cirrhosis and hepatocellular carcinoma after the third decade (around 20%, due to a slower progression of HCV infection of hepatitis B virus infection. In most cases of HCV infection are asymptomatic, including in children. Since there are no obvious symptoms in the diagnosis of HCV infection HCV infection can only be confirmed by laboratory examinations and serologic testing early, and if necessary with molecular testing in patients at high risk. Curative policy is specific to HCV antiviral therapy such as interferon and ribavirin are given when the diagnosis of HCV has been established

  12. Practical C++ financial programming

    CERN Document Server

    Oliveira, Carlos

    2015-01-01

    Practical C++ Financial Programming is a hands-on book for programmers wanting to apply C++ to programming problems in the financial industry. The book explains those aspects of the language that are more frequently used in writing financial software, including the STL, templates, and various numerical libraries. The book also describes many of the important problems in financial engineering that are part of the day-to-day work of financial programmers in large investment banks and hedge funds. The author has extensive experience in the New York City financial industry that is now distilled in

  13. Nitpicking C++ concurrency

    OpenAIRE

    Blanchette, Jasmin Christian; Weber, Tjark; Batty, Mark; Owens, Scott; Sarkar, Susmit

    2011-01-01

    Previous work formalized the C++ memory model in Isabelle/HOL in an effort to clarify the proposed standard's semantics. Here we employ the model finder Nitpick to check litmus test programs that exercise the memory model, including a simple locking algorithm. Nitpick is built on Kodkod (Alloy's backend) but understands Isabelle's richer logic; hence it can be applied directly to the C++ memory model. We only need to give it a few hints, and thanks to the underlying SAT solver it scales much ...

  14. C2 Agility

    DEFF Research Database (Denmark)

    Mitchell, Dr. William; Alberts, David S.; Bernier, Francois

    of improving C2 Agility with empirical evidence obtained from a set of retrospective case studies and simulation-based experiments. Further, it identified next steps toward practical implementation in NATO operations and priorities for increasing the rigor and practicality of methods for measuring...... and improving C2 Agility. The 21st century military mission space is large and complex, characterized by extreme uncertainty, and exposed to increased public and media scrutiny. In addition to the high intensity combat operations traditionally associated with the military, potential missions include a wide...

  15. Illustrated C# 2010

    CERN Document Server

    Solis, Daniel M

    2010-01-01

    This book presents the C# 2012 language in a uniquely succinct and visual format. Often in programming books, the information can be hidden in a vast sea of words. As a programmer who has over the years used a dozen programming languages, the author understands it can sometimes be difficult to slog through another 1,000-page book of dense text to learn a new language. There are likely many other programmers who feel the same way. To address this situation, this book explains C# 2012 using figures; short, focused code samples; and clear, concise explanations. Figures are of prime importance in

  16. Hepatitis C in India

    Indian Academy of Sciences (India)

    PRAKASH KUMAR

    positivity rates in these patients, accounting for nearly 24-. 28% of cases. .... Author. Punjab. Blood donors. 44,064. ELISA. 1.09%. Gupta et al 2004. Delhi. Voluntary blood ... contribution of hepatitis C in these disease conditions is summarized ...

  17. Fundamentals of C

    CERN Document Server

    Guruprasad, N

    2009-01-01

    The book presents a contemporary approach to programming. Complte C programs are presented as and when it is required. This Book is not a cookbook . To get the maximum benefit from this book, you should take as active a role as possible. Don`t just read the examples. Enter it into your system and try them out.

  18. Umesh C S Yadav

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. Umesh C S Yadav. Articles written in Journal of Biosciences. Volume 28 Issue 2 March 2003 pp 215-221 Articles. Regulation of glucose utilization and lipogenesis in adipose tissue of diabetic and fat fed animals: Effects of insulin and manganese · Najma Z Baquer M Sinclair S ...

  19. J.C. Christensen

    DEFF Research Database (Denmark)

    Duedahl, Poul

    I mange år var det en almindelig antagelse, at statsminister J.C. Christensens dagbøger var blevet brændt efter hans død. Nu er hans dagbøger fra årene 1900-09 imidlertid dukket op, og de giver et indblik i dansk politik i årene omkring Systemskiftet. Dagbøgerne dækker den periode, hvor J.C...... af justitsminister P.A. Albertis bedragerier og optakten til en rigsretssag. De tyve små dagbøger indeholder optegnelser om stort og småt fra perioden. De tjente som et sted, hvor den normalt tillukkede J.C. Christensen fik luft for private og ikke mindst politiske bekymringer, og mange af aktørerne...... i det politiske liv blev i dagbøgerne udsat for skarpe bemærkninger. J.C. Christensens dagbøger giver et enestående indblik i et stykke Danmarkshistorie set fra første række....

  20. Revised C++ coding conventions

    CERN Document Server

    Callot, O

    2001-01-01

    This document replaces the note LHCb 98-049 by Pavel Binko. After a few years of practice, some simplification and clarification of the rules was needed. As many more people have now some experience in writing C++ code, their opinion was also taken into account to get a commonly agreed set of conventions

  1. Narayan C Pradhan

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. Narayan C Pradhan. Articles written in Bulletin of Materials Science. Volume 25 Issue 6 November 2002 pp 533-536. Synthesis and performance of a novel polyurethaneurea as pervaporation membrane for the selective removal of phenol from industrial waste water.

  2. D and C - slideshow

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/presentations/100013.htm D and C - series—Normal anatomy To use the ... MD, MHA, Isla Ogilvie, PhD, and the A.D.A.M. Editorial team. Related MedlinePlus Health Topics ...

  3. C to VHDL compiler

    Science.gov (United States)

    Berdychowski, Piotr P.; Zabolotny, Wojciech M.

    2010-09-01

    The main goal of C to VHDL compiler project is to make FPGA platform more accessible for scientists and software developers. FPGA platform offers unique ability to configure the hardware to implement virtually any dedicated architecture, and modern devices provide sufficient number of hardware resources to implement parallel execution platforms with complex processing units. All this makes the FPGA platform very attractive for those looking for efficient heterogeneous, computing environment. Current industry standard in development of digital systems on FPGA platform is based on HDLs. Although very effective and expressive in hands of hardware development specialists, these languages require specific knowledge and experience, unreachable for most scientists and software programmers. C to VHDL compiler project attempts to remedy that by creating an application, that derives initial VHDL description of a digital system (for further compilation and synthesis), from purely algorithmic description in C programming language. This idea itself is not new, and the C to VHDL compiler combines the best approaches from existing solutions developed over many previous years, with the introduction of some new unique improvements.

  4. Suresh C. Jhanwar

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics. Suresh C. Jhanwar. Articles written in Journal of Genetics. Volume 79 Issue 3 2000 pp 113-123. Characterization of newly established colorectal cancer cell lines: correlation between cytogenetic abnormalities and allelic deletions associated with multistep tumorigenesis · Hans Gerdes ...

  5. C N Sundaresan

    Indian Academy of Sciences (India)

    Fascinating Organic Molecules from Nature - Colours in Flight - Pigments from Bird Feathers and Butterfly Wings · N R Krishnaswamy C N Sundaresan · More Details Fulltext PDF. Volume 18 Issue 3 March 2013 pp 218-225 Series Article. Fascinating Organic Molecules from Nature - Hunting with Poisoned Arrows: Story of ...

  6. The 5C Model

    DEFF Research Database (Denmark)

    Friis, Silje Alberthe Kamille; Gelting, Anne Katrine Gøtzsche

    2014-01-01

    the approaches and reach a new level of conscious action when designing? Informed by theories of design thinking, knowledge production, and learning, we have developed a model, the 5C model, accompanied by 62 method cards. Examples of how the model has been applied in an educational setting are provided...

  7. Despite phylogenetic effects, C3-C4 lineages bridge the ecological gap to C4 photosynthesis.

    Science.gov (United States)

    Lundgren, Marjorie R; Christin, Pascal-Antoine

    2017-01-01

    C 4 photosynthesis is a physiological innovation involving several anatomical and biochemical components that emerged recurrently in flowering plants. This complex trait evolved via a series of physiological intermediates, broadly termed 'C 3 -C 4 ', which have been widely studied to understand C 4 origins. While this research program has focused on biochemistry, physiology, and anatomy, the ecology of these intermediates remains largely unexplored. Here, we use global occurrence data and local habitat descriptions to characterize the niches of multiple C 3 -C 4 lineages, as well as their close C 3 and C 4 relatives. While C 3 -C 4 taxa tend to occur in warm climates, their abiotic niches are spread along other dimensions, making it impossible to define a universal C 3 -C 4 niche. Phylogeny-based comparisons suggest that, despite shifts associated with photosynthetic types, the precipitation component of the C 3 -C 4 niche is particularly lineage specific, being highly correlated with that of closely related C 3 and C 4 taxa. Our large-scale analyses suggest that C 3 -C 4 lineages converged toward warm habitats, which may have facilitated the transition to C 4 photosynthesis, effectively bridging the ecological gap between C 3 and C 4 plants. The intermediates retained some precipitation aspects of their C 3 ancestors' habitat, and likely transmitted them to their C 4 descendants, contributing to the diversity among C 4 lineages seen today. © The Author 2016. Published by Oxford University Press on behalf of the Society for Experimental Biology.

  8. Search for C+ C clustering in Mg ground state

    Indian Academy of Sciences (India)

    2017-01-04

    Jan 4, 2017 ... Finite-range knockout theory predictions were much larger for (12C,212C) reaction, indicating a very small 12C−12C clustering in 24Mg. (g.s.) . Our present results contradict most of the proposed heavy cluster (12C+12C) structure models for the ground state of 24Mg. Keywords. Direct nuclear reactions ...

  9. C++ for Particle Physicists

    CERN Multimedia

    Monique Duval

    2002-01-01

    Paul Kunz will be giving his very popular and highly recommended C++ course again on 22-26 July (6 * 3 hour lectures). The course is organised by the CERN Technical Training Programme, it costs 200 CHF, and advance registration is required. People with CERN EDH accounts can apply electronically directly from the Web course description page, accessible from the Technical Training pages. Team Visitors should ask their Group Leader to send an e-mail to the DTO of EP Division, M. Burri, referring to the 'C++ for Particle Physicists' course and giving their name, CERN ID number, the Team account number to which the course fee should be charged, and VERY IMPORTANTLY an email address to which an invitation to the course can be sent.

  10. C++ for Particle Physicists

    CERN Multimedia

    2003-01-01

    Please note that Paul Kunz will be giving his very popular and highly recommended C++ course again on 10 - 14 March. The course costs 200 CHF, and advance registration is required. People with CERN EDH accounts can apply electronically directly from the Web course description page : http://cern.ch/TechnicalTraining/ENSTEC/p2002/Software/cpppp_e.asp Team Visitors should ask their Group Leader to send an e-mail to the DTO of EP Division, M. Burri, referring to the 'C++ for Particle Physicists' course and giving their name, CERN ID number, the Team account number to which the course fee should be charged, and VERY IMPORTANTLY an email address to which an invitation to the course can be sent.

  11. C++ FOR PARTICLE PHYSICISTS

    CERN Multimedia

    Monique Duval

    2002-01-01

    Paul Kunz will be giving his very popular and highly recommended C++ course again on 22-26 July (6 * 3 hour lectures). The course is organised by the CERN Technical Training Programme, it costs 200 CHF, and advance registration is required. People with CERN EDH accounts can apply electronically directly from the Web course description page, accessible from the Technical Training pages. Team Visitors should ask their Group Leader to send an e-mail to the DTO of EP Division, M. Burri, referring to the 'C++ for Particle Physicists' course and giving their name, CERN ID number, the Team account number to which the course fee should be charged, and VERY IMPORTANTLY an email address to which an invitation to the course can be sent.

  12. C++ for Particle Physicists

    CERN Multimedia

    Technical Training; Tel. 74924

    2001-01-01

    Paul Kunz will be giving his very popular and highly recommended C++ course again on 8 - 12 October. The course costs 200 CHF, and advance registration is required. Please note that this will be the last session in 2001 and the next one is planned for March 2002. People with CERN EDH accounts can apply electronically directly from the Web course description page : http://www.cern.ch/Training/ENSTEC/P2001/Software/cpppp_e.htm   Team Visitors should ask their Group Leader to send an e-mail to the DTO of EP Division, M. Burri, referring to the 'C++ for Particle Physicists' course and giving their name, CERN ID number, the Team account number to which the course fee should be charged, and VERY IMPORTANTLY an email address to which an invitation to the course can be sent.

  13. C++ FOR PARTICLE PHYSICISTS

    CERN Multimedia

    TECHNICAL TRAINING; Tel. 74460

    2001-01-01

    Please note that Paul Kunz will be giving his very popular and highly recommended C++ course again on March 5 to 9. The course costs 200 CHF, and advance registration is required. People with CERN EDH accounts can apply electronically directly from the Web course description page : http://www.cern.ch/Training/ENSTEC/P9798/Software/cpppp_e.htm Team Visitors should ask their Group Leader to send an e-mail to the DTO of EP Division, M. Burri, referring to the 'C++ for Particle Physicists' course and giving their name, CERN ID number, the Team account number to which the course fee should be charged, and VERY IMPORTANTLY an email address to which an invitation to the course can be sent.

  14. C++ for Particle Physicists

    CERN Multimedia

    Monique Duval

    2004-01-01

    Please note that Paul Kunz will be giving his very popular and highly recommended C++ course again on 15 �- 19 November. The course costs 200 CHF, and advance registration is required. People with CERN EDH accounts can apply electronically directly from the Web course description page: Team Visitors should ask their Group Leader to send an e-mail to the DTO of PH Department, M. Burri, referring to the 'C++ for Particle Physicists' course and giving their name, CERN ID number, the Team account number to which the course fee should be charged, and VERY IMPORTANTLY an email address to which an invitation to the course can be sent. ENSEIGNEMENT TECHNIQUE TECHNICAL TRAINING Monique Duval 74924 technical.training@cern.ch

  15. C++ for Particle Physicists

    CERN Multimedia

    Monique Duval

    2004-01-01

    Please note that Paul Kunz will be giving his very popular and highly recommended C++ course again on 15 - 19 November. The course costs 200 CHF, and advance registration is required. People with CERN EDH accounts can apply electronically directly from the Web course description page: Team Visitors should ask their Group Leader to send an e-mail to the DTO of PH Department, M. Burri, referring to the 'C++ for Particle Physicists' course and giving their name, CERN ID number, the Team account number to which the course fee should be charged, and VERY IMPORTANTLY an email address to which an invitation to the course can be sent. ENSEIGNEMENT TECHNIQUE TECHNICAL TRAINING Monique Duval 74924 technical.training@cern.ch

  16. Take the "C" Train

    Science.gov (United States)

    Lawton, Rebecca

    2008-01-01

    In this essay, the author recalls several of her experiences in which she successfully pulled her boats out of river holes by throwing herself to the water as a sea-anchor. She learned this trick from her senior guides at a spring training. Her guides told her, "When you're stuck in a hole, take the "C" train."" "Meaning?" The author asked her…

  17. k c anjaneya

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. K C ANJANEYA. Articles written in Bulletin of Materials Science. Volume 39 Issue 5 September 2016 pp 1279-1284. Structural, electrical and electrochemical studies of LiNi 0.4 M 0.1 Mn 1.5 O 4 ( M = Co, Mg) solid solutions for lithium ion battery · G P NAYAKA K V PAI J ...

  18. C P Singh

    Indian Academy of Sciences (India)

    ... Simon-Gillo C P Singh V Singh M Sivertz A Soldatov R A Soltz S Sorensen P W Stankus N Starinsky P Steinberg E Stenlund A Ster S P Stoll M Sugioka T Sugitate J P Sullivan Y Sumi Z Sun M Suzuki E M Takagui A Taketani M Tamai K H Tanaka Y Tanaka E Taniguchi M J Tannenbaum J Thomas J H Thomas T L Thomas ...

  19. Hepatitis C in dermatology

    Directory of Open Access Journals (Sweden)

    Zonunsanga

    2015-10-01

    Full Text Available Hepatitis C is a serious public health problem all over the world. It is caused by a single stranded RNA virus. Most acute infections are subclinical, but in 75% of individuals, infection leads to a chronic hepatitis, which in some cases can progress to cirrhosis and occasionally development of hepatoma. It has wide range of dermatological manifestations. This review article deals with the overview of epidemiology, pathogenesis, clinical manifestations, management and prevention.

  20. Evaluation of candidate alloys for the construction of metal flex hoses in the STS launch environment

    Science.gov (United States)

    Ontiveros, Cordelia

    1988-01-01

    Various vacuum jacketed cryogenic supply lines at the Shuttle launch site use convoluted flexible expansion joints. The atmosphere at the launch site has a very high salt content, and during a launch, fuel combustion products include hydrochloric acid. This extremely corrosive environment has caused pitting corrosion failure in the flex hoses, which were made of 304L stainless steel. A search was done to find a more corrosion resistant replacement material. This study focused on 19 metal alloys. Tests which were performed include electrochemical corrosion testing, accelerated corrosion testing in a salt fog chamber, long term exposure at the beach corrosion testing site, and pitting corrosion tests in ferric chloride solution. Based on the results of these tests, the most corrosion resistant alloys were found to be (in order) Hastelloy C-22, Inconel 625, Hastelloy C-276, Hastelloy C-4, and Inco Alloy G-3. Of these top five alloys, the Hastelloy C-22 stands out as being the best of those tested for this application.

  1. Dicty_cDB: VSJ516 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mlhqv ntlvtllspiktmlkspvlmliltckrik*nkik*khtix*iiy Frame C: neiiisplfrscfsfpifhps...kqc*nrly*c*y*lvne*nkik*nkntpsinyl*ikkk--- ---neiiisplfrscfsfpifhpslvklwyccr*ipnyqcsirptnts*rtryhnqciry sr*nr

  2. Dicty_cDB: SFC593 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IIIIIIIIIXXHXHX A Frame B: ---sssssssssssssssssssssssssssssssssssssssssssssssssssvxixix l Frame C: ---hhhh...hhhhhhhxhxhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhxssssss s Homology vs CSM-cDNA *****

  3. Dicty_cDB: SLH810 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available frhfsdcriwlfwfcfinshtvsfflrisck*CFSFFFWTSGFSIRYLIYCNHLI ILIILCFVIISLFVTFL Translated Amino Acid sequence (Al...rame C: *fncyfrhfsdcriwlfwfcfinshtvsfflrisck*CFSFFFWTSGFSIRYLIYCNHLI ILIILCFVIISLFVTFL Homology vs CSM-cDNA

  4. Isomerisation of c4-c6 aldoses with zeolites

    DEFF Research Database (Denmark)

    2014-01-01

    The present invention relates to isomerization of C4-C6 aldoses to their corresponding C4-C6 ketoses. In particular, the invention concerns isomerization of C4-C6 aldoses over solid zeolite catalysts free of any metals other than aluminum, in the presence of suitable solvent(s) at suitable elevated...... temperatures. C6 and C5 aldose sugars such as glucose and xylose, which are available in large amounts from biomass precursors, are isomerized to fructose and xylulose respectively, in a one or two-step process over inexpensive commercially available zeolite catalysts, containing aluminum as the only metal...

  5. Distinct Signaling Roles of cIMP, cCMP, and cUMP.

    Science.gov (United States)

    Seifert, Roland

    2016-10-04

    The cyclic purine nucleotide cIMP and the cyclic pyrimidine nucleotides cCMP and cUMP are emerging second messengers. These cNMPs show different biological effects, but the molecular mechanisms remain elusive. In this issue of Structure, Ng et al. (2016) provide structural evidence for distinct interactions of cIMP, cCMP, and cUMP with ion channels. Copyright © 2016 Elsevier Ltd. All rights reserved.

  6. Hot pressing of B4C/SiC composites

    International Nuclear Information System (INIS)

    Sahin, F.C.; Turhan, E.; Yesilcubuk, S.A.; Addemir, O.

    2005-01-01

    B 4 C/SiC ceramic composites containing 10-20-30 vol % SiC were prepared by hot pressing method. The effect of SiC addition and hot pressing temperature on sintering behaviour and mechanical properties of hot pressed composites were investigated. Microstructures of hot pressed samples were examined by SEM technique. Three different temperatures (2100 deg. C, 2200 deg. C and 2250 deg. C) were used to optimize hot pressing temperature applying 100 MPa pressure under argon atmosphere during the sintering procedure. The highest relative density of 98.44 % was obtained by hot pressing at 2250 deg. C. However, bending strengths of B 4 C/SiC composite samples were lower than monolithic B 4 C in all experimental conditions. (authors)

  7. Hepatitis B & C and HIV

    Science.gov (United States)

    ... Find Services HIV SERVICES LOCATOR Locator Search Search Hepatitis B & C Topics Hepatitis B Hepatitis C Hepatitis ... Infections Sexually Transmitted Diseases Smoking Women's Health Issues Hepatitis B Virus and Hepatitis C Virus Infection People ...

