WorldWideScience

Sample records for hassium 274

  1. Dicty_cDB: SLH274 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH274 (Link to dictyBase) - G22493 DDB0218769 Contig-U04171-1 SLH2...74F (Link to Original site) SLH274F 340 - - - - - - Show SLH274 Library SL (Link to library) Clone ID SLH2...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-D/SLH274Q.Seq.d/ ...Representative seq. ID SLH274F (Link to Original site) Representative DNA sequence >SLH274 (SLH274Q) /CSM/SL/SLH2-D/SLH2...core E Sequences producing significant alignments: (bits) Value SLH274 (SLH274Q) /CSM/SL/SLH2-D/SLH274Q.Seq.

  2. 7 CFR 274.7 - Coupon management.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Coupon management. 274.7 Section 274.7 Agriculture... FOOD STAMP AND FOOD DISTRIBUTION PROGRAM ISSUANCE AND USE OF COUPONS § 274.7 Coupon management. (a) Coupon inventory management. State agencies shall establish coupon inventory management systems which...

  3. 7 CFR 274.3 - Issuance systems.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Issuance systems. 274.3 Section 274.3 Agriculture... FOOD STAMP AND FOOD DISTRIBUTION PROGRAM ISSUANCE AND USE OF COUPONS § 274.3 Issuance systems. (a) System classification. State agencies may issue benefits to households through any of the following...

  4. 33 CFR 274.4 - Pesticide management.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Pesticide management. 274.4... DEFENSE PEST CONTROL PROGRAM FOR CIVIL WORKS PROJECTS Project Operation § 274.4 Pesticide management. (a... control management personnel prior to advertisement of the contract and procurement of services. The...

  5. 7 CFR 1822.274 - Loan closing.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 12 2010-01-01 2010-01-01 false Loan closing. 1822.274 Section 1822.274 Agriculture... SERVICE, RURAL UTILITIES SERVICE, AND FARM SERVICE AGENCY, DEPARTMENT OF AGRICULTURE LOANS AND GRANTS PRIMARILY FOR REAL ESTATE PURPOSES RURAL HOUSING LOANS AND GRANTS Rural Housing Site Loan Policies...

  6. 8 CFR 274.1 - Seizure and forfeiture authority.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Seizure and forfeiture authority. 274.1 Section 274.1 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS SEIZURE AND FORFEITURE OF CONVEYANCES § 274.1 Seizure and forfeiture authority. Any officer of Customs and Border...

  7. 8 CFR 274a.4 - Good faith defense.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Good faith defense. 274a.4 Section 274a.4... ALIENS Employer Requirements § 274a.4 Good faith defense. An employer or a recruiter or referrer for a fee for employment who shows good faith compliance with the employment verification requirements of...

  8. 40 CFR 52.274 - California air pollution emergency plan.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 3 2010-07-01 2010-07-01 false California air pollution emergency plan. 52.274 Section 52.274 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) APPROVAL AND PROMULGATION OF IMPLEMENTATION PLANS California § 52.274 California air pollution emergency plan. (a) Since the...

  9. 8 CFR 274a.3 - Continuing employment of unauthorized aliens.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Continuing employment of unauthorized aliens. 274a.3 Section 274a.3 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS CONTROL OF EMPLOYMENT OF ALIENS Employer Requirements § 274a.3 Continuing employment of...

  10. 7 CFR 274.1 - State agency issuance responsibility.

    Science.gov (United States)

    2010-01-01

    ... a retail food store, if the issuance is performed by a bank, credit union or other financial... 274.1 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE FOOD STAMP AND FOOD DISTRIBUTION PROGRAM ISSUANCE AND USE OF COUPONS § 274.1 State...

  11. 28 CFR 68.55 - Referral of cases arising under sections 274A or 274C to the Attorney General for review.

    Science.gov (United States)

    2010-07-01

    ...) Review by the Attorney General. When a final order of an Administrative Law Judge or the Chief... 274A or 274C to the Attorney General for review. 68.55 Section 68.55 Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED) RULES OF PRACTICE AND PROCEDURE FOR ADMINISTRATIVE HEARINGS BEFORE...

  12. The Cryo-Thermochromatographic Separator (CTS) A new rapid separation and alpha-detection system for on-line chemical studies of highly volatile osmium and hassium (Z=108) tetroxides

    CERN Document Server

    Kirbach, U W; Gregorich, K E; Lee, D M; Ninov, V; Omtvedt, J P; Patin, J B; Seward, N K; Strellis, D A; Sudowe, R; Türler, A; Wilk, P A; Zielinski, P M; Hoffman, D C; Nitsche, H

    2002-01-01

    The Cryo-Thermochromatographic Separator (CTS) was designed and constructed for rapid, continuous on-line separation and simultaneous detection of highly volatile compounds of short-lived alpha-decaying isotopes of osmium and hassium (Hs, Z=108). A flowing carrier gas containing the volatile species is passed through a channel formed by two facing rows of 32 alpha-particle detectors, cooled to form a temperature gradient extending from 247 K at the channel entrance down to 176 K at the exit. The volatile species adsorb onto the SiO sub 2 -coated detector surfaces at a characteristic deposition temperature and are identified by their observed alpha-decay energies. The CTS was tested on-line with OsO sub 4 prepared from sup 1 sup 6 sup 9 sup - sup 1 sup 7 sup 3 Os isotopes produced in sup 1 sup 1 sup 8 sup , sup 1 sup 2 sup 0 Sn( sup 5 sup 6 Fe, 3,4,5n) reactions. An adsorption enthalpy for OsO sub 4 of -40.2+-1.5 kJ/mol on SiO sub 2 was deduced by comparing the measured deposition distribution with Monte Carlo...

  13. 8 CFR 274a.12 - Classes of aliens authorized to accept employment.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Classes of aliens authorized to accept employment. 274a.12 Section 274a.12 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS CONTROL OF EMPLOYMENT OF ALIENS Employment Authorization § 274a.12 Classes of aliens authorized to...

  14. Test report - 241-AN-274 Caustic Pump Control Building

    International Nuclear Information System (INIS)

    Paintner, G.P.

    1995-05-01

    This Acceptance Test Report documents the test results of test procedure WHC-SD-WM-ATP-135 'Acceptance Test Procedure for the 241-AN- 274 Caustic Pump Control Building.' The objective of the test was to verify that the 241-AN-274 Caustic Pump Control Building functions properly based on design specifications per applicable H-2-85573 drawings and associated ECN's. The objective of the test was met

  15. 26 CFR 1.274-3 - Disallowance of deduction for gifts.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Disallowance of deduction for gifts. 1.274-3... TAX (CONTINUED) INCOME TAXES Items Not Deductible § 1.274-3 Disallowance of deduction for gifts. (a) In general. No deduction shall be allowed under section 162 or 212 for any expense for a gift made...

  16. 38 CFR 3.274 - Relationship of net worth to pension entitlement.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Relationship of net worth to pension entitlement. 3.274 Section 3.274 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS ADJUDICATION Pension, Compensation, and Dependency and Indemnity Compensation Regulations...

  17. CD274 promotes cell cycle entry of leukemia-initiating cells through JNK/Cyclin D2 signaling

    Directory of Open Access Journals (Sweden)

    Xia Fang

    2016-11-01

    Full Text Available Abstract Background CD274 (programmed death ligand 1, also known as B7H1 is expressed in both solid tumors and hematologic malignancies and is of critical importance for the escape of tumor cells from immune surveillance by inhibiting T cell function via its receptor, programmed death 1 (PD-1. Increasing evidence indicates that functional monoclonal antibodies of CD274 may potently enhance the antitumor effect in many cancers. However, the role of CD274 in leukemia-initiating cells (LICs remains largely unknown. Methods We established an MLL-AF9-induced acute myeloid leukemia (AML model with wild-type (WT and CD274-null mice to elucidate the role of CD274 in the cell fates of LICs, including self-renewal, differentiation, cell cycle, and apoptosis. RNA sequencing was performed to reveal the potential downstream targets, the results of which were further validated both in vitro and in vivo. Results In silico analysis indicated that CD274 level was inversely correlated with the overall survival of AML patients. In Mac-1+/c-Kit+ mouse LICs, CD274 was expressed at a much higher level than in the normal hematopoietic stem cells (HSCs. The survival of the mice with CD274-null leukemia cells was dramatically extended during the serial transplantation compared with that of their WT counterparts. CD274 deletion led to a significant decrease in LIC frequency and arrest in the G1 phase of the cell cycle. Interestingly, CD274 is not required for the maintenance of HSC pool as shown in our previous study. Mechanistically, we demonstrated that the levels of both phospho-JNK and Cyclin D2 were strikingly downregulated in CD274-null LICs. The overexpression of Cyclin D2 fully rescued the loss of function of CD274. Moreover, CD274 was directly associated with JNK and enhanced the downstream signaling to increase the Cyclin D2 level, promoting leukemia development. Conclusions The surface immune molecule CD274 plays a critical role in the proliferation of LICs

  18. 26 CFR 5e.274-8 - Travel expenses of Members of Congress.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 14 2010-04-01 2010-04-01 false Travel expenses of Members of Congress. 5e.274...) INCOME TAX (CONTINUED) TEMPORARY INCOME TAX REGULATIONS, TRAVEL EXPENSES OF MEMBERS OF CONGRESS § 5e.274-8 Travel expenses of Members of Congress. (a) In general. Members of Congress (including any...

  19. XTE J1946+274: An Enigmatic X-Ray Pulsar

    Science.gov (United States)

    Wilson, Colleen A.; Finger, Mark H.; Coe, M. J.; Negueruela, Ignacio; Six, N. Frank (Technical Monitor)

    2002-01-01

    XTE J1946+274 = GRO J1944+26 is a 15.8-s X-ray pulsar discovered simultaneously by the Rossi X-ray Timing Explorer (RXTE) and the Burst and Transient Source Experiment (BATSE) in September 1998. Follow-up optical/IR observations resulted in the discovery of a Be star companion. Our pulse timing analysis of BATSE and RXTE data indicates that the orbital period is approximately 169 days. Since its discovery in 1998, XTE J1946+274 has undergone 13 outbursts. These outbursts axe not regularly spaced. They occur approximately twice per orbit and are not locked in orbital phase, unlike most Be/X-ray transient systems. A possible explanation for this is a global-one armed oscillation or density perturbation propagating rapidly in the Be star's disk. We will investigate radial velocity variations in the central peak of the H-alpha line to look for evidence of such a perturbation. From 2001 March-September, we regularly monitored XTE J1946+274 with the RXTE PCA. We will demonstrate that the spectrum appears to be varying with orbital phase, based on the 2001 and 1998 RXTE PCA observations. We will also present histories of pulsed frequency and flux.

  20. Orientational Phase Transition Around 274 K in C60 Single Crystal

    Institute of Scientific and Technical Information of China (English)

    徐亚伯; 何丕模; 杨宏顺; 郑萍; 余朝文; 陈兆甲; 张宣嘉; 李文铸

    1994-01-01

    The electrical conductivity of a C60 single crystal around 274 K and the specific heat of C60 crystals from 150 to 340 K have been measured.The delta-like specific heat peak at about 251 K related to the first-order phase transition has been reported.The activation energy change around 274 K and the lambda-like specific heat peak beginning at 270 K and ending at 310 K show that there is an orientational phase transition in fcc C60 crystals above 251 K.By taking the symmetry into consideration and further analyzing lambda-like specific heat peak and the activation energy change around 274 K,the conclusion has been reached that this new phase transition is an orientational structure transition from the merohedral twinning fcc to the orientationally disordered fcc.The temperature of free rotation of C60 molecules is about 281 K.

  1. 17 CFR 274.130 - Form N-Q, quarterly schedule of portfolio holdings of registered management investment company.

    Science.gov (United States)

    2010-04-01

    ... of portfolio holdings of registered management investment company. 274.130 Section 274.130 Commodity... INVESTMENT COMPANY ACT OF 1940 Forms for Reports § 274.130 Form N-Q, quarterly schedule of portfolio holdings of registered management investment company. This form shall be used by registered management...

  2. 33 CFR 274.7 - Authorization of pesticide use.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Authorization of pesticide use... of pesticide use. (a) Programs approved in § 274.6(b) must be those as described on the pesticide label. Pesticide uses which are different from the registered use, require amendment of the label...

  3. 17 CFR 274.11 - Form N-1, registration statement of open-end management investment companies.

    Science.gov (United States)

    2010-04-01

    ... statement of open-end management investment companies. 274.11 Section 274.11 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) FORMS PRESCRIBED UNDER THE INVESTMENT COMPANY ACT...(b) of the Investment Company Act of 1940 by open-end management investment companies that are...

  4. 48 CFR 211.274-3 - Policy for valuation.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Policy for valuation. 211... Documents 211.274-3 Policy for valuation. (a) It is DoD policy that contractors shall be required to...'s unit acquisition cost is— (1) For fixed-price type line, subline, or exhibit line items, the unit...

  5. 26 CFR 1.274-5A - Substantiation requirements.

    Science.gov (United States)

    2010-04-01

    ... implement the provisions of section 274 and the regulations thereunder by personal interview or otherwise... its equivalent. A notation such as “personal use” or “family use” would, in the case of such use, be... concerning a facility which is likely to serve the personal purposes of the taxpayer, it shall be presumed...

  6. 40 CFR 421.274 - Standards of performance for new sources.

    Science.gov (United States)

    2010-07-01

    ... times. (e) Sodium hypochlorite filter backwash. NSPS for the Primary Rare Earth Metals Subcategory...) EFFLUENT GUIDELINES AND STANDARDS NONFERROUS METALS MANUFACTURING POINT SOURCE CATEGORY Primary Rare Earth Metals Subcategory § 421.274 Standards of performance for new sources. Any new source subject to this...

  7. 17 CFR 274.129 - Form N-PX, annual report of proxy voting record of registered management investment company.

    Science.gov (United States)

    2010-04-01

    ... proxy voting record of registered management investment company. 274.129 Section 274.129 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) FORMS PRESCRIBED UNDER THE INVESTMENT... registered management investment company. This form shall be used by registered management investment...

  8. 17 CFR 274.11a-1 - Form N-2, registration statement of closed end management investment companies.

    Science.gov (United States)

    2010-04-01

    ... statement of closed end management investment companies. 274.11a-1 Section 274.11a-1 Commodity and... management investment companies. This form shall be used as the registration statement to be filed pursuant to section 8(b) of the Investment Company Act of 1940 by closed end management investment companies...

  9. 17 CFR 274.11A - Form N-1A, registration statement of open-end management investment companies.

    Science.gov (United States)

    2010-04-01

    ... statement of open-end management investment companies. 274.11A Section 274.11A Commodity and Securities...(b) of the Investment Company Act of 1940 by open-end management investment companies other than... registration under the Securities Act of 1933 of the securities of all open-end management investment companies...

  10. 17 CFR 274.11b - Form N-3, registration statement of separate accounts organized as management investment companies.

    Science.gov (United States)

    2010-04-01

    ... statement of separate accounts organized as management investment companies. 274.11b Section 274.11b... accounts organized as management investment companies. Form N-3 shall be used as the registration statement... offer variable annuity contracts to register as management investment companies. This form shall also be...

  11. 20 CFR 667.274 - What health and safety standards apply to the working conditions of participants in activities...

    Science.gov (United States)

    2010-04-01

    ... and safety standards apply to the working conditions of participants in activities under title I of... working conditions of participants in activities under title I of WIA? 667.274 Section 667.274 Employees... working conditions of employees are equally applicable to working conditions of participants engaged in...

  12. Culture conditions of Roseobacter strain 27-4 affect its attachment and biofilm formation as quantified by real-time PCR

    DEFF Research Database (Denmark)

    Bruhn, Jesper Bartholin; Haagensen, Janus Anders Juul; Bagge-Ravn, D.

    2006-01-01

    The fish probiotic bacterium Roseobacter strain 27-4 grows only as rosettes and produces its antibacterial compound under static growth conditions. It forms three-dimensional biofilms when precultured under static conditions. We quantified attachment of Roseobacter strain 27-4 using a direct real...

  13. The Reawakening of the Sleeping X-ray Pulsar XTE J1946+274

    Science.gov (United States)

    Mueller, Sebastian; Mueller, Sebastian; Kuechnel, Matthias; Fuerst, Felix; Kreykenbohm, Ingo; Sagredo, Macarena; Obst, Maria; Wilms, Joern; Caballero, Isabel; Potttschmidt, Katja; hide

    2012-01-01

    We report on a series of outbursts of the high mass X-ray binary XTE 11946+274 in 2010/2011 as observed with INTEGRAL, RXTE, and Swift. We discuss possible mechanisms resulting in the extraordinary outburst behavior of this source. The X-ray spectra can be described by standard phenomenological models, enhanced by an absorption feature of unknown origin at about 10 keV and a narrow iron K alpha fluorescence line at 6.4keV, which are variable in flux and pulse phase. We find possible evidence for the presence of a cyclotron resonance scattering feature at about 25 keV at the 93% level. The presence of a strong cyclotron line at 35 keV seen in data from the source's 1998 outburst and confirmed by a reanalysis of these data can be excluded. This result indicates that the cyclotron line feature in XTE 11946+274 is variable between individual outbursts.

  14. 26 CFR 1.274-1 - Disallowance of certain entertainment, gift and travel expenses.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Disallowance of certain entertainment, gift and... certain entertainment, gift and travel expenses. Section 274 disallows in whole, or in part, certain expenditures for entertainment, gifts and travel which would otherwise be allowable under Chapter 1 of the Code...

  15. 17 CFR 274.404 - Form TH-Notification of reliance on temporary hardship exemption.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form TH-Notification of... Forms for Electronic Filing § 274.404 Form TH—Notification of reliance on temporary hardship exemption. Form TH shall be filed by any electronic filer who submits to the Commission, pursuant to a temporary...

  16. 48 CFR 211.274-4 - Policy for reporting of Government-furnished equipment in the DoD Item Unique Identification...

    Science.gov (United States)

    2010-10-01

    ... DEFENSE ACQUISITION PLANNING DESCRIBING AGENCY NEEDS Using and Maintaining Requirements Documents 211.274... contract state otherwise; (b) Government-furnished material; (c) Reparables; (d) Contractor-acquired...

  17. Clasificación del traumatismo del bazo: Estudio de 274 pacientes

    Directory of Open Access Journals (Sweden)

    Eddy Sierra Enrique

    1997-08-01

    Full Text Available Se revisaron 274 historias clínicas que presentaron traumatismo del bazo, en el Hospital Militar "Comandante Manuel Fajardo Rivero" y Hospital Provincial Clinicoquirúrgico Docente, ambos de Santa Clara, durante los años 1988-1994. Se describe la clasificación del trauma esplénico grado 1, con 97 pacientes; grado 2, 53 pacientes; grado 3, 71 pacientes, los grados 2A,33 pacientes y grado 3B, 20 pacientes. Las complicaciones en los esplenectomizados fueron 40, para una morbilidad del 22,3 % y hubo 2 complicaciones en los pacientes a quienes se les realizó cirugía conservadora, para el 2,1 %. No hubo mortalidad en la cirugía conservadora, pero es de señalar que ocurrieron en los traumas de menor cuantía, los grados 1 y 2. Hubo 5 pacientes fallecidos en los esplenectomizados para el 2,7 % de mortalidad, y fue la mortalidad asociada de 9,8 %A number of 274 medical histories presenting with spleen injuries were revised at "Comandante Manuel Fajardo Rivero" Military Hospital, and at the Teaching and Provincial Clinico surgical Hospital of Santa Clara during 1988-1994. The classification of splenic trauma grade 1 with 97 patients; grade 2 with 53 patients; grade 3 with 71 patients, grade 2 A with 33 patients, and grade 3 B with 20 patients, is described. Complications in splectomized patients were found to be 40 accounting for a morbidity of 22.3 %. There were 2 complications in patients who underwent a conservative surgical procedure, accounting for 2.1 %. There was no mortality rate regarding conservative surgery, but injuries less severe grades 1 and 2 occurred. Five patients died in the group of splectomized patients accounting for 2.7 % of mortality; the associated mortality was 9.8 %

  18. Evidence for the formation of sodium hassate(VIII)

    International Nuclear Information System (INIS)

    Zweidorf, A. von; Angert, R.; Bruechle, W.; Buerger, S.; Eberhardt, K.; Eichler, R.; Hummrich, H.; Jaeger, E.; Kling, H.O.; Kratz, J.V.; Kuczewski, B.; Langrock, G.; Mendel, M.; Rieth, U.; Schaedel, M.; Schausten, B.; Schimpf, E.; Thoerle, P.; Trautmann, N.; Tsukada, K.; Wiehl, N.; Wirth, G.

    2004-01-01

    Hassium, element 108, was produced in the fusion reaction between 26 Mg and 248 Cm. The hassium recoils were oxidized in-situ to a highly volatile oxide, presumably HsO 4 , and were transported in a mixture of He and O 2 to a deposition and detection system. The latter consisted of 16 silicon PIN-photodiodes facing a layer of NaOH, which served, in the presence of a certain partial pressure of water in the transport gas, as reactive surface for the deposition of the volatile tetroxides. Six correlated α-decay chains of Hs were detected in the first 5 detectors centred around detection position 3. In analogy to OsO 4 , which forms Na 2 [OsO 4 (OH) 2 ], an osmate(VIII), with aqueous NaOH, HsO 4 presumably was deposited as Na 2 [HsO 4 (OH) 2 ], a hassate(VIII). (orig.)

  19. PLANETS AROUND THE K-GIANTS BD+20 274 AND HD 219415

    International Nuclear Information System (INIS)

    Gettel, S.; Wolszczan, A.; Niedzielski, A.; Nowak, G.; Adamów, M.; Zieliński, P.; Maciejewski, G.

    2012-01-01

    We present the discovery of planet-mass companions to two giant stars by the ongoing Penn State-Toruń Planet Search conducted with the 9.2 m Hobby-Eberly Telescope. The less massive of these stars, K5-giant BD+20 274, has a 4.2 M J minimum mass planet orbiting the star at a 578 day period and a more distant, likely stellar-mass companion. The best currently available model of the planet orbiting the K0-giant HD 219415 points to a ∼> Jupiter-mass companion in a 5.7 year, eccentric orbit around the star, making it the longest period planet yet detected by our survey. This planet has an amplitude of ∼18 m s –1 , comparable to the median radial velocity 'jitter', typical of giant stars.

  20. Core drilling of hydco drillholes ONK-PP262 and ONK-PP274 in ONKALO at Olkiluoto 2010

    Energy Technology Data Exchange (ETDEWEB)

    Toropainen, V. [Suomen Malmi Oy, Espoo (Finland)

    2011-10-15

    Suomen Malmi Oy (Smoy) core drilled two drillholes for HYDCO-program in ONKALO at Eurajoki, Olkiluoto in 2010. The drillhole ONK-PP262 was drilled in May 2010 and the drillhole ONK-PP274 in December 2010. The lengths of the drillholes are 25.02 and 23.88 m respectively. The drillholes are 75.7 mm by diameter. The drillholes were drilled in the investigation niche 4 at the access tunnel chainage 3747. The hydraulic DE 130 drilling rig was used. The drilling water was taken from the ONKALO drilling water pipeline and premixed sodium fluorescein was used as a label agent in the drilling water. The drillholes were measured with EMS deviation survey tool. In addition to drilling the drillcores were logged and reported by geologist. Geological logging included the following parameters: lithology, foliation, fracture parameters, fractured zones, core loss, weathering, fracture frequency, RQD and rock quality. The main rock types in the drillholes are veined gneiss and pegmatitic granite. The average fracture frequencies in both drill cores are 1.4 pcs/m. The average RQD values in the drillcores are 97.2 % (ONK-PP262) and 98.6 % (ONK-PP274). (orig.)

  1. Core drilling of hydco drillholes ONK-PP262 and ONK-PP274 in ONKALO at Olkiluoto 2010

    International Nuclear Information System (INIS)

    Toropainen, V.

    2011-10-01

    Suomen Malmi Oy (Smoy) core drilled two drillholes for HYDCO-program in ONKALO at Eurajoki, Olkiluoto in 2010. The drillhole ONK-PP262 was drilled in May 2010 and the drillhole ONK-PP274 in December 2010. The lengths of the drillholes are 25.02 and 23.88 m respectively. The drillholes are 75.7 mm by diameter. The drillholes were drilled in the investigation niche 4 at the access tunnel chainage 3747. The hydraulic DE 130 drilling rig was used. The drilling water was taken from the ONKALO drilling water pipeline and premixed sodium fluorescein was used as a label agent in the drilling water. The drillholes were measured with EMS deviation survey tool. In addition to drilling the drillcores were logged and reported by geologist. Geological logging included the following parameters: lithology, foliation, fracture parameters, fractured zones, core loss, weathering, fracture frequency, RQD and rock quality. The main rock types in the drillholes are veined gneiss and pegmatitic granite. The average fracture frequencies in both drill cores are 1.4 pcs/m. The average RQD values in the drillcores are 97.2 % (ONK-PP262) and 98.6 % (ONK-PP274). (orig.)

  2. Pressure, flow and hydraulic interference measurements in ONKALO at Olkiluoto, drillholes ONK-PP262 and ONK-PP274

    International Nuclear Information System (INIS)

    Hurmerinta, E.; Pekkanen, J.; Komulainen, J.; Rouhiainen, P.