  8. Insulin C-peptide test

    Science.gov (United States)

    C-peptide ... the test depends on the reason for the C-peptide measurement. Ask your health care provider if ... C-peptide is measured to tell the difference between insulin the body produces and insulin someone injects ...

  9. The 6C Model

    DEFF Research Database (Denmark)

    Friis, Silje Alberthe Kamille

    2016-01-01

    students, teachers, and clients reflect on what abilities the designer must possess in order to be able to promote transformation. The study is informed by the 6C Model, a theory describing the types of knowledge production taking place in design processes, and by the Co-creation Cards, a collection...... of methods translating knowledge production into practical approaches. Design students from six design disciplines explore a regional challenge posed by the local official tourist organization: The City of Aarhus is the European Capital of Culture 2017—how can the entire region, including nineteen...

  10. CLR via C#

    CERN Document Server

    Richter, Jeffrey

    2010-01-01

    Dig deep and master the intricacies of the common language runtime (CLR) and the .NET Framework 4.0. Written by a highly regarded programming expert and consultant to the Microsoft® .NET team, this guide is ideal for developers building any kind of application-including Microsoft® ASP.NET, Windows® Forms, Microsoft® SQL Server®, Web services, and console applications. You'll get hands-on instruction and extensive C# code samples to help you tackle the tough topics and develop high-performance applications.

  11. C programming language essentials

    CERN Document Server

    Ackermann, Ernest C

    2012-01-01

    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. C Programming Language discusses fundamental notions, data types and objects, expressions, statements, declarations, function and program structure, the preprocessor, and the standar

  12. Programming with C++

    CERN Document Server

    Juneja, BL

    2009-01-01

    About the Book: Authors have taken special care to present the various topics in Programming with C++ in an easy-to-learn style. Almost every topic is followed by well designed live programmes so that it becomes easy to grasp the underlying principle or programming technique. A total of more than 450 live programmes are included in the book. It is also taken care that programmes are short and do not include such details which do not relate to the topic on hand. This makes them easy to be tested and suitable for practice students. Authors are confident that the book will prove its worth for th

  13. Dicty_cDB: VFN130 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available XSSXXXTPKPKPKPKPTPTTSTPNLSAKSATNSPYKSSIRNASPQP TSKPK Frame B: ---xxxxxxxxxxxhhxxx...qhqnqnqnqnqhqqhqhqiyqpnqqqihhinhqlgmhhhnp hqnqn Frame C: ---xxxxxxnxxxxiixxxntktktktktntnnintkfisqisnkfti*ii

  14. Dicty_cDB: AFK270 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LFVNKKRKSNPLD GSSTPTNQNQNQNQRKL Frame B: ---xxxxxsxxxxxxxwxnxxxxxxxxxxxgpxxxxsxsssxxxxxxxxxx...kprksmivtlkmtkkkrkkkfyl*tkrenrih*m vvvhqltkiktktken Frame C: ---pxxxxaxxxxpxggxixxxxxxxxxxxxxxqxxvxxxxixxxxxxxxx

  15. Dicty_cDB: AFL805 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Frame A: ---rf*vkkkrfffxxgkkxkkxkxxxxxkxxxxxxxxxxxkxkxxxxkxsxxkkknk Frame B: ---GFRXKKKGFFLXXXKKXKNXKXXXXXKX...XXXXXXXXXXKXKXXXXKXPXEKKKIK Frame C: ---vlgxkkkvffxpwxkkxktkxxxxxxkxxxxxxxxxxxxkxxxxxkxxx

  16. Dicty_cDB: AFM354 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NGXVVLXXXXIXXIHXF XQVXSVXXXXXX Frame B: ---vxxxqxxqarigxwxxxxxxkxxxxxxxxfxcwxxxcxlxmxwwffxxxx...yxxsixx fkxnqxxxxxx Frame C: ---xxxxrxxrqelxxgxxxxgxkxxvrxqxxxnvgxxxaxxxwxggslxxyxxfxpsix ssxisxxxxxx

  17. Dicty_cDB: VSD612 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gavmnsadnsgaknlyviavkgikgrlnrlpsagvgdmv matvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgnilgpva kecsdlw...lpsagvg dmvmatvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgnilg pvakecsdlwpkvatnagtmfk*ihiklkq Frame C:

  18. Dicty_cDB: VSD542 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rlpsag vgymvmatvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgni lgpvakecsdlwp...vkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevk gnilgpvakecsdlgqrlppmpvplfk*ihik Frame C: frcihk*cqkhkpsvv

  19. Dicty_cDB: VSF769 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available dnsgaknlyviavkgikgrlnrlpsagvgdmv matvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgnilgpva kecsdlwpkvatna... dmvmatvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgnilg pvakecsdlwpkvatnagtiv*int Homology vs CSM-cDNA

  20. Selective terminal C–C scission of C5-carbohydrates

    NARCIS (Netherlands)

    Klis, van der F.; Gootjes, L.; Haveren, van J.; Es, van D.S.; Bitter, J.H.

    2015-01-01

    The selective catalytic production of C4-tetritols (erythritol and threitol) from C5-sugars is an attractive route for the conversion of non-digestible sugars to C4-building blocks from agro residues. Here we show that an unprecedented high selectivity of 20–25% C4-tertritols can be achieved under

  1. Dicty_cDB: CHH542 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 35.1 UCRCS08_0003L02_f Parent Washington Navel Orange Callus cDNA Library UCRCS08...cDNA library - UCR Poncirus trifoliata cDNA clone UCRPT01_02_C04, mRNA sequence. 40 0.002 2 CV714035 |CV7140

  2. Microscopic investigation of the 12C + 12C interaction

    International Nuclear Information System (INIS)

    Baye, D.; Pecher, N.; Brussels Univ.

    1982-01-01

    The 12 C + 12 C system is studied in the framework of the generator coordinate method. Each 12 C nucleus is described by a closed psub(3/2) subshell. Phase shifts and resonances are determined for several effective two-body interactions involving a spin-orbit term. The existence and properties of simple local equivalent potentials for the 12 C + 12 C collision are discussed. The 12 C + 12 C system is too light to be well described by potentials independent of the angular momentum or weakly dependent on it. (orig.)

  3. BURNER RIG TESTING OF A500 C/SiC

    Science.gov (United States)

    2018-03-17

    AFRL-RX-WP-TR-2018-0071 BURNER RIG TESTING OF A500® C /SiC Larry P. Zawada Universal Technology Corporation Jennifer Pierce UDRI...TITLE AND SUBTITLE BURNER RIG TESTING OF A500® C /SiC 5a. CONTRACT NUMBER In-House 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 62102F 6...test program characterized the durability behavior of A500® C /SiC ceramic matrix composite material at room and elevated temperature. Specimens were

  4. Bioremediation of Bunker C

    International Nuclear Information System (INIS)

    Emery, D.D.

    1992-01-01

    In the states of Washington and Oregon, the highest priority for waste management is now given to recycling, reuse and permanent solutions as opposed to landfill disposal. Bioremediation is recognized as a treatment of choice over other technologies that do not provide permanent solutions. From a business point of view, it is usually the most cost-effective. Bioremediation works extremely well for most common hydrocarbons including aviation fuel, heating oil and diesel oil. Bunker C, a high boiling point distillate, is the most recalcitrant hydrocarbon for treatment and is the topic of this paper. Bunker C lives up to its reputation of being a very recalcitrant hydrocarbon to biodegrade. The authors have demonstrated, however, that the soil matrix standards at industrial sites in Washington and Oregon can be achieved using new bioremediation techniques. These techniques are necessary over those typically used to biodegrade jet fuel, heating oil and diesel oil. These extra steps have been developed for our own use in our treatability laboratory

  5. Interfacial characterization of CVI-SiC/SiC composites

    International Nuclear Information System (INIS)

    Yang, W.; Kohyama, A.; Noda, T.; Katoh, Y.; Hinoki, T.; Araki, H.; Yu, J.

    2002-01-01

    The mechanical properties of the interfaces of two families of chemical vapor infiltration SiC/SiC composites, advanced Tyranno-SA and Hi-Nicalon fibers reinforced SiC/SiC composites with various carbon and SiC/C interlayers, were investigated by single fiber push-out/push-back tests. Interfacial debonding and fibers sliding mainly occurred adjacent to the first carbon layer on the fibers. The interfacial debonding strengths and frictional stresses for both Tyranno-SA/SiC and Hi-Nicalon/SiC composites were correlated with the first carbon layer thickness. Tyranno-SA/SiC composites exhibited much larger interfacial frictional stresses compared to Hi-Nicalon/SiC composites. This was assumed to be mainly contributed by the rather rough surface of the Tyranno-SA fiber

  6. Transport properties at 3C-SiC interfaces

    OpenAIRE

    Eriksson, Gustav Jens Peter

    2011-01-01

    For years cubic (3C) silicon carbide (SiC) has been believed to be a very promising wide bandgap semiconductor for high frequency and high power electronics. However, 3C-SiC is fraught with large concentrations of various defects, which have so far hindered the achievement of the predicted properties at a macroscopic level. These defects have properties that are inherently nanoscale and that will have a strong influence on the electrical behavior of the material, particularly at interfaces c...

  7. Meningococcal disease serogroup C

    Directory of Open Access Journals (Sweden)

    Cuevas IE

    2012-03-01

    Full Text Available Félix O Dickinson1, Antonio E Pérez1, Iván E Cuevas21Department of Epidemiology, “Pedro Kourí” Institute, Havana, Cuba; 2Pharmacovigilance Group, Finlay Institute, Havana, CubaAbstract: Despite current advances in antibiotic therapy and vaccines, meningococcal disease serogroup C (MDC remains a serious threat to global health, particularly in countries in North and Latin America, Europe, and Asia. MDC is a leading cause of morbidity, mortality, and neurological sequelae and it is a heavy economic burden. At the individual level, despite advances in antibiotics and supportive therapies, case fatality rate remains nearly 10% and severe neurological sequelae are frequent. At the population level, prevention and control of infection is more challenging. The main approaches include health education, providing information to the public, specific treatment, chemoprophylaxis, and the use of vaccines. Plain and conjugate meningococcal C polysaccharide vaccines are considered safe, are well tolerated, and have been used successfully for over 30 years. Most high-income countries use vaccination as a part of public health strategies, and different meningococcal C vaccination schedules have proven to be effective in reducing incidence. This is particularly so with conjugate vaccines, which have been found to induce immunogenicity in infants (the age group with the highest incidence rates of disease, stimulate immunologic memory, have longer effects, not lead to hyporesponsiveness with repeated dosing, and decrease acquisition of nasopharyngeal carriage, inducing herd immunity. Antibiotics are considered a cornerstone of MDC treatment and must be administered empirically as soon as possible. The choice of which antibiotic to use should be made based on local antibiotic resistance, availability, and circulating strains. Excellent options for a 7-day course are penicillin, ampicillin, chloramphenicol, and third-generation cephalosporins (ceftriaxone and

  8. Glucocorticosteroids for viral hepatitis C

    DEFF Research Database (Denmark)

    Brok, J; Mellerup, M T; Krogsgaard, K

    2004-01-01

    Hepatitis C virus may cause liver inflammation and fibrosis. It is not known whether glucocorticosteroids are beneficial or harmful for patients with hepatitis C infection.......Hepatitis C virus may cause liver inflammation and fibrosis. It is not known whether glucocorticosteroids are beneficial or harmful for patients with hepatitis C infection....

  9. Curiosities at c=1

    International Nuclear Information System (INIS)

    Ginsparg, P.

    1988-01-01

    We consider conformal field theories on a torus with central charge c=1, and in particular models based upon modding out string propagation on the SU(2) group manifold by its finite subgroups. We find that the partition functions for these models coincide with the continuum limit partition functions of a recently introduced class of RSOS models, defined in terms of the extended Dynkin diagrams of simply-laced Lie algebras, thus giving an alternative interpretation for the primary fields in these latter theories. Three of the models have no massless moduli and thus do not lie on the same line of critical points with the rest. The particular correspondence between simply-laced Lie algebras and finite subgroups of SU(2) that emerges coincides with that which has already appeared in other mathematical contexts. (orig.)

  10. 8C.02

    DEFF Research Database (Denmark)

    Jensen, B L; Frederiksen-Moller, B; Jorgensen, J S

    2015-01-01

    OBJECTIVE: The serine protease prostasin (PRSS8, CAP1) and its activator matriptase and inhibitor nexin-1 are necessary for normal placental development in mice. Prostasin is regulated by aldosterone in the kidney and may activate the epithelial sodium channel (ENaC). Preeclampsia is characterized...... by disturbed placentation, suppression of aldosterone and avid renal sodium retention with hypertension. It was hypothesized that preeclampsia is associated with low prostasin expression in placenta and spillover of prostasin into urine across the defect glomeular barrier. DESIGN AND METHOD: The hypothesis...... or placental weight. In summary, preeclampsia is associated with increased urine but not plasma or tissue prostasin CONCLUSIONS: : It is concluded that placental and plasma prostasin level is not controlled by aldosterone during term pregnancy. In contrast, prostasin is aberrantly filtered and may contribute...

  11. Highly Stable [C60AuC60]+/- Dumbbells.

    Science.gov (United States)

    Goulart, Marcelo; Kuhn, Martin; Martini, Paul; Chen, Lei; Hagelberg, Frank; Kaiser, Alexander; Scheier, Paul; Ellis, Andrew M

    2018-05-17

    Ionic complexes between gold and C 60 have been observed for the first time. Cations and anions of the type [Au(C 60 ) 2 ] +/- are shown to have particular stability. Calculations suggest that these ions adopt a C 60 -Au-C 60 sandwich-like (dumbbell) structure, which is reminiscent of [XAuX] +/- ions previously observed for much smaller ligands. The [Au(C 60 ) 2 ] +/- ions can be regarded as Au(I) complexes, regardless of whether the net charge is positive or negative, but in both cases, the charge transfer between the Au and C 60 is incomplete, most likely because of a covalent contribution to the Au-C 60 binding. The C 60 -Au-C 60 dumbbell structure represents a new architecture in fullerene chemistry that might be replicable in synthetic nanostructures.

  12. Mechanical characterization of superalloys for space reactors

    International Nuclear Information System (INIS)

    Duchesne, J.

    1989-01-01

    The purpose of this work is the choice of materials usable between 600 and 900 0 C for nuclear space reactor structures. The main criterion of selection for these materials is their good creep behaviour. Consequently, macroscopic theories of creep and several extrapolation methods were described. Superalloys seem the best materials for the studied range of temperatures. Five of them, base nickel, ones unusual in nuclear industry were selected for their good mechanical properties. Three of them are industrial alloys: the first, HAYNES 230 is a recent one, HASTELLOY S and X are more standard materials. The last two, HASTELLOY XR and PYRAD 38 D are issued from special fabrications. Creep tests metallographic investigations, hardness and tensile tests were performed. A contraction of samples was observed during some creep tests under a low stress, 20MPa at 800 0 C, for HAYNES 230 and HASTELLOY X. This could be due to a structural evolution of these materials connected to a decrease of the cristalline parameter. In addition, correlations were observed between certain characteristics determined from slow tensile tests and short duration creep tests. These correlations present a large interest because, at the present time, creep tests cannot be executed on irradiated materials in our laboratories. Consequently creep behaviour of irradiated materials seem may be deduced. Further studies are needed to explain and confirm the behaviour of the most interesting materials under low stresses: HAYNES 230 and HASTELLOY XR to anticipate their behaviour in working conditions [fr

  13. Oxidation protection of multilayer CVD SiC/B/SiC coatings for 3D C/SiC composite

    International Nuclear Information System (INIS)

    Liu Yongsheng; Cheng Laifei; Zhang Litong; Wu Shoujun; Li Duo; Xu Yongdong

    2007-01-01

    A CVD boron coating was introduced between two CVD SiC coating layers. EDS and XRD results showed that the CVD B coating was a boron crystal without other impurity elements. SEM results indicated that the CVD B coating was a flake-like or column-like crystal with a compact cross-section. The crack width in the CVD SiC coating deposited on CVD B is smaller than that in a CVD SiC coating deposited on CVD SiC coating. After oxidation at 700 deg. C and 1000 deg. C, XRD results indicated that the coating was covered by product B 2 O 3 or B 2 O 3 .xSiO 2 film. The cracks were sealed as observed by SEM. There was a large amount of flake-like material on hybrid coating surface after oxidation at 1300 deg. C. Oxidation weight loss and residual flexural strength results showed that hybrid SiC/B/SiC multilayer coating provided better oxidation protection for C/SiC composite than a three layer CVD SiC coating at temperatures from 700 deg. C to 1000 deg. C for 600 min, but worse oxidation protection above 1000 deg. C due to the large amount of volatilization of B 2 O 3 or B 2 O 3 .xSiO 2

  14. C. Gordon Fullerton

    Science.gov (United States)

    1989-01-01

    C. Gordon Fullerton is a research pilot at NASA's Dryden Flight Research Center, Edwards, California. His assignments include a variety of flight research and support activities piloting NASA's B-52 launch aircraft, the 747 Shuttle Carrier Aircraft (SCA), and other multi-engine and high performance aircraft. Fullerton, who has logged 382 hours in space flight, was a NASA astronaut from September 1969 until November 1986 when he joined the Flight Crew Branch at Dryden. In July 1988, he completed a 30-year career with the U.S. Air Force and retired as a colonel. As the project pilot on the NASA B-52 launch aircraft, Fullerton flew during the first six air launches of the commercially developed Pegasus space vehicle. He was involved in a series of development air launches of the X-38 Crew Recovery Vehicle and in the Pegasus launch of the X-43A Hyper-X advanced propulsion project. Fullerton also flies Dryden's DC-8 Airborne Science aircraft, regularly deployed worldwide to support a variety of research studies, including atmospheric physics, ground mapping and meteorology. In addition to these current activities, Fullerton has been involved in numerous other research programs at Dryden. He was the project pilot on the Propulsion Controlled Aircraft program, during which he successfully landed both a modified F-15 and an MD-11 transport with all control surfaces neutralized, using only engine thrust modulation for control. Assigned to evaluate the flying qualities of the Russian Tu-144 supersonic transport during two flights in 1998, he reached a speed of Mach 2 and became one of only two non-Russian pilots to fly that aircraft. He piloted a Convair 990 modified to test space shuttle landing gear components during many very high-speed landings. Other projects for which he has flown in the past include the C-140 JetStar Laminar Flow Control; F-111 Mission Adaptive Wing; F-14 Variable Sweep Flow Transition; Space Shuttle drag chute and F-111 crew module parachute tests

  15. Early antihepatitis C virus response with second-generation C200/C22 ELISA

    NARCIS (Netherlands)

    van der Poel, C. L.; Bresters, D.; Reesink, H. W.; Plaisier, A. A.; Schaasberg, W.; Leentvaar-Kuypers, A.; Choo, Q. L.; Quan, S.; Polito, A.; Houghton, M.

    1992-01-01

    Detection of early antibody to hepatitis C virus (HCV) by a new second-generation C200/C22 anti-HCV enzyme-linked immunosorbent assay (ELISA) and a four-antigen recombinant immunoblot assay (4-RIBA) was compared with the first-generation anti-HCV C100 ELISA using sequential serum samples of 9

  16. Fourier spectroscopy of the 12C2, 13C2, and 12C13C (0-0) swan bands

    International Nuclear Information System (INIS)

    Amiot, C.

    1983-01-01

    The (0-0) band of the C 2 Swan electronic system d 3 Pi/sub g/→a 3 Pi/sub u/ has been recorded by Fourier spectroscopy. The three isotopes species 12 C 2 , 13 C 2 , and 12 C 13 C were investigated. The observed wavenumbers were reduced to molecular parameters using a nonlinear least-square fitting procedure. Well-known perturbations at N' = 47 and N' = 51 again observed in the e 12 C 2 d 3 Pi/sub g/ (v = 0) level. Perturbations of the same kind are present in the 13 C 2 spectrum at N' = 34 and N' = 44,48,52. The 12 C 13 C spectrum exhibits in the observed spectral range a unique perturbation for N' = 41

  17. Dicty_cDB: AFG169 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available --LMKNLN*twllihhhc*krnrqryqrkislrrprl*s*nanccliisprkiiritrr sshhhr**tfplprsplptitlrygiswyprnhl*lhhem*c*yp*rf...rnrqryqrkislrrprl*s*nanccliisprkiiritrr sshhhr**tfplprsplptitlrygiswyprnhl*lhhem*c*yp*rfirqcrliwwyny vpryc*s

  18. Dicty_cDB: VSJ452 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lkth*haqlllvitkri*pk*fhlml hqvntlvtllspiktmlkspvlmliltckrik*nkik*khtix* Frame C: ik*neiiisp...ydrndsi*csir* ihw*rcyhrskqc*nrly*c*y*lvne*nkik*nkntpsinyl*ikkk--- ---ik*neiiisplfrscfsfpifhpslvklwyccr*ipnyq

  19. Demonstration of SiC Pressure Sensors at 750 C

    Science.gov (United States)

    Okojie, Robert S.; Lukco, Dorothy; Nguyen, Vu; Savrun, Ender

    2014-01-01

    We report the first demonstration of MEMS-based 4H-SiC piezoresistive pressure sensors tested at 750 C and in the process confirmed the existence of strain sensitivity recovery with increasing temperature above 400 C, eventually achieving near or up to 100% of the room temperature values at 750 C. This strain sensitivity recovery phenomenon in 4H-SiC is uncharacteristic of the well-known monotonic decrease in strain sensitivity with increasing temperature in silicon piezoresistors. For the three sensors tested, the room temperature full-scale output (FSO) at 200 psig ranged between 29 and 36 mV. Although the FSO at 400 C dropped by about 60%, full recovery was achieved at 750 C. This result will allow the operation of SiC pressure sensors at higher temperatures, thereby permitting deeper insertion into the engine combustion chamber to improve the accurate quantification of combustor dynamics.