    2012-01-01

    The general purpose of these studies is to characterize the fracture network and groundwater flow properties in a volume of rock, which is representative of the rock close to deposition holes. As a part of the studies hydraulic tests and flow measurements were applied in two drillholes in hydraulically poorly conductive bedrock. This report presents the principles of the methods as well as the results of the measurements carried out in the underground facilities of ONKALO. The measurements were conducted in drillholes ONK-PP262 and ONK-PP274 between May 9, 2010 and June 9, 2011. The aim of the measurements was to obtain pressure in the closed drillholes, to detect water yielding fractures by flow measurements, to obtain transmissivity with overpressure and drawdown tests and to study hydraulic interference between the drillholes by cross-hole hydraulic tests. The PFL DIFF probe was used to detect flow within single fractures in the drillhole. Transmissive water yielding fractures were found at depths 17.9 m, 16.9 m and 16.4 m in ONK-PP262 and at depths 19.8 m and 19.5 m in ONK-PP274. The cross-hole hydraulic tests included three basic phases. Flow was measured in one drillhole when the other drillhole was open, closed or overpressurized. The cross-hole hydraulic tests were carried out to both directions in the two drillholes. (orig.)

  3. The hadronic final state in $e^{+}e^{-}$ annihilation at c.m. energies of 13, 17 and 27.4 GeV

    CERN Document Server

    Cashmore, R J; Braunschweig, W.; Gather, K.; Jaax, B.; Kadansky, V.; Lubelsmeyer, K.; Martyn, H.U.; Peise, G.; Rimkus, J.; Sander, H.G.; Schmitz, D.; Schultz von Dratzig, A.; Trines, D.; Wallraff, W.; Boerner, H.; Fischer, H.M.; Hartmann, H.; Hilger, E.; Hillen, W.; Knop, G.; Korbach, W.; Lohr, B.; Roth, F.; Ruhmer, W.; Wedemeyer, R.; Wermes, N.; Wollstadt, M.; Buhring, R.; Heyland, D.; Hultschig, H.; Joos, P.; Koch, W.; Kotz, U.; Kowalski, H.; Ladage, A.; Luke, D.; Lynch, H.L.; Mikenberg, G.; Notz, D.; Pyrlik, J.; Riethmuller, R.; Schliwa, M.; Soding, P.; Wiik, B.H.; Wolf, G.; Fohrmann, R.; Poelz, G.; Ringel, J.; Romer, O.; Rusch, R.; Schmueser, Peter; Binnie, D.M.; Dornan, P.J.; Downie, N.A.; Garbutt, D.A.; Jones, W.G.; Lloyd, S.L.; Pandoulas, D.; Youngman, C.; Barlow, Roger J.; Illingworth, J.; Ogg, M.; Salmon, G.L.; Bell, Kenneth Watson; Chinowsky, W.; Foster, B.; Hart, J.C.; Proudfoot, J.; Quarrie, D.R.; Saxon, D.H.; Woodworth, P.L.

    1979-01-01

    Results on the hadronic final state in e/sup +/e/sup -/ annihilation at 13, 17 and 27.4 GeV are presented. There is no compelling evidence for the existence of the t quark in these data, which are in general agreement with a simple quark parton model. Some tentative indications of QCD effects are observed in the p/sub T//sup 2/ distributions.

  4. Decay properties of nuclei close to Z = 108 and N = 162

    International Nuclear Information System (INIS)

    Dvorak, Jan

    2007-01-01

    The goal of the research conducted in the frame of this thesis was to investigate the decay properties of the nuclides 269-271 Hs and their daughters using an improved chemical separation and detection system. Shell stabilization was predicted in the region around Z=108 and N=162 in calculations, taking into account possible higher orders of deformations of the nuclei. The nucleus 270 Hs with a closed proton and a closed neutron deformed shell, was predicted to be ''deformed doubly magic''. Nuclei around 270 Hs can be produced only via fusion reactions at picobarn levels, resulting in a production rates of few atoms per day. Investigating short-lived nuclei using rapid chemical separation and subsequent on-line detection methods provides an independent and alternative means to electromagnetic on-line separators. Chemical separation of Hs in the form of HsO 4 provides an excellent tool to study the formation reactions and nuclear structure in this region of the chart of nuclides due to a high overall efficiency and a very high purification factor. The goal was accomplished, as element 108, hassium, was produced in the reaction 248 Cm( 26 Mg,xn) 274-x Hs and chemically isolated. After gas phase separation of HsO 4 , 26 genetically linked decay chains have been observed. These were attributed to decays of three different Hs isotopes produced in the 3-5n evaporation channels. The known decay chain of 269 Hs, the 5n evaporation product, serves as an anchor point, thus allowing the unambiguous assignment of the observed decay chains to the 5n, 4n, and 3n channels, respectively. Decay properties of five nuclei have been unambiguously established for the first time, including the one for the the doubly-magic nuclide 270 Hs. This hassium isotope is the next doubly magic nucleus after the well known 208 Pb and the first experimentally observed even-even nucleus on the predicted N=162 neutron shell. The observed decay properties provide strong indications for enhanced nuclear

  5. Geophysical logging and imaging of shallow drillholes ONK-PP262 and ONK-274 at Olkiluoto in 2010

    International Nuclear Information System (INIS)

    Tarvainen, A.-M.

    2011-11-01

    Suomen Malmi Oy conducted geophysical drillhole logging as well as optical and acoustic imaging of shallow drillholes ONK-PP262 and ONK-PP274 at ONKALO in the investigation niche ONK-TKU-4 (Hydco) in May and in December 2010. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and data processing. The report describes field operation, equipment as well as processing procedures and shows the obtained results and an analysis of their quality in the appendices. The raw and processed data are delivered digitally in WellCAD, PDF and Excel format. (orig.)

  6. Decay properties of nuclei close to Z = 108 and N = 162

    Energy Technology Data Exchange (ETDEWEB)

    Dvorak, Jan

    2007-07-12

    The goal of the research conducted in the frame of this thesis was to investigate the decay properties of the nuclides {sup 269-271}Hs and their daughters using an improved chemical separation and detection system. Shell stabilization was predicted in the region around Z=108 and N=162 in calculations, taking into account possible higher orders of deformations of the nuclei. The nucleus {sup 270}Hs with a closed proton and a closed neutron deformed shell, was predicted to be ''deformed doubly magic''. Nuclei around {sup 270}Hs can be produced only via fusion reactions at picobarn levels, resulting in a production rates of few atoms per day. Investigating short-lived nuclei using rapid chemical separation and subsequent on-line detection methods provides an independent and alternative means to electromagnetic on-line separators. Chemical separation of Hs in the form of HsO{sub 4} provides an excellent tool to study the formation reactions and nuclear structure in this region of the chart of nuclides due to a high overall efficiency and a very high purification factor. The goal was accomplished, as element 108, hassium, was produced in the reaction {sup 248}Cm({sup 26}Mg,xn){sup 274-x}Hs and chemically isolated. After gas phase separation of HsO{sub 4}, 26 genetically linked decay chains have been observed. These were attributed to decays of three different Hs isotopes produced in the 3-5n evaporation channels. The known decay chain of {sup 269}Hs, the 5n evaporation product, serves as an anchor point, thus allowing the unambiguous assignment of the observed decay chains to the 5n, 4n, and 3n channels, respectively. Decay properties of five nuclei have been unambiguously established for the first time, including the one for the the doubly-magic nuclide {sup 270}Hs. This hassium isotope is the next doubly magic nucleus after the well known {sup 208}Pb and the first experimentally observed even-even nucleus on the predicted N=162 neutron shell. The

  7. US Findings of Small Hepatocellular Carcinoma : Analysis of 274 cases

    Energy Technology Data Exchange (ETDEWEB)

    Jung, Hye Weon; Lee, Hak Jong; Kim, Tae Kyung; Han, Joon Koo; Choi, Byung Ihn [Seoul National University College of Medicine, Seoul (Korea, Republic of)

    1996-12-15

    The prognosis of hepatocellular carcinoma (HCC) is very poor because of the difficulty in early detection and association with the liver cirrhosis. Because the surgical resection or transarterial chemoembolization is the most effective treatment, the detection of the small HCCs is important. The purpose of this study was to assess the frequencies of a suggestive sonographic morphology of small HCC. In 222 patients with small HCCs less than 5 cm in diameter, each sonographic feature of 274 nodules was analyzed. HCCs were diagnosed pathologically (n = 83) or by elevated serum alpha-fetoprotein levels and characteristic angiographic {delta} Lipiodol CT findings (n = 191). The diameters of the tumors were as follows : {<=} 2 cm (n = 90),2{approx}3 cm (n = 87), and 3{approx}5 cm (n = 97). The frequencies of sonographic morphology of small HCCs including echo pattern, peripheral hypoechoic halo, lateral shadow, posterior acoustic enhancement, and the mosaic pattern were assessed. For statistical analysis of the differences of echo pattern, Chi-square test was used and for evaluation of the differences of the sonographic characteristics according to the tumor size, Friedman Two-Way ANOVA test was used. Overall, characteristics of small HCCs less than 5 cm were peripheral halo (70%), posterior enhancement (43%), and mosaic pattern (39%). In small HCCs less than 3 cm hyper echoic masses are more common than hypoechoic masses, which is different from previous peports. The smaller the mass, the more frequent the incidence of high or low echo pattern. Mixed echo pattern, peripheral halo, and mosaic pattern increased isoecho, lateral shadow, and posterior acoustic enhancement between 2 cm, 2{approx}3 cm, and 3{approx}5 cm size nodules.The understanding about the sonographic characteristics of small HCCs according to the size may be useful for the detection and characterization of the small HCCs

  8. THE TRANSIENT ACCRETING X-RAY PULSAR XTE J1946+274: STABILITY OF X-RAY PROPERTIES AT LOW FLUX AND UPDATED ORBITAL SOLUTION

    Energy Technology Data Exchange (ETDEWEB)

    Marcu-Cheatham, Diana M.; Pottschmidt, Katja [CRESST and Department of Physics, University of Maryland Baltimore County, 1000 Hilltop Circle, Baltimore, MD 21250 (United States); Kühnel, Matthias; Müller, Sebastian; Falkner, Sebastian; Kreykenbohm, Ingo [Dr. Karl Remeis-Observatory and ECAP, University Erlangen-Nuremberg, Sternwartstr. 7, Bamberg (Germany); Caballero, Isabel [Laboratoire AIM, CEA/IRFU, CNRS/INSU, Université Paris Diderot, CEA DSM/IRFU/SAp, F-91191 Gif-sur-Yvette (France); Finger, Mark H. [Universities Space Research Association, National Space Science and Technology Center, 320 Sparkman Drive, Huntsville, AL 35805 (United States); Jenke, Peter J. [University of Alabama in Huntsville, 301 Sparkman Drive, Huntsville, AL 35899 (United States); Wilson-Hodge, Colleen A. [Astrophysics Office, ZP 12, NASA Marshall Space Flight Center, Huntsville, AL 35812 (United States); Fürst, Felix [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Grinberg, Victoria [Massachusetts Institute of Technology, Kavli Institute for Astrophysics, Cambridge, MA 02139 (United States); Hemphill, Paul B.; Rothschild, Richard E. [University of California, San Diego, Center for Astrophysics and Space Sciences, 9500 Gilman Drive, La Jolla, CA 92093-0424 (United States); Klochkov, Dmitry [Institut für Astronomie und Astrophysik, Universität Tübingen (IAAT), Sand 1, Tübingen (Germany); Terada, Yukikatsu [Graduate School of Science and Engineering, Saitama University, 255 Simo-Ohkubo, Sakura-ku, Saitama City, Saitama 338-8570 (Japan); and others

    2015-12-10

    We present a timing and spectral analysis of the X-ray pulsar XTE J1946+274 observed with Suzaku during an outburst decline in 2010 October and compare with previous results. XTE J1946+274 is a transient X-ray binary consisting of a Be-type star and a neutron star with a 15.75 s pulse period in a 172 days orbit with 2–3 outbursts per orbit during phases of activity. We improve the orbital solution using data from multiple instruments. The X-ray spectrum can be described by an absorbed Fermi–Dirac cut-off power-law model along with a narrow Fe Kα line at 6.4 keV and a weak Cyclotron Resonance Scattering Feature (CRSF) at ∼35 keV. The Suzaku data are consistent with the previously observed continuum flux versus iron line flux correlation expected from fluorescence emission along the line of sight. However, the observed iron line flux is slightly higher, indicating the possibility of a higher iron abundance or the presence of non-uniform material. We argue that the source most likely has only been observed in the subcritical (non-radiation dominated) state since its pulse profile is stable over all observed luminosities and the energy of the CRSF is approximately the same at the highest (∼5 × 10{sup 37} erg s{sup −1}) and lowest (∼5 × 10{sup 36} erg s{sup −1}) observed 3–60 keV luminosities.

  9. Thromboembolic risk in 16 274 atrial fibrillation patients undergoing direct current cardioversion with and without oral anticoagulant therapy

    DEFF Research Database (Denmark)

    Hansen, Morten Lock; Jepsen, Rikke Malene H G; Olesen, Jonas Bjerring

    2015-01-01

    -time DC cardioversion for atrial fibrillation between 2000 and 2008. Use of oral anticoagulant therapy within 90 days prior and 360 days after DC cardioversion was obtained from the Danish Register of Medicinal Product Statistics. The risk of thromboembolism was estimated by calculating incidence rates......AIMS: To study the risk of thromboembolism in a nationwide cohort of atrial fibrillation patients undergoing direct current (DC) cardioversion with or without oral anticoagulant coverage. METHODS AND RESULTS: A retrospective study of 16 274 patients in Denmark discharged from hospital after a first...... and by multivariable adjusted Cox proportional-hazard models. During the initial 30 days following discharge, the thromboembolic incidence rate was 10.33 per 100 patient-years for the no prior oral anticoagulant therapy group [n = 5084 (31.2%)], as compared with 4.00 per 100 patient-years for the prior oral...

  10. Genome Sequencing and Comparative Analysis of the Biocontrol Agent Trichoderma harzianum sensu stricto TR274

    Energy Technology Data Exchange (ETDEWEB)

    Steindorff, Andrei S.; Noronha, Elilane F.; Ulhoa, Cirano J.; Kuo, Alan; Salamov, Asaf A.; Haridas, Sajeet; Riley, Robert W.; Druzhinina, Irina S.; Kubicek, Christian P.; Grigoriev, Igor V.

    2015-03-17

    Biological control is a complex process which requires many mechanisms and a high diversity of biochemical pathways. The species of Trichoderma harzianum are well known for their biocontrol activity against many plant pathogens. To gain new insights into the biocontrol mechanism used by T. harzianum, we sequenced the isolate TR274 genome using Illumina. The assembly was performed using AllPaths-LG with a maximum coverage of 100x. The assembly resulted in 2282 contigs with a N50 of 37033bp. The genome size generated was 40.8 Mb and the GC content was 47.7%, similar to other Trichoderma genomes. Using the JGI Annotation Pipeline we predicted 13,932 genes with a high transcriptome support. CEGMA tests suggested 100% genome completeness and 97.9% of RNA-SEQ reads were mapped to the genome. The phylogenetic comparison using orthologous proteins with all Trichoderma genomes sequenced at JGI, corroborates the Trichoderma (T. asperellum and T. atroviride), Longibrachiatum (T. reesei and T. longibrachiatum) and Pachibasium (T. harzianum and T. virens) section division described previously. The comparison between two Trichoderma harzianum species suggests a high genome similarity but some strain-specific expansions. Analyses of the secondary metabolites, CAZymes, transporters, proteases, transcription factors were performed. The Pachybasium section expanded virtually all categories analyzed compared with the other sections, specially Longibrachiatum section, that shows a clear contraction. These results suggests that these proteins families have an important role in their respective phenotypes. Future analysis will improve the understanding of this complex genus and give some insights about its lifestyle and the interactions with the environment.

  11. Development of a SISAK extraction system for chemical studies of element 108, hassium

    Energy Technology Data Exchange (ETDEWEB)

    Samadani, F.; Alstad, J.; Bjoernstad, T.; Stavsetra, L.; Omtvedt, J.P. [Oslo Univ. (Germany). Dept. of Chemistry

    2010-07-01

    A liquid-liquid extraction system suitable for studies of chemical properties of Hs (element 108), in the form of HsO{sub 4}, was developed using {gamma}-emitting isotopes of its homologue Os. The system is targeted for the fast on-line extraction system SISAK, which operates in a continuous manner and is suitable for liquid-phase studies of transactinide elements. The distribution of OsO{sub 4} between various dilute NaOH solutions and toluene was studied. Both batch and SISAK on-line experiments were performed to develop an appropriate system. From analysis of the extraction curves equilibrium constants for the formation of the presumed complexes, Na[OsO{sub 4}(OH)] and Na{sub 2}[OsO{sub 4}(OH){sub 2}], were obtained: K{sub 1} = (1 {+-} 0.5) x 10{sup 4} and K{sub 2} = 12 {+-} 8, respectively. The SISAK system includes a liquid-scintillation detection system for {alpha} measurements. Due to quenching effects it is not possible to perform direct measurement of the aqueous phase {alpha}'s. Therefore, a two-stage extraction method that provides an indirect measurement of the activity in the aqueous phase was developed as part of the proposed system for Hs: Acidification of the raffinate from the first stage result in recovery of OsO{sub 4}, which is highly extractable into toluene. The yield of extraction in the second step, from 0.01 M NaOH solution after acidification with H{sub 2}SO{sub 4} solution, was (90 {+-} 3)%. (orig.)

  12. Development of a SISAK extraction system for chemical studies of element 108, hassium

    International Nuclear Information System (INIS)

    Samadani, F.; Alstad, J.; Bjoernstad, T.; Stavsetra, L.; Omtvedt, J.P.

    2010-01-01

    A liquid-liquid extraction system suitable for studies of chemical properties of Hs (element 108), in the form of HsO 4 , was developed using γ-emitting isotopes of its homologue Os. The system is targeted for the fast on-line extraction system SISAK, which operates in a continuous manner and is suitable for liquid-phase studies of transactinide elements. The distribution of OsO 4 between various dilute NaOH solutions and toluene was studied. Both batch and SISAK on-line experiments were performed to develop an appropriate system. From analysis of the extraction curves equilibrium constants for the formation of the presumed complexes, Na[OsO 4 (OH)] and Na 2 [OsO 4 (OH) 2 ], were obtained: K 1 = (1 ± 0.5) x 10 4 and K 2 = 12 ± 8, respectively. The SISAK system includes a liquid-scintillation detection system for α measurements. Due to quenching effects it is not possible to perform direct measurement of the aqueous phase α's. Therefore, a two-stage extraction method that provides an indirect measurement of the activity in the aqueous phase was developed as part of the proposed system for Hs: Acidification of the raffinate from the first stage result in recovery of OsO 4 , which is highly extractable into toluene. The yield of extraction in the second step, from 0.01 M NaOH solution after acidification with H 2 SO 4 solution, was (90 ± 3)%. (orig.)

  13. From bohrium to copernicium and beyond SHE research at SHIP

    Energy Technology Data Exchange (ETDEWEB)

    Münzenberg, G., E-mail: G.Muenzenberg@gsi.de [GSI Helmholtzzentrum für Schwerionenforschung, Planckstrasse 1, 64291 Darmstadt (Germany); Manipal Centre for Natural Sciences, Manipal University, Manipal 576104, Karnataka (India)

    2015-12-15

    Heavy-element research with SHIP at GSI is reviewed including the discovery of the chemical elements bohrium to copernicium, experimental developments, cold fusion of heavy ions, and the discovery of a shell region around hassium. Elements bohrium and heavier are located beyond the limit of liquid-drop stability. They exist by shell stabilization. A universal, sensitive, and fast method: in-flight separation and identification of single atomic nuclei has been developed with the velocity filter SHIP and the detector system to measure decay sequences of individual atoms. Research with single atomic nuclei including detection methods, identification, and physics results will be discussed. Experiments with actinide targets as well as prospects with NUSTAR at FAIR will be addressed.

  14. Distal phalanx fractures in horses: a survey of 274 horses with radiographic assessment of healing in 36 horses

    International Nuclear Information System (INIS)

    Honnas, C.M.; O'Brien, T.R.; Linford, R.L.

    1988-01-01

    The case records of 274 horses with fractures of the distal phalanx were reviewed. Fifty-two horses had bilateral forelimb fractures, for a total of 326 distal phalanx fractures. The fractures were classified into one of five previously described types, based on the radiographic anatomic configuration of the fracture. Solar margin fractures, which have been briefly described in other reports and previously classified as type V fractures, were identified in 132 horses. This type of fracture is distinct from other distal phalanx fractures. Due to the high incidence of solar margin fractures, these fractures were classified as a separate type (type VI). Follow-up radiographic examinations to assess fracture healing were available for 36 horses. Twenty-two horses with distal phalanx fractures (three type I, nine type II, two type III, one type IV, one type V, and six type VI) had radiographic evidence of complete bony union of the fracture at a mean of 11 months after injury. Eight horses with conplete type II fractures involving the articular surface had bony union of the body and solar margin, but not the subchondral bone at the articular surface, a mean of 11 months after injury. Six horses (four type II and two type IV) had little radiographic evidence of bony healing during the follow-up period. All fractures that eventually healed had evidence of progression toward bony union by 6 months after injury

  15. 274 REVIEW ARTICLE

    African Journals Online (AJOL)

    boaz

    Le consentement informé verbal et écrit a été prise de tous les patients. Un total de 404 VIH .... 2014. 404 HIV seropositive clients who attended. Kogi State University Teaching Hospital Anyigba ..... Renata AB, Renata ZAM, Geovana MN etal.

  16. A Novel Heme Pocket Hemoglobin Variant Associated with Normal Hematology: Hb Zara or α91(FG3)Leu→Ile (α2) (HBA2: c.274C > A).

    Science.gov (United States)

    Trova, Sandro; Mereu, Paolo; Decandia, Luca; Cocco, Elena; Masala, Bruno; Manca, Laura; Pirastru, Monica

    2015-08-13

    We report a new hemoglobin (Hb) variant on the HBA2 gene, Hb Zara [α91(FG3)Leu→Ile (α2); HBA2: c.274C > A], which was found in a Caucasian man from Croatia. It was observed by routine cation exchange chromatography as an abnormal 21.8% fraction overlapping Hb A 2 , and associated with normal hematology. It was slightly unstable by the standard isopropanol precipitation test. DNA analysis revealed the CTT > ATT mutation at codon 91 on an α2 gene of a normal α-globin gene arrangement. This new variant represents the sixth described mutation at codon α91 and fourth on the α2 locus. As a result of the slight instability due to the significant role of the α91 residue in the α1β2 contact, the level of the Hb Zara variant was lower than levels observed for several stable variants codified by the α2 locus.

  17. A retrospective study of ketamine administration and the development of acute or post-traumatic stress disorder in 274 war-wounded soldiers.

    Science.gov (United States)

    Mion, G; Le Masson, J; Granier, C; Hoffmann, C

    2017-12-01

    The objective of this study was to explore whether ketamine prevents or exacerbates acute or post-traumatic stress disorders in military trauma patients. We conducted a retrospective study of a database from the French Military Health Service, including all soldiers surviving a war injury in Afghanistan (2010-2012). The diagnosis of post-traumatic stress disorder was made by a psychiatrist and patients were analysed according to the presence or absence of this condition. Analysis included the following covariables: age; sex; acute stress disorder; blast injury; associated fatality; brain injury; traumatic amputation; Glasgow coma scale; injury severity score; administered drugs; number of surgical procedures; physical, neurosensory or aesthetic sequelae; and the development chronic pain. Covariables related to post-traumatic and acute stress disorders with a p ≤ 0.10 were included in a multivariable logistic regression model. The data from 450 soldiers were identified; 399 survived, of which 274 were analysed. Among these, 98 (36%) suffered from post-traumatic stress disorder and 89 (32%) had received ketamine. Fifty-four patients (55%) in the post-traumatic stress disorder group received ketamine vs. 35 (20%) in the no PTSD group (p stress disorder and total number of surgical procedures were independently associated with the development of post-traumatic stress disorder. In this retrospective study, ketamine administration was not a risk factor for the development of post-traumatic stress disorder in the military trauma setting. © 2017 The Association of Anaesthetists of Great Britain and Ireland.

  18. Densities and volume properties of (water + tert-butanol) over the temperature range of (274.15 to 348.15) K at pressure of 0.1 MPa

    International Nuclear Information System (INIS)

    Egorov, Gennadiy I.; Makarov, Dmitriy M.

    2011-01-01

    The densities of {water (1) + tert-butanol (2)} binary mixture were measured over the temperature range (274.15 to 348.15) K at atmospheric pressure using 'Anton Paar' digital vibrating-tube densimeter. Density measurements were carried out over the whole concentration range at (308.15 to 348.15) K. The following volume parameters were calculated: excess molar volumes and thermal isobaric expansivities of the mixture, partial molar volumes and partial molar thermal isobaric expansivities of the components. Concentration dependences of excess molar volumes were fitted with Redlich-Kister equation. The results of partial molar volume calculations using four equations were compared. It was established that for low alcohol concentrations at T ≤ 208 K the inflection points at x 2 ∼ 0.02 were observed at concentration dependences of specific volume. The concentration dependences of partial molar volumes of both water and tert-butanol had extremes at low alcohol content. The temperature dependence of partial molar volumes of water had some inversion at x 2 ∼ 0.65. The temperature dependence of partial molar volumes of tert-butanol at infinite dilution had minimum at ∼288 K. It was discovered that concentration dependences of thermal isobaric expansivities of the mixture at small alcohol content and low temperatures passed through minimum.