  20. Dicty_cDB: CHJ780 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Frame A: iqkcqinkkkkkkn*kkfx*vxkgxsfxkkkkxpxfffxkkxxkxkkkkxkkxxxxxprg lxkkkxxxkkxkkxxkkkkkxkktf*xpxxx...fggxxkxxxxgxxppxxxxxxpxpxkxwx pxkxxpxxxxggtpxxxxxlfxxxxpxfxkkxflkkkkxkktffxxff*kxxxkk-...--- Frame C: skmsnk*kkkkkklkkilxgxkrx*f*xkkkkxpfffx*kkxkxkkkkxkkxxxxxxpga xkkkkxxkkkxkxxkkkkkxkknxlxppxxfwgxxxxkxxggxxpxxxxxx...ppxxkxlxp pxxgpxxxpggnpxxxxxxfxxxkxxfxxkxffkkkkxxknffxxfflkxxxkk--- Homology vs CSM-cDNA Sc

  1. Dicty_cDB: CHQ769 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available klklnl*NQFVTKTSNLKKK--- ---xxxxxxxxxkkkkkkkkkkkkkxxxxxxxxxfff*kkkkkn Frame B: lnhcsilfifklnintikks*n*ickinl*...qklvi*kk--- ---XXXXXXXXXKKKKKKKKKKKKNXXKXXXXXXFFFKKKKKKI Frame C: *iivvfcsysn*isiqlkkvkikfvksicnkn**fkkk--- ---xxxxxxxxx...kkkkkkkkkkkkxxxkxxxxxxfflkkkkkk* Homology vs CSM-cDNA Score E Sequences producing significant al

  2. Dicty_cDB: VFH554 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available RXKXXXXXXXQRXXXXEXXXXXX--- Frame B: eledsklxgxvytkkxn*rxlxxihwxrsxxxrxrkxxx*rgxyxxxiqrxhxxxxkrsn trrxxxrxxxernxxxkgxrxxxaxxxkexxxxx...gxxga--- Frame C: s*ktrnxxgxfiqkkxirgxxhxytgqeaxxagxexaxtkexhxxtxyrxhtxxxxrgat peexxaexxxketgxxkgkggxxxxxtkxxx...ggxxxxxx--- Homology vs CSM-cDNA Score E Sequences produ

  3. Interstellar clouds toward 3C 154 and 3C 353

    International Nuclear Information System (INIS)

    Federman, S.R.; Evans, N.J. II; Willson, R.F.; Falgarone, E.; Combes, F.; Texas Univ., Austin; Tufts Univ., Medford, MA; Meudon, Observatoire, France)

    1987-01-01

    Molecular observations of the interstellar clouds toward the radio sources 3C 154 and 3C 353 were obtained in order to elucidate the physical conditions within the clouds. Maps of (C-12)O emission in the J = 1-0 and J = 2-1 lines were compared with observations of the (C-13)O, CH, and OH molecules. The peak emission in the (C-12)O transitions does not occur in the direction of the continuum sources, and thus, an incomplete picture arises when only one line of sight in the two clouds is analyzed. The cloud toward 3C 154 appears to have a low extinction, but a relatively high CO abundance, suggesting that it is similar to high-latitude clouds and CO-rich diffuse clouds. The cloud toward 3C 353 is considerably denser than that toward 3C 154 and may be more like a dark cloud. 32 references

  4. Dicty_cDB: SHE454 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VTHTPVNVDDNNKCTIDTCTKEGGVTHTPINTDDNNACTLDSCSXXXGVSHTPNK X****xmdl*nscsklnwlx*ippinwddxnxc--- Frame C: lmitmp...vhlipvhhqlvfptpqltvmivihvp*thvqiqpvv*tlqsmlmiiihvl*mlv pnqqvshipq*m*mittnvqlmhvpkkvv*lilqstlmitm...xmiitnvqlihvpkkvv*lilqsilmitmpvplipahxxlvfpippin xddnnxwtcrihvpnstgxgkylqltgtixxxv--- Homology vs CSM-cDNA S

  5. Dicty_cDB: VFL581 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mgc*ccglvnhwflpig*c riy*lanyhlg*nyhynssclvrtiiydlss*kwwlslrclvrfnvmcntssifikiipk dfsft**fnflfky*ygprmve*yewl...gc*ccglvnhwflpig*c riy*lanyhlg*nyhynssclvrtiiydlss*kwwlslrclvrfnvmcntssifikiipk dfsft**fnflfky*ygprmve*yewla

  6. Dicty_cDB: VFM647 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available XYMGGVFDFPCGQTLDHGILIVGYGAQ DTIVGKNTPYWIIKNSWGADWGEAGYLKV Translated Amino Acid sequence (All Frames) Frame A: ---xxxxxxxxxxxxxxxwxxx...xxxxxhhqkxryxnxsylsixcc*wrm*i*lcxswc*n fifhygstk*nsncflliqqwsisycs*c*rmaixygrcfrfpm...IIKNSWGADWGEAGYLKV Frame C: ---xxxxxxxxxxxxxxvvxxxmxxxtsskxxvxkxklpihtxllmenvnltlxklvlkf hlslwfhkmklkllptyst

  7. Dicty_cDB: AFK702 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ity*ptrkcyrnnqnry*w *lhvlsiing*ilsqcnnsirynssnr*qrfsih*wsvlc*ikwsyti*qh*c*srfrin ...rnnqnry*w *lhvlsiing*ilsqcnnsirynssnr*qrfsih*wsvlc*ikwsyti*qh*c*srfrin t*ywsicldrke**wy*rir*tiitrcfsfivltkwn

  8. Irradiation effect on Nite-SiC/SiC composites

    International Nuclear Information System (INIS)

    Hinoki, T.; Choi, Y.B.; Kohyama, A.; Ozawa, K.

    2007-01-01

    Full text of publication follows: Silicon carbide (SiC) and SiC composites are significantly attractive materials for nuclear application in particular due to exceptional low radioactivity, excellent high temperature mechanical properties and chemical stability. Despite of the excellent potential of SiC/SiC composites, the prospect of industrialization has not been clear mainly due to the low productivity and the high material cost. Chemical vapor infiltration (CVI) method can produce the excellent SiC/SiC composites with highly crystalline and excellent mechanical properties. It has been reported that the high purity SiC/SiC composites reinforced with highly crystalline fibers and fabricated by CVI method is very stable to neutron irradiation. However the production cost is high and it is difficult to fabricate thick and dense composites by CVI method. The novel processing called Nano-powder Infiltration and Transient Eutectic Phase (NITE) Processing has been developed based on the liquid phase sintering (LPS) process modification. The NITE processing can achieve both the excellent material quality and the low processing cost. The productivity of the processing is also excellent, and various kinds of shape and size of SiC/SiC composites can be produced by the NITE processing. The NITE processing can form highly crystalline matrix, which is requirement for nuclear application. The objective of this work is to understand irradiation effect of the NITESiC/SiC composites. The SiC/SiC composites used were reinforced with high purity SiC fibers, Tyranno TM SA and fabricated by the NITE method. The NITE-SiC/SiC composite bars and reference monolithic SiC bars fabricated by CVI and NITE were irradiated at up to 1.0 dpa and 600-1000 deg. C at JMTR, Japan. Mechanical properties of non-irradiated and irradiated NITESiC/ SiC composites bars were evaluated by tensile tests. Monolithic SiC bars were evaluated by flexural tests. The fracture surface was examined by SEM. Ultimate

  9. Dicty_cDB: VSJ304 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LPIYRDGDFVLTQSSTIARYIAKKHNFMGKNLEEEFLVD--- ---prvpkklxlni*nvniispkfnlfprswirsilscfiklswnsi*kyysy*nfrcps cns...lyekyfgsfekklqetgflvgssvtladlyvyvgfdyirfrgeaalssel sdekypkiaelkkffesnegvakyikerpetkf*tvfiti Frame C: ktklni*nvniisp

  10. Integration of C1 and C2 Metabolism in Trees

    OpenAIRE

    Jardine, Kolby J.; Fernandes de Souza, Vinicius; Oikawa, Patty; Higuchi, Niro; Bill, Markus; Porras, Rachel; Niinemets, Ülo; Chambers, Jeffrey Q.

    2017-01-01

    C1 metabolism in plants is known to be involved in photorespiration, nitrogen and amino acid metabolism, as well as methylation and biosynthesis of metabolites and biopolymers. Although the flux of carbon through the C1 pathway is thought to be large, its intermediates are difficult to measure and relatively little is known about this potentially ubiquitous pathway. In this study, we evaluated the C1 pathway and its integration with the central metabolism using aqueous solutions of 13C-labele...

  11. Dicty_cDB: CHR636 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available p 8. 48 0.50 1 CO165293 |CO165293.1 FLD1_53_C12.g1_A029 Root flooded Pinus taeda cDNA clone FLD1_53_C12_A029... 5', mRNA sequence. 46 2.0 1 CO165215 |CO165215.1 FLD1_53_C12.b1_A029 Root floode

  12. Forging C-C Bonds Through Decarbonylation of Aryl Ketones.

    Science.gov (United States)

    Somerville, Rosie J; Martin, Ruben

    2017-06-06

    The ability of nickel to cleave strong σ-bonds is again in the spotlight after a recent report that demonstrates the feasibility of using nickel complexes to promote decarbonylation of diaryl ketones. This transformation involves the cleavage of two strong C-C(O) bonds and avoids the use of noble metals, hence reinforcing the potential of decarbonylation as a technique for forging C-C bonds. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  13. Dicty_cDB: SFK882 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ence ptgkfhvykqinkiqvcrdlsihlfvvpcwsslfnksvhtfflvmlsk*iknlvrnhiih tytytyinkylilkngnknnsnkimiptvpkvewnilrsnlips*rvnsydaft...sisxfrxkk Frame C: ptgkfhvykqinkiqvcrdlsihlfvvpcwsslfnksvhtfflvmlsk*iknlvrnhiih tytytyinkylilkngnknnsnkimiptvpkvewnilrsnlips*rvnsydaf

  14. Dicty_cDB: SSJ391 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vrvkkkpergfhgwldelnfrgcskq*nlngdcqgffvaknhrvsv vemeadgfkady*rksqkvrkscalavcti**nr...** lk Frame C: ---gxgi*gcvdiqvrvkkkpergfhgwldelnfrgcskq*nlngdcqgffvaknhrvsv vemeadgfkady*rksqkvrkscalavcti**

  15. Dicty_cDB: CFC794 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available c*nsxw*npspwkskvvitlxmskpkxktkkvfxqin kvsfsxvnn*xxavlxxittskxnplsx*fsd*kvvckxl*kpxlvxpsxwkxkvxitxk msxpkfxtk...tiffck***liiif*ilyffkhikiffflcilfffpfxhin*lckfllklslvkps hwklkvxttlkmsxlkfktkkvfh

  16. Dicty_cDB: SHA333 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SILPIPFKSIIECNGLEEVNQSSKSYKFNDTIKINPFEIKTFR FISN*klkiklinkyknkfn Translated Amino...LQSASVIKEGYSLNNNFYISETPFSLASTTHIDKTFISTNKEAIIVDTIKKAEDGTSFV VRVYESFGGATTFNFTSSILPIPFKSIIECNGLEEVNQSSKSYKFNDT...IKINPFEIKTFR FISN*klkiklinkyknkfn Frame C: KDAIQLEYKDTKIGESFGPSWTNYWFKVTIDVPTDWKD

  17. Dicty_cDB: CFJ554 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Frame A: ---LFPHCSENXLXXXQREXTTXPXRNXPRXGHXSALXXXXRXXXXRPSCTN Frame B: ---sfltvpktxxxxprexxqhxpxexnqdxdtxahxxxxxxxxxx...ghlvq Frame C: ---lsslfrkxaxxxperxxntpx*kxtkxwtlxrtxxxxsxxxxxailyk Hom

  18. Dicty_cDB: CFH318 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ence (All Frames) Frame A: ---VXQXXLXXGIFXSXXVXKPGIFXIXXXGTGAXPGACWKLKKXAKXKXXXX Frame B: ---xxxxxxxxgfsfpxxxknpgflxlxxx...glgpxxghvgn*kxxxkxxsix Frame C: ---xxxxxxxxdfxfxxsxktrdf*xxlxxdwgpsxgmleiekxxxx

  19. Dicty_cDB: SFH756 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available PVSDNQ CQCSVGFSGDDCRQCDNGMVLWASDNGIPMCSPLNSLGKPKTCYAAY Frame B: ---xxxxxxxxxxxxxxxxxxkxxxxx*xxivnwhxxqvlvgsl...vhh*ihwvnqkpvmll Frame C: ---xxxxxxxxkxxxxxxxaxxxxxxxsxx*xigxxxkc*wvrfxk*lyvlxv*w

  20. Dicty_cDB: CHA864 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Frames) Frame A: ---XXXXXXXXXXXXXXXXXXXXXXMXXXIEXXXAAXESXXHGSXXFXYIMRDGXLERXX Frame B: ---xxxxxxxxxxxlxxxxxxxxxxcxvx*rxxx...qqxspxxmdxpfsxil*emvnwkexx Frame C: ---xxxxxxxxxvxxxxxxxxxxxxaxxyre

  1. Dicty_cDB: CHA554 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IIQILNSYFIFLYIVTFHKKKKKKKNLKXXXFXKKK--- ---xxxxxxxxxxxxxxxxxxxxvxxxmsxxxxxcxg*xwxxlcxxxxrxixr*fixrxi rwssr F...GXS GGHP Frame C: ihfyytnikfifyfsiycnis*kkkkkkkfkxxxfxkkk--- ---xxxxxxxxxxxsxxxxxxscxxxyvxlxxxvxrivmxxx

  2. Dicty_cDB: VFN350 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ce update 2001.11.22 Translated Amino Acid sequence iilhpitnkmsfnsrietisrhlstgpilesnptsgsvksgddivivapfrtaick... C: iilhpitnkmsfnsrietisrhlstgpilesnptsgsvksgddivivapfrtaickakrg afketapddllapvikhiikvtkldpn*LEMLLWEQYYQDHHK

  3. Dicty_cDB: VHJ560 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ckivfqfvekqssywvwkfdggnlvvsfksicntsdnanfnfeall* n*xk Translated Amino Acid sequen...eiiryisqnivkrckdd dmvkegfveatqnckivfqfvekqssywvwkfdggnlvvsfksicntsdnanfnfeall* n*xk Frame C: tivilqtynflkcl*

  4. Dicty_cDB: VSJ211 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lpsagvgdmv matvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgnilgpva kecsdlwpkvatnagtiv*inthkvkti*kk--- -...lvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgnilg pvakecsdlgqrlppmpvpxlint* Frame C: k*cqkhkpsvvtteyhsvfqlvls*tvliilvp

  5. Dicty_cDB: VFG826 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available no Acid sequence ---LXXPLNXXTKXMXNXESXEKXKGGVMIXNVSKGALVXAXXAXVGLKSGKXXSLGXXX YENETXYFXQXPXGSIXKXXNXXLLIS*pnvmips...fxpxppxxxkkk Frame C: ---LXXPLNXXTKXMXNXESXEKXKGGVMIXNVSKGALVXAXXAXVGLKSGKXXSLGXXX YENETXYFXQXPXGSIXKXXNXXLLIS*pnvmips

  6. Dicty_cDB: VSE856 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LRTKNKTQLLEHLKELRTELSSLRVAQVKSPNPSKLAKIGTVRKAIARVLTVFN QTQKNHLRAVYSKKSSSKIPTDLRYKKTRAIRRRLTNKQSKVVTLRVSKTATNFPQRVFA VKA*ici*milk...KNHLRAVYSKKSSSKIPTDLRYKKTRAIRRRLTNKQSKVVTLRVSKTATNFPQRVFA VKA*ici*milknkiy*kk Frame C: klkllnsepktrlnylntsrn

  7. Dicty_cDB: VSC875 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NKTQLLEHLKELRTELSSLRVAQVKSPNPSKLAKIGTVRKAIARVLTVF NQTQKNHLRAVYSKKSSSKIPTDLRYKKTRAIRRRFTNKQSKVVTLRVSKTATNFPQRVF AVKA*ici*milk...YSKKSSSKIPTDLRYKKTRAIRRRFTNKQSKVVTLRVSKTATNFPQRVF AVKA*ici*milknkiy* Frame C: kklkllnsepktrlnylntsrnselssqv*

  8. Dicty_cDB: CFC703 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHQAQAAHQVQAQAVLAQAV LVQGRKXI*xi* Frame C: ---ixiiiiiiixmxxxxiixkxxxiiixkxmmxxiimxxxxxxxxmxxxxxxxxx...lxxxlxxxxxxxxxllxxxxlxxxxxxiiiiiiiiiiiiiiii iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii...iiii xkxxmxiimxxxmmxkxxxxxxxxxxxxxxmxxxxmxxxxxxxxxxlxxxqxxxxlxxxq xxxxxxxxlxxxqxxxx

  9. Dicty_cDB: SSB881 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FLNDIKXGIKNQTAVWETKEFRDKYLTLDESK N*iksxxxxxxiiiiiiiiniayfpltlksqkkkkksxi*yk*ffflk...TAVWETKEFRDKYLTLDESK N*iksxxxxxxiiiiiiiiniayfpltlksqkkkkksxi*yk*ffflkk Frame C: ipihqxmmlhtqlpskklrlknnqslln

  10. Radiation effects in C cells

    International Nuclear Information System (INIS)

    Alcaraz Banos, M.; Garcia Ayala, A.; Meseguer Penalver, J.; Genoves Garcia, J.L.

    1994-01-01

    The para follicular cell (C cell) ultrastructure of euthyroid, propyl thiouracil-treated (PTU) and protyrreline-treated (TRH) irradiated rabbit thyroid gland was studied. The ultrastructural features of C cells in the non-irradiated thyroid glands were similar to those described in other mammals. We have not observed the disappearance of the C cells in irradiated thyroid glands. Clusters of C cells were occasionally observed in the irradiated glands. The irradiated C cells showed intranuclear, filamentous bundles and a dense body together with a well-developed endoplasmic reticulum and numerous secretory vesicles. C cells follicles could be observed in irradiated and TRH-treated animals. (Author)

  11. Dicty_cDB: CHM552 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available actuca sativa cDNA clone QGB20J11, mRNA sequence. 80 6e-11 1 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA ...Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence. 54 3e-09 3 CV172465 |CV172465.1 rsmsx

  12. Dicty_cDB: SHL126 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ce. 52 6e-09 5 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorr...hiza cDNA 5', mRNA sequence. 54 7e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.scf cDNA Library of Salvia m

  13. Dicty_cDB: CHJ706 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 09 6 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA ...5', mRNA sequence. 54 2e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.scf cDNA Library of Salvia miltiorrhiz

  14. Dicty_cDB: SHJ838 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza S...alvia miltiorrhiza cDNA 5', mRNA sequence. 54 6e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.scf cDNA Libra

  15. Dicty_cDB: CHN523 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available -09 5 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA... 5', mRNA sequence. 54 5e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.scf cDNA L

  16. Dicty_cDB: SHG607 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sativa cDNA clone QGJ1L02, mRNA sequence. 80 9e-11 1 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library... of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence. 54 6e-09 3 CV172465 |CV172465.1 rsmsxlre

  17. Dicty_cDB: VSD136 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 8 |CB290208.1 UCRCS01_01aa10_g1 Washington Navel orange cold acclimated flavedo & albedo cDNA library Citrus....1 UCRCS01_04cd07_g1 Washington Navel orange cold acclimated flavedo & albedo cDNA library Citrus sinensis c

  18. Dicty_cDB: SHE451 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available evipalpis DNA, complete genome. 34 0.015 17 CV091260 |CV091260.1 NA1759 cDNA non acclimated Bluecrop library... Vaccinium corymbosum cDNA 5', mRNA sequence. 46 0.036 2 CV091166 |CV091166.1 NA1661 cDNA non acclimated Blu

  19. Dicty_cDB: SFE866 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cDNA library MtBC from arbuscular mycorrhiza of cultivar Jemalong of Medicago tru...protein. 94 1e-21 2 AL385573 |AL385573.1 Medicago truncatula EST MtBC29C12F1 : T3 end of clone MtBC29C12 of

  20. Dicty_cDB: SSJ172 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cDNA library MtBC from arbuscular mycorrhiza of cultivar Jemalong of Medicago tru...te cds. 494 e-147 3 AL386374 |AL386374.1 Medicago truncatula EST MtBC34C06F1 : T3 end of clone MtBC34C06 of

  1. Dicty_cDB: SHJ446 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available X4, complete sequence. 42 0.41 8 CX076494 |CX076494.1 UCRCS08_50C12_g Parent Washington Navel Orange Callus ... |CX076493.1 UCRCS08_50C12_b Parent Washington Navel Orange Callus cDNA Library U

  2. Dicty_cDB: VSI127 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available w*nwnw*iksccnchtkftrvngfiqkcfwc*c**tses s*twcnnsicwirkykn*itpsiwr*itn*kffkkesirwy...ii*yqyrkw*qnw*yyw*nwnw*iksccnchtkftrvngfiqkcfwc*c**tses s*twcnnsicwirkykn*itpsiwr*itn*kffkkesirwyssylfrs**ys...scsqnfis rkc*ny*sntkdwcsw*TSCFLTSKINEWCFSRIRRKIKIIYRIFFKKK--- ---lnk**ii*yqyrkw*qnw*yyw*nwnw*iksccnchtkftrvngfiqkcfwc*c**t sess*twcnn

  3. Remote mechanical C line

    International Nuclear Information System (INIS)

    Nuttall, K.R.; Gardner, P.R.