  19. The Role of Programmed Cell Death Ligand-1 (PD-L1/CD274) in the Development of Graft versus Host Disease

    Science.gov (United States)

    Al-Chaqmaqchi, Heevy; Sadeghi, Behnam; Abedi-Valugerdi, Manuchehr; Al-Hashmi, Sulaiman; Fares, Mona; Kuiper, Raoul; Lundahl, Joachim

    2013-01-01

    Programmed cell death ligand-1 (PD-L1/CD274) is an immunomodulatory molecule involved in cancer and complications of bone marrow transplantation, such as graft rejection and graft-versus-host disease. The present study was designed to assess the dynamic expression of this molecule after hematopoietic stem cell transplantation in relation to acute graft-versus-host disease. Female BALB/c mice were conditioned with busulfan and cyclophosphamide and transplanted with either syngeneic or allogeneic (male C57BL/6 mice) bone marrow and splenic cells. The expression of PD-L1 was evaluated at different time points employing qPCR, western blot and immunohistochemistry. Allogeneic- but not syngeneic-transplanted animals exhibited a marked up-regulation of PD-L1 expression in the muscle and kidney, but not the liver, at days 5 and 7 post transplantation. In mice transplanted with allogeneic bone marrow cells, the enhanced expression of PD-L1 was associated with high serum levels of IFNγ and TNFα at corresponding intervals. Our findings demonstrate that PD-L1 is differently induced and expressed after allogeneic transplantation than it is after syngeneic transplantation, and that it is in favor of target rather than non-target organs at the early stages of acute graft-versus-host disease. This is the first study to correlate the dynamics of PD-L1 at the gene-, protein- and activity levels with the early development of acute graft-versus-host disease. Our results suggest that the higher expression of PD-L1 in the muscle and kidney (non-target tissues) plays a protective role in skeletal muscle during acute graft-versus-host disease. PMID:23593203

  20. [Human enterovirus infection status and clinical characteristics of 274 patients with viral encephalitis in Henan Province, 2011-2012].

    Science.gov (United States)

    Ma, H X; Pan, J J; Li, Y; Kang, K; Huang, X Y; You, A G; Xu, B L

    2017-02-06

    Objective: To investigate human enterovirus (HEV) infection and clinical characteristics of viral encephalitis patients in Pingdingshan, Henan Province. Methods: Cerebrospinal fluid specimens and epidemiological information were collected from 274 viral encephalitis patients in the departments of pediatrics and neurology in hospitals in Pingdingshan, Henan Province, from April 2011 to August 2012. Patients with bacterial infections were excluded from the study. Demographic information was collected by questionnaires and clinical information was mainly obtained from hospital examinations. Viral RNA was extracted using magnetic bead extraction. Real-time RT-PCR was then performed for HEV, CV-A16, and EV-A71 testing. SPSS statistical software was statistical analyses. Significant differences were determined using the chi-squared test ( P15 years old age groups, HEV infections comprised 31.5% (53/168), 52.9% (18/34), 53.0% (35/66), and 16.7% (1/6) (χ(2)=13.10, P= 0.003), respectively. The EV-A71 infection rates were 17.9% (30/168), 23.5% (8/34), 6.1% (4/66), and 0 (χ(2)=8.04, P= 0.045), respectively. The other enterovirus (OEV) infection rates were 12.5% (21/168), 29.4% (10/34), 48.5% (32/66), and 16.7% (1/6) (χ(2)=35.19, P< 0.001), respectively. The rate of vomiting in OEV and EV-A71 infected patients was 73% (44/60) and 26% (11/42), respectively, while the frequency of skin rash in OEV and EV-A71 infected patients was 32% (19/60) and 79% (33/42), respectively. Approximately 95% (99/104) of patients infected with HEV had a fever, and the breathing rhythm change rate was 19% (20/104), which was lower than that of patients without HEV infection (36.8% (60/163)) (χ(2)=9.35, P= 0.002). Conclusion: In Pingdingshan, HEV was a major causative agent of viral encephalitis and the rate of OEV infection was high, especially in children aged 3-15 years old. Fever was a common clinical symptom of patients infected with HEV. Patients infected with OEV primarily exhibited

  1. IVO, a device for In situ Volatilization and On-line detection of products from heavy ion reactions

    CERN Document Server

    Duellmann, C E; Eichler, R; Gäggeler, H W; Jost, D T; Piguet, D; Türler, A

    2002-01-01

    A new gaschromatographic separation system to rapidly isolate heavy ion reaction products in the form of highly volatile species is described. Reaction products recoiling from the target are stopped in a gas volume and converted in situ to volatile species, which are swept by the carrier gas to a chromatography column. Species that are volatile under the given conditions pass through the column. In a cluster chamber, which is directly attached to the exit of the column, the isolated volatile species are chemically adsorbed to the surface of aerosol particles and transported to an on-line detection system. The whole set-up was tested using short-lived osmium (Os) and mercury (Hg) nuclides produced in heavy ion reactions to model future chemical studies with hassium (Hs, Z=108) and element 112. By varying the temperature of the isothermal section of the chromatography column between room temperature and -80 deg. C, yield measurements of given species can be conducted, yielding information about the volatility o...

  2. Chemical experiments with superheavy elements.

    Science.gov (United States)

    Türler, Andreas

    2010-01-01

    Unnoticed by many chemists, the Periodic Table of the Elements has been extended significantly in the last couple of years and the 7th period has very recently been completed with eka-Rn (element 118) currently being the heaviest element whose synthesis has been reported. These 'superheavy' elements (also called transactinides with atomic number > or = 104 (Rf)) have been artificially synthesized in fusion reactions at accelerators in minute quantities of a few single atoms. In addition, all isotopes of the transactinide elements are radioactive and decay with rather short half-lives. Nevertheless, it has been possible in some cases to investigate experimentally chemical properties of transactinide elements and even synthesize simple compounds. The experimental investigation of superheavy elements is especially intriguing, since theoretical calculations predict significant deviations from periodic trends due to the influence of strong relativistic effects. In this contribution first experiments with hassium (Hs, atomic number 108), copernicium (Cn, atomic number 112) and element 114 (eka-Pb) are reviewed.

  3. Neutron Diffraction Studies of a Class A beta-Lactamase Toho-1 E166A/R274N/R276N Triple Mutant

    International Nuclear Information System (INIS)

    Blakeley, Matthew P.; Chen, Yu; Afonine, Pavel

    2010-01-01

    beta-Lactam antibiotics have been used effectively over several decades against many types of bacterial infectious diseases. However, the most common cause of resistance to the beta-lactam antibiotics is the production of beta-lactamase enzymes that inactivate beta-lactams by rapidly hydrolyzing the amide group of the beta-lactam ring. Specifically, the class A extended-spectrum beta-lactamases (ESBLs) and inhibitor-resistant enzymes arose that were capable of hydrolyzing penicillins and the expanded-spectrum cephalosporins and monobactams in resistant bacteria, which lead to treatment problems in many clinical settings. A more complete understanding of the mechanism of catalysis of these ESBL enzymes will impact current antibiotic drug discovery efforts. Here, we describe the neutron structure of the class A, CTX-M-type ESBL Toho-1 E166A/R274N/R276N triple mutant in its apo form, which is the first reported neutron structure of a beta-lactamase enzyme. This neutron structure clearly reveals the active-site protonation states and hydrogen-bonding network of the apo Toho-1 ESBL prior to substrate binding and subsequent acylation. The protonation states of the active-site residues Ser70, Lys73, Ser130, and Lys234 in this neutron structure are consistent with the prediction of a proton transfer pathway from Lys73 to Ser130 that is likely dependent on the conformation of Lys73, which has been hypothesized to be coupled to the protonation state of Glu166 during the acylation reaction. Thus, this neutron structure is in agreement with a proposed mechanism for acylation that identifies Glu166 as the general base for catalysis.

  4. Developments for transactinide chemistry experiments behind the gas-filled separator TASCA

    Energy Technology Data Exchange (ETDEWEB)

    Even, Julia

    2011-12-13

    Topic of this thesis is the development of experiments behind the gas-filled separator TASCA (TransActinide Separator and Chemistry Apparatus) to study the chemical properties of the transactinide elements. In the first part of the thesis, the electrodepositions of short-lived isotopes of ruthenium and osmium on gold electrodes were studied as model experiments for hassium. From literature it is known that the deposition potential of single atoms differs significantly from the potential predicted by the Nernst equation. This shift of the potential depends on the adsorption enthalpy of therndeposited element on the electrode material. If the adsorption on the electrode-material is favoured over the adsorption on a surface made of the same element as the deposited atom, the electrode potential is shifted to higher potentials. This phenomenon is called underpotential deposition. Possibilities to automatize an electro chemistry experiment behind the gas-filled separator were explored for later studies with transactinide elements. The second part of this thesis is about the in-situ synthesis of transition-metal-carbonyl complexes with nuclear reaction products. Fission products of uranium-235 and californium-249 were produced at the TRIGA Mainz reactor and thermalized in a carbon-monoxide containing atmosphere. The formed volatile metal-carbonyl complexes could be transported in a gas-stream. Furthermore, short-lived isotopes of tungsten, rhenium, osmium, and iridium were synthesised at the linear accelerator UNILAC at GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt. The recoiling fusion products were separated from the primary beam and the transfer products in the gas-filled separator TASCA. The fusion products were stopped in the focal plane of TASCA in a recoil transfer chamber. This chamber contained a carbon-monoxide - helium gas mixture. The formed metal-carbonyl complexes could be transported in a gas stream to various experimental setups. All

  5. Synthesis, characterization, and bonding of indium cluster phases: Na15In27.4, a network of In16 and In11 clusters; Na2In with isolated indium tetrahedra

    International Nuclear Information System (INIS)

    Sevov, S.C.; Corbett, J.D.

    1993-01-01

    The remaining phases in the Na-In system have been identified and characterized. The indium-richest is Na 15 In 27.4 , with a structure containing novel closo-In 16 clusters interconnected to two kinds of nido-In 11 units and isolated, 4-bonded atoms (Cmcm, Z = 8, a = 16.108 (4) Angstrom, b = 35.279 (8) Angstrom, c = 15.931 (3) Angstrom, R/R w = 0.041/0.044 at the indium-rich limits Na 15 In 27.54 ). Fractional occupancy of two atoms in cluster chain positions were found, one as a function of a narrow nonstoichiometry. The structure is related to that recently established for Na 7 In 11.8 . Resistivity and magnetic properties are consistent with a small (0.5-3.2%) excess of electrons relative to the calculated bonding requirements. The sodium-richest phase is the stable, diamagnetic, and weakly metallic Na 2 In, isostructural with Na 2 Tl (C222 1 , Z = 16, a = 13.855 (1) Angstrom, b = 8.836 (1) Angstrom, c = 11.762 (1) Angstrom, R/R w = 0.030/0.034). A corrected phase diagram is given. 21 refs., 5 figs., 5 tabs

  6. ‘What is that to us? See to it yourself’ (Mt 27:4: Making atonement and the Matthean portrait of the Jewish chief priests

    Directory of Open Access Journals (Sweden)

    Dorothy Jean Weaver

    2014-10-01

    Full Text Available To read the Gospel of Matthew within its 1st century religious context is to read an intensely Jewish narrative. Central to the world of this Gospel are the Jerusalem temple, its administrators, the chief priests, and the sacrificial system which they are charged by Jewish law to officiate. This article assesses the Matthean portrait of the Jewish chief priests of Jesus’ day against the scriptural backdrop which lays out their prominent role within Jewish religious life, namely ‘making atonement’ before God for the ‘sins’ of the people. In section one I sketch out the Matthean portrait of the scripturally assigned role of the priests, connecting this portrait to its biblical antecedents. In section two I assess the overall performance of the Matthean chief priests against the backdrop of their assigned role. In section three I address the question of atonement. Crucial here is 27:3–10, the account of Judas Iscariot, who returns his 30 silver coins to the chief priests and says (27:4a; emphasis mine, ‘I have sinned, because I have handed over innocent blood’. Here I highlight Matthew’s ironic modus operandi as he portrays the chief priests’ non-priestly response to Judas. Additionally, I contrast Matthew’s portrait of the Jewish chief priests with a brief portrait of Jesus’ own ministry within the Jewish community, a ministry which fulfils the priestly role abandoned by the chief priests. I conclude my article in section four with brief reflections on the rhetorical impact of Matthew’s portrait of the Jewish chief priests within his overall narrative.

  7. 50 CFR 216.274 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ... lookouts can be counted among required lookouts as long as supervisors monitor their progress and... submerged objects). This does not forbid personnel being trained as lookouts from being counted as those... to detect any vocalizing marine mammals (particularly sperm whales) in the vicinity of the exercise...

  8. Korean Affairs Report, Number 274.

    Science.gov (United States)

    1983-03-23

    Malaysia ; Zone C: India, Pakistan, Bangladesh, Sri Lanka and Iran. CSO: 4100/123 121 S.KOREA/MEDIA AND THE ARTS DAILY VIEWS EXCHANGE OF TV NEWS...officials said. Samchok will supply local IC makers, such as Gold Star Semiconductor Ltd. and Samsung Semicon- ductor Inc., with wafers, they said

  9. BDML Metadata: 274 [SSBD[Archive

    Lifescience Database Archive (English)

    Full Text Available Ce_KK_P002 BDML file for quantitative information about nuclear division dynamics of wild-type embryo quanti...tative information about nuclear division dynamics in wild-type embryo C. elegans n

  10. 28 CFR 68.54 - Administrative review of a final order of an Administrative Law Judge in cases arising under...

    Science.gov (United States)

    2010-07-01

    ... an Administrative Law Judge in cases arising under section 274A or 274C. 68.54 Section 68.54 Judicial... BEFORE ADMINISTRATIVE LAW JUDGES IN CASES INVOLVING ALLEGATIONS OF UNLAWFUL EMPLOYMENT OF ALIENS, UNFAIR... an Administrative Law Judge in cases arising under section 274A or 274C. (a) Authority of the Chief...

  11. Chemistry of superheavy elements

    International Nuclear Information System (INIS)

    Schaedel, M.

    2012-01-01

    The chemistry of superheavy elements - or transactinides from their position in the Periodic Table - is summarized. After giving an overview over historical developments, nuclear aspects about synthesis of neutron-rich isotopes of these elements, produced in hot-fusion reactions, and their nuclear decay properties are briefly mentioned. Specific requirements to cope with the one-atom-at-a-time situation in automated chemical separations and recent developments in aqueous-phase and gas-phase chemistry are presented. Exciting, current developments, first applications, and future prospects of chemical separations behind physical recoil separators ('pre-separator') are discussed in detail. The status of our current knowledge about the chemistry of rutherfordium (Rf, element 104), dubnium (Db, element 105), seaborgium (Sg, element 106), bohrium (Bh, element 107), hassium (Hs, element 108), copernicium (Cn, element 112), and element 114 is discussed from an experimental point of view. Recent results are emphasized and compared with empirical extrapolations and with fully-relativistic theoretical calculations, especially also under the aspect of the architecture of the Periodic Table. (orig.)

  12. The synthesis of the deformed superheavy elements 107 to 111

    International Nuclear Information System (INIS)

    Armbuster, P.

    1995-01-01

    By inflight separation, implantation into Si-detector arrays, and correlation analysis of subsequent α-decay chains many isotopes were discovered at GSI since 1980, among others the elements Nielsbohriurn, Hassium and Meitnerium. The sensitivity of the method allows to identify an element by one decay chain, as we demonstrated for the case of 266 Mt. After a break of our work during the time when the new accelerator system SIS-FRS-ESR was installed (1989-1993) at GSI, and many improvements of our system EZR-UNILAC-SHIP accomplished, we restarted element synthesis in 1994. The synthesis of the isotopes 269 110, 271 110, and 272 111 of the new elements Z--110 and Z=l11 was a first success at the end of 1994. This discovery is in the center of this presentation. The reaction mechanism, a one-step, cold and compact rearrangement process at a level of some 10 -36 cm 2 is discussed. Cross sections and excitation functions systematically studied allow to extrapolate to the next element Z=112, which seems not to be out of reach

  13. 28 CFR 68.53 - Review of an interlocutory order of an Administrative Law Judge in cases arising under section...

    Science.gov (United States)

    2010-07-01

    ... Administrative Law Judge in cases arising under section 274A or 274C. 68.53 Section 68.53 Judicial Administration... ADMINISTRATIVE LAW JUDGES IN CASES INVOLVING ALLEGATIONS OF UNLAWFUL EMPLOYMENT OF ALIENS, UNFAIR IMMIGRATION... Administrative Law Judge in cases arising under section 274A or 274C. (a) Authority. In a case arising under...

  14. Incidence and causes of lower-limb amputations in the city of Ribeirão Preto from 1985 to 2008: evaluation of the medical records from 3,274 cases

    Directory of Open Access Journals (Sweden)

    Bruna Maria Bueno Barbosa

    Full Text Available ABSTRACT: Objective: It was to identify trends of traumatic and non-traumatic causes of lower limb amputations, as well as the role played by population aging, traffic violence increase, public health policy of diabetes control program and drivers anti-alcohol laws on these amputations. Method: Hospitalization data recorded in the discharge forms of 32 hospitals located in the region of Ribeirão Preto, Brazil, from 1985 to 2008 were analyzed. Result: A total of 3,274 lower-limb amputations were analyzed, of which 95.2% were related to non-traumatic causes, mainly infectious and ischemic complications of diabetes mellitus. Cancer (2.8% and congenital (1.3% causes were included in this group. Only 4.8% were related to traumatic causes. Traumatic amputation average rate was 1.5 amputations in 100,000 habitants with a slight tendency of increase in the last 5 years. Non-traumatic causes showed an average rate of 30.0 amputations for 100,000 habitants and remained relatively constant during the whole period. Non-traumatic were much more predominant in patients older than 60 years and traumatic amputations occurred more frequently in patients younger than 39 years. Conclusion: The overall rates of amputation and the rates of traumatic and non-traumatic amputations remained nearly constant during the study period. The impact of diabetes control policies and the introduction of traffic safety laws could not be identified on the amputation rates.

  15. Bajpai, Prof. Sunil

    Indian Academy of Sciences (India)

    ... Paleontology, Biostratigraphy and Paleobiogeography Address: Director, Birbal Sahni Institute of Palaeobotany, 53, University Road, Lucknow 226 007, U.P.. Contact: Office: (0522) 274 0470, (0522) 274 0439. Fax: (0522) 274 0485. Email: directorbsip@gmail.com, director@bsip.res.in. YouTube · Twitter · Facebook ...

  16. Publications | Page 274 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Vilma Almendra, a 23-year-old Paez Indian from Colombia, seems to fit ... Poverty reduction programs in developing countries risk undermining their ... It challenged photographers to capture the creative ways people in the world's cities are.

  17. 8 CFR 274a.1 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... for a number of clients at the same time; has an opportunity for profit or loss as a result of labor or services provided; invests in the facilities for work; directs the order or sequence in which the...

  18. 7 CFR 1150.274 - Certification standards.

    Science.gov (United States)

    2010-01-01

    ... the organization; (4) Sources from which the organization's operating funds are derived; (5) Functions... objectives of the Act. (b) The primary considerations in determining the eligibility of an organization shall...

  19. 48 CFR 211.274-1 - General.

    Science.gov (United States)

    2010-10-01

    ... burden on the workforce through increased productivity and efficiency. [70 FR 20836, Apr. 22, 2005] ... delivered to DoD that will enhance logistics, contracting, and financial business transactions supporting...

  20. Publications | Page 274 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Tapping into community resources in China. In remote highland villages in Guizhou — one of China's poorest provinces — villagers have solved a problem that had existed for 200 years. Working with researchers from the Guizhou Academy of Agricultural Sciences (GAAS), with support.

  1. Publications | Page 274 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    According to her sister, “She'd been having problems with him for a while and we had told her to leave... Brain gain. IDRC has joined forces with academic and research institutes in sub-Saharan Africa to train new scholars and repair a tattered academic infrastructure. These are vital steps in addressing the region's critical ...

  2. Design and properties of silicon charged-particle detectors developed at the Institute of Electron Technology (ITE)

    Science.gov (United States)

    Wegrzecki, Maciej; Bar, Jan; Budzyński, Tadeusz; CieŻ, Michal; Grabiec, Piotr; Kozłowski, Roman; Kulawik, Jan; Panas, Andrzej; Sarnecki, Jerzy; Słysz, Wojciech; Szmigiel, Dariusz; Wegrzecka, Iwona; Wielunski, Marek; Witek, Krzysztof; Yakushev, Alexander; Zaborowski, Michał

    2013-07-01

    The paper discusses the design of charged-particle detectors commissioned and developed at the Institute of Electron Technology (ITE) in collaboration with foreign partners, used in international research on transactinide elements and to build personal radiation protection devices in Germany. Properties of these detectors and the results obtained using the devices are also presented. The design of the following epiplanar detector structures is discussed: ♢ 64-element chromatographic arrays for the COMPACT (Cryo On-line Multidetector for Physics And Chemistry of Transactinides) detection system used at the GSI Helmholtzzentrum für Schwerionenforschung in Darmstadt (GSI) for research on Hassium, Copernicium and Flerovium, as well as elements 119 and 120, ♢ 2-element flow detectors for the COLD (Cryo On-Line Detector) system used for research on Copernicium and Flerovium at the Joint Institute for Nuclear Research, Dubna, ♢ detectors for a radon exposimeter and sensors for a neutron dosimeter developed at the Institut für Strahlenschutz, Helmholtz Zentrum München. The design of planar detectors - single-sided and double-sided strip detectors for the Focal Plane Detector Box used at GSI for research on Flerovium and elements 119 and 120 is also discussed.

  3. 40 CFR 60.274 - Monitoring of operations.

    Science.gov (United States)

    2010-07-01

    ... system is in use, and a furnace static pressure gauge is installed according to paragraph (f) of this... volumetric flow rate through each separately ducted hood; or install, calibrate, and maintain a monitoring device that continuously records the volumetric flow rate at the control device inlet and check and...

  4. 38 CFR 21.274 - Revolving fund loan.

    Science.gov (United States)

    2010-07-01

    ...) VOCATIONAL REHABILITATION AND EDUCATION Vocational Rehabilitation and Employment Under 38 U.S.C. Chapter 31...-interest loan from the revolving fund. (c) Eligibility. A veteran is eligible for an advance if the... section are met, a counseling psychologist or vocational rehabilitation specialist in the VR&E Division...

  5. 48 CFR 211.274-6 - Contract clauses.

    Science.gov (United States)

    2010-10-01

    ... Valuation, in solicitations and contracts that— (i) Require item identification or valuation, or both, in... the clause at— (i) FAR 52.245-1, Government Property; or (ii) FAR 52.245-2, Government Property...— (1) Contain the clause at 252.211-7003, Item Identification and Valuation; and (2) Require the...

  6. 47 CFR 27.4 - Terms and definitions.

    Science.gov (United States)

    2010-10-01

    ... be received by the public, directly or by the intermediary of relay stations.” 47 U.S.C. 153(6... electronic filing of all applications and related documents by applicants and licensees in the Wireless Radio...

  7. 26 CFR 1.274-5 - Substantiation requirements.

    Science.gov (United States)

    2010-04-01

    ... expenditures for business travel if it contains the following: name, location, date, and separate amounts for... travel expenses as well as the time, place, and business purpose of the travel. See paragraphs (b)(2) and... other travel expenses as well as the time, place, and business purpose of the travel. (k)-(l) [Reserved...

  8. Coordination cycles

    Czech Academy of Sciences Publication Activity Database

    Steiner, Jakub

    -, č. 274 (2005), s. 1-26 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : coordination * crises * cycles and fluctuations Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp274.pdf

  9. Developments for transactinide chemistry experiments behind the gas-filled separator TASCA

    International Nuclear Information System (INIS)

    Even, Julia

    2011-01-01

    Topic of this thesis is the development of experiments behind the gas-filled separator TASCA (TransActinide Separator and Chemistry Apparatus) to study the chemical properties of the transactinide elements. In the first part of the thesis, the electrodepositions of short-lived isotopes of ruthenium and osmium on gold electrodes were studied as model experiments for hassium. From literature it is known that the deposition potential of single atoms differs significantly from the potential predicted by the Nernst equation. This shift of the potential depends on the adsorption enthalpy of therndeposited element on the electrode material. If the adsorption on the electrode-material is favoured over the adsorption on a surface made of the same element as the deposited atom, the electrode potential is shifted to higher potentials. This phenomenon is called underpotential deposition. Possibilities to automatize an electro chemistry experiment behind the gas-filled separator were explored for later studies with transactinide elements. The second part of this thesis is about the in-situ synthesis of transition-metal-carbonyl complexes with nuclear reaction products. Fission products of uranium-235 and californium-249 were produced at the TRIGA Mainz reactor and thermalized in a carbon-monoxide containing atmosphere. The formed volatile metal-carbonyl complexes could be transported in a gas-stream. Furthermore, short-lived isotopes of tungsten, rhenium, osmium, and iridium were synthesised at the linear accelerator UNILAC at GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt. The recoiling fusion products were separated from the primary beam and the transfer products in the gas-filled separator TASCA. The fusion products were stopped in the focal plane of TASCA in a recoil transfer chamber. This chamber contained a carbon-monoxide - helium gas mixture. The formed metal-carbonyl complexes could be transported in a gas stream to various experimental setups. All

  10. Short Term Prediction of Highway Travel Time using GUHA Data Mining Method

    Czech Academy of Sciences Publication Activity Database

    Coufal, David; Turunen, E.

    2004-01-01

    Roč. 14, - (2004), s. 221-231 ISSN 1210-0552 R&D Projects: GA MŠk OC 274.001 Grant - others:COST(XE) Action 274 TARSKI Institutional research plan: CEZ:AV0Z1030915 Keywords : data mining * many-valued logic Subject RIV: BA - General Mathematics

  11. Chemistry of the superheavy elements.

    Science.gov (United States)

    Schädel, Matthias

    2015-03-13

    The quest for superheavy elements (SHEs) is driven by the desire to find and explore one of the extreme limits of existence of matter. These elements exist solely due to their nuclear shell stabilization. All 15 presently 'known' SHEs (11 are officially 'discovered' and named) up to element 118 are short-lived and are man-made atom-at-a-time in heavy ion induced nuclear reactions. They are identical to the transactinide elements located in the seventh period of the periodic table beginning with rutherfordium (element 104), dubnium (element 105) and seaborgium (element 106) in groups 4, 5 and 6, respectively. Their chemical properties are often surprising and unexpected from simple extrapolations. After hassium (element 108), chemistry has now reached copernicium (element 112) and flerovium (element 114). For the later ones, the focus is on questions of their metallic or possibly noble gas-like character originating from interplay of most pronounced relativistic effects and electron-shell effects. SHEs provide unique opportunities to get insights into the influence of strong relativistic effects on the atomic electrons and to probe 'relativistically' influenced chemical properties and the architecture of the periodic table at its farthest reach. In addition, they establish a test bench to challenge the validity and predictive power of modern fully relativistic quantum chemical models. © 2015 The Author(s) Published by the Royal Society. All rights reserved.

  12. 77 FR 274 - Combined Notice of Filings #1

    Science.gov (United States)

    2012-01-04

    ... the Commission received the following electric rate filings: Docket Numbers: ER10-1144-001; ER11-2014.... Docket Numbers: ER12-675-000. Applicants: Pacific Gas and Electric Company. Description: CCSF IA--2012...: ER12-677-000. Applicants: ITC Midwest LLC. Description: ITC Midwest--Storm Lake Power Partners 205...

  13. 40 CFR 60.274a - Monitoring of operations.

    Science.gov (United States)

    2010-07-01

    ... system is in use, and a furnace static pressure gauge is installed according to paragraph (f) of this... volumetric flow rate through each separately ducted hood; or install, calibrate, and maintain a monitoring device that continuously records the volumetric flow rate at the control device inlet and check and...

  14. 40 CFR 180.274 - Propanil; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... Cattle, meat 0.05 Cattle, meat byproducts 1.0 Crayfish 0.05 Egg 0.30 Goat, fat 0.10 Goat, meat 0.05 Goat, meat byproducts 1.0 Hog, fat 0.10 Hog, meat 0.05 Hog, meat byproducts 1.0 Horse, fat 0.10 Horse, meat 0.05 Horse, meat byproducts 1.0 Milk 0.05 Poultry, fat 0.05 Poultry, meat 0.10 Poultry, meat byproducts...

  15. Dicty_cDB: SLF274 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 5215 |pid:none) Lymphocytic choriomeningitis virus... 39 0.20 AE014187_324( AE014187 |pid:none) Plasmodium f...alciparum 3D7 chromo... 37 0.75 EU480452_2( EU480452 |pid:none) Lymphocytic choriomeningitis... virus... 36 1.3 AF325214_2( AF325214 |pid:none) Lymphocytic choriomeningitis virus... 36 1.7 ( P...09992 ) RecName: Full=Nucleoprotein; AltName: Full=Nucleocapsid... 35 2.2 Y16308_1( Y16308 |pid:none) Lymphocytic choriomeningitis

  16. Translations on Narcotics and Dangerous Drugs, Number 274

    Science.gov (United States)

    1976-12-02

    of heroin worth $250,000 at Sydney Airport on Saturday. Bernice Carol Devereaux, 23, and John Peter Griffin, 27, both of Tweed Heads, were charged...FRONTERIZO in Spanish 10 Oct 76 p 10-B [Text] The Federal Judicial Police, working under Commander Margarito Mendez Rico, has successfully... Mendez Rico reported that the ringleader of the marihuana traffickers had confessed that in the town of Parral, Chihuahua, he had "secured" another

  17. Dicty_cDB: VHK274 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available -28 CP000087_1092( CP000087 |pid:none) Rickettsia bellii RML369-C, com... 129 2e-28 CP000683_198( CP000683 |pid:none) Rickettsia mass...iliae MTU5, compl... 128 3e-28 CP001503_2917( CP001503 |

  18. 7 CFR 274.2 - Providing benefits to participants.

    Science.gov (United States)

    2010-01-01

    ..., households being moved into or out of a staggered issuance procedure, households on a fluctuating schedule within a staggered system, and households being moved from a direct-mail issuance system to an... issuances, the State agency shall divide the new issuance into two parts, with one part being issued within...

  19. 7 CFR 274.6 - Replacement issuances to households.

    Science.gov (United States)

    2010-01-01

    ... recipient's signature on the authorization document matches the signature on the ID card. In a Photo ID area... matches the serial number on the recipient's ID card; (3) Issue a replacement in accordance with... other action, such as correcting the address on the master issuance file, warranted by the reported...

  20. Ecology, Inhibitory Activity, and Morphogenesis of a Marine Antagonistic Bacterium Belonging to the Roseobacter Clade

    DEFF Research Database (Denmark)

    Bruhn, Jesper Bartholin; Nielsen, Kristian Fog; Hjelm, Mette

    2005-01-01

    Roseobacter strain 27-4 has been isolated from a turbot larval rearing unit and is capable of reducing mortality in turbot egg yolk sac larvae. Here, we demonstrate that the supernatant of Roseobacter 27-4 is lethal to the larval pathogens Vibrio anguillarum and Vibrio splendidus in a buffer syst...

  1. 28 CFR 68.56 - Judicial review of a final agency order in cases arising under section 274A or 274C.

    Science.gov (United States)

    2010-07-01

    ... review by the Chief Administrative Hearing Officer of a final order by an Administrative Law Judge shall... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Judicial review of a final agency order... OF JUSTICE (CONTINUED) RULES OF PRACTICE AND PROCEDURE FOR ADMINISTRATIVE HEARINGS BEFORE...

  2. Isotope effect in the Knight shift of potassium

    International Nuclear Information System (INIS)

    Sahm, W.; Schwenk, A.

    1975-01-01

    The Knight shifts of the potassium isotopes 39 K and 41 K were determined with high accuracy: Ksup((39)) = 0.274 35(10)% and Ksup((41)) = 0.274 93(12)%. The relative isotope effect ΔK/K = -0.210 (20)% is in agreement with the hyperfine structure anomaly 39 Δ 41 . (orig.) [de

  3. Briefly on the GUHA Method of Data Mining

    Czech Academy of Sciences Publication Activity Database

    Hájek, Petr

    -, č. 3 (2003), s. 112-114 ISSN 1509-4553 R&D Projects: GA MŠk OC 274.001 Grant - others:COST(XE) Action 274 TARSKI Institutional research plan: AV0Z1030915 Keywords : GUHA method * data mining * exploratory data analuysis Subject RIV: BA - General Mathematics http://www.nit.eu/czasopisma/JTIT/2003/3/112.pdf

  4. Coat colour and chromosome variation in cetral European populations of the weasel (Mustela nivalis)

    Czech Academy of Sciences Publication Activity Database

    Zima, Jan; Cenevová, E.

    2002-01-01

    Roč. 51, č. 4 (2002), s. 265-274 ISSN 0139-7893 R&D Projects: GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z6093917 Keywords : weasel * pelage coloration * karyotype Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.234, year: 2002 http://www.ivb.cz/folia/51/4/265-274.pdf

  5. Analysis of Coniferous Forest Damage: Effects of Trichloroacetic Acid, Sulphur, Fluorine and Chlorine on Needle Loss of Norway Spruce

    Czech Academy of Sciences Publication Activity Database

    Coufal, David; Matucha, P.; Uhlířová, H.; Lomský, B.; Forczek, Sándor; Matucha, Miroslav

    2003-01-01

    Roč. 13, č. 1 (2003), s. 89-102 ISSN 1210-0552 R&D Projects: GA ČR GA522/99/1465; GA MŠk OC 274.001 Grant - others:COST(XE) Action 274 TARSKI Institutional research plan: AV0Z1030915 Keywords : forest decline * polyfactorial problem * monitoring * stress factors * dose/response-relationship Subject RIV: BA - General Mathematics

  6. 17 CFR 270.30a-2 - Certification of Form N-CSR and Form N-Q.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Certification of Form N-CSR... Form N-CSR and Form N-Q. (a) Each report filed on Form N-CSR (§§ 249.331 and 274.128 of this chapter) or Form N-Q (§§ 249.332 and 274.130 of this chapter) by a registered management investment company...

  7. Acetylated tau destabilizes the cytoskeleton in the axon initial segment and is mislocalized to the somatodendritic compartment.

    Science.gov (United States)

    Sohn, Peter Dongmin; Tracy, Tara E; Son, Hye-In; Zhou, Yungui; Leite, Renata E P; Miller, Bruce L; Seeley, William W; Grinberg, Lea T; Gan, Li

    2016-06-29

    Neurons are highly polarized cells in which asymmetric axonal-dendritic distribution of proteins is crucial for neuronal function. Loss of polarized distribution of the axonal protein tau is an early sign of Alzheimer's disease (AD) and other neurodegenerative disorders. The cytoskeletal network in the axon initial segment (AIS) forms a barrier between the axon and the somatodentritic compartment, contributing to axonal retention of tau. Although perturbation of the AIS cytoskeleton has been implicated in neurological disorders, the molecular triggers and functional consequence of AIS perturbation are incompletely understood. Here we report that tau acetylation and consequent destabilization of the AIS cytoskeleton promote the somatodendritic mislocalization of tau. AIS cytoskeletal proteins, including ankyrin G and βIV-spectrin, were downregulated in AD brains and negatively correlated with an increase in tau acetylated at K274 and K281. AIS proteins were also diminished in transgenic mice expressing tauK274/281Q, a tau mutant that mimics K274 and K281 acetylation. In primary neuronal cultures, the tauK274/281Q mutant caused hyperdynamic microtubules (MTs) in the AIS, shown by live-imaging of MT mobility and fluorescence recovery after photobleaching. Using photoconvertible tau constructs, we found that axonal tauK274/281Q was missorted into the somatodendritic compartment. Stabilizing MTs with epothilone D to restore the cytoskeletal barrier in the AIS prevented tau mislocalization in primary neuronal cultures. Together, these findings demonstrate that tau acetylation contributes to the pathogenesis of neurodegenerative disease by compromising the cytoskeletal sorting machinery in the AIS.

  8. Fast sex identification in wild mammals using PCR amplification of the Sry gene

    Czech Academy of Sciences Publication Activity Database

    Bryja, Josef; Konečný, A.

    2003-01-01

    Roč. 52, č. 3 (2003), s. 269-274 ISSN 0139-7893 R&D Projects: GA ČR GA524/01/1316; GA ČR GP206/02/P068 Institutional research plan: CEZ:AV0Z6093917 Keywords : sex identification * Sry gene * rodents Subject RIV: EG - Zoology Impact factor: 0.494, year: 2003 http://www.ivb.cz/folia/52/3/269-274.pdf

  9. Superheavy element chemistry. Achievements and perspectives

    International Nuclear Information System (INIS)

    Schaedel, M.

    2007-01-01

    Superheavy elements have been synthesized and chemically characterized one-atom-at-a-time up to element 108. Presently, the quest for element 112 is one of the hottest topics in this field. The transactinide elements 104 to 108 are members of group 4 to 8 of the Periodic Table and element 112 belongs into group 12. Chemical properties of some of these elements, like elements 104 and 105, show stunning deviations from simple extrapolations within their respective group while others exhibit great similarities with their lighter homologues elements. First experiments to investigate seaborgium (Sg, element 106) in aqueous solution were performed. Again, in large international collaborations at the GSI, several gas-phase chemistry experiments were performed with hassium (Hs, element 108). Recently, the highly efficient and very clean separation of Hs was applied for nuclear studies of various Hs nuclides investigating their cross section and their nuclear decay properties in the region of the doubly-magic 270 Hs (Z=108, N=162). To overcome certain limitations of the presently used on-line chemical separations the new TransActinide Separation and Chemistry Apparatus (TASCA) - with a gas-filled recoil separator as a front-end tool - was designed and built at the GSI in a collaborative effort. Presently in its commissioning phase, TASCA shall be a key instrument for a big leap into quantitatively and qualitatively new experiments in the region of superheavy elements. (author)

  10. 37 CFR 2.74 - Form and signature of amendment.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Form and signature of... signature of amendment. (a) Form of Amendment. Amendments should be set forth clearly and completely... record. (b) Signature. A request for amendment of an application must be signed by the applicant, someone...

  11. 26 CFR 1.274-5T - Substantiation requirements (temporary).

    Science.gov (United States)

    2010-04-01

    ... account statement is submitted by an employee to his employer or by an independent contractor to his... remainder of 1986. If other circumstances do not change (e.g., A does not obtain a second car for exclusive... amount which is attributable to each person participating in the event giving rise to the expenditure...

  12. 48 CFR 1816.405-274 - Award fee evaluation factors.

    Science.gov (United States)

    2010-10-01

    ... above the contracting officer, with the concurrence of the project manager. The rationale for any waiver... business, women-owned small business, veteran-owned small business, and service-disabled veteran-owned... small, HUBZone, women-owned, veteran-owned, and service-disabled veteran-owned small business concerns...

  13. 49 CFR 178.274 - Specifications for UN portable tanks.

    Science.gov (United States)

    2010-10-01

    ... definition of a “container” within the terms of the International Convention for Safe Containers (CSC) must... equipment to an internal pressure. Maximum allowable working pressure (MAWP) is defined according to the... environment where they will be transported, taking into account the determined design temperature range...

  14. All projects related to | Page 274 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2017-06-02

    Canadian researchers analyzing the causes of food insecurity in India and the use of new technologies to address food shortages aim to improve access to food supplies in India and elsewhere. End Date: June 2, 2017. Topic: AGRICULTURAL WASTES, BIOMASS, ENERGY TECHNOLOGY, INFORMATION TECHNOLOGY, ...

  15. Worldwide Report Telecommunications Policy, Research and Development No. 274.

    Science.gov (United States)

    1983-06-07

    Text] [Lima EL COMERCIO in Spanish 27 Apr 83 p 3] 8143 CSO: 5500/2071 ARGENTINA BRIEFS SATELLITE GROUND STATION—Buenos Aires, 5 May (TELAM...Iquitos, Arequipa, lea, Huaraz, Cuzco and Tacna. [TextJ [.Lima EL COMERCIO in Spanish 3 May 83 p a 8 PY] CSO; 5500/2074 ST LUCIA DETAILED REVIEW OF...anniversary of the World International Telecommunications day. According to Mr (Khabele), Lesotho is also to introduce a new digital exchange for

  16. Algebraic Structures Related to the Combination of Belief Functions

    Czech Academy of Sciences Publication Activity Database

    Daniel, Milan

    2004-01-01

    Roč. 60, č. 2 (2004), s. 245-255 ISSN 1346-0862 R&D Projects: GA MŠk OC 274.001 Grant - others:COST(XE) Action 274 TARSKI Institutional research plan: CEZ:AV0Z1030915 Keywords : belief functions * Dempster-Shafer theory * combination of belief functions * Dempster's semigroup * uncertainty processing * decision making * expert systems Subject RIV: BA - General Mathematics http://www.jams.or.jp/ scm /contents/Vol-10-5/10-50.pdf

  17. 300-MHz-repetition-rate, all-fiber, femtosecond laser mode-locked by planar lightwave circuit-based saturable absorber.

    Science.gov (United States)

    Kim, Chur; Kim, Dohyun; Cheong, YeonJoon; Kwon, Dohyeon; Choi, Sun Young; Jeong, Hwanseong; Cha, Sang Jun; Lee, Jeong-Woo; Yeom, Dong-Il; Rotermund, Fabian; Kim, Jungwon

    2015-10-05

    We show the implementation of fiber-pigtailed, evanescent-field-interacting, single-walled carbon nanotube (CNT)-based saturable absorbers (SAs) using standard planar lightwave circuit (PLC) fabrication processes. The implemented PLC-CNT-SA device is employed to realize self-starting, high-repetition-rate, all-fiber ring oscillators at telecommunication wavelength. We demonstrate all-fiber Er ring lasers operating at 303-MHz (soliton regime) and 274-MHz (stretched-pulse regime) repetition-rates. The 303-MHz (274-MHz) laser centered at 1555 nm (1550 nm) provides 7.5 nm (19 nm) spectral bandwidth. After extra-cavity amplilfication, the amplified pulse train of the 303-MHz (274-MHz) laser delivers 209 fs (178 fs) pulses. To our knowledge, this corresponds to the highest repetition-rates achieved for femtosecond lasers employing evanescent-field-interacting SAs. The demonstrated SA fabrication method, which is based on well-established PLC processes, also shows a potential way for mass-producible and lower-cost waveguide-type SA devices suitable for all-fiber and waveguide lasers.

  18. People and things. CERN Courier, May 1987, v. 27(4)

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1987-05-15

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The XIX General Assembly of the International Union of Pure and Applied Physics (IUPAP) is to be held at the US National Academy of Sciences, Washington DC, from 29 September - 3 October. The theme of the scientific programme will be 'Physics in a Technological World', reflecting the IUPAP General Council's aim of emphasizing the role of industrial physics and improving relations between industrial and academic physics. The CERN Accelerator School is organizing in collaboration with BESSY (the Berlin electron synchrotron radiation centre) the second of its biennial two-week courses on advanced accelerator physics.

  19. People and things. CERN Courier, May 1987, v. 27(4)

    International Nuclear Information System (INIS)

    Anon.

    1987-01-01

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The XIX General Assembly of the International Union of Pure and Applied Physics (IUPAP) is to be held at the US National Academy of Sciences, Washington DC, from 29 September - 3 October. The theme of the scientific programme will be 'Physics in a Technological World', reflecting the IUPAP General Council's aim of emphasizing the role of industrial physics and improving relations between industrial and academic physics. The CERN Accelerator School is organizing in collaboration with BESSY (the Berlin electron synchrotron radiation centre) the second of its biennial two-week courses on advanced accelerator physics

  20. 17 CFR 274.128 - Form N-CSR, certified shareholder report.

    Science.gov (United States)

    2010-04-01

    ... Form N-CSR, certified shareholder report. This form shall be used by registered management investment... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form N-CSR, certified... Form N-CSR, see the List of CFR Sections Affected, which appears in the Finding Aids section of the...

  1. ORF Alignment: NC_003210 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 215 EINIPETLVEICNNKLGVGIIPESIALNYHFLNYETLPTEYAALRKTLIYHADHTISNGE 274 ... E...INIPETLVEICNNKLGVGIIPESIALNYHFLNYETLPTEYAALRKTLIYHADHTISNGE Sbjct: 131 EINIPETLVEICNNKLGVGIIPESIALNYHFLNYETLPTEYAALRKTLIYHADHTISNGE 190 ...

  2. Supplemental Environmental Assessment for the Nuclear and Space Security Tactics Training Center Project AFSPC053012 for Air Force Security Forces at Camp Guernsey, Wyoming

    Science.gov (United States)

    2010-02-01

    8217Ŕ IPACE: lfCUNTY TACTlet lRAINIIIG CI! NT1 !IIt (NIITTC) /lllfll!tA DI!W!l.OPI&I!NT JI\\AH c co -c._ -.; Q) ~::: Ill~ +-’ ~~ ·- ~~ (f) ti li LA N...Manager WMD- CFMO 3919 Central Ave. Cheyenne, WY 82001 (307) 772-5066 (o) (307) 274-0844 ( cell ) --- - -Original Message----- From: Lloyd, Dee W Mr...772-5066 (o) (307) 274-0844 ( cell ) -----Original Message----- From: Pesenti, Cathryn M Civ USAF AFGSC 90 CES/CEV [mailto:Cathryn.Pesenti@warren

  3. Evolution of the Pseudomonas aeruginosa mutational resistome in an international Cystic Fibrosis clone

    DEFF Research Database (Denmark)

    López-Causapé, Carla; Madsen Sommer, Lea Mette; Cabot, Gabriel

    2017-01-01

    ) and resistome of a widespread clone (CC274), in isolates from two highly-distant countries, Australia and Spain, covering an 18-year period. The coexistence of two divergent CC274 clonal lineages was revealed, but without evident geographical barrier; phylogenetic reconstructions and mutational resistome...... for the first time that high-level aminoglycoside resistance in CF is likely driven by mutations in fusA1/fusA2, coding for elongation factor G. Altogether, our results provide valuable information for understanding the evolution of the mutational resistome of CF P. aeruginosa....

  4. Pressure dependence of BaNi2As2

    Energy Technology Data Exchange (ETDEWEB)

    Ronning, Filip [Los Alamos National Laboratory; Park, Tuscon [Los Alamos National Laboratory; Bauer, Eric D [Los Alamos National Laboratory; Thompson, Joe D [Los Alamos National Laboratory

    2009-01-01

    We report results from resistivity measurements of BaNi{sub 2}As{sub 2} up to 27.4 kbar of pressure. We find the structural transition at 130 K is broadened slightly with increasing pressure. There is also minimal influence on the superconducting transition, where the resistive onset increases from 2 to 3 K, but the temperature at which zero resistance is obtained is unchanged up to 27.4 kbar. This behavior is in contrast to that observed in the Fe-based systems as well as in LaNiPO and LaNiAsO.

  5. ORF Alignment: NC_003279 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Sbjct: 121 GLQRLELSNNRIPSFDFARTCLKELKALMLAGNLIQKIPADIWDFLPSLSSLDISNNPID 180 ... Query: 299 LFVIAVGILWLYKKYRERTR...HMSSVPVGYTNLQH 332 ... LFVIAVGILWLYKKYRERTRHMSSVPVGYTNLQH Sbjct: 241 LFVIAVGILWLYKKYRERTRHMSSVPVGYTNLQH 274

  6. Protein (Viridiplantae): 746637 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 218 ... 38832:274 ... 38833:414 ... 564608:414 predicted protein Micromonas pusilla CCMP1545 MAQLPSYEVDDGEDSMPGAPGEGPMTDSMQGPPVEVPTSDSM...PGAPGEVPTMDSMHGPPVEVPTMDSMHGAPVEVPMMDSMPGAPVEVPTMDSMQGPPVEVPTMDSMQGAPGEGPMTDSMHGAPGEGPTMDSMNSGNPTKCVVPDWCSTYPPEMQKSKPECQCPDDSHP

  7. 8 CFR 274a.2 - Verification of identity and employment authorization.

    Science.gov (United States)

    2010-01-01

    ... not contain a photograph, identifying information shall be included such as: name, date of birth, sex..., identifying information shall be included such as: name, date of birth, sex, height, color of eyes, and... retention system must exhibit a high degree of legibility and readability when displayed on a video display...

  8. 26 CFR 1.274-4 - Disallowance of certain foreign travel expenses.

    Science.gov (United States)

    2010-04-01

    ... travel from one point in the United States to another point in the United States. However, travel which... outside the United States, the portion, if any, of such travel which is from one point in the United... (see paragraph (f) of this section). (2) Determination of travel from one point in the United States to...

  9. CULTIVAR RELEASE-BRS 274 (BRS Jacaju: common or giant cashew clone

    Directory of Open Access Journals (Sweden)

    João Rodrigues de Paiva

    2008-01-01

    Full Text Available BRS Jacaju is a common cashew clone developed by the Brazilian Agricultural Research Corporation Embrapa,sector Tropical Agro-industry, in partnership with the Companhia Industrial de Óleos do Nordeste (CIONE. The clone isrecommended for rainfed cultivation along the coastline of the Northeastern Region or similar environmental conditions, forboth nut and peduncle production for fruit juice industry.