    1991-01-01

    Westinghouse Hanford Company is developing a desk-top simulation based training program on the operation of the Remote Mechanical C (RMC) Line process in the Plutonium Finishing Plant on the Hanford site, Richland, Washington. Simulations display aod contioually update current values of system parameters on computer graphics of RMC line equipment. Students are able to operate a variety of controllers to maintain proper system status. Programmed faults, selectable by the course instructor, can be used to test student responses to off-normal events. Prior to operation of the simulation, students are given computer-based tutorials on the function, processes, operation, and error conditions associated with individual components. By including the capability of operating each individual component - valves, heaters, agitators, etc. - the computer-based training (CBT) lessons become an interactive training manual. From one perspective RMC represents one step in the diffusion of the well-known and well-documented simulator training activities for nuclear reactor operators to other training programs, equally critical, perhaps, but less well scrutinized in the past. Because of the slowly responding nature of the actual process, RMC can retain many of the capabilities of practice and testing in a simulated work environment while avoiding the cost of a full scale simulator and the exposure and waste developed by practice runs of the RMC line. From another perspective RMC suggests training advances even beyond the most faithful simulators. For example, by integrating CBT lessons with the simulation, RMC permits students to focus in on specific processes occurring inside chosen components. In effect, the interactive training manual is available on-line with the simulation itself. Cost are also discussed

  4. Generation of a C3c specific monoclonal antibody and assessment of C3c as a putative inflammatory marker derived from complement factor C3

    DEFF Research Database (Denmark)

    Palarasah, Yaseelan; Skjodt, Karsten; Brandt, Jette

    2010-01-01

    complex (C5b-C9) and quantification of complement split products by precipitation-in-gel techniques (e.g. C3d). We have developed a mouse monoclonal antibody (mAb) that is able to detect fluid phase C3c without interference from other products generated from the complement component C3. The C3c specific m....... The C3c mAb was confirmed to be C3c specific, as it showed no cross-reactivity with native (un-cleaved) C3, with C3b, iC3b, or with C3d. Also, no significant reaction was observed with C3 fragments in factor I deficient sera or plasma. This antibody forms the basis for the generation of a robust ELISA...... that allows for a quick and reliable evaluation of complement activation and consumption as a marker for inflammatory processes. We established the C3c plasma range in 100 healthy Danish blood donors with a mean of 3.47 μg/ml and a range of 2.12-4.92 μg/ml. We believe that such an antibody might...

  5. Dicty_cDB: VHJ195 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available -B/AFN547Q.Seq.d/ 1342 0.0 SLE172 (SLE172Q) /CSM/SL/SLE1-C/SLE172Q.Seq.d/ 1102 0.0 SLD492 (SLD492Q) /CSM/SL/SLD4-D/SLD492...8502 ) Dictyostelium discoideum cDNA clone:dda28m11, 5' ... 839 0.0 2 ( AU052538 ) Dictyostelium discoideum slug cDNA, clone SLD492...2597 ) Dictyostelium discoideum slug cDNA, clone SLD569. 113 2e-20 1 ( AU061182 ) Dictyostelium discoideum slug cDNA, clone SLD492

  6. Alcator C-Mod Tokamak

    Data.gov (United States)

    Federal Laboratory Consortium — Alcator C-Mod at the Massachusetts Institute of Technology is operated as a DOE national user facility. Alcator C-Mod is a unique, compact tokamak facility that uses...

  7. CoC Dashboard Reports

    Data.gov (United States)

    Department of Housing and Urban Development — Continuum of Care (CoC) Homeless Assistance Programs Dashboard Reports are available for each CoC and include information on each CoC’s awards by award amount,...

  8. Human complement component C3

    DEFF Research Database (Denmark)

    Behrendt, N

    1985-01-01

    The two common genetic variants of human C3, C3 S and C3 F, were purified and characterized by SDS-PAGE, agarose gel electrophoresis, isoelectric focusing and amino acid analysis. The difference in electrophoretic mobility between the two variants was conserved after purification, and by isoelect......The two common genetic variants of human C3, C3 S and C3 F, were purified and characterized by SDS-PAGE, agarose gel electrophoresis, isoelectric focusing and amino acid analysis. The difference in electrophoretic mobility between the two variants was conserved after purification......, and by isoelectric focusing of the hemolytically active proteins, pI values of 5.86 and 5.81 were determined for C3 S and C3 F, respectively. Any difference in amino acid composition was too small to be detected by amino acid analysis, and the two proteins had the same molecular weight as determined by SDS-PAGE....

  9. SiC-SiC and C-SiC Honeycomb for Advanced Flight Structures, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — The proposed project builds upon the work done in Phase I with the development of a C-SiC CMC honeycomb material that was successfully tested for mechanical...

  10. Hepatitis C: Sex and Sexuality

    Science.gov (United States)

    ... with Hepatitis » Sex and Sexuality: Entire Lesson Viral Hepatitis Menu Menu Viral Hepatitis Viral Hepatitis Home For ... hepatitis C virus through sex. Can you pass hepatitis C to a sex partner? Yes, but it ...

  11. Preventing hepatitis B or C

    Science.gov (United States)

    ... page: //medlineplus.gov/ency/patientinstructions/000401.htm Preventing hepatitis B or C To use the sharing features on this page, please enable JavaScript. Hepatitis B and hepatitis C infections cause irritation and ...

  12. Nitazoxanide for chronic hepatitis C

    DEFF Research Database (Denmark)

    Nikolova, Kristiana; Gluud, Christian; Grevstad, Berit

    2014-01-01

    BACKGROUND: Hepatitis C infection is a disease of the liver caused by the hepatitis C virus. The estimated number of chronically infected people with hepatitis C virus worldwide is about 150 million people. Every year, another three to four million people acquire the infection. Chronic hepatitis C......) and ribavirin was the approved standard treatment for chronic hepatitis C. In 2011, first-generation direct-acting antivirals (DAAs) have been licensed, for use in combination with peginterferon and ribavirin for treating hepatitis C virus genotype 1 infection. Nitazoxanide is another antiviral drug with broad...... antiviral activity and may have potential as an effective alternative, or an addition to standard treatment for the treatment of the hepatitis C virus. OBJECTIVES: To assess the benefits and harms of nitazoxanide in people with chronic hepatitis C virus infection. SEARCH METHODS: We searched The Cochrane...

  13. Structures, stabilities, aromaticity, and electronic properties of C66 fullerene isomers, anions (C662-, C664-, C666-), and metallofullerenes (Sc2-C66)

    International Nuclear Information System (INIS)

    Cui Yanhong; Tian, Wei Quan; Feng Jikang; Chen Deli

    2010-01-01

    Among all the 4478 classical isomers of C 66 , C 66 (C s :0060) with the lowest number of pentagon-pentagon fusions was predicted to be the most stable isomer, followed by isomers C 66 (C 2v :0011) and C 66 (C 2 :0083). The infrared spectra and aromaticity of the most stable isomers were predicted. The relative stabilities of C 66 isomers change with charges or doping of metals. The structures and relative stabilities of the most stable metallofullerenes were delineated and compared with experiment. Sc 2 -C 66 (C 2 :0083) was predicted to be the most stable metallofullerene, although Sc 2 -C 66 (C 2v :0011) was observed. Charge-transfer from Sc 2 to the fused pentagons and the bonding between these two moieties significantly decrease the strain energies caused by the pair of fused pentagons thereby stabilizing the fullerene cage.

  14. Screening effects on 12C+12C fusion reaction

    Science.gov (United States)

    Koyuncu, F.; Soylu, A.

    2018-05-01

    One of the important reactions for nucleosynthesis in the carbon burning phase in high-mass stars is the 12C+12C fusion reaction. In this study, we investigate the influences of the nuclear potentials and screening effect on astrophysically interesting 12C+12C fusion reaction observables at sub-barrier energies by using the microscopic α–α double folding cluster (DFC) potential and the proximity potential. In order to model the screening effects on the experimental data, a more general exponential cosine screened Coulomb (MGECSC) potential including Debye and quantum plasma cases has been considered in the calculations for the 12C+12C fusion reaction. In the calculations of the reaction observables, the semi-classical Wentzel-Kramers-Brillouin (WKB) approach and coupled channel (CC) formalism have been used. Moreover, in order to investigate how the potentials between 12C nuclei produce molecular cluster states of 24Mg, the normalized resonant energy states of 24Mg cluster bands have been calculated for the DFC potential. By analyzing the results produced from the fusion of 12C+12C, it is found that taking into account the screening effects in terms of MGECSC is important for explaining the 12C+12C fusion data, and the microscopic DFC potential is better than the proximity potential in explaining the experimental data, also considering that clustering is dominant for the structure of the 24Mg nucleus. Supported by the Turkish Science and Research Council (TÜBİTAK) with (117R015)

  15. Alcohol Use and Hepatitis C

    OpenAIRE

    Peters, Marion G.; Terrault, Norah A.

    2002-01-01

    Excess alcohol consumption can worsen the course and outcome of chronic hepatitis C. It is important to distinguish between alcohol abuse, which must be treated on its own merits, and the effect of alcohol use on progression, severity, and treatment of hepatitis C. Most studies on the effects of alcohol on hepatitis C have focused on patients, with high levels of daily alcohol intake. Indeed, the adverse effects of light and moderate amounts of alcohol intake on hepatitis C virus (HCV) infect...

  16. Creep properties of heat-resistant superalloys for nuclear plants in helium

    International Nuclear Information System (INIS)

    Shimizu, Shigeki; Satoh, Keisuke; Matsuda, Shozo; Murase, Hirokazu; Fujioka, Junzo.

    1979-01-01

    In order to estimate the creep and rupture strengths of candidate alloys for the intermediate heat exchanger of VHTR, creep and stress rupture tests in impure helium were conducted on Hastelloy X, Inconel 617, Inconel 625, Incoloy 800 and Incoloy 807 at 900 0 C. The results were discussed in comparison with those in air and the alloys were examined from the point of view of the elevated temperature structural design. The main results obtained are summarized as follows: (1) No appreciable decrease in creep and rupture strengths in helium as compared with those in air is observed on Hastelloy X and Inconel 625. On the contrary, the creep and rupture strengths of Inconel 617 in helium decrease slightly as compared with those in air. In the case of Incoloy 807, the creep strength to cause 1 percent total strain and that to initiate secondary creep increase remarkably in helium as compared with those in air. However, the creep strength to cause initiation of tertiary creep and the rupture strength in helium remarkably decrease as compared with those in air. (2) The order of magnitude of the S 0 value for each material in helium is as follows; Hastelloy X > Inconel 617 > Incoloy 807 > Inconel 625 > Incoloy 800 Meanwhile, that of the S sub(t) value in helium is; Inconel 617 > Hastelloy X > Incoloy 807 > Inconel 625 > Incoloy 800. (author)

  17. Creep properties of superalloys for the HTGR in impure helium environments

    International Nuclear Information System (INIS)

    Kawakami, H.; Nakanishi, T.

    1981-01-01

    This paper describes creep behaviors of two heat resistant alloys, Hastelloy X and Incoloy 800, in helium environments of the HTGR. In impure helium environments, these alloys are susceptible to carburization and oxidization. We have investigated these effects separately, and related them to the creep behaviors of the alloys. Experiments were carried out at 900 0 C both in helium and in air. Carburization results in decrease of secondary creep strain rate and delay of tertiary creep initiation. Oxidization caused decrease in tertiary creep strain rate of Hastelloy X, but did not that of Incoloy 800. Enhancement in tertiary creep strain rate of Hastelloy X in a very weakly oxidizing environment was confirmed in creep crack growth experiment using notched plate specimens. The rupture time of Hastelloy X in helium was short when compared with in air. Stress versus rupture time curves for both environments were parallel up to 5000 hours test, and a ratio of rupture stress in helium to that in air was about 0.9. In case of Incoloy 800, rupture time in helium was markedly prolonged as compared with that in air. (orig.)

  18. Hi-C First Results

    Science.gov (United States)

    Cirtain, Jonathan

    2013-01-01

    Hi-C obtained the highest spatial and temporal resolution observatoins ever taken in the solar corona. Hi-C reveals dynamics and structure at the limit of its temporal and spatial resolution. Hi-C observed ubiquitous fine-scale flows consistent with the local sound speed.

  19. Outlook on EDRS-C

    Science.gov (United States)

    Migliore, R.; Duncan, J.; Pulcino, V.; Bourne, D.; Voegt, S.; Perez, G.

    2017-09-01

    EDRS-C will operate on a geostationary orbit as the second node of the European Data Relay System (EDRS). The EDRS-C satellite, designed by OHB System as prime contractor, has been procured in the frame of a Public Private Partnership (PPP) between Airbus Defence and Space and ESA. EDRS-C is currently under assembly at OHB facilities in Bremen.

  20. A complex of cardiac cytochrome c1 and cytochrome c.

    Science.gov (United States)

    Chiang, Y L; Kaminsky, L S; King, T E

    1976-01-10

    The interactions of cytochrome c1 and cytochrome c from bovine cardiac mitochondria were investigated. Cytochrome c1 and cytochrome c formed a 1:1 molecular complex in aqueous solutions of low ionic strength. The complex was stable to Sephadex G-75 chromatography. The formation and stability of the complex were independent of the oxidation state of the cytochrome components as far as those reactions studied were concerned. The complex was dissociated in solutions of ionic strength higher than 0.07 or pH exceeding 10 and only partially dissociated in 8 M urea. No complexation occurred when cytochrome c was acetylated on 64% of its lysine residues or photooxidized on its 2 methionine residues. Complexes with molecular ratios of less than 1:1 (i.e. more cytochrome c) were obtained when polymerized cytochrome c, or cytochrome c with all lysine residues guanidinated, or a "1-65 heme peptide" from cyanogen bromide cleavage of cytochrome c was used. These results were interpreted to imply that the complex was predominantly maintained by ionic interactions probably involving some of the lysine residues of cytochrome c but with major stabilization dependent on the native conformations of both cytochromes. The reduced complex was autooxidizable with biphasic kinetics with first order rate constants of 6 X 10(-5) and 5 X U0(-5) s-1 but did not react with carbon monoxide. The complex reacted with cyanide and was reduced by ascorbate at about 32% and 40% respectively, of the rates of reaction with cytochrome c alone. The complex was less photoreducible than cytochrome c1 alone. The complex exhibited remarkably different circular dichroic behavior from that of the summation of cytochrome c1 plus cytochrome c. We concluded that when cytochromes c1 and c interacted they underwent dramatic conformational changes resulting in weakening of their heme crevices. All results available would indicate that in the complex cytochrome c1 was bound at the entrance to the heme crevice of

  1. Java to C: A Primer

    DEFF Research Database (Denmark)

    McDowell, Charlie; Villadsen, Jørgen

    This book is designed to be used as a quick introduction to C for programmers already familiar with Java. It is not a replacement for a reference book on C but is instead a supplement. For the programmer already familiar with Java, the typical book on C requires the reader to wade through many...... details of already-familiar material. In this book, we quickly present the main concepts needed to begin writing serious programs in C, highlighting the differences between C and Java....

  2. Substrate-Mediated C-C and C-H Coupling after Dehalogenation.

    Science.gov (United States)

    Kong, Huihui; Yang, Sha; Gao, Hongying; Timmer, Alexander; Hill, Jonathan P; Díaz Arado, Oscar; Mönig, Harry; Huang, Xinyan; Tang, Qin; Ji, Qingmin; Liu, Wei; Fuchs, Harald

    2017-03-15

    Intermolecular C-C coupling after cleavage of C-X (mostly, X = Br or I) bonds has been extensively studied for facilitating the synthesis of polymeric nanostructures. However, the accidental appearance of C-H coupling at the terminal carbon atoms would limit the successive extension of covalent polymers. To our knowledge, the selective C-H coupling after dehalogenation has not so far been reported, which may illuminate another interesting field of chemical synthesis on surfaces besides in situ fabrication of polymers, i.e., synthesis of novel organic molecules. By combining STM imaging, XPS analysis, and DFT calculations, we have achieved predominant C-C coupling on Au(111) and more interestingly selective C-H coupling on Ag(111), which in turn leads to selective synthesis of polymeric chains or new organic molecules.

  3. Effective modern C++ 42 specific ways to improve your use of C++11 and C++14

    CERN Document Server

    Meyers, Scott

    2015-01-01

    At first glance, C++11 and C++14 are defined by the new features they introduce, e.g., auto type declarations, move semantics, lambda expressions, and concurrency support. Information on these features is easy to come by, but learning to apply them effectively (such that the resulting software is correct, efficient, maintainable, and portable) is more challenging. That’s the role of this book. It describes how to write effective software using C++11 and C++14, i.e., using modern C++. Topics include: * The pros and cons of uniform initialization, noexcept specifications, perfect forwarding, and smart pointer make functions. * The relationships among std::move, std::forward, rvalues references, and universal references. * The most effective forms of lambda capture. * How best practices in “old” C++ programming (i.e., C++98) require revision for modern C++. Effective Modern C++ follows the proven format of Scott Meyers’ earlier Effective books (Effective C++, More Effective C++, and Effective STL), but c...

  4. Quantification of C=C and C=O Surface Carbons in Detonation Nanodiamond by NMR

    Energy Technology Data Exchange (ETDEWEB)

    Cui, J -F; Fang, X -W; Schmidt-Rohr, K

    2014-05-08

    The ability of solid-state 13C NMR to detect and quantify small amounts of sp2-hybridized carbon on the surface of ~5 nm diameter nanodiamond particles is demonstrated. The C=C carbon fraction is only 1.1 ± 0.4% in pristine purified detonation nanodiamond, while a full single-layer graphitic or “bucky diamond” shell would contain ca. 25% of all C in a 5 nm diameter particle. Instead of large aromatic patches repeatedly proposed in the recent literature, sp3-hybridized CH and COH carbons cover most of the nanodiamond particle surface, accounting for ~5% each. C=O and COO groups also seen in X-ray absorption near-edge structure spectroscopy (XANES) but not detected in previous NMR studies make up ca. 1.5% of all C. They are removed by heat treatment at 800 °C, which increases the aromatic fraction. 13C{1H} NMR demonstrates that the various sp2-hybridized carbons are mostly not protonated, but cross-polarization shows that they are separated from 1H by only a few bond lengths, which proves that they are near the protonated surface. Together, the observed C–H, C–OH, C=O, and C=C groups account for 12–14% of all C, which matches the surface fraction expected for bulk-terminated 5 nm diameter diamond particles.

  5. Nanosized f.c.c. thallium inclusions in aluminium

    International Nuclear Information System (INIS)

    Johnson, E.; Johansen, A.; Thoft, N.B.; Andersen, H.H.; Sarholt-Kristensen, L.

    1993-01-01

    Ion implantation of pure aluminium with thallium induces the formation of nanosized crystalline inclusions of thallium with a f.c.c. structure. The size of the inclusions depends on the implantation conditions and subsequent annealing treatments and is typically in the range from 1 to 10 nm. The inclusions are aligned topotactically with the aluminium matrix with a cube-cube orientation relationship and they have a truncated octahedral shape bounded by {111} and {001} planes. The lattice parameter of the f.c.c. thallium inclusions is 0.484 ± 0.002 nm, which is slightly but significantly larger than in the high-pressure f.c.c. thallium phase known to be stable above 3.8 GPa. (Author)

  6. Electronically excited C 2 from laser photodissociated C 60

    Science.gov (United States)

    Arepalli, S.; Scott, C. D.; Nikolaev, P.; Smalley, R. E.