  10. SU-E-T-274: Does Atmospheric Oxygen Affect the PRESAGE Dosimeter?

    Energy Technology Data Exchange (ETDEWEB)

    Alqathami, M; Ibbott, G [UT MD Anderson Cancer Center, Houston, TX (United States); Blencowe, A [The University of South Australia, South Australia, SA (Australia)

    2015-06-15

    Purpose: To experimentally determine the influence of atmospheric oxygen on the efficiency of the PRESAGE dosimeter and its reporting system. Methods: Batches of the reporting system – a mixture of chloroform and leuchomalachite green dye – and PRESAGE were prepared in aerobic and anaerobic conditions. For anaerobic batches, samples were deoxygenated by bubbling nitrogen through the dosimeter precursors or reporting system for 10 min. The dosimeters and reporting systems were prepared in spectrophotometric cuvettes and glass vials, respectively, and were irradiated with 6 MV photons to various radiation doses using a clinical linear accelerator. Changes in optical density of the dosimeters and reporting system before and after irradiation were measured using a spectrophotometer. In addition, the concentrations of dissolved oxygen were measured using a dissolved oxygen meter. Results: The experiments revealed that oxygen has little influence on the characteristics of PRESAGE, with the radical initiator oxidizing the leucomalachite green even in the presence of oxygen. However, deoxygenation of the reporting system leads to an increase in sensitivity to radiation dose by ∼ 30% when compared to the non-deoxygenated system. A slight improvement in sensitivity (∼ 5%) was also achieved by deoxygenating the PRESAGE precursor prior to casting. Measurement of the dissolved oxygen revealed low levels (0.4 ppm) in the polyurethane precursor used to fabricate the dosimeters, as compared to water (8.6 ppm). In addition, deoxygenation had no effect on the retention of the post-response absorption value of the PRESAGE dosimeter. Conclusion: The results suggest that the presence of oxygen does not inhibit the radiochromic properties of the PRESAGE system. In addition, there were no observed changes in the dose linearity, absorption spectrum and post-response photofading characteristics of the PRESAGE under the conditions investigated.

  11. S. A{r. Tldskr. Veek. 4, 271-274 (1974) NWTSTE ONTWIKKELINGE ...

    African Journals Online (AJOL)

    teen 'n toonemende tempo geihtensifiseer en ook in die voerkrale kan mineraalversorgingen mineraalmetabolisme ... vulling teen 150 mg 7-nldag by die didte van norrnale jmg mans, die tempo van wondgenesing ... knowns in zinc nutrition, especially with ruminants, than there are established facts. Ttre fact that a severe ...

  12. 7 CFR 274.12 - Electronic Benefit Transfer issuance system approval standards.

    Science.gov (United States)

    2010-01-01

    ...) All EBT systems within a State must follow a singular EBT APD and system architecture submitted by the... occur within two business days after receipt; (ii) Add newly authorized food retail stores or third... days of the error transaction. The State agency has 10 business days from the date the household...

  13. Identifikasi dan Kuantifikasi Metabolit Bakteri Pelarut Fosfat dan Pengaruhnya terhadap Aktivitas Rhizoctonia solani pada Tanaman Kedelai

    Directory of Open Access Journals (Sweden)

    Tri Candra Setiawati

    2008-09-01

    Full Text Available Phosphate solubilizing bacteria (PSB metabolites are organic acids, phosphomonoesterase enzyme (alkaline phosphatase and antibiotic, which is able to dissolve insoluble phosphate. Phosphate solubilizing bacteria used in this study was expected to suppress Rhizoctonia solani attacks. This experiment was aimed at (1 identifiying and quantifying PSB metabolites, and (2 examining their capability as biocontrol agent for Rhizoctonia solani in vitro and hydroponics soybean. This study was conducted in three stages. The first stage of this study was culturing two PSB isolates (Pseudomonas putida 27.4B and Pseudomonas diminuta in the Pikovskaya medium to analyze their metabolites. The second and third stage of this study was testing the antagonist of two bacteria to suppressed R. solani activity, which was conducted in vitro, and in hydroponics medium soybean as indicator plant. The results showed that P. putida 27.4B and P. diminuta produced organic acids i.e.: citrate, formic, succinic, acetic, propionate, butyrate, and oxalate. The totals of organic acids from each bacterium were 70,3 mg.kg-1 and 61,9 mg.kg-1. Production of alkaline phosphatase enzyme in Pikovskaya medium of P. Putida 27.4B was 11,71 ìg pNP .mL-1.h-1 and P. diminuta was 24,04 ìg pNP.mL-1.h-1. Concentration of this enzyme in soil medium was higher than that in Pikovskaya medium with 26,27 ìg pNP.g-1.h-1 and 39,03 ìg pNP.g-1.h-1 respectively. This study also showed that total concentration of antibiotics (tetracycline, oxitetracycline and penicillin produced by the PSB, were 3,2 ìg.mL-1 (P. putida 27.4B and 10,96 ìg.m1-1 (P. diminuta, respectively. The results from second stage of this study showed that by using in vitro, the reduced growth of R. solani was observed 58,35% with P. putida 27.4B and 41,96% with P. diminuta. In addition, inoculations of PSB in hydroponics medium reduced the fungal pathogenesis from 10,71% to 21,42% of pre and post emergence damping-off. Visually

  14. Localization of a membrane glycoprotein in benign fibrocystic disease and infiltrating duct carcinomas of the human breast with the use of a monoclonal antibody to guinea pig milk fat globule membrane.

    Science.gov (United States)

    Greenwalt, D. E.; Johnson, V. G.; Kuhajda, F. P.; Eggleston, J. C.; Mather, I. H.

    1985-01-01

    With monoclonal antibody D-274, raised against guinea pig milk fat globule membrane, the distribution of mucinlike glycoproteins of Mrs greater than or equal to 400,000 was determined in benign fibrocystic disease and infiltrating duct carcinoma of the human breast. These glycoproteins, called collectively PAS-I, were detected in 19 out of 20 cases of benign fibrocystic disease and in at least 26 out of 47 cases of infiltrating duct carcinoma. PAS-I was concentrated on luminal surfaces of ducts and alveoli in morphologically differentiated regions of the tumors. In areas where the glandular nature of the tissue was less evident in infiltrating duct carcinoma, the PAS-I determinant recognized by antibody D-274 was present on irregular luminal surfaces and in the cytoplasm. There was a negative correlation between the short-term recurrence (less than 2 years) of infiltrating duct carcinoma and the detection of strong positive staining with antibody D-274. The results are discussed with reference to recent studies on PAS-I in human breast tissue using monoclonal antibodies raised against human milk fat globule membrane. Images Figure 1 Figure 2 Figure 3 PMID:2579563

  15. ORF Alignment: NC_004605 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... parahaemolyticus RIMD 2210633] ... Length = 286 ... Query: 215 ETTRVLQRVEADHTRLDLFVIDDARKLPLGRPWLTLL...FDTHTKSVVGFYLGFEPPGYLSV 274 ... ETTRVLQRVEADHTRLDLFVIDDARKLPLGRPWLTLLFDTHT...KSVVGFYLGFEPPGYLSV Sbjct: 1 ... ETTRVLQRVEADHTRLDLFVIDDARKLPLGRPWLTLLFDTHTKSVVGFYLGFEPPGYLSV 60 ... Query: 335 NP

  16. Association of the solute carrier family 11 member 1 gene polymorphisms with susceptibility to leprosy in a Brazilian sample

    Directory of Open Access Journals (Sweden)

    Maria José Franco Brochado

    2016-02-01

    Full Text Available Natural resistance-associated macrophage protein 1/solute carrier family 11 member 1 gene (Nramp1/Slc11a1 is a gene that controls the susceptibility of inbred mice to intracellular pathogens. Polymorphisms in the human Slc11a1/Nramp1 gene have been associated with host susceptibility to leprosy. This study has evaluated nine polymorphisms of the Slc11a1/Nramp1 gene [(GTn, 274C/T, 469+14G/C, 577-18G/A, 823C/T, 1029 C/T, 1465-85G/A, 1703G/A, and 1729+55del4] in 86 leprosy patients (67 and 19 patients had the multibacillary and the paucibacillary clinical forms of the disease, respectively, and 239 healthy controls matched by age, gender, and ethnicity. The frequency of allele 2 of the (GTn polymorphism was higher in leprosy patients [p = 0.04, odds ratio (OR = 1.49], whereas the frequency of allele 3 was higher in the control group (p = 0.03; OR = 0.66. Patients carrying the 274T allele (p = 0.04; OR = 1.49 and TT homozygosis (p = 0.02; OR = 2.46, such as the 469+14C allele (p = 0.03; OR = 1.53 of the 274C/T and 469+14G/C polymorphisms, respectively, were more frequent in the leprosy group. The leprosy and control groups had similar frequency of the 577-18G/A, 823C/T, 1029C/T, 1465-85G/A, 1703G/A, and 1729+55del4 polymorphisms. The 274C/T polymorphism in exon 3 and the 469+14G/C polymorphism in intron 4 were associated with susceptibility to leprosy, while the allele 2 and 3 of the (GTn polymorphism in the promoter region were associated with susceptibility and protection to leprosy, respectively.

  17. Evolution of the Pseudomonas aeruginosa mutational resistome in an international Cystic Fibrosis clone.

    Science.gov (United States)

    López-Causapé, Carla; Sommer, Lea Mette; Cabot, Gabriel; Rubio, Rosa; Ocampo-Sosa, Alain A; Johansen, Helle Krogh; Figuerola, Joan; Cantón, Rafael; Kidd, Timothy J; Molin, Soeren; Oliver, Antonio

    2017-07-17

    Emergence of epidemic clones and antibiotic resistance development compromises the management of Pseudomonas aeruginosa cystic fibrosis (CF) chronic respiratory infections. Whole genome sequencing (WGS) was used to decipher the phylogeny, interpatient dissemination, WGS mutator genotypes (mutome) and resistome of a widespread clone (CC274), in isolates from two highly-distant countries, Australia and Spain, covering an 18-year period. The coexistence of two divergent CC274 clonal lineages was revealed, but without evident geographical barrier; phylogenetic reconstructions and mutational resistome demonstrated the interpatient transmission of mutators. The extraordinary capacity of P. aeruginosa to develop resistance was evidenced by the emergence of mutations in >100 genes related to antibiotic resistance during the evolution of CC274, catalyzed by mutator phenotypes. While the presence of classical mutational resistance mechanisms was confirmed and correlated with resistance phenotypes, results also showed a major role of unexpected mutations. Among them, PBP3 mutations, shaping up β-lactam resistance, were noteworthy. A high selective pressure for mexZ mutations was evidenced, but we showed for the first time that high-level aminoglycoside resistance in CF is likely driven by mutations in fusA1/fusA2, coding for elongation factor G. Altogether, our results provide valuable information for understanding the evolution of the mutational resistome of CF P. aeruginosa.

  18. Profesor Bohumil Ryba, mezi vědou a vězením

    Czech Academy of Sciences Publication Activity Database

    Dvořáčková, Věra

    -, č. 8 (2010), s. 227-274 ISSN 2336-1387 Institutional support: RVO:68378092 Keywords : Bohumil Ryba * linguistics * history * classical philology * political persecution * political trials Subject RIV: AI - Linguistics

  19. Význam kapra v rybničním hospodářství

    Czech Academy of Sciences Publication Activity Database

    Matěna, Josef; Flajšhans, Martin

    2013-01-01

    Roč. 61, č. 6 (2013), s. 272-274 ISSN 0044-4812 Institutional support: RVO:60077344 ; RVO:67985904 Keywords : Cyprinus carpio * fish production * pond ecosystem * Czech Republic Subject RIV: EH - Ecology, Behaviour

  20. 75 FR 62057 - Proposed Flood Elevation Determinations

    Science.gov (United States)

    2010-10-07

    ... buildings. Comments on any aspect of the Flood Insurance Study and FIRM, other than the proposed BFEs, will... State Highway 274. Duck Creek Approximately 925 feet None +458 Unincorporated Areas of downstream of...

  1. 77 FR 30220 - Final Flood Elevation Determinations

    Science.gov (United States)

    2012-05-22

    ... proof Flood Insurance Study and FIRM available at the address cited below for each community. The BFEs... Areas of 175. Kaufman County. Approximately 1 mile +342 downstream of State Highway 274. Duck Creek...

  2. 76 FR 19468 - Notice of Determinations Regarding Eligibility To Apply for Worker Adjustment Assistance

    Science.gov (United States)

    2011-04-07

    ... Services and Kelly Services. 75,274 Abbott Laboratories, Abbott Park, IL....... February 14, 2010... Moines, IA........ January 28, 2010. Inc., D/B/A UPS; Des Moines Billing Site. 75,156 Abbott Point of...

  3. 76 FR 7189 - Trunkline Gas Company, LLC; Notice of Request Under Blanket Authorization

    Science.gov (United States)

    2011-02-09

    ... Ship Shoal T-27 Platform and appurtenant facilities located in Ship Shoal 274, Offshore Louisiana... as more fully set forth in the application, which is open to the public for inspection. The filing...

  4. 17 CFR 270.30d-1 - Filing of copies of reports to shareholders.

    Science.gov (United States)

    2010-04-01

    ... shareholders. A registered management investment company, other than a small business investment company... and procedures specified therefor, of reports on Form N-CSR (§§ 249.331 and 274.128 of this chapter...

  5. Download this PDF file

    African Journals Online (AJOL)

    Elamin

    274-7. 14. Wright RS, Quinones-Baldrich WJ, Anders AJ,. Danovitch GM. Pleural effusion associated withipsilateral breast and arm edema as a complication of subclavian vein catheterization and arteriovenous fistula formation for hemodialysis.

  6. Asset stripping and firm survival in mass privatization: testing the Hoff-Stiglitz and Campos-Giovannoni models in Montenegro

    Czech Academy of Sciences Publication Activity Database

    Koman, M.; Lakićević, M.; Prašnikar, J.; Švejnar, Jan

    2015-01-01

    Roč. 43, č. 2 (2015), s. 274-289 ISSN 0147-5967 Institutional support: PRVOUK-P23 Keywords : asset stripping * mass privatization * firm survival Subject RIV: AH - Economics Impact factor: 1.380, year: 2015

  7. 75 FR 38871 - Proposed Collection; Comment Request for Revenue Procedure 2004-29

    Science.gov (United States)

    2010-07-06

    ... meal and entertainment expenses that are excepted from the 50% deduction disallowance of Sec. 274(n)(1... forms of information technology; and (e) estimates of capital or start-up costs and costs of operation...

  8. Garlic

    Science.gov (United States)

    ... Events Multimedia (Video, Images, and Audio) NCCIH Clinical Digest A monthly newsletter with evidence-based information on ... require a viewer such as the free Adobe Reader . NCCIH Publication No.: D274 Updated: September 2016 Print ...

  9. On the interaction between [Ru(NH3)(6)](3+) and the G-quadruplex forming thrombin binding aptamer sequence

    Czech Academy of Sciences Publication Activity Database

    De Rache, A.; Doneux, T.; Kejnovská, Iva; Buess-Herman, C.

    2013-01-01

    Roč. 126, SEP 2013 (2013), s. 84-90 ISSN 0162-0134 Institutional support: RVO:68081707 Keywords : SELF-ASSEMBLED MONOLAYERS * DNA-MODIFIED SURFACES * CIRCULAR-DICHROISM Subject RIV: BO - Biophysics Impact factor: 3.274, year: 2013

  10. 78 FR 29613 - Modification and Revocation of Air Traffic Service Routes; Jackson, MS

    Science.gov (United States)

    2013-05-21

    ... structure as required to preserve the safe and efficient flow of air traffic. Environmental Review The FAA... Guthrie 156[deg] and Millsap, TX, 274[deg] radials; Millsap; Glen Rose, TX; Cedar Creek, TX; Quitman, TX...

  11. South African Journal of Education - Vol 22, No 4 (2002)

    African Journals Online (AJOL)

    Analysing the role of ICT in bridging the digital divide amongst learners · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Marlien Herselman, K.G. Britton, 270-274 ...

  12. 77 FR 22806 - Proposed Extension of Existing Collection; Comment Request

    Science.gov (United States)

    2012-04-17

    ... annually. Total Burden Cost (capital/startup): $0. Total Burden Cost (operating/maintenance): $45,979... (Section 8(f) Payments) 1,425 ESA-100 (20 SFR 702.201) 840 LS-271 (Self Insurance Application) 60 LS-274...

  13. Fibromyalgia

    Science.gov (United States)

    ... eds. Goldman-Cecil Medicine . 25th ed. Philadelphia, PA: Elsevier Saunders; 2016:chap 274. Mbuyi N. Fibromyalgia. In: ... FF, ed. Ferri's Clinical Advisor 2018 . Philadelphia, PA: Elsevier; 2017:491-492. Selfridge NJ. Fibromyalgia. In: Rakel ...

  14. Culturally Diverse Communities and End-of-Life Care

    Science.gov (United States)

    ... Azen, S.P. (1995). Ethnicity and attitudes toward patient autonomy. JAMA, 274, 820-5 . Phipps, E., True, G., & ... briefly about end-of-life options and neglect culture or values (Tulsky, Fischer, Rose, & Arnold, 1998). Speaking ...

  15. Worldwide frequency distribution of the 'Gait keeper' mutation in the DMRT3 gene

    Czech Academy of Sciences Publication Activity Database

    Promerová, M.; Andersson, L.S.; Juras, R.; Penedo, M.C.T.; Reissmann, M.; Tozaki, T.; Bellone, R.; Dunner, S.; Hořín, P.; Imsland, F.; Imsland, P.; Mikko, S.; Modrý, David; Roed, K.H.; Schwochow, D.; Vega-Pla, J.L.; Mehrabani-Yeganeh, H.; Yousefi-Mashouf, N.; Cothran, E.G.; Lindgren, G.; Andersson, L.

    2014-01-01

    Roč. 45, č. 2 (2014), s. 274-282 ISSN 0268-9146 Institutional support: RVO:60077344 Keywords : ambling * domestication * horse * locomotion * pace * running walk Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.207, year: 2014

  16. 75 FR 26312 - Self-Regulatory Organizations; NYSE Amex LLC; Notice of Filing and Immediate Effectiveness of...

    Science.gov (United States)

    2010-05-11

    ... MannKind Corp. 255 TM Toyota Motor Corp. 171 MDVN Medivation Inc. 257 HK Petrohawk Energy Corp. 176... Gold Corp. 213 MRVL Marvell Technology 273 EP El Paso Corp. Group Ltd. 215 XLP Consumer Staples 274...

  17. Did Ms Wisdom of Proverbs 8 become a mystery in 4QInstruction?

    African Journals Online (AJOL)

    2016-07-29

    Jul 29, 2016 ... pmventer686@gmail.com .... Seeing the raz nihyeh as revelation by God, Lockett (2005:143) remarks ..... In this 'character sketch of wisdom' (Brown 1996:loc. ..... bears a 'strong eschatological perspective' (Collins 1997:274).

  18. NJP VOLUME 41 NO 4

    African Journals Online (AJOL)

    PROF. EZECHUKWU

    2014-07-24

    Jul 24, 2014 ... review of 274 children with primary malignant hepatic tumours in South ... Weidemann syndrome, hemi-hypertrophy, familial ade- nomatosis polypi and in ... with accidental palpation of the liver by caregiver or during routine ...

  19. The effects of costless pre-play communication: experimental evidence from games with Pareto-ranked equilibria

    Czech Academy of Sciences Publication Activity Database

    Blume, A.; Ortmann, Andreas

    2007-01-01

    Roč. 132, č. 1 (2007), s. 274-290 ISSN 0022-0531 Institutional research plan: CEZ:MSM0021620846 Keywords : coordination games * order-statistic games * cheap talk Subject RIV: AH - Economics Impact factor: 1.353, year: 2007

  20. Effect of oxygen intercalation on properties of sputtered CuYO 2 for ...

    Indian Academy of Sciences (India)

    Keywords. Transparent conducting oxide; RF sputtering; -type TCO. ... The positive sign of Seebeck coefficient (+274 VK-1) confirms the -type conductivity of the films. The optical bandgap of CuYO2 ... Bulletin of Materials Science | News.

  1. Solvent extraction of microamounts of strontium and barium from water into nitrobenzene using hydrogen dicarbollylcobaltate in the presence of benzo-18-crown-6

    Czech Academy of Sciences Publication Activity Database

    Makrlík, E.; Vančura, P.; Selucký, P.; Hálová, Jaroslava

    2007-01-01

    Roč. 274, č. 3 (2007), s. 625-629 ISSN 0236-5731 Institutional research plan: CEZ:AV0Z40320502 Keywords : unex proces * dicarbolide * separation Subject RIV: CA - Inorganic Chemistry Impact factor: 0.499, year: 2007

  2. Creep deformation and microstructural examination of a prior thermally exposed nickel base superalloy

    Czech Academy of Sciences Publication Activity Database

    Zrník, J.; Strunz, Pavel; Vrchovinský, V.; Muránsky, O.; Horňák, P.; Wiedenmann, A.

    2004-01-01

    Roč. 274 (2004), s. 925-930 ISSN 1013-9826 R&D Projects: GA AV ČR KSK1010104 Keywords : superalloy * thermal exposition * creep Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.278, year: 2004

  3. Strategie "zeleného růstu" a trh práce

    Czech Academy of Sciences Publication Activity Database

    Tošovská, Eva

    2011-01-01

    Roč. 59, č. 10 (2011), s. 987-1004 ISSN 0013-3035 Institutional research plan: CEZ:AV0Z70850503 Keywords : green growth strategy * environmental policy * employment Subject RIV: AH - Economics Impact factor: 0.274, year: 2011

  4. 75 FR 26299 - Self-Regulatory Organizations; Notice of Filing and Immediate Effectiveness of Proposed Rule...

    Science.gov (United States)

    2010-05-11

    ... AMED Amedisys Inc. 255 TM Toyota Motor Corp. 257 HK Petrohawk Energy Corp. 258 ENER Energy Conversion... Kinross Gold Corp. 273 EP El Paso Corp. 274 SEED Origin Agritech Ltd. 275 WIN Windstream Corp. 279 DHI DR...

  5. Maternal diabetes alters transcriptional programs in the developing embryo

    Czech Academy of Sciences Publication Activity Database

    Pavlínková, Gabriela; Salbaum, M.; Kappen, C.

    2009-01-01

    Roč. 10, č. 274 (2009), s. 1-12 ISSN 1471-2164 Institutional research plan: CEZ:AV0Z50520701 Keywords : Diabetic embryopathy * microarray * hypoxia Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.759, year: 2009

  6. Draft Genome Sequence of Serratia sp. Strain DD3, Isolated from the Guts of Daphnia magna

    OpenAIRE

    Poehlein, Anja; Freese, Heike M.; Daniel, Rolf; Simeonova, Diliana D.

    2014-01-01

    We report the draft genome sequence of Serratia sp. strain DD3, a gammaproteobacterium from the family Enterobacteriaceae. It was isolated from homogenized guts of Daphnia magna. The genome size is 5,274 Mb. peerReviewed

  7. SPIDIA-DNA: An External Quality Assessment for the pre-analytical phase of blood samples used for DNA-based analyses

    Czech Academy of Sciences Publication Activity Database

    Malentacchi, F.; Pazzagli, M.; Simi, L.; Orlando, C.; Wyrich, R.; Hartmann, C.C.; Verderio, P.; Pizzamiglio, S.; Ciniselli, C.M.; Tichopád, Aleš; Kubista, Mikael; Gelmini, S.

    -, č. 424 (2013), s. 274-286 ISSN 0009-8981 Institutional research plan: CEZ:AV0Z50520701 Keywords : Pre-analytical phase * DNA quality * Blood samples Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.764, year: 2013

  8. Molecular cloning, expression analysis and sequence prediction of ...

    African Journals Online (AJOL)

    ajl yemi

    2011-11-28

    Nov 28, 2011 ... prediction of CCAAT/enhancer-binding protein beta ... CCAAT/enhancer-binding protein beta (C/EBPβ), as an essential transcriptional factor, regulates the ... acid area from 274 to 337 was found, concurring with the main ...

  9. The effect of Bt-corn on soil invertebrates, soil microbial community and decomposition rates of corn post-harvest residues under field and laboratory conditions

    Czech Academy of Sciences Publication Activity Database

    Frouz, Jan; Elhottová, Dana; Helingerová, M.; Kocourek, F.

    2008-01-01

    Roč. 32, č. 4 (2008), s. 645-655 ISSN 1044-0046 Institutional research plan: CEZ:AV0Z60660521 Keywords : Bt corn * soil biology * decomposition Subject RIV: EH - Ecology, Behaviour Impact factor: 0.274, year: 2008

  10. Letter to the Editor

    OpenAIRE

    Thomas K. Karikari

    2015-01-01

    This article is a reaction to a previously published article in the Journal of Microbiology & Biology Education, “Gamification of the Laboratory Experience to Encourage Student Engagement” by Kevin Drace (JMBE 14(2):273–274, 2013).