    2000-03-01

    Spectral and transient emission measurements are made of radiation from products of laser excitation of buckminsterfullerene (C 60) vapor diluted in argon at 973 K. The principal radiation is from the Swan band system of C 2 and, at early times, also from a black-body continuum. Transient measurements indicate two characteristic periods of decay 2 and 50 μs long, with characteristic decay times of ˜0.3 and 5 μs, respectively. The first period is thought to be associated with decomposition and radiative cooling of C 60 molecules or nano-sized carbon particles and the second period continues with decomposition products of laser excited C 60, C 58, C 56, etc.

  7. Dicty_cDB: SLA508 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e-101 SLD569 (SLD569Q) /CSM/SL/SLD5-C/SLD569Q.Seq.d/ 250 1e-65 SLD492 (SLD492Q) /CSM/SL/SLD4-D/SLD492...oideum slug cDNA, clone SLD569. 250 2e-62 1 ( AU052538 ) Dictyostelium discoideum slug cDNA, clone SLD492. 7

  8. Dicty_cDB: AFH685 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 99 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequence....dration Library Tortula ruralis cDNA, mRNA sequence. 70 4e-08 1 CK030146 |CK030146.....1 TTE00006978 Normalized large Tetrahymena thermophila cDNA, mRNA sequence. 74 3e-09 1 CN206834 |CN206834.1 Tor7258 Gametophyte rehy

  9. Dicty_cDB: AFK467 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequenc....1 Tor7258 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequence. 70 5e-08 1 CK030146 |CK03014...55.1 TTE00006978 Normalized large Tetrahymena thermophila cDNA, mRNA sequence. 74 3e-09 1 CN206834 |CN206834

  10. Dicty_cDB: AFH538 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e-165 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequence. 7...ge Tetrahymena thermophila cDNA, mRNA sequence. 74 3e-09 1 CN206834 |CN206834.1 Tor7258 Gametophyte rehydr...ation Library Tortula ruralis cDNA, mRNA sequence. 70 5e-08 1 CK030146 |CK030146.1

  11. Dicty_cDB: SLJ419 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |CB367289.1 E38 early-oocyst library Plasmodium berghei/Anopheles stephensi mixe...7 |CB367287.1 E830 early-oocyst library Plasmodium berghei/Anopheles stephensi mixed EST library cDNA clone ...oocyst library Plasmodium berghei/Anopheles stephensi mixed EST library cDNA clon...ly-oocyst library Plasmodium berghei/Anopheles stephensi mixed EST library cDNA clone E3015 similar to Plasm

  12. Dicty_cDB: SFF870 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available aiiishhxhxsssxxxs xxss Frame C: anrkasicilnlylyks*innnnkknkknsiswfvriiilfffqkkx*kk--- ---adxxxxxxdhxxxhhhhxxg*x*xsxxxxsx*ssxxc...ssxxssxxcxsxcssxxxcx xxsxsxxsxxsx*xxxsxxss*sxs*xxxxsxsx*sxsssxxxssxxsxxxxxssxxsxs sxsxssss

  13. Dicty_cDB: VFA373 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available qlfqeilkkmfnmplkvsngwvy*vlmkkl*irilqsivfalyskr nsltklvnvm*lslnitlssntlivqkkkfhhsfvmvfqmvvlqlhsllvfqlvsqlnss lmvklqlevllvq*llilftnfrei...kixkyxxxklnkk*kikkklifkkn Homology vs CSM-cDNA Score E S

  14. Dicty_cDB: VHE632 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KKIFXFFFXKKK--- ---YKKLFINNIYIQWVTEHSKHTTVTT*aldtitsrpttvitiitltsisktteaklx* epiavntfqlvtinkftshttytvtnqxst*...tshttytvtnqxst*ntttvkxqskvittxtylltvtvmsxxpi ttiimlxskntsykqinkxkkk Homology vs CSM-cDNA Score E Sequences p

  15. Dicty_cDB: SHB845 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ASNKQKK--- ---FNIVGNVKMAATATVYANIDALMSITTSTQTSIYQSSTKTVNGKTTTQSSSRSSSSI YKQFVPMIVCSGTADVAW*xqcrcfrsqsr*ncxmvlysnssqpqllkvmsx...I YKQFVPMIVCSGTADVAW*xqcrcfrsqsr*ncxmvlysnssqpqllkvmsxqlavsxqa Frame C: cwptgiqsnkqktti*knnnl**sknn*ritncffl

  16. Dicty_cDB: AFN538 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nk*tnkkknkkwmxkmfkl*llimvqvcvklvllvmmlhvlfshql lvvqdtlvlwlvwvkrihmsxmklnqkevf*hlsiqlnmvlspigmiwkksgiilfimnf ...irwynyvpryc*sye*rinctctinnen*nyct Frame C: llnnskdfnyililnk*tnkkknkkwmxkmfkl*llimvqvcvklvllvmmlhvlfshql lvvqdtlvlwlvwvkrihmsx

  17. Dicty_cDB: VHH141 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available avntfqlvtinkftshttytvtthssx*ntttvkxqskvittttslltvtvmsxppit tiimllskntsxkqinktikmckilk Translated Amino Acid ...tvtthssx*ntttvkxqskvittttslltvtvmsxppit tiimllskntsxkqinktikmckilk Homology vs CSM-cDNA Score E Sequences pr

  18. Dicty_cDB: CFG476 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lts*pkvkkfhsqfh*nht lihhllmmvihtiqlafhfkdsiexilcyysi Translated Amino Acid sequence (All Frames) Frame A: ii...pststf*vlkksfqilklts*pkvkkfhsqfh*nht lihhllmmvihtiqlafhfkdsiexilcyysi Frame C: ns*NLFFIVLNIFFKMKKIILFLTVLLVL

  19. Dicty_cDB: VFA445 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available C: teinnvi*lq*dlshstssirkgknrr*ikscr*iwfkeqkrsmespirfsqnqkgc*rt prs**krpktyl*rfss...kr*rrkln**--- ---teinnvi*lq*dlshstssirkgknrr*ikscr*iwfkeqkrsmespirfsqnqkgc *rtprs**krpktyl*rfsspp*tpqirchgri

  20. Dicty_cDB: VSK150 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NAAACAATTTAAAAAAAAAAAAACTAAAAATATCC sequence update 2001. 3.22 Translated Amino Acid sequence kvn*slllilnihrilqmmilk...rame C: kvn*slllilnihrilqmmilknslksyqklppllfqnlivnrlvsqr*TLIPTNKVLMV VLVVLINNMVVLMVIKNNNNKVLILLILVLNLVVVVHNK

  1. Efficient C/C++ programming smaller, faster, better

    CERN Document Server

    Heller, Steve

    1994-01-01

    Efficient C/C++ Programming describes a practical, real-world approach to efficient C/C++ programming. Topics covered range from how to save storage using a restricted character set and how to speed up access to records by employing hash coding and caching. A selective mailing list system is used to illustrate rapid access to and rearrangement of information selected by criteria specified at runtime.Comprised of eight chapters, this book begins by discussing factors to consider when deciding whether a program needs optimization. In the next chapter, a supermarket price lookup system is used to

  2. Dicty_cDB: VFD294 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SSESLDN DDEEVNQINSKLPTKMTLRDQY Frame B: ---vxxxrxxxxxxxxxxxxxxxxxxxxx*x*fxyxxqx*f...lkmkmtmtmmmmmkkrkslklkvqighqsp*im mmkkltksipnyqlk*l*eint Frame C: ---fxxxgxxxxxxxxxxxxxxxxxxxxlxxdsxxxxkxdfx

  3. Dicty_cDB: CFF802 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available XTXXTKXTXSTKXTXXTKXTXSTKXTXSTKXTXXTKSPXSTXSTKPT XSTKXKXKKKTGKKKQKKTE Frame B: tfglssikfplk*y**YYKIIVIVQFVSFLFFFFXKXX--- ---d*qxxxxx...qxxxxxqnxxxqqnxxxxqnxxxxqnxxxxqnxxxqqnpxxxxxxqnxx xxqkxnxk...kkxekknkkkqk Frame C: llvylvssfh*nninniik***lynlyhsfffffxkxn--- ---inxxnxxnxxxxxnkxnxxnkxxxxxkxxxxxkxxxxxkxxxxnkipxxxxxx

  4. Dicty_cDB: AFL721 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VRRADALNKILQDIGFPSICIHRDLDQKDRIEQYRKFKNFESRIMVATNIFGR GIDIERVNVVINYDMAESA Frame B: ---xxxvxxvxxxxxxxxxxxxxmvvxxlxmvxxnxxx...tlnlvswlplislvv vsilnvsmsssttiwlnl Frame C: ---xxxxxx*xxyxxxxxxxxxxw*xxxxxwxxxxxxxnx*rxke*kth*txgfirl*ss ryf

  5. Dicty_cDB: CFI277 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nslated Amino Acid sequence (All Frames) Frame A: ---xxxxxxxxxxxxxnxxxxxxkgxxxxxkxxxxkxyxxxxqxkx*cnxknrixtfn...NKTPVKPKLGEYG QKSIKTK Frame C: ---xxxxxxxxxxxxqxxxxxxxrxxxxxkxlxxqxixxxsxxqtxmq*xk*nxhfqslq ingsspxq*nis*vsa

  6. Dicty_cDB: CFH289 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IFQKFHQHFQKNKIK*ikifk Translated Amino Acid sequence (All Frames) Frame A: ---vxxxxxnxxxxxnxxxxxnxxxxxxxxxxxkxkxxxxxxr*xxxtxxxx...VVQTNSPKSESTLSDYASYFD QFLNIVDLFTQKYNQQHQQDKKVKIITKLIIXKXKIIFQKFHQHFQKNKIK*ikifk Frame C: ---xxxxxxxxxxxxfxxxxxfxxxxxxxxxxkxkxxxxxx

  7. Dicty_cDB: SFJ266 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tpvqyenvkstvpaifdiai tiktdaknti*neindniyasndhrx*txxxxixxxxxxxxxxxxxxxxxxlxxxxxx--...k*iinmmnptktir**inwy*ksge*yqyy*ytcti*kc*insssni*hcyy hkn*c*kyhik*nq**yicfk*psxmnxtxxxxxxxxxxxxxxxxxxxxxxxxxxxx

  8. Dicty_cDB: AFM417 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e (All Frames) Frame A: kfifiiqilnsyfiflyivtfhkkkkkkkxlkxxlf*kkk--- ---xxxxxgxxxxxxxrxx*yxxcxxxxxxxxryxxxxxxixfxwxxixxwxxxx...ENVKTKI QDKEGIP Frame C: ihfyytnikfifyffiycnis*KKKKKKKXKXSXFLKKK--- ---xxxxwxxxxxxxxxxxixxxxxxxxxxxkvxxxxxkx

  9. Dicty_cDB: VSJ617 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 01. 3.26 Translated Amino Acid sequence rinfiqnqlnlkklnywrn*nqiqnqvifgklninqln*y*...msidhp*tn**mlgsstk**tnfq*ylktfrsfggki ilfftrytlvvk**srggertskerafq*nyrvftgkkihsqsfknnli Frame C: rinfiqnqlnl

  10. Dicty_cDB: SHF238 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EGALKIKEITYCHAEGYSGGALKHGPFALIEQDTPIILIILE***fsinesr Translated Amino Acid sequence (All Frames) Frame A: il...YCHAEGYSGGALKHGPFALIEQDTPIILIILE***fsinesr Frame C: ssyklsniekknnnnni*LTIEIKNISKN

  11. Dicty_cDB: CHO707 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available itdkkivmiiiqkqlivaiprlvnvltnhimlsqvvli*sl v*lgshwwgtggkgmqnxkxxtll Frame C: vllipqsm*miitnvqlihvpkkvv*lilqsilmitm...smpvpnqq vllipxsm*mittnvqlmhvpkxvv*lipqsilmitmpvqlmhvqkkvv*phtsxqy*** qclypltpvxhplafptpqltaxixipcxvxlmf---

  12. Dicty_cDB: SSH521 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KKKKKKKKKKKKRKQIKNIYIYI* nikeiiq Translated Amino Acid sequence (All Frames) Frame A: ---enxkknfaifexapqesxg...KNLXLNTFFKKKKKKKKKKKKKKRKQIKNIYIYI* nikeiiq Frame C: ---kx*kelcnl*xcssrikxcpx*ktcx*ilflkkkkkkkkkkkkkkenkskiy

  13. Dicty_cDB: VSE508 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GAPSDEDRHVGDLGNIVADGESNTKGTISDKIISLFGEHTI VGRTMVVHADQDDLGKGGKPDSLTTGAAGARLGCGVIGVSQ*isn*nktllnikeappfy yyyfl...DSLTTGAAGARLGCGVIGVSQ*isn*nktllnikeappfy yyyfl Homology vs CSM-cDNA Score E Seque

  14. Dicty_cDB: SFJ810 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available y*rehfkqfe*cqtyy*rkcp*csknrlstkgtsswik* Frame C: yslyy*fvfkkfikikiinfk*ikr*kkmtdnwdkeklakkaaeglknakntassyasgi naskdqlnsnfknike...eqklikqkh*kk--- ---yslyy*fvfkkfikikiinfk*ikr*kkmtdnwdkeklakkaaeglknakntassya sginaskdqlnsnfknikenissnlnnakht

  15. Dicty_cDB: VSB406 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GTVRKAIARVLTVFNQTQKNHLR XVYSKKSSSKIPTDLRYKKTRAIRRRLTNKQSKVVTLRVSKTATNFPQRVFAVKA*ici* milknkiy Translated Ami...RRLTNKQSKVVTLRVSKTATNFPQRVFAVKA*ici* milknkiy Homology vs CSM-cDNA Score E Sequences producing significant a

  16. Dicty_cDB: VSA330 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available QKNHLRAVYSKKSSSKIPTDLRYKKTRAIRRRFTNKQSKVVTLRVSKTATNFPQRVF AVKA*ici*milknkiy*kkekkkkkkkkkkkkkkk Translated Am...TRAIRRRFTNKQSKVVTLRVSKTATNFPQRVF AVKA*ici*milknkiy*kkekkkkkkkkkkkkkkk Frame C: kklkllnsepktrlnylntsrnselssqv

  17. Dicty_cDB: SLK302 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available qpqlqpqlplkfnqktffikyhynn nfnnnsikk*y*kspfflynf*IKYKINKKKKKISKKKKKKKK--- ---*i*sknifyqvslq**f****yqkmilk...iskkk Frame C: sassssassaattaattiattaatttatttattatttatttats*i*sknifyqvslq** f****yqkmilk

  18. Dicty_cDB: VFD272 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NIDGLKNVQTICYNNMSQCYLKEKKVPMLW*lqkkh*nyhqmilkhsl eklklyl*wrnmmklskiskks Translate...IAK YNKALRYLDCCSNIDGLKNVQTICYNNMSQCYLKEKKVPMLW*lqkkh*nyhqmilkhsl eklklyl*wrnmmklskiskks Homology vs CSM-cDNA

  19. Dicty_cDB: VSF365 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ted Amino Acid sequence lishmnlkqklvsn*lmqvvkhltrshi*meleipilqfhsiiqvvmvgkcmvhhqshgm klwqyqlk*qfkilkm*LNHSNL...kn*lcstistckkfiitlf** ink*iiyin Frame C: lishmnlkqklvsn*lmqvvkhltrshi*meleipilqfhsiiqvvmvgkcmvhhqshgm klwqyq

  20. Dicty_cDB: AFB744 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lqhpkripplpfsfxixrxyanfc*xlfxgktiplever***h*kcqsqnprqrry spxstxfhfxw*tixxwpxsl*lqhpkxipxpfsxxikrwxanxcknlxwx...xhxigsxrf **hxkcxxqnsxqxrysxrstxinfxwxtixxwxxxx*lqxskgixxpfsxxikrwxanx c*nfnr*nxpxgsxr***x*kc*sqxprqxrxspxst

  1. Dicty_cDB: SHA805 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Frame A: fdeeyelakllkiqsfptiigfsngnflkkhtgpfrskshileflnhietehkkky*CKT LKKKKKKKXXXFXXK--- ---FDXEYELAKLLKIQSFPXIIGFSNGNFLKKHRGPFR...ed Amino Acid sequence fdeeyelakllkiqsfptiigfsngnflkkhtgpfrskshileflnhietehkkky*C...KT LKKKKKKKXXXFXXK--- ---FDXEYELAKLLKIQSFPXIIGFSNGNFLKKHRGPFRSKN Translated Amino Acid sequence (All Frames)

  2. Dicty_cDB: VSI877 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Frame C: kishitkfllilstniky*ilkfrikik*ykekkkxr*kk--- ---isiwfixhcfyxiygihvxcl*eq*ryxqigcngsilxsmyfgly*inrsl...dqqiwl xxxsnawsfilylnkgmfrshl*kyvqcchygfhwwfgfiir*dfgfscfcslhhctlvw yg*isqsnhycsl

  3. Dicty_cDB: AFM145 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LEVEGSDNIENVKAKIQDKEGIPPDQQRLIFAGKQLEDG RTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEGSDNIENVKTKIQDKEGXP Frame B: ---xxxxxxxvxxxxxxxxxx...vxxxxmvglxxixiskxnxlsxwxxd*evvxkxlskh*x vrpsllklrxqiilxmlxqrfkxkkvshqtnkd*fslvnn*kmvv...ittfkrnplsi*fsd*evvckfl*klslvkplhsklkvvttlrm*kqkfktkkvx Frame C: ---xxxxxxrfxxxxxxxixx*xixxwxxxxxxqypkxixxpx

  4. Dicty_cDB: CHF875 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available fld* hskfpkwf**yfksil***kstndchlcyllqfqksp*ns Frame B: iiiiiiiiiiiiiiiiiiiiiiiixxxxmxxxxxxxxrxxxhhhhhnxxxx...VTSVIYCNFKNHLKTP Frame C: ***********************x*xx**xxxxxxxxxxxxttttttxxxxxcxxyccyx xyyxx*xxxx*xxqxx*xqxx

  5. Dicty_cDB: VHE759 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 5 CX072513 |CX072513.1 UCRCS08_28E10_g Parent Washington Navel Orange Callus cDNA Library UCRCS08-2 Citrus s...72512.1 UCRCS08_28E10_b Parent Washington Navel Orange Callus cDNA Library UCRCS08-2 Citrus sinensis cDNA cl...inensis cDNA clone UCRCS08-28E10-J20-1-4.g, mRNA sequence. 46 1.5 1 CX072512 |CX0

  6. Dicty_cDB: VSJ248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vrdnanq*m*s*rsnprrlclwm*kkleclpsmfrsccqira*rksklfrsifrtcsmy **mcwtkiicsikvkymanm*kiviknsnikkkkkixwxkxxlxkx*k...kkfxgxxpfx*xfkkkxf*xffxxkk- -- ---dnanq*m*s*rsnprrlclwm*kkleclpsmfrsccqira*rksklfrsifrtcsmy **mcwtk Frame C:

  7. Dicty_cDB: VHG647 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KKIQVYSIFPSYTDGGEVIFYGWFTANSPISILIGSQTCTPTLVTTDQIKC NIGAGNGVKDISITQAGYTWFSPNSYEYVIXPTTPANCPTNCSNX--- ---ELNKLGY*inkfkkknee...KIQVYSIFPSYTDGGEVIFYGWFTANSPISILIGSQTCTPTLVTTDQIKC NIGAGNGVKDISITQAGYTWFSPNSYEYVIXPTTPANCPTNCSNX--- ---ELNKLGY*inkfkkknee...disitqagytwfspnsyeyvirpttpancptncsnrgycgagrcv Frame C: lnklgy*inkfkkkneensfnnfnfnfynfyk*lycrnmwkwlfkwxyl*fk*

  8. Dicty_cDB: AFE377 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available iikkikxtrsvglfaslfyfffqkkx*kk--- ---xixqliiiiiiiiiiiiiiiiiiiiiiiiiiiiiiixiixxxxii...ssssssssssssssssxssxxxxsssalxxxxiixxx iixixi Homology vs CSM-cDNA Score E Sequences producing significant al

  9. Dicty_cDB: CFE102 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available yslnvqldpivyqvkakepststf*vlkksfqilklts*pkvkkf hsqfh*nhtlihhllmmvihtiqlafhfkdsiemn...ivyqvkakepststf*vlkksfqilklts*pkvkkf hsqfh*nhtlihhllmmvihtiqlafhfkdsiemn Frame C: neknniifnsttciiiw*n*itfiye

  10. Dicty_cDB: CHJ566 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available no Acid sequence hmlvskikpcmskykflydetadgslqq**tnrlsgftfwitavnrg*yiqamgdwqrkl sdy*hstnafgfwvipnniadrgfifdkst...tiqikkvivktksliqie*nkllkn*vksm*tlklnfhvekkknsqdkpqlkdktk nnkkgxskdyks*enkxrssk Frame C: hmlvskikpcms

  11. Dicty_cDB: SHH309 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GGTAAAGGNATGCAAAACTGTAAAAATTAAATAACTCTTTT sequence update 2002.10.25 Translated Amino Acid sequence scspstgcvntpiscddknpctvdscnns...p*tvnvmtfvtlvnvvkiqenvitdkkivmiiiqkqlivaiprlvnvltnhimlsqvvli *slv*lvvslvvvqevkxcktvkik*lf Frame C: scspstgcvntpiscddknpctvdscnns

  12. Dicty_cDB: CHE515 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available hvpkkxv*lilqsilmitmhvplipvhhqlvfptlqltvmi vnpctidscnnstglxxhsnqw****slvp*ih--- --...FGLXGGFXGGGTXGKXDCXTCKN*xtxfi*lxfkk ixkkfxkkfxkkkklfvflsniynf*k*kf Frame C: nkctvdscsnstgcvntpincddsnpctvdscnns

  13. Dicty_cDB: AFG886 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available anslated Amino Acid sequence *hfqhphiiltitkyri*niavytnttqasiyiyi*nkfilkfcnnsikqinr*IDNLFF FXXKFFFFKX--- ---S...nskffksinentxqtpxfthlentsx ttpn Frame C: *hfqhphiiltitkyri*niavytnttqasiyiyi*nkfilkfcnnsikqinr*IDNLFF FXXKFF

  14. Dicty_cDB: SSC483 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AAAAAAA AAAAAAAAAAAAAAAAAC sequence update 1998.12. 2 Translated Amino Acid sequence eiliaiai***w****qxkyssnncnncnncnns...NSLIKNKELFIGFXRQSLNFWSEKKRNQXQRKR*kkknnkkkkiikkkktnkkkkkk kkn Frame C: eiliaiai***w****qxkyssnncnncnncnnsnns

  15. Caffeine-11C, ephedrine-11C and methylephedrine-11C: synthesis and distribution in mice

    International Nuclear Information System (INIS)

    Saji, Hideo; Ido, Tatsuo; Iwata, Ren; Suzuki, Kazutoshi; Tamate, Kazuhiko

    1978-01-01

    Caffeine, ephedrine and methylephedrine were labeled with carbon-11 by the action of methyliodide- 11 C on theophylline, norephedrine and ephedrine, respectively. Caffeine- 11 C was prepared in 44 min. with a radiochemical yield of 40%, ephedrine- 11 C in 45 min. with a 11% radiochemical yield and methylephedrine- 11 C in 36 min. with a 43% radiochemical yield. When injected in mice intravenously, these products show a high uptake in the liver, the kidney and the blood for caffeine- 11 C and in the liver and the kidney for ephedrine- 11 C and methylephedrine- 11 C. The brain uptake for these products was found to be 2.4 to 3.9% of the injected dose per gram at 5 min. after injection. These studies in mice have demonstrated that these products are potentially useful agents for the dynamic studies of the brain. (auth.)

  16. Joining of SiC ceramics and SiC/SiC composites

    Energy Technology Data Exchange (ETDEWEB)

    Rabin, B.H. [Idaho National Engineering Lab., Idaho Falls, ID (United States)

    1996-08-01

    This project has successfully developed a practical and reliable method for fabricating SiC ceramic-ceramic joints. This joining method will permit the use of SiC-based ceramics in a variety of elevated temperature fossil energy applications. The technique is based on a reaction bonding approach that provides joint interlayers compatible with SiC, and excellent joint mechanical properties at temperatures exceeding 1000{degrees}C. Recent emphasis has been given to technology transfer activities, and several collaborative research efforts are in progress. Investigations are focusing on applying the joining method to sintered {alpha}-SiC and fiber-reinforced SiC/SiC composites for use in applications such as heat exchangers, radiant burners and gas turbine components.

  17. Alcohol binding in the C1 (C1A + C1B) domain of protein kinase C epsilon

    Science.gov (United States)

    Pany, Satyabrata; Das, Joydip

    2015-01-01

    Background Alcohol regulates the expression and function of protein kinase C epsilon (PKCε). In a previous study we identified an alcohol binding site in the C1B, one of the twin C1 subdomains of PKCε. Methods In this study, we investigated alcohol binding in the entire C1 domain (combined C1A and C1B) of PKCε. Fluorescent phorbol ester, SAPD and fluorescent diacylglycerol (DAG) analog, dansyl-DAG were used to study the effect of ethanol, butanol, and octanol on the ligand binding using fluorescence resonance energy transfer (FRET). To identify alcohol binding site(s), PKCεC1 was photolabeled with 3-azibutanol and 3-azioctanol, and analyzed by mass spectrometry. The effects of alcohols and the azialcohols on PKCε were studied in NG108-15 cells. Results In the presence of alcohol, SAPD and dansyl-DAG showed different extent of FRET, indicating differential effects of alcohol on the C1A and C1B subdomains. Effects of alcohols and azialcohols on PKCε in NG108-15 cells were comparable. Azialcohols labeled Tyr-176 of C1A and Tyr-250 of C1B. Inspection of the model structure of PKCεC1 reveals that these residues are 40 Å apart from each other indicating that these residues form two different alcohol binding sites. Conclusions The present results provide evidence for the presence of multiple alcohol-binding sites on PKCε and underscore the importance of targeting this PKC isoform in developing alcohol antagonists. PMID:26210390

  18. TMS320C31 master

    International Nuclear Information System (INIS)

    Yun, Deok Yong

    1999-06-01

    The contents of this book are explanation of basic conception for DSP, perfect a complete master of TMS320C31, I/O interface design and memory, practice with PC print port, basic programing skill, assembly and C programing technique, timer and interrupt application skill, serial communication programing technique, application of digital conditioning and application of digital servo control. This book is divided into two parts, which is about TMS320C31 master of theory and application.

  19. Anti-C.Diff Pill

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Anand [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2018-01-30

    The anti- C.diff pill is being developed for patients who are at high risk for Clostridium difficile, a bacterium that causes diarrhea and serious intestinal conditions like colitis. C-diff is deadly, killing over 30,000 people a year in the United States and costing an average of $42,000 per treatment. The most common treatment is a fecal transplant (FT). The anti- C.diff replaces the invasive and messy FT practice with a pill.

  20. Dicty_cDB: VSK373 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available update 2001. 3.22 Translated Amino Acid sequence *neiiisplfrscfsfpifhpslvklwyccr*ipnyqcsirptnts*rtryhnqcirys...kpslvemlplksnmvslhlsmkmflfavlkth*haqlllvitkri*pk*fhlmlhq vntlvtllspiktmlkspvlmliltckrik*kkkxkht Frame C: *neiiisp...cfylqfsrpismpnccw*lpkeydrndsi*csir*ih w*rcyhrskqc*nrly*c*y*lvne*nkik*NKNTPSIKKK--- ---*neiiisplfrscfsfpifhps

  1. C reaction from the Coulomb dissociation of C

    Indian Academy of Sciences (India)

    non-resonant continuum (corresponding to all multipoles and relative orbital angular ..... As mentioned earlier, 14C(n, γ )15C is in direct competition with proton, deuteron .... The local momentum approximation is also a price one has to pay to.

  2. C&S Enterprise, L.L.C.

    Science.gov (United States)

    The EPA is providing notice of a proposed Administrative Penalty Assessment against C & S Enterprise, L.L.C. (“Respondent”), a business located at 2454 480th Ave, Deep River, IA 52222, for alleged violations of the Clean Water Act at property owned by Resp

  3. Dicty_cDB: CHN414 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available C137668.18 Medicago truncatula clone mth2-5f8, complete sequence. 52 2e-09 5 CV164410 |CV164410.1 rsmsx...sequence. 54 3e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.scf cDNA Library of Salvia miltiorrhiza Salvia

  4. Dicty_cDB: SHK285 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ce. 52 4e-09 4 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Salvia m...iltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence. 54 6e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.s

  5. Dicty_cDB: CHR818 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nce. 52 5e-09 4 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltior...rhiza cDNA 5', mRNA sequence. 54 7e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.

  6. Dicty_cDB: SHB431 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TGACATTGATAA sequence update 2002.10.25 Translated Amino Acid sequence llaywxynqinnly*kmsxsnsyfi**rir*tfas*k...skq iifc*innctknatn*INKKKKIIXKLFYLIYXLKKK--- ---YNQINNLY*kmsxvihisfneeldkxlqaexlvidfsaawcgpcxaxxpvfeklsne fv...tftxvhvdid Translated Amino Acid sequence (All Frames) Frame A: llaywxynqinnly*kmsxsnsyfi**rir*tfas*kisd*l*c...sqiilfnlxfkkk--- ---YNQINNLY*kmsxvihisfneeldkxlqaexlvidfsaawcgpcxaxxpvfeklsne fvtftxvhvdid Homology vs CSM-c

  7. Dicty_cDB: CHK742 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available uncatula clone mth2-5f8, complete sequence. 52 1e-09 6 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Librar...y of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence. 54 2e-09 3 CV172465 |CV172465.1 rsmsx

  8. Dicty_cDB: SHA189 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2, mRNA sequence. 80 8e-11 1 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza S...alvia miltiorrhiza cDNA 5', mRNA sequence. 54 5e-09 3 CV172465 |CV172465.1 rsmsxl

  9. Dicty_cDB: SHA788 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available . 52 6e-09 5 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Salvia mil...tiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence. 54 6e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.scf

  10. Dicty_cDB: SHJ790 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available a cDNA clone QGJ1L02, mRNA sequence. 80 1e-10 1 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Sa...catula clone mth2-5f8, complete sequence. 52 8e-09 5 CV172465 |CV172465.1 rsmsxlr

  11. Dicty_cDB: SHE806 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available one mth2-5f8, complete sequence. 52 7e-09 5 CV164410 |CV164410.1 rsmsxl_003361.y1....scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence. 54 7e-09 3 CV172465 |CV172465.1 rsmsx

  12. Dicty_cDB: SHE135 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available RNA sequence. 80 9e-11 1 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library o...f Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence. 54 8e-09 3 CV172465 |CV172465.1 rsmsxlre_0

  13. Dicty_cDB: CHM217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .ab1 QG_EFGHJ lettuce serriola Lactuca sativa cDNA clone QGJ1L02, mRNA sequence. 80 6e-11 1 CV164410 |CV164410.1 rsmsx... 3e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.scf cDNA Library of Salvia milti

  14. Dicty_cDB: SHG537 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available catula clone mth2-5f8, complete sequence. 52 5e-09 5 CV164410 |CV164410.1 rsmsxl_...003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence. 54 6e-09 3 CV172465 |CV172465.1 rsmsx

  15. Get more control over your C/C++ service

    CERN Multimedia

    CERN. Geneva

    2015-01-01

    Are you looking for a way to better diagnose or monitor your C/C++ programs? Find out more about CMX - a neat, lightweight library (<32Kb) which targets this need. It allows to expose information from inside a process through a simple API, enabling pre-failure detection in combination with your favourite monitoring system.

  16. Dicty_cDB: SFF302 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AAAATTCAAGACAAAGAAGGTATT C sequence update 2001. 6. 1 Translated Amino Acid sequence ---xxxixkvxprxtxxixggxxxxxwxxxx*xqxxkxxxxpxgxxxx...nshw*nhytrs*r**qh*ecknknsrqrry Translated Amino Acid sequence (All Frames) Frame A: ---xxxixkvxprxtxxixggxxxxxwxxxx*xqxxkxxxxpxgxxxx...shw*nhytrs*r**qh*ecknknsrqrry Frame B: ---xxr*xrfxxxxxvsfxxgxx*xxgxxxxdxxxqkxxtxxxvxrxxggxqxfvxtlxg ktixxexe...tlrmlkpksktkkvfhqinnvsfspvnnwrmv vlsxdyniqkestlhlvlrlrggmqifvktltgktitlevegsdnienvktkiqdkegi Frame C: ---xxdxxgxpxxnxxhfxxvxxxxmvxxxx...xxxxkkxxlxxwsxx*xvvxkxlxkh*xv rpsxlxlrxsxnienvktkdxxqrrypxrptkinfxw*tirxwxysx*lqhsk

  17. Dicty_cDB: AFI202 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mvfwi*cgsrcnsxxcnsissfniktrr*nilxxyitn*wnvykfidytnixiy*xs ykntixkkktisxgxnxdxxxxxmxrgxxxxxxxxxxx--- ---XQXVD...KDSRDNIKIRSSFISSSLFFIK ISIWFFGYSVGQGATAXFAIPYQVSILRPEDKTYXXGILPISGMFINLLITPIXGYIXDH TKTPXGRRRPYLXXGTXXXXXXXXXEAXXXXPXXXXX--- ---xxx...ligxwpfihyqxkplakxwxfgxxllsxxlxxxx Frame C: iniikriwikwnqqhqkpp*hihqniqkvqk*yqkqvvkiv...viilklevalyhhlyfl*k yqygfldivwvkvqqxxlqfhikfqy*dqkikhixxvyyqlvecl*iy*lhqyxdilxii qkhhxeeedhiyxxerxxxxxxxxx...rxhxxxxxxxxx--- ---xxx*lgxgpsfitkxnxwqkxgxlaxxfyrxxxxxsx Homology vs CSM-cDNA Score

  18. Dicty_cDB: VSH879 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vegetative cDNA clone:VS... 58 3e-04 1 ( FG283397 ) 1108770600507 New World Screwworm Egg 9261 ESTs C... 38... 0.012 2 ( FG301147 ) 1108799260169 New World Screwworm Larvae 9387 EST... 38 0.013 2 ( FG297431 ) 1108793286826 New World

  19. Dicty_cDB: VHB154 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |EL476245.1 CHUL4181.b1_J14.ab1 CHU(LMS) puzzle sunflower Helianthus paradoxus cDNA clone CHUL4181, mRNA se...quence. 72 5e-12 2 EL513430 |EL513430.1 CHUX465.b1_A21.ab1 CHU(XYZ) puzzle sunflower Helianthus paradoxus cD

  20. Dicty_cDB: VHB386 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 10.b1_C08.ab1 CHU(LMS) puzzle sunflower Helianthus paradoxus cDNA clone CHUL5210,... (bits) Value N X98286 |X98286.1 D.discoideum mRNA for P-type ATPase. 1285 0.0 1 EL476977 |EL476977.1 CHUL52

  1. Dicty_cDB: VHB564 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 430.1 CHUX465.b1_A21.ab1 CHU(XYZ) puzzle sunflower Helianthus paradoxus cDNA clone CHUX465, mRNA sequence. 7...2 1e-17 4 EL476245 |EL476245.1 CHUL4181.b1_J14.ab1 CHU(LMS) puzzle sunflower Helianthus paradoxus cDNA clone

  2. Dicty_cDB: AFL429 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ens subsp. patens cDNA clone:pph30f12, 3' end,single read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydration... sequence. 70 5e-08 1 CN206834 |CN206834.1 Tor7258 Gametophyte rehydration Library Tortula ruralis cDNA, mRN

  3. Dicty_cDB: AFL314 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s cDNA clone:pph30f12, 3' end,single read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydration ...NA sequence. 74 3e-09 1 CN206834 |CN206834.1 Tor7258 Gametophyte rehydration Library Tortula ruralis cDNA, m

  4. Dicty_cDB: AFH680 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available dration Library Tortula ruralis cDNA, mRNA sequence. 78 2e-10 1 BM398179 |BM398179....hyscomitrella patens subsp. patens cDNA clone:pph30f12, 3' end,single read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehy

  5. Dicty_cDB: AFK581 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available dration Library Tortula ruralis cDNA, mRNA sequence. 78 3e-10 1 BM398179 |BM398179....hyscomitrella patens subsp. patens cDNA clone:pph30f12, 3' end,single read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehy

  6. Dicty_cDB: AFJ364 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ydration Library Tortula ruralis cDNA, mRNA sequence. 78 2e-10 1 BM398179 |BM398179.... patens cDNA clone:pph30f12, 3' end,single read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte reh

  7. Dicty_cDB: AFL268 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available dration Library Tortula ruralis cDNA, mRNA sequence. 78 4e-10 1 BM398179 |BM398179.... patens cDNA clone:pph30f12, 3' end,single read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehy

  8. Dicty_cDB: AFL127 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 7 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequence. 78 2e-...trahymena thermophila cDNA, mRNA sequence. 74 3e-09 1 CN206834 |CN206834.1 Tor7258 Gametophyte rehydration

  9. Dicty_cDB: AFK427 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mitrella patens subsp. patens cDNA clone:pph30f12, 3' end,single read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydrati...on Library Tortula ruralis cDNA, mRNA sequence. 78 2e-10 1 BM398179 |BM398179.1 500

  10. Dicty_cDB: AFI675 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 6669.1 Tor7097 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequence. 70 5e-08 1 CN597971 |CN5... mRNA sequence. 62 1e-05 1 CN206834 |CN206834.1 Tor7258 Gametophyte rehydration Library Tortula ruralis cDNA

  11. Dicty_cDB: AFH816 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ingle read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydration Library Tortula ruralis cDNA, m...4 |CN206834.1 Tor7258 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequence. 70 5e-08 1 CK0301

  12. Dicty_cDB: AFI447 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mitrella patens subsp. patens cDNA clone:pph30f12, 3' end,single read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydrati...on Library Tortula ruralis cDNA, mRNA sequence. 78 2e-10 1 BM398179 |BM398179.1 500

  13. Dicty_cDB: AFN505 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s subsp. patens cDNA clone:pph30f12, 3' end,single read. 593 e-165 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydration...equence. 70 5e-08 1 CN206834 |CN206834.1 Tor7258 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA

  14. Dicty_cDB: AFK784 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ens cDNA clone:pph30f12, 3' end,single read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydration...N206834 |CN206834.1 Tor7258 Gametophyte rehydration Library Tortula ruralis cDNA,

  15. Dicty_cDB: AFH576 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tens subsp. patens cDNA clone:pph30f12, 3' end,single read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydration...A sequence. 70 4e-08 1 CN206834 |CN206834.1 Tor7258 Gametophyte rehydration Library Tortula ruralis cDNA, mR

  16. Dicty_cDB: AFH828 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 6669.1 Tor7097 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequence. 78 2e-10 1 CN597971 |CN5...ila cDNA, mRNA sequence. 74 3e-09 1 CN206834 |CN206834.1 Tor7258 Gametophyte rehydration

  17. Dicty_cDB: AFK470 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |CN206669.1 Tor7097 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequence. 78 3e-10 1 CN59146...NA sequence. 70 7e-08 1 CN206834 |CN206834.1 Tor7258 Gametophyte rehydration Library Tortula ruralis cDNA, m

  18. Dicty_cDB: AFH744 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available scomitrella patens subsp. patens cDNA clone:pph30f12, 3' end,single read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydr...ation Library Tortula ruralis cDNA, mRNA sequence. 78 4e-10 1 BM398179 |BM398179.1

  19. Dicty_cDB: AFK831 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ydration Library Tortula ruralis cDNA, mRNA sequence. 78 2e-10 1 BM398179 |BM398179...Physcomitrella patens subsp. patens cDNA clone:pph30f12, 3' end,single read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte reh

  20. Dicty_cDB: CHH862 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available d Amino Acid sequence thvlkinvlnqvv*lilqllvmikmpvp*thvqiqlvvstphlpvmixihaq*thvqtql availqsmsmitmhvlkinvlnqva...lnqvv*lilqld vmiimhvl*ihvqiqlvvlixq*nvmiiihvqlthvqiqlvvsipq*iatmvtsvxlihv vqlvvlihqlllmtithvqsxlvaiqpvssilqwivmitm...tvxsccnstgvvhtpvdcndnnvxtcdycsikqggkcihv Frame C: thvlkinvlnqvv*lilqllvmikmpvp*thvqiqlvvstphlpvmixihaq*thvqtql availqsmsmitm...ihqlllmtithvqsxlvaiqpvssilqwivmitmsllvitavsnkvvnvfmf Homology vs CSM-cDNA Score E Sequences producing signif

  1. Dicty_cDB: VFD555 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ashington Navel orange cold acclimated flavedo & albedo cDNA library Citrus sinensis cDNA clone UCRCS01_01aa...10, mRNA sequence. 54 0.003 1 CB292489 |CB292489.1 UCRCS01_04cd07_g1 Washington Navel orange cold acclimated

  2. A new f.c.c. phase in yttrium films

    International Nuclear Information System (INIS)

    Kaul, V.K.; Srivastava, O.N.

    1976-01-01

    A new polymorphic phase characterised by a face-centered cubic structure, with lattice parameter 5.83 +- 0.02A, has been identified in thin films of yttrium. Electron diffraction evidence and electrical resistivity measurements have been carried out in order to detect the new f.c.c. phase. (Auth.)