  11. Final task force report on the Agreement State Program

    International Nuclear Information System (INIS)

    1977-12-01

    Section 274 of the Atomic Energy Act provides a statutory means by which the U.S. Nuclear Regulatory Commission may relinquish to the States a part of its regulatory authority over the use of source material, by-product material, and small quantities of special nuclear material. The Commission is required to retain regulatory authority over the licensing of nuclear facilities, exports and imports of nuclear materials and facilities, larger quantities of special nuclear material, and activities conducted by other Federal agencies which are not exempted by the Act. This study analyzes the NRC Agreement State Program to determine: whether the NRC should aggressively promote Agreement State status; whether the NRC should relinquish additional responsibility to the States and if so, which responsibilities and under what circumstances, and conversely if NRC should reassert authority in any areas; to what extent the NRC should continue to oversee State performance; and whether changes in the statute or regulations are desirable or required. At present, there are 25 states that have not opted for agreement status. Appendix A contains a discussion of the legislative history of Section 274, a report on the current status of the program, Agreement State review procedures, the full text of Section 274, a list of Agreement States, dates of agreements, number of licenses, a list of non-Agreement States, and numbers of NRC licenses in these States. Appendix B analyzes states' comments

  12. Zur Fachterminologie von Comenius' Physicae synopsis. Specimen Lexici Comeniani

    Czech Academy of Sciences Publication Activity Database

    Steiner, Martin

    39-40, 15-16 (2002), s. 241-274 ISSN 0231-5955 R&D Projects: GA AV ČR IAA9009102 Institutional research plan: CEZ:AV0Z9009908 Keywords : Comenius * Latin * terminology * vocabulary Subject RIV: AA - Philosophy ; Religion

  13. Influence of the dislocation core on the glide of the 1/2 < 111 >{110} edge dislocation in bcc-iron: An embedded atom method study

    Czech Academy of Sciences Publication Activity Database

    Haghighat, S.M.H.; von Pezold, J.; Race, C. P.; Kormann, F.; Friák, Martin; Neugebauer, J.; Raabe, D.

    2014-01-01

    Roč. 87, MAY (2014), s. 274-282 ISSN 0927-0256 Institutional support: RVO:68081723 Keywords : Molecular dynamics * Edge dislocation * Core structure * Dislocation glide * Iron Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.131, year: 2014

  14. 75 FR 26301 - Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2010-05-11

    ... SYMC Symantec Corp. 162 TIVO TiVo Inc 253 AMED Amedisys Inc. 163 MNKD MannKind Corp 255 TM Toyota Motor... Marvell Technology Group 273 EP El Paso Corp. Ltd. 215 XLP Consumer Staples Select 274 SEED Origin...

  15. 75 FR 25895 - Self-Regulatory Organizations; Notice of Filing and Immediate Effectiveness of a Proposed Rule...

    Science.gov (United States)

    2010-05-10

    ... Symantec Corp. 162 TIVO TiVo Inc 253 AMED Amedisys Inc. 163 MNKD MannKind Corp 255 TM Toyota Motor Corp... Marvell Technology Group 273 EP El Paso Corp. Ltd. 215 XLP Consumer Staples Select 274 SEED Origin...

  16. Metallographic examination of two medieval knives from Kobilić (Republic of Croatia)

    Czech Academy of Sciences Publication Activity Database

    Thiele, Á.; Hošek, Jiří; Antonić, N.; Rácz, T. Á.

    2017-01-01

    Roč. 32, 7-8 (2017), s. 867-875 ISSN 1042-6914 Institutional support: RVO:67985912 Keywords : knife * Kobilić * metallography * Middle Ages Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Archaeology Impact factor: 2.274, year: 2016

  17. FastStats: Births -- Method of Delivery

    Science.gov (United States)

    ... 1990–2013 [PDF – 423 KB] Primary Cesarean Delivery Rates, by State: Results From the Revised Birth Certificate, 2006–2012 [PDF – 274 KB] Related Links Vital Statistics downloadable public use data files American College of ...

  18. checkCIF/PLATON report Datablock: 1

    Indian Academy of Sciences (India)

    Calculated. Reported. Volume ... PLAT094_ALERT_2_C Ratio of Maximum / Minimum Residual Density .... 2.74 Report ... outliers and unusual parameters, but every test has its limitations and alerts that are not important in a particular case ...

  19. The Manufacture of the Grinding Wheels Based on the Ca–K Geopolymer Matrix

    Czech Academy of Sciences Publication Activity Database

    Perná, Ivana; Hanzlíček, Tomáš; Boura, P.; Lučaník, A.

    2016-01-01

    Roč. 31, č. 5 (2016), s. 667-672 ISSN 1042-6914 Institutional support: RVO:67985891 Keywords : geopolymer * grinding * wheel * low-temperature * industrial * manufacturing * technology Subject RIV: DM - Solid Waste and Recycling Impact factor: 2.274, year: 2016

  20. Personality correlates of self-esteem and life satisfaction

    Czech Academy of Sciences Publication Activity Database

    Blatný, Marek; Jelínek, Martin; Blížkovská, J.; Klimusová, Helena

    2004-01-01

    Roč. 46, č. 2 (2004), s. 97-104 ISSN 0039-3320 Institutional research plan: CEZ:AV0Z7025918 Keywords : self - esteem * five-factor model * life satisfaction Subject RIV: AN - Psychology Impact factor: 0.274, year: 2004

  1. Data of evolutionary structure change: 1PVDA-1ZPDE [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1PVDA-1ZPDE 1PVD 1ZPD A E SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEV...HHHHH--HHHHH EEEEE HHHHHHHHHHHHHHH 0 1PVD... A 1PVDA KSFND-NSKIR ALA CA 225 SER CA 274 1PVD... A 1PVDA AKLLQTPID

  2. the place of quinolones in the treatment of enteric fevers in the 21st ...

    African Journals Online (AJOL)

    Dr. Jombo

    conducted to verify the view that poverty influences the incidence and ... sample of 274 subjects: males (162/59%) and females (112/41%) within the economically ..... India. Intl. J. Tubercl. Lung Dis. 3:869–877. World. Health. Organization.

  3. 17 CFR 229.407 - (Item 407) Corporate governance.

    Science.gov (United States)

    2010-04-01

    ...-CSR (§§ 249.331 and 274.128 of this chapter)), unless the party relying on such report knows or has... expert for any purpose, including without limitation for purposes of section 11 of the Securities Act (15...

  4. Planck intermediate results XXXI. Microwave survey of Galactic supernova remnants

    DEFF Research Database (Denmark)

    Arnaud, M.; Ashdown, M.; Atrio-Barandela, F.

    2016-01-01

    The all-sky Planck survey in 9 frequency bands was used to search for emission from all 274 known Galactic supernova remnants. Of these, 16 were detected in at least two Planck frequencies. The radio-through-microwave spectral energy distributions were compiled to determine the mechanism for micr......The all-sky Planck survey in 9 frequency bands was used to search for emission from all 274 known Galactic supernova remnants. Of these, 16 were detected in at least two Planck frequencies. The radio-through-microwave spectral energy distributions were compiled to determine the mechanism...... for microwave emission. In only one case, IC 443, is there high-frequency emission clearly from dust associated with the supernova remnant. In all cases, the low-frequency emission is from synchrotron radiation. As predicted for a population of relativistic particles with energy distribution that extends...

  5. Fabrication of in-situ grown graphene reinforced Cu matrix composites

    Science.gov (United States)

    Chen, Yakun; Zhang, Xiang; Liu, Enzuo; He, Chunnian; Shi, Chunsheng; Li, Jiajun; Nash, Philip; Zhao, Naiqin

    2016-01-01

    Graphene/Cu composites were fabricated through a graphene in-situ grown approach, which involved ball-milling of Cu powders with PMMA as solid carbon source, in-situ growth of graphene on flaky Cu powders and vacuum hot-press sintering. SEM and TEM characterization results indicated that graphene in-situ grown on Cu powders guaranteed a homogeneous dispersion and a good combination between graphene and Cu matrix, as well as the intact structure of graphene, which was beneficial to its strengthening effect. The yield strength of 244 MPa and tensile strength of 274 MPa were achieved in the composite with 0.95 wt.% graphene, which were separately 177% and 27.4% enhancement over pure Cu. Strengthening effect of in-situ grown graphene in the matrix was contributed to load transfer and dislocation strengthening. PMID:26763313

  6. The Serratia gene cluster encoding biosynthesis of the red antibiotic, prodigiosin, shows species- and strain-dependent genome context variation

    DEFF Research Database (Denmark)

    Harris, Abigail K P; Williamson, Neil R; Slater, Holly

    2004-01-01

    The prodigiosin biosynthesis gene cluster (pig cluster) from two strains of Serratia (S. marcescens ATCC 274 and Serratia sp. ATCC 39006) has been cloned, sequenced and expressed in heterologous hosts. Sequence analysis of the respective pig clusters revealed 14 ORFs in S. marcescens ATCC 274...... and 15 ORFs in Serratia sp. ATCC 39006. In each Serratia species, predicted gene products showed similarity to polyketide synthases (PKSs), non-ribosomal peptide synthases (NRPSs) and the Red proteins of Streptomyces coelicolor A3(2). Comparisons between the two Serratia pig clusters and the red cluster...... from Str. coelicolor A3(2) revealed some important differences. A modified scheme for the biosynthesis of prodigiosin, based on the pathway recently suggested for the synthesis of undecylprodigiosin, is proposed. The distribution of the pig cluster within several Serratia sp. isolates is demonstrated...

  7. Consolidated bioprocessing of microalgal biomass to carboxylates by a mixed culture of cow rumen bacteria using anaerobic sequencing batch reactor (ASBR).

    Science.gov (United States)

    Zhao, Baisuo; Liu, Jie; Frear, Craig; Holtzapple, Mark; Chen, Shulin

    2016-12-01

    This study employed mixed-culture consolidated bioprocessing (CBP) to digest microalgal biomass in an anaerobic sequencing batch reactor (ASBR). The primary objectives are to evaluate the impact of hydraulic residence time (HRT) on the productivity of carboxylic acids and to characterize the bacterial community. HRT affects the production rate and patterns of carboxylic acids. For the 5-L laboratory-scale fermentation, a 12-day HRT was selected because it offered the highest productivity of carboxylic acids and it synthesized longer chains. The variability of the bacterial community increased with longer HRT (R 2 =0.85). In the 5-L laboratory-scale fermentor, the most common phyla were Firmicutes (58.3%), Bacteroidetes (27.4%), and Proteobacteria (11.9%). The dominant bacterial classes were Clostridia (29.8%), Bacteroidia (27.4%), Tissierella (26.2%), and Betaproteobacteria (8.9%). Copyright © 2016 Elsevier Ltd. All rights reserved.

  8. 75 FR 26310 - Self-Regulatory Organizations; International Securities Exchange, LLC; Notice of Filing and...

    Science.gov (United States)

    2010-05-11

    ... Symantec Corp. 162 TIVO TiVo Inc. 253 AMED Amedisys Inc. 163 MNKD MannKind Corp. 255 TM Toyota Motor Corp... 273 EP El Paso Corp. Group Ltd. 215 XLP Consumer Staples 274 SEED Origin Agritech Select Sector SPDR...

  9. The History of Expropriation in Ethiopian Law

    African Journals Online (AJOL)

    Daniel_W_A

    Expropriation is a compulsory taking of land by the state for public purpose and upon .... International Federation of Surveyors. 8 Black ... In Ethiopia, the first systematic definition for the concept was given in the ...... De Droit, 28, 235-274.

  10. Disease: H00259 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available y Apparent mineralocorticoid excess (AME) syndrome is characterized by hypertension, low plasma renin and al...: E27.4 I15.2 OMIM: 218030 207765 PMID:16980198 ... AUTHORS ... Hammer F, Stewart PM ... TITLE ... Cortisol metabolism in hypertension

  11. Tennessee Valley Authority: Information on Benchmarking and Electricity Rates

    National Research Council Canada - National Science Library

    2002-01-01

    .... In 1997 TVA declared its intent to reduce its cost of power and increase its financial flexibility to respond to competitive pressure largely by reducing debt by over half from $27.4 billion to about $13.2 billion by 2007...

  12. KLE Translog production function and total factor productivity

    Czech Academy of Sciences Publication Activity Database

    Klacek, J.; Vošvrda, Miloslav; Schlosser, Š.

    2007-01-01

    Roč. 87, č. 4 (2007), s. 261-274 ISSN 0322-788X Institutional research plan: CEZ:AV0Z10750506 Keywords : total factor productivity * translog production function * aggregate production function * least squares method * ridge regression Subject RIV: AH - Economics

  13. Heterozygous STAT1 gain-of-function mutations underlie an unexpectedly broad clinical phenotype

    NARCIS (Netherlands)

    Toubiana, Julie; Okada, Satoshi; Hiller, Julia; Oleastro, Matias; Lagos Gomez, Macarena; Aldave Becerra, Juan Carlos; Ouachée-Chardin, Marie; Fouyssac, Fanny; Girisha, Katta Mohan; Etzioni, Amos; van Montfrans, Joris M.; Camcioglu, Yildiz; Kerns, Leigh Ann; Belohradsky, Bernd; Blanche, Stéphane; Bousfiha, Aziz; Rodriguez-Gallego, Carlos; Meyts, Isabelle; Kisand, Kai; Reichenbach, Janine; Renner, Ellen D; Rosenzweig, Sergio; Grimbacher, Bodo; van de Veerdonk, Frank L; Traidl-Hoffmann, Claudia; Picard, Capucine; Marodi, Laszlo; Morio, Tomohiro; Kobayashi, Masao; Lilic, Desa; Milner, Joshua D; Holland, Steven; Casanova, Jean-Laurent; Puel, Anne

    2016-01-01

    Since their discovery in patients with autosomal dominant (AD) chronic mucocutaneous candidiasis (CMC) in 2011, heterozygous STAT1 gain-of-function (GOF) mutations have increasingly been identified worldwide. The clinical spectrum associated with them needed to be delineated. We enrolled 274

  14. Measure functional differential equations in the space of functions of bounded variation

    Czech Academy of Sciences Publication Activity Database

    Afonso, S.; Rontó, András

    2013-01-01

    Roč. 2013, č. 582161 (2013), s. 582161 ISSN 1085-3375 Institutional support: RVO:67985840 Keywords : measure differential equations * functional differential equations Subject RIV: BA - General Mathematics Impact factor: 1.274, year: 2013 http://www.hindawi.com/journals/ aaa /2013/582161/

  15. Antimicrobial, Anthelmintic Activities and Characterisation of Functional Phenolic Acids of Achyranthes aspera Linn.: A Medicinal Plant Used for the Treatment of Wounds and Ringworm in East Africa

    Czech Academy of Sciences Publication Activity Database

    Ndhlala, A.R.; Ghebrehiwot, H.M.; Ncube, B.; Aremu, A.O.; Grúz, Jiří; Šubrtová, Michaela; Doležal, Karel; du Plooy, C.P.; Abdelgadir, H.A.; van Staden, J.

    2015-01-01

    Roč. 6, NOV 23 (2015), s. 274 ISSN 1663-9812 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : Amaranthaceae * chlorogenic acid * genistein Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.418, year: 2015

  16. Reduction of ploidy level by androgenesis in intergeneric Lolium-Festuca hybrids for turf grass breeding

    Czech Academy of Sciences Publication Activity Database

    Kopecký, David; Lukaszewski, A.J.; Gibeault, V.

    2005-01-01

    Roč. 45, č. 1 (2005), s. 274-281 ISSN 0011-183X Institutional research plan: CEZ:AV0Z50380511 Keywords : anther culture * pentaploid hybrids * perenne L. Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.925, year: 2005

  17. Vom work Book Journal 2011, 2010 4th Edition PDF

    African Journals Online (AJOL)

    USER

    affecting human and animal health (Arshad et al., 2006 ... were restreaked on EMB or sheep blood agar .... Ph D. 273. Ahmed et al, Studies of E. coli Isolates from Diarrhoeic lamb 271 - 274 .... In: AMS 5350 Large Animal Digestive System.

  18. Letter to the Editor

    Directory of Open Access Journals (Sweden)

    Thomas K. Karikari

    2015-02-01

    Full Text Available This article is a reaction to a previously published article in the Journal of Microbiology & Biology Education, “Gamification of the Laboratory Experience to Encourage Student Engagement” by Kevin Drace (JMBE 14(2:273–274, 2013.

  19. 5 CFR 330.1106 - Appointment.

    Science.gov (United States)

    2010-01-01

    ... Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, SELECTION, AND PLACEMENT (GENERAL) Federal Employment Priority Consideration Program for Displaced Employees of the... under Public Law 105-274. For employees appointed before October 21, 1998, the conversion will be...

  20. Cervical Cancer Awareness and Screening Uptake among Rural ...

    African Journals Online (AJOL)

    femi oloka

    year and 274,000 women die of the disease annually. ... and the overall knowledge was equally poor. ... population and HPV in women with cervical cancer. 6 ..... This finding is similar to the study done among rural women in. 28 india.

  1. López Sala, A. M., y Cachón Rodríguez, L.: Juventud e Inmigración

    Directory of Open Access Journals (Sweden)

    Virtudes Téllez Delgado

    2013-12-01

    Full Text Available Desafíos para la participación y para la integración, Canarias: Dirección General de Juventud de la Consejería de Empleo y Asuntos Sociales del Gobierno de Canarias, 2007, 274 pp

  2. African Journal of Environmental Science and Technology - Vol 7 ...

    African Journals Online (AJOL)

    Ecosystem services and drivers of change in Nyando floodplain wetland, Kenya · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. PJK Rongoei, J Kipkemboi, JB Okeyo-Owuor, AA van Dam, 274-291 ...

  3. v Micro vegetab obiolog bles so gical q old in J uality Jimma and sa ...

    African Journals Online (AJOL)

    sunny

    cci and aero ..... These were carried out by Gram staining techniques and observing .... horse cart (26.7%), car (23.3%) and humans back ...... Microbiology. The Benjamin puplishing co. Ic., New. York, USA. pp. 274-278. Trias R, Bañeras L, ...

  4. Geometric Arveson–Douglas conjecture

    Czech Academy of Sciences Publication Activity Database

    Engliš, Miroslav; Eschmeier, J.

    2015-01-01

    Roč. 274, April (2015), s. 606-630 ISSN 0001-8708 Institutional support: RVO:67985840 Keywords : Arveson- Douglas conjecture * generalized Toeplitz operator Subject RIV: BA - General Mathematics Impact factor: 1.405, year: 2015 http://www.sciencedirect.com/science/article/pii/S0001870815000328

  5. Technologické využití elektronového svazku

    Czech Academy of Sciences Publication Activity Database

    Zobač, Martin; Zobačová, Jitka; Vlček, Ivan

    2012-01-01

    Roč. 57, č. 10 (2012), s. 270-274 ISSN 0447-6441 Institutional support: RVO:68081731 Keywords : focused intense electron beam * welding * machining * heat treatment * surface modifica­tion * engraving * texturing * additive manufactu­ring Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  6. Effect of Chronic Dietary Copper Exposure on Haematology and ...

    African Journals Online (AJOL)

    Michael Horsfall

    ... of common carp and establish a threshold for dietary copper toxicity in the ... temperature 27.4 ± 0.420C and left unfed in the first 2 .... dependent effects of dietary copper exposure on .... mechanisms of acclimation to metals in freshwater fish.

  7. 77 FR 45480 - Deductions for Entertainment Use of Business Aircraft

    Science.gov (United States)

    2012-08-01

    ... Deductions for Entertainment Use of Business Aircraft AGENCY: Internal Revenue Service (IRS), Treasury... business aircraft for entertainment. These final regulations affect taxpayers that deduct expenses for... section 274 of the Internal Revenue Code (Code) of deductions for the use of business aircraft for...

  8. Concentration of phytic acid in faeces of calves fed starter diets

    Czech Academy of Sciences Publication Activity Database

    Dušková, Dagmar; Dvořák, R.; Rada, V.; Doubek, J.; Marounek, Milan

    2001-01-01

    Roč. 70, č. 4 (2001), s. 381-385 ISSN 0001-7213 R&D Projects: GA ČR GA524/99/0101; GA AV ČR KSK5020115 Keywords : nutrition * concentrated feed * phosphorus Subject RIV: ED - Physiology Impact factor: 0.274, year: 2001

  9. Methods applied for the characterization of Si:H thin films with embedded nanoparticles

    Czech Academy of Sciences Publication Activity Database

    Stuchlíková, The-Ha; Remeš, Zdeněk; Purkrt, Adam; Stuchlík, Jiří; Král, Karel

    2015-01-01

    Roč. 7, č. 4 (2015), s. 270-274 ISSN 2164-6627 R&D Projects: GA MŠk LH12236 Institutional support: RVO:68378271 Keywords : electrical conductivity * activation energy * CPM * SEM * I - V characteristics * nanoparticles Subject RIV: BM - Solid Matter Physics ; Magnetism

  10. Organisational age cultures : The interplay of chief executive officers age and attitudes toward younger and older employees

    NARCIS (Netherlands)

    Zacher, Hannes; Gielnik, Michael M.

    This article investigates the interactive effects of chief executive officer (CEO) age and CEO attitudes toward younger and older employees on organisational age cultures. Data was collected from 66 CEOs of small and medium-sized businesses and 274 employees. Results were consistent with

  11. Sahni, Prof. Ashok

    Indian Academy of Sciences (India)

    ... Vertebrate Palaeontology, Palaeobiogeography and Electron Microscope Applications to Biomineralization Address: 98, Mahatma Gandhi Marg, Lucknow 226 001, U.P.. Contact: Office: (0522) 274 0051. Residence: (0522) 223 5385. Mobile: 99560 29934. Email: ashok.sahni@gmail.com. YouTube · Twitter · Facebook ...

  12. The Cancer Genome Atlas Comprehensive Molecular Characterization of Renal Cell Carcinoma

    NARCIS (Netherlands)