  3. SiC/SiC Cladding Materials Properties Handbook

    Energy Technology Data Exchange (ETDEWEB)

    Snead, Mary A. [Brookhaven National Lab. (BNL), Upton, NY (United States); Katoh, Yutai [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Koyanagi, Takaaki [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Singh, Gyanender P. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-08-01

    When a new class of material is considered for a nuclear core structure, the in-pile performance is usually assessed based on multi-physics modeling in coordination with experiments. This report aims to provide data for the mechanical and physical properties and environmental resistance of silicon carbide (SiC) fiber–reinforced SiC matrix (SiC/SiC) composites for use in modeling for their application as accidenttolerant fuel cladding for light water reactors (LWRs). The properties are specific for tube geometry, although many properties can be predicted from planar specimen data. This report presents various properties, including mechanical properties, thermal properties, chemical stability under normal and offnormal operation conditions, hermeticity, and irradiation resistance. Table S.1 summarizes those properties mainly for nuclear-grade SiC/SiC composites fabricated via chemical vapor infiltration (CVI). While most of the important properties are available, this work found that data for the in-pile hydrothermal corrosion resistance of SiC materials and for thermal properties of tube materials are lacking for evaluation of SiC-based cladding for LWR applications.

  4. Dicty_cDB: SSE446 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e MtBC21H02 of cDNA library MtBC from arbuscular mycorrhiza of cultivar Jemalong ... T3 end of clone MtBC21H02 of cDNA library MtBC from arbuscular mycorrhiza of cultivar Jemalong of Medicago

  5. Dicty_cDB: SHJ789 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 01R1 : T7 end of clone MtBC46H01 of cDNA library MtBC from arbuscular mycorrhiza of cultivar Jemalong of Med...d of clone MtBC46H01 of cDNA library MtBC from arbuscular mycorrhiza of cultivar

  6. Dicty_cDB: VSG433 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available G08F1 : T3 end of clone MtBC23G08 of cDNA library MtBC from arbuscular mycorrhiza...tula EST MtBC26G02F1 : T3 end of clone MtBC26G02 of cDNA library MtBC from arbuscular mycorrhiza of cultivar

  7. Dicty_cDB: AHA244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available one) Pichia stipitis CBS 6054 chromos... 35 4.8 EU095850_1( EU095850 |pid:none) Turkey coronavirus isolate M...G10, c... 35 4.8 EU095850_2( EU095850 |pid:none) Turkey coronavirus isolate MG10, c... 35 4.8 CP000094_2730(

  8. Dicty_cDB: VFE826 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rmelon lambda zap library Citrullus lanatus cDNA clone WMLS336 5' similar to acetyl...of Vitis vinifera var. Chardonnay Vitis vinifera cDNA clone VVC055H06 5, mRNA sequence. 60 3e-08 2 AI563047 |AI563047.1 EST00171 wate

  9. Dicty_cDB: VHI596 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 295 |pid:none) Pongo abelii mRNA; cDNA DKFZp469L1... 62 9e-09 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli...one) Synthetic construct Homo sapiens c... 61 2e-08 BC027622_1( BC027622 |pid:none) Homo sapiens pipecolic a

  10. Oxidative electrochemical aryl C-C coupling of spiropyrans

    NARCIS (Netherlands)

    Ivashenko, Oleksii; van Herpt, Jochem T.; Rudolf, Petra; Feringa, Ben L.; Browne, Wesley R.

    2013-01-01

    The isolation and definitive assignment of the species formed upon electrochemical oxidation of nitro-spiropyran (SP) is reported. The oxidative aryl C-C coupling at the indoline moiety of the SP radical cation to form covalent dimers of the ring-closed SP form is demonstrated. The coupling is

  11. On the Michael addition of water to C = C bonds

    NARCIS (Netherlands)

    Chen, B.

    2015-01-01

    ?-Hydroxy carbonyl compounds are an important class of compounds often found as a common structural motif in natural products. Although the molecules themselves look rather simple, their synthesis can be challenging. Water addition to conjugated C = C bonds opens up a straightforward route for the

  12. Deformation microstructure and orientation of F.C.C. crystals

    DEFF Research Database (Denmark)

    Liu, Q.; Hansen, N.

    1995-01-01

    The effect of crystallographic orientation on the microstructural evolution in f.c.c. metals with medium to high stacking fault energy is analyzed. This analysis is based on a literature review of the behaviour of single crystals and polycrystals supplemented with an experimental study of cold...

  13. Presenilin dependence of phospholipase C and protein kinase C signaling

    DEFF Research Database (Denmark)

    Dehvari, Nodi; Cedazo-Minguez, Angel; Isacsson, Ola

    2007-01-01

    -stimulated phospholipase C (PLC) activity which was gamma-secretase dependent. To further evaluate the dependence of PLC on PSs we measured PLC activity and the activation of variant protein kinase C (PKC) isoforms in mouse embryonic fibroblasts (MEFs) lacking either PS1, PS2, or both. PLC activity and PKCalpha...

  14. Multilocus sequence typing (MLST methods for the emerging Campylobacter species C. hyointestinalis, C. lanienae, C. sputorum, C. concisus and C. curvus

    Directory of Open Access Journals (Sweden)

    William G Miller

    2012-04-01

    Full Text Available Multilocus sequence typing (MLST systems have been reported previously for multiple food- and food animal-associated Campylobacter species (e.g. C. jejuni, C. coli, C. lari and C. fetus to both differentiate strains and identify clonal lineages. These MLST methods focused primarily on campylobacters of human clinical (e.g. C. jejuni or veterinary (e.g. C. fetus relevance. However, other, emerging, Campylobacter species have been isolated increasingly from environmental, food animal or human clinical samples. We describe herein MLST methods for five emerging Campylobacter species: C. hyointestinalis, C. lanienae, C. sputorum, C. concisus and C. curvus. The concisus/curvus method uses the loci aspA, atpA, glnA, gltA, glyA, ilvD and pgm, whereas the other methods use the seven loci defined for C. jejuni (i.e., aspA, atpA, glnA, gltA, glyA, pgm, and tkt. Multiple food animal and human clinical C. hyointestinalis (n=48, C. lanienae (n=34 and C. sputorum (n=24 isolates were typed, along with 86 human clinical C. concisus and C. curvus isolates. A large number of sequence types (STs were identified using all four MLST methods. Similar to Campylobacter MLST methods described previously, these novel MLST methods identified mixed isolates containing two or more strains of the same species. Additionally, these methods speciated unequivocally isolates that had been typed ambiguously using other molecular-based speciation methods, such as 16S rDNA sequencing. Finally, the design of degenerate primer pairs for some methods permitted the typing of related species; for example, the C. hyointestinalis primer pairs could be used to type C. fetus strains. Therefore, these novel Campylobacter MLST methods will prove useful in speciating and differentiating strains of multiple, emerging Campylobacter species.

  15. Oracle 12c for dummies

    CERN Document Server

    Ruel, Chris

    2013-01-01

    Demystifying the power of the Oracle 12c database The Oracle database is the industry-leading relational database management system (RDMS) used from small companies to the world's largest enterprises alike for their most critical business and analytical processing. Oracle 12c includes industry leading enhancements to enable cloud computing and empowers users to manage both Big Data and traditional data structures faster and cheaper than ever before. Oracle 12c For Dummies is the perfect guide for a novice database administrator or an Oracle DBA who is new to Oracle 12c. The book covers what

  16. Normalized cDNA libraries

    Science.gov (United States)

    Soares, Marcelo B.; Efstratiadis, Argiris

    1997-01-01

    This invention provides a method to normalize a directional cDNA library constructed in a vector that allows propagation in single-stranded circle form comprising: (a) propagating the directional cDNA library in single-stranded circles; (b) generating fragments complementary to the 3' noncoding sequence of the single-stranded circles in the library to produce partial duplexes; (c) purifying the partial duplexes; (d) melting and reassociating the purified partial duplexes to moderate Cot; and (e) purifying the unassociated single-stranded circles, thereby generating a normalized cDNA library.

  17. C*-algebras by example

    CERN Document Server

    Davidson, Kenneth R

    1996-01-01

    The subject of C*-algebras received a dramatic revitalization in the 1970s by the introduction of topological methods through the work of Brown, Douglas, and Fillmore on extensions of C*-algebras and Elliott's use of K-theory to provide a useful classification of AF algebras. These results were the beginning of a marvelous new set of tools for analyzing concrete C*-algebras. This book is an introductory graduate level text which presents the basics of the subject through a detailed analysis of several important classes of C*-algebras. The development of operator algebras in the last twenty yea

  18. A Robot Supported By C

    International Nuclear Information System (INIS)

    Shin, Junghwan

    1994-11-01

    This book introduces analog with register, diode and light emitting diode, condenser, capacitor and transistor, operational amplifier tester, oscilloscope and lapping, digital circuit such as sorts of digital lc, gate circuit flip-flop, shift register and latch, and counter, C-language including entering C-language, editor using, debugging, basic data type of C-language, operator and control structure, array and pointer, storage class, structure and union, expansion SLOT of PC, interface card and C-language such as graphic function, keyboard control, and mouse control.

  19. Fullerene C[sub 60

    Energy Technology Data Exchange (ETDEWEB)

    Koruga, D; Hameroff, S; Sundareshan, M [Univ. of Arizona, Tucson, AZ (United States); Withers, J; Loutfy, R [MER Corp., Tucson, AZ (United States)

    1993-01-01

    This book, one of the first to be published in the exciting field of fullerenes, includes a short history of scientific discovery, as well as one possible answer to the question: for what purposes can C[sub 60] be utilized. The book opens with a review of the life of Buckminster Fuller. Modern history of fivefold symmetry and the icosahedron began between 1984 and 1985, when Shechtman and his research team opened a new branch in crystallography (fivefold symmetry) and when the Kroto/Smalley research team discovered the C[sub 60] molecule (truncated icosahedron). Production of solid C[sub 60] by the Huffman/Kraeschner research team in 1990 provided a new stimulus for research by producing C[sub 60] in macroscopic amounts for use by the scientific and technological community. This achievement led to developments such as Koruga's August 1992 creation of the dimer C[sub 116] using scanning tunneling engineering and Loutfy's hydrogenation of C[sub 60] and construction of the first Ni/C[sub 60] rechargeable batteries in December 1992. New inventions based on C[sub 60] will continue to be forthcoming, particularly in the areas of superconductivity, quantum devices, and molecular electronic devices. Discovery of the C[sub 60] molecule (Kroto/Smalley), production of solid C[sub 60] (Huffman/Kraeschmer) and technological inventions such as C[sub 116] (Koruga) have been chance discoveries. A short history of these discoveries is detailed in the book along with the results of the authors' Fullerene research efforts, including atomic resolution images of Fullerene C[sub 60], Ni/C[sub 60] batteries, nanotechnology of C[sub 60], comparison of C[sub 60] with biological systems, and others. As Fullerene C[sub 60] will require control engineering, an overview of control systems, in particular, general and optimal control of the Schroedinger equation, is contained. Some experimental and theoretical work of other researchers are also presented. 140 figs., 4 tabs., 342 refs.

  20. Mol 7C/6; Mol 7C/6

    Energy Technology Data Exchange (ETDEWEB)

    Aberle, J.; Schleisiek, K.; Schmuck, I.; Schmidt, L.; Romer, O.; Weih, G.

    1995-08-01

    The Mol 7C/6 coolant blockage experiment in the Belgian BR2 reactor yielded results different from Mol 7C experiments with low burnup pins: At 10% burnup local failure is not self-limiting, but requires active systems for detection and scram. The Mol 7C series was finished in 1991. In each of the test bundles Mol 7C/4, /5 and /6, 30 Mk I pins pre-irradiated in KNK II were used. The central blockage consisted of enriched UO{sub 2} covering 30 percent of the bundle cross-section, with a height of 40 mm. The most important system for timely detection of coolant blockages of the type studied in Mol 7C/6 is based on DND. (orig.)

  1. The C-12/C-13 abundance ratio in Comet Halley

    International Nuclear Information System (INIS)

    Wyckoff, S.; Lindholm, E.; Wehinger, P.A.; Peterson, B.A.; Zucconi, J.M.

    1989-01-01

    The individual (C-13)N rotational lines in Comet Halley are resolved using high-resolution spectra of the CN B2Sigma(+)-X2Sigma(+) (0,0) band. The observe C-12/C-13 abundance ratio excludes a site of origin for the comet near Uranus and Neptune and suggests a condensation environment quite distinct from other solar system bodies. Two theories are presented for the origin of Comet Halley. One theory suggest that the comet originated 4.5 Gyr ago in an inner Oort cloud at a heliocentric distance greater than 100 AU where chemical fractionation led to the C-13 enrichment in the CN parent molecule prior to condensation of the comet nucleus. According to the other, more plausible theory, the comet nucleus condensed relatively recently from the interstellar medium which has become enriches in C-13 and was subsequently gravitationally captured by the solar system. 107 refs

  2. Grinding, Machining Morphological Studies on C/SiC Composites

    Science.gov (United States)

    Xiao, Chun-fang; Han, Bing

    2018-05-01

    C/SiC composite is a typical material difficult to machine. It is hard and brittle. In machining, the cutting force is large, the material removal rate is low, the edge is prone to collapse, and the tool wear is serious. In this paper, the grinding of C/Si composites material along the direction of fiber distribution is studied respectively. The surface microstructure and mechanical properties of C/SiC composites processed by ultrasonic machining were evaluated. The change of surface quality with the change of processing parameters has also been studied. By comparing the performances of conventional grinding and ultrasonic grinding, the surface roughness and functional characteristics of the material can be improved by optimizing the processing parameters.

  3. Sim3C: simulation of Hi-C and Meta3C proximity ligation sequencing technologies.

    Science.gov (United States)

    DeMaere, Matthew Z; Darling, Aaron E

    2018-02-01

    Chromosome conformation capture (3C) and Hi-C DNA sequencing methods have rapidly advanced our understanding of the spatial organization of genomes and metagenomes. Many variants of these protocols have been developed, each with their own strengths. Currently there is no systematic means for simulating sequence data from this family of sequencing protocols, potentially hindering the advancement of algorithms to exploit this new datatype. We describe a computational simulator that, given simple parameters and reference genome sequences, will simulate Hi-C sequencing on those sequences. The simulator models the basic spatial structure in genomes that is commonly observed in Hi-C and 3C datasets, including the distance-decay relationship in proximity ligation, differences in the frequency of interaction within and across chromosomes, and the structure imposed by cells. A means to model the 3D structure of randomly generated topologically associating domains is provided. The simulator considers several sources of error common to 3C and Hi-C library preparation and sequencing methods, including spurious proximity ligation events and sequencing error. We have introduced the first comprehensive simulator for 3C and Hi-C sequencing protocols. We expect the simulator to have use in testing of Hi-C data analysis algorithms, as well as more general value for experimental design, where questions such as the required depth of sequencing, enzyme choice, and other decisions can be made in advance in order to ensure adequate statistical power with respect to experimental hypothesis testing.

  4. Electronic structure of C28, Pa at sign C28, and U at sign C28

    International Nuclear Information System (INIS)

    Zhao, K.; Pitzer, R.M.

    1996-01-01

    Electronic structure calculations, including relativistic core potentials and the spin-orbit interaction, have been carried out on the C 28 , Pa at sign C 28 , and U at sign C 28 species. Excitation energies, spin-orbit splittings, the electron affinity, and the ionization potential are computed for C 28 . The ground state of C 28 is described well by the Hartree-Fock wave functions, but other states are not. The computed electron affinity and ionization potential are similar to those of C 60 . Strong metal-cage binding is found for Pa at sign C 28 and U at sign C 28 , similar to that in U(C 8 H 8 ) 2 . The ground electronic states depend on the order of the lowest-energy cage π * and metal 5f orbitals, with (π * ) 1 and (π * ) 1 (5f) 1 found to be the ground electronic configurations for the two complexes. U at sign C 28 is found to be diamagnetic. 30 refs., 1 fig., 13 tabs

  5. Atmospheric histories and growth trends of C4F10, C5F12, C6F14, C7F16 and C8F18

    Directory of Open Access Journals (Sweden)

    R. F. Weiss

    2012-05-01

    Full Text Available Atmospheric observations and trends are presented for the high molecular weight perfluorocarbons (PFCs: decafluorobutane (C4F10, dodecafluoropentane (C5F12, tetradecafluorohexane (C6F14, hexadecafluoroheptane (C7F16 and octadecafluorooctane (C8F18. Their atmospheric histories are based on measurements of 36 Northern Hemisphere and 46 Southern Hemisphere archived air samples collected between 1973 to 2011 using the Advanced Global Atmospheric Gases Experiment (AGAGE "Medusa" preconcentration gas chromatography-mass spectrometry systems. A new calibration scale was prepared for each PFC, with estimated accuracies of 6.8% for C4F10, 7.8% for C5F12, 4.0% for C6F14, 6.6% for C7F16 and 7.9% for C8F18. Based on our observations the 2011 globally averaged dry air mole fractions of these heavy PFCs are: 0.17 parts-per-trillion (ppt, i.e., parts per 1012 for C4F10, 0.12 ppt for C5F12, 0.27 ppt for C6F14, 0.12 ppt for C7F16 and 0.09 ppt for C8F18. These atmospheric mole fractions combine to contribute to a global average radiative forcing of 0.35 mW m−2, which is 6% of the total anthropogenic PFC radiative forcing (Montzka and Reimann, 2011; Oram et al., 2012. The growth rates of the heavy perfluorocarbons were largest in the late 1990s peaking at 6.2 parts per quadrillion (ppq, i.e., parts per 1015 per year (yr for C4F10, at 5.0 ppq yr−1 for C5F12 and 16.6 ppq yr−1 for C6F14 and in the early 1990s for C7F16 at 4.7 ppq yr−1 and in the mid 1990s for C8F18 at 4.8 ppq yr−1. The 2011 globally averaged mean atmospheric growth rates of these PFCs are subsequently lower at 2.2 ppq yr−1 for C4F10, 1.4 ppq yr−1 for C5F12, 5.0 ppq yr−1 for C6F14, 3.4 ppq yr−1 for C7F16 and 0.9 ppq yr−1 for C8F18. The more recent slowdown in the growth rates suggests that emissions are declining as compared to the 1980s and 1990s.

  6. Synthesis of the C(18)-C(34) fragment of amphidinolide C and the C(18)-C(29) fragment of amphidinolide F.

    Science.gov (United States)

    Roy, Sudeshna; Spilling, Christopher D

    2010-11-19

    A convergent synthesis of the C(18)-C(34) fragment of amphidinolide C and the C(18)-C(29) fragment of amphidinolide F is reported. The approach involves the synthesis of the common intermediate tetrahydrofuranyl-β-ketophosphonate via cross metathesis, Pd(0)-catalyzed cyclization, and hydroboration-oxidation. The β-ketophosphonate was coupled to three side chain aldehydes using a Horner-Wadsworth-Emmons (HWE) olefination reaction to give dienones, which were reduced with l-selectride to give the fragments of amphidinolide C and F.

  7. Synthesis of the C(18)–C(34) Fragment of Amphidinolide C and the C(18)–C(29) Fragment of Amphidinolide F

    Science.gov (United States)

    Roy, Sudeshna; Spilling, Christopher D.

    2010-01-01

    A convergent synthesis of the C(18)–C(34) fragment of amphidinolide C and the C(18)–C(29) fragment of amphidinolide F is reported. The approach involves the synthesis of the common intermediate tetrahydrofuranyl-β-ketophosphonate via cross metathesis, Pd(0)-catalyzed cyclization and hydroboration-oxidation. The β-ketophosphonate was coupled to three side chain aldehydes using a Horner-Wadsworth-Emmons (HWE) olefination reaction to give dienones, which were reduced with L-selectride to give the fragments of amphidinolide C and F. PMID:21028791

  8. V S C Manga Rao

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. V S C Manga Rao. Articles written in Pramana – Journal of Physics. Volume 61 Issue 3 September 2003 pp 563-575 Research Articles. Phase conjugation of gap solitons: A numerical study · V S C Manga Rao S Dutta Gupta · More Details Abstract Fulltext PDF. We study the ...

  9. Remembering Sir J C Bose

    Indian Academy of Sciences (India)

    for this wonderful gift to Indian science. I would like to end this review with another quote for C. N. R. Rao's inspiring foreword. 'The book brings out the spirit of J. C. Bose and the flavour of the great man. I do hope it will be read by a large number of people, particularly young people of India.' M S Swaminathan, UNESCO ...

  10. Photophysics of C60 Colloids

    Science.gov (United States)

    2012-11-28

    nonlinear-optical properties and excited-state dynamics of pristine, oxygen- doped , and photopolymerized C-60 in the solid-state," Physical Review B...C45 (2009). 139. E. A. Brujan, "Numerical investigation on the dynamics of cavitation nanobubbles," Microfluidics and Nanofluidics 11(5), 511-517

  11. C9H14N

    Indian Academy of Sciences (India)

    J. Chem. Sci. Vol. 128, No. 7, July 2016, pp. 1037–1045. c Indian Academy of ..... Teraski O, Barry J C and Thomas J M 1987 Nature ... Betteridge P W, Carruthers J R, Cooper R I, Prout K and ... Clegg W and Watson D G 2007 Acta Cryst.

  12. Biomimicry of surfactant protein C.

    Science.gov (United States)

    Brown, Nathan J; Johansson, Jan; Barron, Annelise E

    2008-10-01

    Since the widespread use of exogenous lung surfactant to treat neonatal respiratory distress syndrome, premature infant survival and respiratory morbidity have dramatically improved. Despite the effectiveness of the animal-derived surfactant preparations, there still remain some concerns and difficulties associated with their use. This has prompted investigation into the creation of synthetic surfactant preparations. However, to date, no clinically used synthetic formulation is as effective as the natural material. This is largely because the previous synthetic formulations lacked analogues of the hydrophobic proteins of the lung surfactant system, SP-B and SP-C, which are critical functional constituents. As a result, recent investigation has turned toward the development of a new generation of synthetic, biomimetic surfactants that contain synthetic phospholipids along with a mimic of the hydrophobic protein portion of lung surfactant. In this Account, we detail our efforts in creating accurate mimics of SP-C for use in a synthetic surfactant replacement therapy. Despite SP-C's seemingly simple structure, the predominantly helical protein is extraordinarily challenging to work with given its extreme hydrophobicity and structural instability, which greatly complicates the creation of an effective SP-C analogue. Drawing inspiration from Nature, two promising biomimetic approaches have led to the creation of rationally designed biopolymers that recapitulate many of SP-C's molecular features. The first approach utilizes detailed SP-C structure-activity relationships and amino acid folding propensities to create a peptide-based analogue, SP-C33. In SP-C33, the problematic and metastable polyvaline helix is replaced with a structurally stable polyleucine helix and includes a well-placed positive charge to prevent aggregation. SP-C33 is structurally stable and eliminates the association propensity of the native protein. The second approach follows the same design

  13. Determination of material properties for short fibre reinforced C/C-SiC

    Directory of Open Access Journals (Sweden)

    Hausherr J.-M.

    2015-01-01

    Full Text Available Determining the mechanical properties of short fibre reinforced CMC using standard sized coupons has always been a challenge due to a high statistical scattering of the measured values. Although the random orientation of short fibres results in a quasi-isotropic material behavior of 2D-structures with a sufficiently large volume, the small volume typical for test coupons usually results in a non-isotropic fibre orientation in the tested volume. This paper describes a method for manufacturing unidirectional oriented short fibre reinforced CMC materials and presents material properties of UD-C/C-SiC. After verifying the fibre orientation of the CMC using micro-computed tomography, coupons were extracted to determine the orthotropic material properties. These orthotropic material properties were then used to predict the properties of C/C-SiC with randomly distributed short fibres. To validate the method, micro-computed tomography is used to quantitatively determine the fibre orientation within coupons extracted from randomly distributed short fibre C/C-SiC. After mechanical three-point-bending tests, the measured stiffness and bending strength is compared with the predicted properties. Finally, the data are used to devise a method suited for reducing the inherent large spread of material properties associated with the measurement of CMC materials with randomly distributed short fibres.

  14. Borane-catalyzed cracking of C-C bonds in coal; Boran-katalysierte C-C-Bindungungsspaltung in Steinkohle

    Energy Technology Data Exchange (ETDEWEB)

    Narangerel, J; Haenel, M W [Max-Planck-Institut fuer Kohlenforschung, Muelheim an der Ruhr (Germany)

    1998-09-01

    Coal, especially coking coal, was reacted with hydrogen at comparatively mild reaction conditions (150-280 degrees centigrade, 20 MPa hydrogen pressure) in the presence of catalysts consisting of borange reagents and certain transition metal halides to obtaine more than 80 percent of pyridine-soluble products. The influence of the degree of coalification, catalyst and temperature on the borane-catalyzed hydrogenolysis of C-C bonds in coal was investigated. (orig.) [Deutsch] Steinkohlen, insbesondere im Inkohlungsbereich der Fettkohlen (Kokskohlen), werden in Gegenwart von Katalysatoren aus Boran-Reagentien und bestimmten Uebergangsmetallhalogeniden mit Wasserstoff bei vergleichsweise milden Reaktionsbedingungen (250-280 C, 20 MPa Wasserstoffdruck) in zu ueber 80% pyridinloesliche Produkte umgewandelt. Der Einfluss von Inkohlungsgrad, Katalysator und Temperatur auf die Boran-katalysierte C-C-Bindungshydrogenolyse in Kohle wurde untersucht. (orig.)

  15. Is vitamin C supplementation beneficial?

    DEFF Research Database (Denmark)

    Lykkesfeldt, Jens; Poulsen, Henrik Enghusen

    2010-01-01

    of the benefit:harm ratio of antioxidant supplements. We have examined the literature on vitamin C intervention with the intention of drawing a conclusion on its possible beneficial or deleterious effect on health and the result is discouraging. One of several important issues is that vitamin C uptake is tightly...... controlled, resulting in a wide-ranging bioavailability depending on the current vitamin C status. Lack of proper selection criteria dominates the currently available literature. Thus, while supplementation with vitamin C is likely to be without effect for the majority of the Western population due...... to saturation through their normal diet, there could be a large subpopulation with a potential health problem that remains uninvestigated. The present review discusses the relevance of the available literature on vitamin C supplementation and proposes guidelines for future randomised intervention trials....

  16. Dicty_cDB: VSJ223 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available etical protein ZK381.7 - Caenorhabditis elegans. 46 0.43 1 AF277887 |AF277887.1 Sida crystallina clone 67SE ...5 unordered pieces. 44 1.7 1 AF277884 |AF277884.1 Sida crystallina clone 63NA cytochrome c oxidase subunit I... (COI) gene, partial cds; mitochondrial gene for mitochondrial product. 34 3.8 2 AF277883 |AF277883.1 Sida... 2 AF277888 |AF277888.1 Sida crystallina clone 68SE cytochrome c oxidase subunit ...cytochrome c oxidase subunit I (COI) gene, partial cds; mitochondrial gene for mitochondrial product. 36 1.0

  17. Dicty_cDB: AFL826 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFL826 (Link to dictyBase) - - - - AFL826P (Link to Original s...ite) AFL826F 588 AFL826Z 766 AFL826P 1334 - - Show AFL826 Library AF (Link to library) Clone ID AFL826 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.t... Score E Sequences producing significant alignments: (bits) Value N ( BJ346543 ) Dictyostelium discoideum cD...NA clone:dda24d08, 3' ... 1100 0.0 1 ( BJ341682 ) Dictyostelium discoideum cDNA c

  18. Dicty_cDB: CHD152 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHD152 (Link to dictyBase) - - - - - (Link to Original site) C...HD152F 603 - - - - - - Show CHD152 Library CH (Link to library) Clone ID CHD152 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHD...Score E Sequences producing significant alignments: (bits) Value N U36937 |U36937.1 Dictyostelium discoideum...UF_IpTrk_27_j08 Trunk kidney cDNA library Ictalurus punctatus cDNA 5' similar to

  19. C# deconstructed discover how C# works on the .NET framework

    CERN Document Server

    Rahman, Mohammad

    2014-01-01

    C# Deconstructed answers a seemingly simply question: Just what is going on, exactly, when you run C# code on the .NET Framework? To answer this question we will dig ever deeper into the structure of the C# language and the onion-skin abstraction layers of the .NET Framework that underpins it. We'll follow the execution thread downwards, first to MSIL (Microsoft Intermediate Language) then down through just-in-time compilation into Machine Code before finally seeing the results executed at the hardware level. The aim of this deep-dive is to provide you with a much more rounded know

  20. Dicty_cDB: VHK256 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHK256 (Link to dictyBase) - - - Contig-U16260-1 - (Link to Original site) VHK2...56F 620 - - - - - - Show VHK256 Library VH (Link to library) Clone ID VHK256 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHK2-C/VHK256Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHK256 (VHK256Q) /CSM/VH/VHK2-C/VHK256Q.Seq.d/ AACTCTCGAGTGCAAAA...27874 ) Dictyostelium discoideum cDNA clone:ddv63k23, 5' ... 1170 0.0 1 ( BJ42787

  1. Dicty_cDB: VHC679 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 513430 |EL513430.1 CHUX465.b1_A21.ab1 CHU(XYZ) puzzle sunflower Helianthus paradoxus cDNA clone CHUX465, mRN...aris cDNA clone CHPX9185, mRNA sequence. 72 2e-13 2 EL476245 |EL476245.1 CHUL4181.b1_J14.ab1 CHU(LMS) puzz...le sunflower Helianthus paradoxus cDNA clone CHUL4181, mRNA sequence. 72 2e-13 2 EL

  2. Dicty_cDB: VHO809 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e E Sequences producing significant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL1...57766 |pid:none) 105 5e-21 BC171956_1( BC171956 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 1e-20 B...C138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 2e-20 (Q9JLC8) RecName: Full=Sacsin

  3. Dicty_cDB: CHE555 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available la EST MtBC10B03R1 : T7 end of clone MtBC10B03 of cDNA library MtBC from arbuscular mycorrhiza of cultivar J...03F1 : T3 end of clone MtBC10B03 of cDNA library MtBC from arbuscular mycorrhiza ...a EST MtBC39A08F1 : T3 end of clone MtBC39A08 of cDNA library MtBC from arbuscular mycorrhiza of cultivar Je

  4. 13C/12C ratios in human urine concrementes

    International Nuclear Information System (INIS)

    Hoefs, J.; Armbruster, T.

    1978-01-01

    Oxalate, uric acid, and phosphate stones have been analyzed for their carbon isotope composition. The oxalate stones show delta 13 C values between -17.0 and -19.5 pro mille, the uric acid stones between -14.9 and -19.4 pro mille, and the phosphate stones between -13.0 and -23.9 pro mille. It is proposed that endogenic rather than exogenic sources are responsible for the 13 C/ 12 C ratios of the stones. The isotopic composition of the phosphate stones seems to be influenced primarily by bacterial activity. (orig.) [de

  5. Dicty_cDB: VHA862 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available complete sequence. 38 0.17 5 CX072513 |CX072513.1 UCRCS08_28E10_g Parent Washington Navel Orange Callus cDNA...72512.1 UCRCS08_28E10_b Parent Washington Navel Orange Callus cDNA Library UCRCS0... Library UCRCS08-2 Citrus sinensis cDNA clone UCRCS08-28E10-J20-1-4.g, mRNA sequence. 46 1.2 1 CX072512 |CX0

  6. Creep properties of heat-resistant superalloys for nuclear plants in helium

    International Nuclear Information System (INIS)

    Shimizu, Shigeki; Satoh, Keisuke; Honda, Yoshio; Matsuda, Shozo; Murase, Hirokazu

    1979-01-01

    Creep properties of candidate superalloys for VHTR components in a helium environment at both temperatures of 800 0 C and 900 0 C were compared with those of the same alloys in the atmospheric condition, and the superalloys were contrasted with each other from the viewpoint of high temperature structural design. At 800 0 C, no significant effect of a helium environment on creep properties of the superalloys is observed. At 900 0 C, however, creep strength of Inconel 617, Incoloy 800 and Incoloy 807 in the helium environment decrease more than in the atmospheric environment. In Hastelloy X and Inconel 625, there is no significant difference between creep strengths in helium and those in the atmospheric condition. Concerning So and St values in helium at 900 0 C, Inconel 617 and Hastelloy X are clearly superior to other superalloys. (author)

  7. .. c .. . -

    African Journals Online (AJOL)

    1986-10-03

    Oct 3, 1986 ... a hundred polymorphic species (Frost 1985). The H. puncticulatus complex in east Africa was shown by. Schi~z (1975) to consist of two cryptic species, H. mit- chelli Loveridge and H. puncticulatus (Pfeffer). Both species are morphologically similar and share a range of colour patterns. They are sympatric ...

  8. C

    African Journals Online (AJOL)

    This showed me the boundless confidence which these sons .... self. He has heard our prayers. We are free! Oh, how I long to see General Smuts!' ... ing camp games, which gave us a little diver- .... mund to board the German ship which would.

  9. ,': :.' ': c'.\\>; ';,.",_".,' ,

    African Journals Online (AJOL)

    genes with small effects. For both crosses the data shows contin,uous distribution in pqd fil! period-2. Pqd fill period-2 was found to be inherited quantitatively in the cross TMO 216 x CIAT16-1 . . " ..• "'':'~' ". The knowledge' o,btained from this study together with heritability, values obtained from other studies will be valuable ...

  10. Low dose irradiation performance of SiC interphase SiC/SiC composites

    International Nuclear Information System (INIS)

    Snead, L.L.; Lowden, R.A.; Strizak, J.; More, K.L.; Eatherly, W.S.; Bailey, J.; Williams, A.M.; Osborne, M.C.; Shinavski, R.J.

    1998-01-01

    Reduced oxygen Hi-Nicalon fiber reinforced composite SiC materials were densified with a chemically vapor infiltrated (CVI) silicon carbide (SiC) matrix and interphases of either 'porous' SiC or multilayer SiC and irradiated to a neutron fluence of 1.1 x 10 25 n m -2 (E>0.1 MeV) in the temperature range of 260 to 1060 C. The unirradiated properties of these composites are superior to previously studied ceramic grade Nicalon fiber reinforced/carbon interphase materials. Negligible reduction in the macroscopic matrix microcracking stress was observed after irradiation for the multilayer SiC interphase material and a slight reduction in matrix microcracking stress was observed for the composite with porous SiC interphase. The reduction in strength for the porous SiC interfacial material is greatest for the highest irradiation temperature. The ultimate fracture stress (in four point bending) following irradiation for the multilayer SiC and porous SiC interphase materials was reduced by 15% and 30%, respectively, which is an improvement over the 40% reduction suffered by irradiated ceramic grade Nicalon fiber materials fabricated in a similar fashion, though with a carbon interphase. The degradation of the mechanical properties of these composites is analyzed by comparison with the irradiation behavior of bare Hi-Nicalon fiber and Morton chemically vapor deposited (CVD) SiC. It is concluded that the degradation of these composites, as with the previous generation ceramic grade Nicalon fiber materials, is dominated by interfacial effects, though the overall degradation of fiber and hence composite is reduced for the newer low-oxygen fiber. (orig.)

  11. Generation of Anaphylatoxins by Human β-Tryptase from C3, C4, and C51

    Science.gov (United States)

    Fukuoka, Yoshihiro; Xia, Han-Zhang; Sanchez-Muñoz, Laura B.; Dellinger, Anthony L.; Escribano, Luis; Schwartz, Lawrence B.

    2009-01-01

    Both mast cells and complement participate in innate and acquired immunity. The current study examines whether β-tryptase, the major protease of human mast cells, can directly generate bioactive complement anaphylatoxins. Important variables included pH, monomeric vs tetrameric forms of β-tryptase, and the β-tryptase-activating polyanion. The B12 mAb was used to stabilize β-tryptase in its monomeric form. C3a and C4a were best generated from C3 and C4, respectively, by monomeric β-tryptase in the presence of low molecular weight dextran sulfate or heparin at acidic pH. High molecular weight polyanions increased degradation of these anaphylatoxins. C5a was optimally generated from C5 at acidic pH by β-tryptase monomers in the presence of high molecular weight dextran sulfate and heparin polyanions, but also was produced by β-tryptase tetramers under these conditions. Mass spectrometry verified that the molecular mass of each anaphylatoxin was correct. Both β-tryptase-generated C5a and C3a (but not C4a) were potent activators of human skin mast cells. These complement anaphylatoxins also could be generated by β-tryptase in releasates of activated skin mast cells. Of further biologic interest, β-tryptase also generated C3a from C3 in human plasma at acidic pH. These results suggest β-tryptase might generate complement anaphylatoxins in vivo at sites of inflammation, such as the airway of active asthma patients where the pH is acidic and where elevated levels of β-tryptase and complement anaphylatoxins are detected. PMID:18424754

  12. Paramagnetic centers in nanocrystalline TiC/C system

    International Nuclear Information System (INIS)

    Guskos, N.; Bodziony, T.; Maryniak, M.; Typek, J.; Biedunkiewicz, A.

    2008-01-01

    Electron paramagnetic resonance is applied to study the defect centers in nanocrystalline titanium carbide dispersed in carbon matrix (TiC x /C) synthesized by the non-hydrolytic sol-gel process. The presence of Ti 3+ paramagnetic centers is identified below 120 K along with a minor contribution from localized defect spins coupled with the conduction electron system in the carbon matrix. The temperature dependence of the resonance intensity of the latter signal indicates weak antiferromagnetic interactions. The presence of paramagnetic centers connected with trivalent titanium is suggested to be the result of chemical disorder, which can be further related to the observed anomalous behavior of conductivity, hardness, and corrosion resistance of nanocrystalline TiC x /C

  13. Dicty_cDB: SHJ782 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DDLGPNTTINIF*tknhsysns*k*krwyfnksgwc*firyykckfrnfir kcfsfm*ftm*fisk*nilfk*sntkfk*krynk*y*lfimsfnefncc**nirsiisp...fm*ftm*fisk*nilfk*sntkfk*krynk*y*lfimsfnefncc**nirsiispi rpniisl*c*nrrnsiiiksiiikww*kkiiktirwcncwyynwlccwcwc

  14. Dicty_cDB: VSG174 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available pslvemlplksnmvslhlsmkmflfavlkth*haqlllvitkri*pk*fhlmlh qvntlvtllspiktmlkspvlhvdinl*t**nkik*nknt Frame B: k*neiiisp...kcfylqfsrpismpnccw*lpkeydrndsi*csir*i hw*rcyhrskqc*nrly*c*y*lvne*nkik*nkntpsinyl*ikkk--- ---k*neiiisplfrscfs

  15. Dicty_cDB: CHP289 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Acid sequence ---dxh*kllxq*xhqtdcs*PCVKNNKAFDIINGVFNKPSLSGSSPKLLNNVFTDDCIV FKTSWXWINGSLFFPKSTNSFAFSI*s Trans...wift*tt**cly**lhc i*nfmxmd*wfsllskin*flclfhli Frame C: ---dxh*kllxq*xhqtdcs*PCVKNNKAFDIINGVFNKPSLSGSSPKLLNNV

  16. Dicty_cDB: AFN327 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TTATAATTTTATTGT AAAGGTTAA sequence update 2009. 4. 3 Translated Amino Acid sequence ifiif*itiiqtiiflilkiivillilvkiiknamak...ftieqisfhviki*mlifili s*i*nptk*qi*liknf*iqvkmnfnfqkql*fyckg* Frame C: ifiif*itiiqtiiflilkiivillilvkiiknama

  17. Dicty_cDB: VSK476 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSK476 (Link to dictyBase) - - - Contig-U07114-1 VSK476Z (Link... to Original site) - - VSK476Z 291 - - - - Show VSK476 Library VS (Link to library) Clone ID VSK476 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U07114-1 Original site URL http://dict...239C9 in linkage group 3. 46 0.24 1 BM495069 |BM495069.1 IpCGBr1_4_C04_22 Ictalur...us punctatus Brain1 primary library Ictalurus punctatus cDNA clone IpCGBr1_4_C04_22_07Mar00_034 3', mRNA seq

  18. Dicty_cDB: VSG286 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSG286 (Link to dictyBase) - - - Contig-U16209-1 VSG286E (Link... Clone ID VSG286 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16209-1 Original site URL http://dict...846 |BQ096846.1 IfHdk00487 Ictalurus furcatus head kidney cDNA library Ictalurus furcatus cDNA 5' similar to... Ribosomal protein Sa (laminin receptor 1), mRNA sequence. 46 2e-11 4 CK406973 |CK406973.1 AUF_IfLvr_212_m02 Ict...alurus furcatus liver cDNA library Ictalurus furcatus cDNA 5' similar to lami

  19. Dicty_cDB: CHL558 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SKTGNVYVADASX--- ---nqqr*innklrc*hsnn*kkpkkisllmkinselhqamkp*wklsri*kprttefqs lkmklml*iyy*mksqkvlkscalavvplm...lvgltkfqvqxfkifwv*nmvlqtnitlssxk Frame C: r*innklrc*hsnn*kkpkkisllmkinselhqamkp*wklsri*kprttefqslkmklm l*iyy*mksqkvlkscala

  20. Dicty_cDB: CHC212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ce nqqr*innklrc*hsnn*kkpkkisllmkinselhqamkp*wklsri*kprttefqslkm klml*iyy*mesqkvlkscalavvplmksvsrkfisvmilhsst...c*hsnn*kkpkkisllmkinselhqamkp*wklsri*kprttefqslkm klml*iyy*mesqkvlkscalavvplmksvsrkfisvmilhsstfikrf*lyqlinkl...**itrxk elnnsvyhv--- ---tnkgk*iin*dvniqtikrnrkrfhc**k*iqsctkq*nl*wklsri*kprttefqs lkmklml*iyy*mesqkvlkscalav