    Ricketts, Christopher J.; De Cubas, Aguirre A.; Fan, Huihui; Smith, Christof C.; Lang, Martin; Reznik, Ed; Bowlby, Reanne; Gibb, Ewan A.; Akbani, Rehan; Beroukhim, Rameen; Bottaro, Donald P.; Choueiri, Toni K.; Gibbs, Richard A.; Godwin, Andrew K.; Haake, Scott; Hakimi, A. Ari; Henske, Elizabeth P.; Hsieh, James J.; Ho, Thai H.; Kanchi, Rupa S.; Krishnan, Bhavani; Kwaitkowski, David J.; Lui, Wembin; Merino, Maria J.; Mills, Gordon B.; Myers, Jerome; Nickerson, Michael L.; Reuter, Victor E.; Schmidt, Laura S.; Shelley, Carl Simon; Shen, Hui; Shuch, Brian; Signoretti, Sabina; Srinivasan, Ramaprasad; Tamboli, Pheroze; Thomas, George; Vincent, Benjamin G.; Vocke, Cathy D.; Wheeler, David A.; Yang, Lixing; Kim, William T.; Robertson, A. Gordon; Caesar-Johnson, Samantha J.; Demchok, John A.; Felau, Ina; Kasapi, Melpomeni; Ferguson, Martin L.; Hutter, Carolyn M.; Sofia, Heidi J.; Tarnuzzer, Roy; Wang, Zhining; Yang, Liming; Zenklusen, Jean C.; Zhang, Jiashan (Julia); Chudamani, Sudha; Liu, Jia; Lolla, Laxmi; Naresh, Rashi; Pihl, Todd; Sun, Qiang; Wan, Yunhu; Wu, Ye; Cho, Juok; DeFreitas, Timothy; Frazer, Scott; Gehlenborg, Nils; Getz, Gad; Heiman, David I.; Kim, Jaegil; Lawrence, Michael S.; Lin, Pei; Meier, Sam; Noble, Michael S.; Saksena, Gordon; Voet, Doug; Zhang, Hailei; Bernard, Brady; Chambwe, Nyasha; Dhankani, Varsha; Knijnenburg, Theo; Kramer, Roger; Leinonen, Kalle; Liu, Yuexin; Miller, Michael; Reynolds, Sheila; Shmulevich, Ilya; Thorsson, Vesteinn; Zhang, Wei; Akbani, Rehan; Broom, Bradley M.; Hegde, Apurva M.; Ju, Zhenlin; Kanchi, Rupa S.; Korkut, Anil; Li, Jun; Liang, Han; Ling, Shiyun; Liu, Wenbin; Lu, Yiling; Mills, Gordon B.; Ng, Kwok Shing; Rao, Arvind; Ryan, Michael; Wang, Jing; Weinstein, John N.; Zhang, Jiexin; Abeshouse, Adam; Armenia, Joshua; Chakravarty, Debyani; Chatila, Walid K.; de Bruijn, Ino; Gao, Jianjiong; Gross, Benjamin E.; Heins, Zachary J.; Kundra, Ritika; La, Konnor; Ladanyi, Marc; Luna, Augustin; Nissan, Moriah G.; Ochoa, Angelica; Phillips, Sarah M.; Reznik, Ed; Sanchez-Vega, Francisco; Sander, Chris; Schultz, Nikolaus; Sheridan, Robert; Sumer, S. Onur; Sun, Yichao; Taylor, Barry S.; Wang, Jioajiao; Zhang, Hongxin; Anur, Pavana; Peto, Myron; Spellman, Paul; Benz, Christopher; Stuart, Joshua M.; Wong, Christopher K.; Yau, Christina; Hayes, D. Neil; Parker, Joel S.; Wilkerson, Matthew D.; Ally, Adrian; Balasundaram, Miruna; Bowlby, Reanne; Brooks, Denise; Carlsen, Rebecca; Chuah, Eric; Dhalla, Noreen; Holt, Robert; Jones, Steven J.M.; Kasaian, Katayoon; Lee, Darlene; Ma, Yussanne; Marra, Marco A.; Mayo, Michael; Moore, Richard A.; Mungall, Andrew J.; Mungall, Karen; Robertson, A. Gordon; Sadeghi, Sara; Schein, Jacqueline E.; Sipahimalani, Payal; Tam, Angela; Thiessen, Nina; Tse, Kane; Wong, Tina; Berger, Ashton C.; Beroukhim, Rameen; Cherniack, Andrew D.; Cibulskis, Carrie; Gabriel, Stacey B.; Gao, Galen F.; Ha, Gavin; Meyerson, Matthew; Schumacher, Steven E.; Shih, Juliann; Kucherlapati, Melanie H.; Kucherlapati, Raju S.; Baylin, Stephen; Cope, Leslie; Danilova, Ludmila; Bootwalla, Moiz S.; Lai, Phillip H.; Maglinte, Dennis T.; Van Den Berg, David J.; Weisenberger, Daniel J.; Auman, J. Todd; Balu, Saianand; Bodenheimer, Tom; Fan, Cheng; Hoadley, Katherine A.; Hoyle, Alan P.; Jefferys, Stuart R.; Jones, Corbin D.; Meng, Shaowu; Mieczkowski, Piotr A.; Mose, Lisle E.; Perou, Amy H.; Perou, Charles M.; Roach, Jeffrey; Shi, Yan; Simons, Janae V.; Skelly, Tara; Soloway, Matthew G.; Tan, Donghui; Veluvolu, Umadevi; Fan, Huihui; Hinoue, Toshinori; Laird, Peter W.; Shen, Hui; Zhou, Wanding; Bellair, Michelle; Chang, Kyle; Covington, Kyle; Creighton, Chad J.; Dinh, Huyen; Doddapaneni, Harsha Vardhan; Donehower, Lawrence A.; Drummond, Jennifer; Gibbs, Richard A.; Glenn, Robert; Hale, Walker; Han, Yi; Hu, Jianhong; Korchina, Viktoriya; Lee, Sandra; Lewis, Lora; Li, Wei; Liu, Xiuping; Morgan, Margaret; Morton, Donna; Muzny, Donna; Santibanez, Jireh; Sheth, Margi; Shinbrot, Eve; Wang, Linghua; Wang, Min; Wheeler, David A.; Xi, Liu; Zhao, Fengmei; Hess, Julian; Appelbaum, Elizabeth L.; Bailey, Matthew; Cordes, Matthew G.; Ding, Li; Fronick, Catrina C.; Fulton, Lucinda A.; Fulton, Robert S.; Kandoth, Cyriac; Mardis, Elaine R.; McLellan, Michael D.; Miller, Christopher A.; Schmidt, Heather K.; Wilson, Richard K.; Crain, Daniel; Curley, Erin; Gardner, Johanna; Lau, Kevin; Mallery, David; Morris, Scott; Paulauskis, Joseph; Penny, Robert; Shelton, Candace; Shelton, Troy; Sherman, Mark; Thompson, Eric; Yena, Peggy; Bowen, Jay; Gastier-Foster, Julie M.; Gerken, Mark; Leraas, Kristen M.; Lichtenberg, Tara M.; Ramirez, Nilsa C.; Wise, Lisa; Zmuda, Erik; Corcoran, Niall; Costello, Tony; Hovens, Christopher; Carvalho, Andre L.; de Carvalho, Ana C.; Fregnani, José H.; Longatto-Filho, Adhemar; Reis, Rui M.; Scapulatempo-Neto, Cristovam; Silveira, Henrique C.S.; Vidal, Daniel O.; Burnette, Andrew; Eschbacher, Jennifer; Hermes, Beth; Noss, Ardene; Singh, Rosy; Anderson, Matthew L.; Castro, Patricia D.; Ittmann, Michael; Huntsman, David; Kohl, Bernard; Le, Xuan; Thorp, Richard; Andry, Chris; Duffy, Elizabeth R.; Lyadov, Vladimir; Paklina, Oxana; Setdikova, Galiya; Shabunin, Alexey; Tavobilov, Mikhail; McPherson, Christopher; Warnick, Ronald; Berkowitz, Ross; Cramer, Daniel; Feltmate, Colleen; Horowitz, Neil; Kibel, Adam; Muto, Michael; Raut, Chandrajit P.; Malykh, Andrei; Barnholtz-Sloan, Jill S.; Barrett, Wendi; Devine, Karen; Fulop, Jordonna; Ostrom, Quinn T.; Shimmel, Kristen; Wolinsky, Yingli; Sloan, Andrew E.; De Rose, Agostino; Giuliante, Felice; Goodman, Marc; Karlan, Beth Y.; Hagedorn, Curt H.; Eckman, John; Harr, Jodi; Myers, Jerome; Tucker, Kelinda; Zach, Leigh Anne; Deyarmin, Brenda; Hu, Hai; Kvecher, Leonid; Larson, Caroline; Mural, Richard J.; Somiari, Stella; Vicha, Ales; Zelinka, Tomas; Bennett, Joseph; Iacocca, Mary; Rabeno, Brenda; Swanson, Patricia; Latour, Mathieu; Lacombe, Louis; Têtu, Bernard; Bergeron, Alain; McGraw, Mary; Staugaitis, Susan M.; Chabot, John; Hibshoosh, Hanina; Sepulveda, Antonia; Su, Tao; Wang, Timothy; Potapova, Olga; Voronina, Olga; Desjardins, Laurence; Mariani, Odette; Roman-Roman, Sergio; Sastre, Xavier; Stern, Marc Henri; Cheng, Feixiong; Signoretti, Sabina; Berchuck, Andrew; Bigner, Darell; Lipp, Eric; Marks, Jeffrey; McCall, Shannon; McLendon, Roger; Secord, Angeles; Sharp, Alexis; Behera, Madhusmita; Brat, Daniel J.; Chen, Amy; Delman, Keith; Force, Seth; Khuri, Fadlo; Magliocca, Kelly; Maithel, Shishir; Olson, Jeffrey J.; Owonikoko, Taofeek; Pickens, Alan; Ramalingam, Suresh; Shin, Dong M.; Sica, Gabriel; Van Meir, Erwin G.; Zhang, Hongzheng; Eijckenboom, Wil; Gillis, Ad; Korpershoek, Esther; Looijenga, Leendert; Oosterhuis, Wolter; Stoop, Hans; van Kessel, Kim E.; Zwarthoff, Ellen C.; Calatozzolo, Chiara; Cuppini, Lucia; Cuzzubbo, Stefania; DiMeco, Francesco; Finocchiaro, Gaetano; Mattei, Luca; Perin, Alessandro; Pollo, Bianca; Chen, Chu; Houck, John; Lohavanichbutr, Pawadee; Hartmann, Arndt; Stoehr, Christine; Stoehr, Robert; Taubert, Helge; Wach, Sven; Wullich, Bernd; Kycler, Witold; Murawa, Dawid; Wiznerowicz, Maciej; Chung, Ki; Edenfield, W. Jeffrey; Martin, Julie; Baudin, Eric; Bubley, Glenn; Bueno, Raphael; De Rienzo, Assunta; Richards, William G.; Kalkanis, Steven; Mikkelsen, Tom; Noushmehr, Houtan; Scarpace, Lisa; Girard, Nicolas; Aymerich, Marta; Campo, Elias; Giné, Eva; Guillermo, Armando López; Van Bang, Nguyen; Hanh, Phan Thi; Phu, Bui Duc; Tang, Yufang; Colman, Howard; Evason, Kimberley; Dottino, Peter R.; Martignetti, John A.; Gabra, Hani; Juhl, Hartmut; Akeredolu, Teniola; Stepa, Serghei; Hoon, Dave; Ahn, Keunsoo; Kang, Koo Jeong; Beuschlein, Felix; Breggia, Anne; Birrer, Michael; Bell, Debra; Borad, Mitesh; Bryce, Alan H.; Castle, Erik; Chandan, Vishal; Cheville, John; Copland, John A.; Farnell, Michael; Flotte, Thomas; Giama, Nasra; Ho, Thai; Kendrick, Michael; Kocher, Jean Pierre; Kopp, Karla; Moser, Catherine; Nagorney, David; O'Brien, Daniel; O'Neill, Brian Patrick; Patel, Tushar; Petersen, Gloria; Que, Florencia; Rivera, Michael; Roberts, Lewis; Smallridge, Robert; Smyrk, Thomas; Stanton, Melissa; Thompson, R. Houston; Torbenson, Michael; Yang, Ju Dong; Zhang, Lizhi; Brimo, Fadi; Ajani, Jaffer A.; Gonzalez, Ana Maria Angulo; Behrens, Carmen; Bondaruk, Jolanta; Broaddus, Russell; Czerniak, Bogdan; Esmaeli, Bita; Fujimoto, Junya; Gershenwald, Jeffrey; Guo, Charles; Lazar, Alexander J.; Logothetis, Christopher; Meric-Bernstam, Funda; Moran, Cesar; Ramondetta, Lois; Rice, David; Sood, Anil; Tamboli, Pheroze; Thompson, Timothy; Troncoso, Patricia; Tsao, Anne; Wistuba, Ignacio; Carter, Candace; Haydu, Lauren; Hersey, Peter; Jakrot, Valerie; Kakavand, Hojabr; Kefford, Richard; Lee, Kenneth; Long, Georgina; Mann, Graham; Quinn, Michael; Saw, Robyn; Scolyer, Richard; Shannon, Kerwin; Spillane, Andrew; Stretch, onathan; Synott, Maria; Thompson, John; Wilmott, James; Al-Ahmadie, Hikmat; Chan, Timothy A.; Ghossein, Ronald; Gopalan, Anuradha; Levine, Douglas A.; Reuter, Victor; Singer, Samuel; Singh, Bhuvanesh; Tien, Nguyen Viet; Broudy, Thomas; Mirsaidi, Cyrus; Nair, Praveen; Drwiega, Paul; Miller, Judy; Smith, Jennifer; Zaren, Howard; Park, Joong Won; Hung, Nguyen Phi; Kebebew, Electron; Linehan, W. Marston; Metwalli, Adam R.; Pacak, Karel; Pinto, Peter A.; Schiffman, Mark; Schmidt, Laura S.; Vocke, Cathy D.; Wentzensen, Nicolas; Worrell, Robert; Yang, Hannah; Moncrieff, Marc; Goparaju, Chandra; Melamed, Jonathan; Pass, Harvey; Botnariuc, Natalia; Caraman, Irina; Cernat, Mircea; Chemencedji, Inga; Clipca, Adrian; Doruc, Serghei; Gorincioi, Ghenadie; Mura, Sergiu; Pirtac, Maria; Stancul, Irina; Tcaciuc, Diana; Albert, Monique; Alexopoulou, Iakovina; Arnaout, Angel; Bartlett, John; Engel, Jay; Gilbert, Sebastien; Parfitt, Jeremy; Sekhon, Harman; Thomas, George; Rassl, Doris M.; Rintoul, Robert C.; Bifulco, Carlo; Tamakawa, Raina; Urba, Walter; Hayward, Nicholas; Timmers, Henri; Antenucci, Anna; Facciolo, Francesco; Grazi, Gianluca; Marino, Mirella; Merola, Roberta; de Krijger, Ronald; Gimenez-Roqueplo, Anne Paule; Piché, Alain; Chevalier, Simone; McKercher, Ginette; Birsoy, Kivanc; Barnett, Gene; Brewer, Cathy; Farver, Carol; Naska, Theresa; Pennell, Nathan A.; Raymond, Daniel; Schilero, Cathy; Smolenski, Kathy; Williams, Felicia; Morrison, Carl; Borgia, Jeffrey A.; Liptay, Michael J.; Pool, Mark; Seder, Christopher W.; Junker, Kerstin; Omberg, Larsson; Dinkin, Mikhail; Manikhas, George; Alvaro, Domenico; Bragazzi, Maria Consiglia; Cardinale, Vincenzo; Carpino, Guido; Gaudio, Eugenio; Chesla, David; Cottingham, Sandra; Dubina, Michael; Moiseenko, Fedor; Dhanasekaran, Renumathy; Becker, Karl Friedrich; Janssen, Klaus Peter; Slotta-Huspenina, Julia; Abdel-Rahman, Mohamed H.; Aziz, Dina; Bell, Sue; Cebulla, Colleen M.; Davis, Amy; Duell, Rebecca; Elder, J. Bradley; Hilty, Joe; Kumar, Bahavna; Lang, James; Lehman, Norman L.; Mandt, Randy; Nguyen, Phuong; Pilarski, Robert; Rai, Karan; Schoenfield, Lynn; Senecal, Kelly; Wakely, Paul; Hansen, Paul; Lechan, Ronald; Powers, James; Tischler, Arthur; Grizzle, William E.; Sexton, Katherine C.; Kastl, Alison; Henderson, Joel; Porten, Sima; Waldmann, Jens; Fassnacht, Martin; Asa, Sylvia L.; Schadendorf, Dirk; Couce, Marta; Graefen, Markus; Huland, Hartwig; Sauter, Guido; Schlomm, Thorsten; Simon, Ronald; Tennstedt, Pierre; Olabode, Oluwole; Nelson, Mark; Bathe, Oliver; Carroll, Peter R.; Chan, June M.; Disaia, Philip; Glenn, Pat; Kelley, Robin K.; Landen, Charles N.; Phillips, Joanna; Prados, Michael; Simko, Jeffry; Smith-McCune, Karen; VandenBerg, Scott; Roggin, Kevin; Fehrenbach, Ashley; Kendler, Ady; Sifri, Suzanne; Steele, Ruth; Jimeno, Antonio; Carey, Francis; Forgie, Ian; Mannelli, Massimo; Carney, Michael; Hernandez, Brenda; Campos, Benito; Herold-Mende, Christel; Jungk, Christin; Unterberg, Andreas; von Deimling, Andreas; Bossler, Aaron; Galbraith, Joseph; Jacobus, Laura; Knudson, Michael; Knutson, Tina; Ma, Deqin; Milhem, Mohammed; Sigmund, Rita; Godwin, Andrew K.; Madan, Rashna; Rosenthal, Howard G.; Adebamowo, Clement; Adebamowo, Sally N.; Boussioutas, Alex; Beer, David; Giordano, Thomas; Mes-Masson, Anne Marie; Saad, Fred; Bocklage, Therese; Landrum, Lisa; Mannel, Robert; Moore, Kathleen; Moxley, Katherine; Postier, Russel; Walker, Joan; Zuna, Rosemary; Feldman, Michael; Valdivieso, Federico; Dhir, Rajiv; Luketich, James; Pinero, Edna M.Mora; Quintero-Aguilo, Mario; Carlotti, Carlos Gilberto; Dos Santos, Jose Sebastião; Kemp, Rafael; Sankarankuty, Ajith; Tirapelli, Daniela; Catto, James; Agnew, Kathy; Swisher, Elizabeth; Creaney, Jenette; Robinson, Bruce; Shelley, Carl Simon; Godwin, Eryn M.; Kendall, Sara; Shipman, Cassaundra; Bradford, Carol; Carey, Thomas; Haddad, Andrea; Moyer, Jeffey; Peterson, Lisa; Prince, Mark; Rozek, Laura; Wolf, Gregory; Bowman, Rayleen; Fong, Kwun M.; Yang, Ian; Korst, Robert; Rathmell, W. Kimryn; Fantacone-Campbell, J. Leigh; Hooke, Jeffrey A.; Kovatich, Albert J.; Shriver, Craig D.; DiPersio, John; Drake, Bettina; Govindan, Ramaswamy; Heath, Sharon; Ley, Timothy; Van Tine, Brian; Westervelt, Peter; Rubin, Mark A.; Lee, Jung Il; Aredes, Natália D.; Mariamidze, Armaz; Spellman, Paul T.; Rathmell, W. Kimryn; Linehan, W. Marston

    2018-01-01

    Renal cell carcinoma (RCC) is not a single disease, but several histologically defined cancers with different genetic drivers, clinical courses, and therapeutic responses. The current study evaluated 843 RCC from the three major histologic subtypes, including 488 clear cell RCC, 274 papillary RCC,

  13. Can war foster cooperation?

    Czech Academy of Sciences Publication Activity Database

    Bauer, Michal; Blattman, C.; Chytilová, Julie; Henrich, J.; Miguel, E.; Mitts, T.

    2016-01-01

    Roč. 30, č. 3 (2016), s. 249-274 ISSN 0895-3309 R&D Projects: GA ČR(CZ) GBP402/12/G130 Institutional support: RVO:67985998 Keywords : war * conflict * cooperation Subject RIV: AH - Economics Impact factor: 5.727, year: 2016

  14. Cytokinin Dynamics during the Response to Nitrogen in Two Contrasting Plectranthus Genotypes

    Czech Academy of Sciences Publication Activity Database

    Paparozzi, E.T.; Chahal, J.K.; Dobrev, Petre; Claassen, E.A.; Stroup, W.W.; Vaňková, Radomíra

    2016-01-01

    Roč. 141, č. 3 (2016), s. 264-274 ISSN 0003-1062 Institutional support: RVO:61389030 Keywords : ZEATIN-TYPE CYTOKININS * ARABIDOPSIS-THALIANA * ABSCISIC-ACID Subject RIV: EF - Botanics Impact factor: 1.125, year: 2016 http://journal.ashspublications.org/content/141/3/264.abstract

  15. Severe and complicated malaria in KwaZulu-Natal

    African Journals Online (AJOL)

    predictors of poor outcome (95% confidence intervals. 1.53 - 91 .9, 2.74 - 100.0 ... cases of severe malaria occur among young children over the age of 6 ... southern distribution of the infection in Africa. Sharp" ... urinary tract and 8 of the chest.

  16. Defining pottery use and animal management at the Neolithic site of Bylany (Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Mátlová, V.; Roffet-Salque, M.; Pavlů, Ivan; Kyselka, J.; Sedlářová, I.; Filip, V.; Evershed, R. P.

    2017-01-01

    Roč. 14, August (2017), s. 262-274 ISSN 2352-409X Institutional support: RVO:67985912 Keywords : LBK pottery * organic residue analysis * gas chromatography * fatty acids * stable carbon isotope analyse * vessel use * porosity Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Archaeology

  17. Structure-guided investigation of lipopolysaccharide O-antigen chain length regulators reveals regions critical for modal length control.

    Science.gov (United States)

    Kalynych, Sergei; Ruan, Xiang; Valvano, Miguel A; Cygler, Miroslaw

    2011-08-01

    The O-antigen component of the lipopolysaccharide (LPS) represents a population of polysaccharide molecules with nonrandom (modal) chain length distribution. The number of the repeat O units in each individual O-antigen polymer depends on the Wzz chain length regulator, an inner membrane protein belonging to the polysaccharide copolymerase (PCP) family. Different Wzz proteins confer vastly different ranges of modal lengths (4 to >100 repeat units), despite having remarkably conserved structural folds. The molecular mechanism responsible for the selective preference for a certain number of O units is unknown. Guided by the three-dimensional structures of PCPs, we constructed a panel of chimeric molecules containing parts of two closely related Wzz proteins from Salmonella enterica and Shigella flexneri which confer different O-antigen chain length distributions. Analysis of the O-antigen length distribution imparted by each chimera revealed the region spanning amino acids 67 to 95 (region 67 to 95), region 200 to 255, and region 269 to 274 as primarily affecting the length distribution. We also showed that there is no synergy between these regions. In particular, region 269 to 274 also influenced chain length distribution mediated by two distantly related PCPs, WzzB and FepE. Furthermore, from the 3 regions uncovered in this study, region 269 to 274 appeared to be critical for the stability of the oligomeric form of Wzz, as determined by cross-linking experiments. Together, our data suggest that chain length determination depends on regions that likely contribute to stabilize a supramolecular complex.

  18. Asset stripping and firm survival in mass privatization: testing the Hoff-Stiglitz and Campos-Giovannoni models in Montenegro

    Czech Academy of Sciences Publication Activity Database

    Koman, M.; Lakićević, M.; Prašnikar, J.; Švejnar, Jan

    2015-01-01

    Roč. 43, č. 2 (2015), s. 274-289 ISSN 0147-5967 R&D Projects: GA ČR(CZ) GA15-24642S Institutional support: RVO:67985998 Keywords : asset stripping * mass privatization * firm survival Subject RIV: AH - Economics Impact factor: 1.380, year: 2015

  19. Microendoscopic Surgery of the Hypopharyngeal Diverticulum Using Electrocoagulation or Carbon Dioxide Laser

    NARCIS (Netherlands)

    van Overbeek, J. J. M.; Hoeksema, P. E.; Edens, E. Th.

    1984-01-01

    In 1964 we started to treat hypopharyngeal (Zenker's) diverticula endoscopically, using the procedure described by Dohlman. With the increase in the number of patients (274 patients up until 1982), the technique and the instruments used have improved. This paper describes the technique we have used

  20. Quantitative analysis of HGF and EGF-dependent phosphotyrosine signaling networks

    DEFF Research Database (Denmark)

    Hammond, Dean E; Hyde, Russell; Kratchmarova, Irina

    2010-01-01

    549 lung adenocarcinoma cells with EGF or HGF. In total, we obtained quantitative information for 274 proteins, which respond to either or both stimuli by >1.5 fold changes in enrichment, following immuno-precipitation with antiphosphotyrosine antibodies. The data reveal a high degree of overlap...

  1. Beckova škála deprese BDI-II - standardizace a využití v praxi

    Czech Academy of Sciences Publication Activity Database

    Ptáček, R.; Raboch, J.; Vňuková, M.; Hlinka, Jaroslav; Anders, M.

    2016-01-01

    Roč. 112, č. 6 (2016), s. 270-274 ISSN 1212-0383 Grant - others:1 LF(CZ) PRVOUK Institutional support: RVO:67985807 Keywords : BDI-II * depression * standards * validity * reliability Subject RIV: FL - Psychiatry, Sexuology OBOR OECD: Psychiatry http://www.cspsychiatr.cz/detail.php?stat=1121

  2. Precise, contactless measurements of the surface tension of picolitre aerosol droplets

    Czech Academy of Sciences Publication Activity Database

    Bzdek, B. R.; Power, R. M.; Simpson, Stephen Hugh; Reid, J. P.; Royall, C. P.

    2016-01-01

    Roč. 7, č. 1 (2016), s. 274-285 ISSN 2041-6520 R&D Projects: GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : hygroscopicity model framework * organic-compounds * inorganic-compounds Subject RIV: BH - Optics, Masers, Lasers Impact factor: 8.668, year: 2016

  3. Attachment Style, Social Support, and Coping as Psychosocial Correlates of Happiness in Persons with Spinal Cord Injuries

    Science.gov (United States)

    Wilson, Lisa; Catalano, Denise; Sung, Connie; Phillips, Brian; Chou, Chih-Chin; Chan, Jacob Yui Chung; Chan, Fong

    2013-01-01

    Objective: To examine the roles of attachment, social support, and coping as psychosocial correlates in predicting happiness in people with spinal cord injuries. Design: Quantitative descriptive research design using multiple regression and correlation techniques. Participants: 274 individuals with spinal cord injuries. Outcome Measures: Happiness…

  4. Modus operandi onderzoek naar door informatie en communicatie technologie (ICT) gefaciliteerde criminaliteit

    NARCIS (Netherlands)

    Junger, Marianne; Montoya, L.; Hartel, Pieter H.; Karemaker, M.

    Dit onderzoek beschrijft de invloed van ICT op de 'traditionele' misdrijven door te onderzoeken hoe delicten als inbraak, overvallen en fraude doordrongen zijn van ICT. In totaal zijn 136 woninginbraken, 140 commerciële inbraken, 259 bedreigingen en 274 fraudeza-ken onderzocht. Uit de resultaten

  5. Německé podnikání Baťova koncernu. Studie k hospodářským a sociálním dějinám hornoslezského továrního města Ottmuth (Otmęt)

    Czech Academy of Sciences Publication Activity Database

    Jemelka, M.; Ševeček, Ondřej

    2013-01-01

    Roč. 111, č. 2 (2013), s. 237-274 ISSN 0037-6833 R&D Projects: GA ČR(CZ) GAP410/10/1995 Institutional support: RVO:67985955 Keywords : Baťa concern * Upper Silesia * Ottmuth (Otmęt) * shoe Industry Subject RIV: AB - History

  6. Victimization and Suicidality Among Dutch Lesbian, Gay, and Bisexual Youths

    NARCIS (Netherlands)

    van Bergen, Diana; Bos, Henny M.W.; van Lisdonk, jantine; Keuzenkamp, S; Sandfort, T.G.M

    2013-01-01

    We examined Netherlands Institute for Social Research data, collected between May and August 2009, on 274 Dutch lesbian, gay, and bisexual youths. The data showed that victimization at school was associated with suicidal ideation and actual suicide attempts. Homophobic rejection by parents was also

  7. Associations between pathogen-specific clinical mastitis and somatic cell count patterns

    NARCIS (Netherlands)

    Haas, de Y.; Veerkamp, R.F.; Barkema, H.W.; Gröhn, Y.T.; Schukken, Y.H.

    2004-01-01

    Associations were estimated between pathogen-specific cases of clinical mastitis (CM) and somatic cell count (SCC) patterns based on deviations from the typical curve for SCC during lactation and compared with associations between pathogen-specific CM and lactation average SCC. Data from 274 Dutch

  8. Victimization and suicidality among Dutch lesbian, gay, and bisexual youths

    NARCIS (Netherlands)

    van Bergen, D.D.; Bos, H.M.W.; van Lisdonk, J.; Keuzenkamp, S.; Sandfort, T.G.M.

    2013-01-01

    We examined Netherlands Institute for Social Research data, collected between May and August 2009, on 274 Dutch lesbian, gay, and bisexual youths. The data showed that victimization at school was associated with suicidal ideation and actual suicide attempts. Homophobic rejection by parents was also

  9. Victimization and suicidality among Dutch lesbian, gay and bisexual youths

    NARCIS (Netherlands)

    van Bergen, D.D.; Bos, H.M.W.; van Lisdonk, J.; Keuzenkamp, S.; Sandfort, T.G.M.

    2013-01-01

    We examined Netherlands Institute for Social Research data, collected between May and August 2009, on 274 Dutch lesbian, gay, and bisexual youths. The data showed that victimization at school was associated with suicidal ideation and actual suicide attempts. Homophobic rejection by parents was also

  10. On aNew Kind of Rays

    Indian Academy of Sciences (India)

    than glass free from lead. Ebonite several ... The English Translation of his German speech was also published in Nature, 53, 274, 1896, ... From these values it is clear that in no case can we obtain the transparency of a body from the product ...

  11. Regional unemployment and human capital in transition economies

    Czech Academy of Sciences Publication Activity Database

    Jurajda, Štěpán; Terrell, K.

    2009-01-01

    Roč. 17, č. 2 (2009), s. 241-274 ISSN 0967-0750 R&D Projects: GA MŠk LC542 Institutional research plan: CEZ:AV0Z70850503 Keywords : unemployment * human capital * regional labour markets Subject RIV: AH - Economics Impact factor: 0.774, year: 2009

  12. 75 FR 14227 - Self-Regulatory Organizations; The NASDAQ Stock Market LLC; Order Approving Proposed Rule Change...

    Science.gov (United States)

    2010-03-24

    ... Commission has considered the proposed rule's impact on efficiency, competition, and capital formation. See... its rules governing NOM, the Securities Industry and Financial Markets Association (``SIFMA... security.''). See also Newton v. Merrill, Lynch, Pierce, Fenner & Smith, Inc., 135 F.3d 266, at 271, 274...

  13. Inferentializing Semantics

    Czech Academy of Sciences Publication Activity Database

    Peregrin, Jaroslav

    2010-01-01

    Roč. 39, č. 3 (2010), s. 255-274 ISSN 0022-3611 R&D Projects: GA ČR(CZ) GA401/07/0904 Institutional research plan: CEZ:AV0Z90090514 Keywords : inference * proof theory * model theory * inferentialism * semantics Subject RIV: AA - Philosophy ; Religion

  14. Genetic control of plasticity in root morphology and anatomy of rice in response to water deficit

    NARCIS (Netherlands)

    Kadam, Niteen N.; Tamilselvan, Anandhan; Lawas, Lovely M.F.; Quinones, Cherryl; Bahuguna, Rajeev N.; Thomson, Michael J.; Dingkuhn, Michael; Muthurajan, Raveendran; Struik, Paul C.; Yin, Xinyou; Jagadish, Krishna S.V.

    2017-01-01

    Elucidating the genetic control of rooting behavior under water-deficit stress is essential to breed climate-robust rice (Oryza sativa) cultivars. Using a diverse panel of 274 indica genotypes grown under control and water-deficit conditions during vegetative growth, we phenotyped 35 traits, mostly

  15. Interaction of Silver Nanopowder with Cooper Substrate

    Czech Academy of Sciences Publication Activity Database

    Sopoušek, J.; Buršík, Jiří; Zálešák, J.; Buršíková, V.; Brož, P.

    2011-01-01

    Roč. 43, - (2011), s. 33-38 ISSN 0350-820X R&D Projects: GA ČR(CZ) GA106/09/0700 Institutional research plan: CEZ:AV0Z20410507 Keywords : silver * copper * sintering Subject RIV: JG - Metallurgy Impact factor: 0.274, year: 2011

  16. Morphometric and molecular characterization of Parapharyngodon echinatus (Nematoda, Pharyngodonidae) from the Senegal gecko ( Tarentola parvicarinata )

    Czech Academy of Sciences Publication Activity Database

    Mašová, Š.; Baruš, Vlastimil; Hodová, I.; Matějusová, I.; Koubek, Petr; Koubková, B.

    2008-01-01

    Roč. 53, č. 3 (2008), s. 274-283 ISSN 1230-2821 R&D Projects: GA AV ČR IAA6093404 Institutional research plan: CEZ:AV0Z60930519 Keywords : Nematoda * Senegal gecko * West Africa Subject RIV: EG - Zoology Impact factor: 0.748, year: 2008

  17. Nuclear structure studies towards superheavy elements and perspectives with AGATA

    International Nuclear Information System (INIS)

    Korichi, A.

    2005-01-01

    A variety of theoretical approaches have been used to calculate the shell closure of spherical Super Heavy Elements (SHE) but the predictions of the location of the 'island of stability' vary from Z=114 to 120 and 126, with neutron numbers around N=172 or N=184 depending on the model employed. A deformed minimum around Z=108 and N=162 is predicted and an increase of the half-life of Hassium (Z=108) is experimentally observed when approaching the neutron number N=162. Super heavy nuclei are produced with very low cross-section (a few picobarns) and this makes their spectroscopic study impossible with today's beam intensities and detectors. However, important information can be obtained from the structure of mid-shell deformed nuclei (Z∼104) where selected single particle orbitals, which lie close to the spherical shell gap in SHE, are close to the Fermi level. The information will come from decay and in-beam spectroscopy. A promising area of progress, using the state-of-the art instruments, is represented by the observation of rotational gamma-ray transitions in No and Fm isotopes showing the deformed character of these nuclei. One of the objectives and focus of the nuclear structure community is related to the investigation of Single particle excitations beyond the N=152 neutron gap and collective properties of heavier systems towards Z∼104. The IN2P3-JINR collaboration has launched a project of electron and gamma-ray spectroscopy studies of heavy nuclei at the FLNR. This project benefits from the radioactive actinide targets uniquely available at Dubna and from the very intense stable beams provided by the U400 cyclotron. This offers a unique opportunity for the study of nuclei above Z=100 along an isotopic chain approaching N=162. In this contribution, the emphasis will be on the GABRIELA project and its issues. I will finally point out the perspectives with the new generation of gamma detectors such as AGATA

  18. Role of traditions in tourism development in the Czech part of the Bohemian Forest

    Czech Academy of Sciences Publication Activity Database

    Kušová, Drahomíra; Těšitel, Jan; Bartoš, Michael

    2002-01-01

    Roč. 8, - (2002), s. 265-274 ISSN 1211-7420 Grant - others:GA-(EU) QLK5-CT-2000-01211-SPRITE; 960 72(US) RSS 358/1999 Institutional research plan: CEZ:AV0Z3042911 Keywords : rural tourism * Šumava Mts. region * traditions Subject RIV: AO - Sociology, Demography

  19. Prostorová paměť, navigace a mozkové mapy.

    Czech Academy of Sciences Publication Activity Database

    Stuchlík, Aleš

    2017-01-01

    Roč. 96, č. 5 (2017), s. 274-276 ISSN 0042-4544 R&D Projects: GA ČR(CZ) GA17-04047S; GA ČR NV17-30833A Institutional support: RVO:67985823 Keywords : memory * behavior * orientation Subject RIV: FH - Neurology OBOR OECD: Neurosciences (including psychophysiology

  20. Untitled

    African Journals Online (AJOL)

    hypermobility of the urethra and intrinsic sphincter deficiency (ISD).1°'“ The main indication for TVT and ... posterior colporrhaphy and Burch colposuspension. (N: 29; 27.4%). ' Burch colposuspension (N = 16; ... tape (2 and 1, respectively), and posterior colporrhaphy. (1 and 0, respectively), sacrocolpopexy for prolapse.

  1. 41 CFR 101-27.406 - Disposition of stock.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Disposition of stock. 101-27.406 Section 101-27.406 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 27-INVENTORY MANAGEMENT 27.4...

  2. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. ZAKI ABU RABI. Articles written in Journal of Biosciences. Volume 42 Issue 2 June 2017 pp 265-274 Article. Interleukin 8 in progression of hormone-dependent early breast cancer · JELENA MILOVANOVIĆ NATAŠA TODOROVIĆ-RAKOVIĆ TIJANA VUJASINOVIĆ ZAKI ABU RABI.

  3. Do Physical and Relational Aggression Explain Adolescents' Friendship Selection? The Competing Roles of Network Characteristics, Gender, and Social Status

    NARCIS (Netherlands)

    Dijkstra, Jan Kornelis; Berger, Christian; Lindenberg, Siegwart

    2011-01-01

    The role of physical and relational aggression in adolescents' friendship selection was examined in a longitudinal sample of 274 Chilean students from 5th and 6th grade followed over 1 year. Longitudinal social network modeling (SIENA) was used to study selection processes for aggression while

  4. Early Medieval gombiky from the “Lumbe Garden” cemetery, Prague Castle

    Czech Academy of Sciences Publication Activity Database

    Ottenwelter, Estelle; Děd, J.; Barčáková, Ludmila

    2017-01-01

    Roč. 32, 7-8 (2017), s. 836-849 ISSN 1042-6914 R&D Projects: GA ČR GAP405/12/2195 Institutional support: RVO:67985912 Keywords : gombiky * Bohemia * jewels * manufacture Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Archaeology Impact factor: 2.274, year: 2016

  5. 76 FR 28823 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2011-05-18

    ..., depositary, management personnel, compensation, and financial statements. The Commission uses the information... Copies Available From: Securities and Exchange Commission, Office of Investor Education and Advocacy... information discussed below. Form N-8B-4 (17 CFR 274.14) is the form used by face-amount certificate companies...

  6. Effect of genetic and coexisting polymorphisms on platelet response ...

    Indian Academy of Sciences (India)

    analysis was performed adjusting for confounding factors: age, gender, body ... 65 (71.4). 55 (57.9). 17 (60.7). 0.1470. Diabetes. 69 (31.1). 1 (20.0). 32 (35.2). 26 (27.4). 10 (35.7) ..... a systematic review and meta-analysis. Thromb. Res. 135 ...

  7. Attacks by “Anonymous‿ WikiLeaks Proponents not Anonymous

    NARCIS (Netherlands)

    Pras, Aiko; Sperotto, Anna; Moreira Moura, Giovane; Drago, Idilio; Barbosa, R.R.R.; Sadre, R.; de Oliveira Schmidt, R.; Hofstede, R.J.; Hofstede, Rick

    2010-01-01

    On November 28, 2010, the world started watching the whistle blower website WikiLeaks to begin publishing part of the 250,000 US Embassy Diplomatic cables. These confidential cables provide an insight on U.S. international affairs from 274 different embassies, covering topics such as analysis of

  8. Feeling hopeful inspires support for social change

    NARCIS (Netherlands)

    Greenaway, Katharine H.; Cichocka, Aleksandra; van Veelen, Ruth; Likki, Tiina; Branscombe, Nyla R.

    2014-01-01

    Hope is an emotion that has been implicated in social change efforts, yet little research has examined whether feeling hopeful actually motivates support for social change. Study 1 (N = 274) confirmed that hope is associated with greater support for social change in two countries with different

  9. Temperature, salinity and transmissivity data from the Alpha Helix in the Arctic Ocean, 2000 - 2004 (NODC Accession 0059005)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This is calibrated CTD downcast data from five Alpha Helix cruises: HX235, 8/1/2000 - 9/30/2000 HX250, 9/1/2001 - 9/30/2001 HX260, 6/1/2002 - 6/30/2002 HX274,...

  10. Nikkaji Dictionary: バラニマイシン [MeCab user dictionary for science technology term[Archive

    Lifescience Database Archive (English)

    Full Text Available MeCab user dictionary for science technology term バラニマイシン 名詞 一般 * * * * バラニマイシン ... Nikkaji J126.274B 200906073537358452 C CA06 UNKNOWN_1 バラニマイシン

  11. Evaluation of the innate immune response of Angus heifers with genetic marker variation for intramuscular fat deposition following a lipopolysaccharide challenge

    Science.gov (United States)

    This study evaluated the effect of genetic selection for markers related to marbling deposition in Angus heifers on the immune response following a lipopolysaccharide (LPS) challenge. Fall-born heifers (n = 19; ~7 months of age, 274 +/- 24 kg) with genetic variation for marbling were utilized inclu...

  12. Resensi Buku: Organization Strategy, Structure, and Process

    Directory of Open Access Journals (Sweden)

    Ayi Ahadiyat

    2009-08-01

    Full Text Available Book ReviewJudul Buku    : Organization Strategy, Structure, and ProcessPenulis    : Raymond E. Miles and Charles C. SnowPenerbit     : McGraw-Hill Kogakusha, Ltd (International Student Edition, Tokyo,  274 hlm.Tahun    : 1978

  13. Temporal variation of trace elements in waters polluted by municipal solid waste landfill leachate

    Czech Academy of Sciences Publication Activity Database

    Ettler, V.; Mihaljevič, M.; Matura, M.; Skalková, M.; Šebek, O.; Bezdička, Petr

    2008-01-01

    Roč. 80, č. 3 (2008), s. 274-279 ISSN 0007-4861 R&D Projects: GA AV ČR KJB3111402 Institutional research plan: CEZ:AV0Z40320502 Keywords : trace elements * landfill leachate * temporal variation Subject RIV: DD - Geochemistry Impact factor: 0.609, year: 2008

  14. Gould's belt and beyond, comparing models with observations

    Czech Academy of Sciences Publication Activity Database

    Palouš, Jan

    2001-01-01

    Roč. 276, - (2001), s. 359-365 ISSN 0004-640X R&D Projects: GA AV ČR KSK1003601 Institutional research plan: CEZ:AV0Z1003909 Keywords : stars * formation * kinematics * galaxy Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 0.274, year: 2001

  15. Metallographic examination and reconstruction of the 6th century lombardic sword from Kyjov

    Czech Academy of Sciences Publication Activity Database

    Hošek, Jiří; Bárta, P.; Šmerda, J.

    2017-01-01

    Roč. 32, 7-8 (2017), s. 885-899 ISSN 1042-6914 R&D Projects: GA ČR GAP405/12/2289 Institutional support: RVO:67985912 Keywords : sword * Kyjov * metallography * Lombards Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Archaeology Impact factor: 2.274, year: 2016

  16. 77 FR 30998 - Information Collection Requirement; Defense Federal Acquisition Regulation Supplement; Government...

    Science.gov (United States)

    2012-05-24

    ..., Government Property, DFARS section 211.274, Reporting of Government-Furnished Equipment in the DoD Item... surplus Government property. Under paragraph (b), a contractor may be directed by the plant clearance... plant clearance officer to purchase or retain Government property at less than cost if the plant...

  17. Fathering and Attachment in the USA and Taiwan: Contextual Predictors and Child Outcomes

    Science.gov (United States)

    Newland, Lisa A.; Coyl, Diana D.; Chen, Hui-Hua

    2010-01-01

    This study examined connections between fathering context (stress, social support, and fathers' internal working models), fathering dimensions, children's attachment to fathers, and children's social-emotional and academic outcomes within two culturally diverse samples in the USA and Taiwan. Participants included 274 fathers and their eight- to…

  18. A constructive approach to boundary value problems with state-dependent impulses

    Czech Academy of Sciences Publication Activity Database

    Rachůnková, I.; Rachůnek, L.; Rontó, András; Rontó, M.

    2016-01-01

    Roč. 274, February (2016), s. 726-744 ISSN 0096-3003 Institutional support: RVO:67985840 Keywords : non-linear system of differential equation * impulse effect * parameterization * successive approximations Subject RIV: BA - General Mathematics Impact factor: 1.738, year: 2016 http://www.sciencedirect.com/science/article/pii/S0096300315015234

  19. Cyber Infrastructure Protection

    Science.gov (United States)

    2011-05-01

    274 TOWARD A SOLUTION THAT WORKS Building on our long history of involvement in assuring all types of communications networks, Tel- cordia has...wireless, and security areas. He currently has responsibility for a new Tel- cordia software product in IP network management, and has led all product

  20. 28 CFR 68.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... BEFORE ADMINISTRATIVE LAW JUDGES IN CASES INVOLVING ALLEGATIONS OF UNLAWFUL EMPLOYMENT OF ALIENS, UNFAIR... law by an Administrative Law Judge or the Chief Administrative Hearing Officer; Document fraud cases...; Final agency order is an Administrative Law Judge's final order, in cases arising under sections 274A...

  1. A Review of Breast Calcifications on Mammography in a Tertiary ...

    African Journals Online (AJOL)

    Biopsies were performed where indicated and histology results were compared with radiological findings. Data was analyzed using the Epi-info statistical software. Results Out of the 248 patients assessed, the predominant presenting symptoms were breast pain (30.2%) and breast lump (27.4%). While assessing the ...

  2. Blood pressure and anthropometric measurements in healthy ...

    African Journals Online (AJOL)

    Methods. We measured the blood pressures of 650 healthy, randomly ... In addition, blood pressure measurement should be a part of the routine clinical examination of children. ... familial risk factors.2 ... common cause of elevated blood pressure in children.4 They ... sphygmomanometer (Accoson, hospital model BS 274,.

  3. Psychosocial and Psychophysiological Strain in Extended Spaceflight Simulation

    Czech Academy of Sciences Publication Activity Database

    Šolcová, Iva

    2004-01-01

    Roč. 46, č. 3 (2004), s. 179-186 ISSN 0039-3320 R&D Projects: GA ČR GA406/03/1168 Institutional research plan: CEZ:AV0Z7025918 Keywords : spaceflight simulation * enforced confinement * psychosocial burden Subject RIV: AN - Psychology Impact factor: 0.274, year: 2004

  4. The Muslim Brotherhood and the Perception of Democracy

    Science.gov (United States)

    2012-12-01

    encompasses several genres of literature, such as autobiography, poetry, literary criticism, religiously inspired analytical work and, last but not least...to do with Christians is quickly turned into a cause for jihad.”274 Recent protests over a independent movie filmed in the United States that

  5. Disease: H00648 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available Med Genet A 149A:2003-13 (2009) DOI:10.1002/ajmg.a.32804 ... PMID:8741874 (description) ... AUTHORS ... Hassed SJ,...indings. ... JOURNAL ... Am J Med Genet 61:274-6 (1996) DOI:10.1002/(SICI)1096-8628(19960122)61:3 3.0.CO;2-Q ...

  6. Using brothel leadership to promote condom use among brothel-based female sex workers in Abuja, Nigeria : study protocol for a cluster randomized pilot trial

    NARCIS (Netherlands)

    Okafor, Uchenna; Crutzen, Rik; Okekearu, Ifeanyi; Adebajo, Sylvia; Uzoh, Adaora; Awo, Egbe Aneotah; Chima, Chukwuemeka; Agwagwa, Ogechukwu; Van Den Borne, Bart

    2017-01-01

    Background The HIV prevalence among female populations involved in sex work in Nigeria has heightened interest in HIV prevention programming for this sub-population with brothel-based female sex workers (BB FSWs) having a prevalence of 27.4%, six times higher than the prevalence in the general

  7. Intimate Partner Violence: What Health Care Providers Need to Know

    Science.gov (United States)

    2012-06-28

    and Infant Health Assessment, California Department of Health Services, Maternal, Child and Adolescent Health/Office of Family Planning Branch, 2004...reduce risk associated with reproductive coercion. Contraception . 2011 Mar;83(3):274-80.  O’Campo P, Kirst M, Tsamis C, Chambers C, Ahmad F

  8. Genetic and Epigenetic Biomarkers for Recurrent Prostate Cancer After Radiotherapy

    Science.gov (United States)

    2015-07-01

    several distinct advantages over surgical treatment, such as no complications from surgery, and a low risk of urinary incontinence , RT treatment takes...Khorana, Tissue factor and VEGF expression in prostate carcinoma: a tissue microarray study. Cancer Invest, 2009. 27(4): p. 430-4. 7. Crawford, E.D

  9. 78 FR 76067 - Defense Federal Acquisition Regulation Supplement: Item Unique Identifier Update (DFARS Case 2011...

    Science.gov (United States)

    2013-12-16

    ... emphasizes the importance of quantifying both costs and benefits, of reducing costs, of harmonizing rules...) Ensures item level traceability throughout lifecycle to strengthen supply chain integrity, enhance cyber security, and combat counterfeiting. 0 3. Section 211.274-2 is amended by-- 0 a. Revising the section...

  10. Capillary electrophoresis in an extended nanospray tip-electrospray as an electrophoretic column

    Czech Academy of Sciences Publication Activity Database

    Týčová, Anna; Foret, František

    2015-01-01

    Roč. 1388, APR (2015), s. 274-279 ISSN 0021-9673 R&D Projects: GA ČR(CZ) GBP206/12/G014 Institutional support: RVO:68081715 Keywords : mass spectrometry * interface * separation * capillary electrophoresis Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 3.926, year: 2015

  11. An Analysis of the Relationship between Organizational Communication and Organizational Cynicism According to Teachers' Perceptions in Turkey

    Science.gov (United States)

    Ayik, Ahmet

    2015-01-01

    In this study, the relations between organizational communication and organizational cynicism have been analyzed. The sample of the study consists of 274 teachers working in state secondary schools in Palandöken County of Erzurum, in 2013-2014 academic year. "Organizational Cynicism Scale" and "Organizational Communication…

  12. Placení záloh je bariérou v podnikání matek po rodičovské

    Czech Academy of Sciences Publication Activity Database

    Křížková, Alena

    2016-01-01

    Roč. 12, č. 1 (2016) ISSN 1802-7202 Grant - others:Norway Grants(NO) 274 Institutional support: RVO:68378025 Keywords : mothers after parental leave * entrepreneurship context Subject RIV: AO - Sociology, Demography http://zpravodaj.genderstudies.cz/cz/clanek/placeni-zaloh-je-barierou-v-podnikani-matek-po-rodicovske

  13. Birth preparedness and complication readiness among prenatal attendees in a teaching hospital in South West Nigeria.

    Science.gov (United States)

    Aduloju, Olusola P; Akintayo, Akinyemi A; Aduloju, Tolulope; Akin-Akintayo, Oladunni O

    2017-11-01

    To assess birth preparedness and complication readiness (BPCR) as well as knowledge of danger signs during pregnancy, labor/delivery, and the postpartum period. A cross-sectional study was undertaken of pregnant women attending the prenatal clinic at a tertiary hospital in Nigeria between October and December 2016. A pretested and structured questionnaire was used to collect data on BPCR, and logistic regression was performed to determine factors affecting BPCR. Of 325 participants, 274 (84.3%) had knowledge of BPCR components, and 265 (81.5%) were well prepared for birth and its complications. However, only 89 (27.4%) knew key danger signs during labor/delivery and 81 (24.9%) knew those in the first 2 days after delivery. Older age, higher parity, tertiary education of women, paid employment of women and their spouses, higher social class, frequent prenatal visits, and knowledge of danger signs were significantly associated with BPCR (Pteaching pregnant women to recognize key danger signs. © 2017 International Federation of Gynecology and Obstetrics.

  14. Quantum chaos on discrete graphs

    International Nuclear Information System (INIS)

    Smilansky, Uzy

    2007-01-01

    Adapting a method developed for the study of quantum chaos on quantum (metric) graphs (Kottos and Smilansky 1997 Phys. Rev. Lett. 79 4794, Kottos and Smilansky 1999 Ann. Phys., NY 274 76), spectral ζ functions and trace formulae for discrete Laplacians on graphs are derived. This is achieved by expressing the spectral secular equation in terms of the periodic orbits of the graph and obtaining functions which belong to the class of ζ functions proposed originally by Ihara (1966 J. Mat. Soc. Japan 18 219) and expanded by subsequent authors (Stark and Terras 1996 Adv. Math. 121 124, Kotani and Sunada 2000 J. Math. Sci. Univ. Tokyo 7 7). Finally, a model of 'classical dynamics' on the discrete graph is proposed. It is analogous to the corresponding classical dynamics derived for quantum graphs (Kottos and Smilansky 1997 Phys. Rev. Lett. 79 4794, Kottos and Smilansky 1999 Ann. Phys., NY 274 76). (fast track communication)

  15. Early-onset ocular ochronosis in a girl with alkaptonuria (AKU) and a novel mutation in homogentisate 1,2-dioxygenase (HGD).

    Science.gov (United States)

    Gucev, Z S; Slaveska, N; Laban, N; Danilovski, D; Tasic, V; Pop-Jordanova, N; Zatkova, A

    2011-01-01

    Alkaptonuria (AKU) is a disorder of phenylalanine/tyrosine metabolism due to a defect in the enzyme homogentisate 1,2-dioxygenase (HGD). This recessive disease is caused by mutations in the HGD gene. We report a 14-year-old girl who was referred after presenting black urine. Careful examination revealed ochronosis of the conjunctiva. There was no affection of the cardiac valves. Elevated excretion of homogentisic acid in urine was found. Sequence analysis of the HGD gene from genomic DNA revealed that the patient is a compound heterozygote with a previously described mutation (c.473C>T, p.Pro158Leu), and a novel one (c.821C>T, p.Pro274Leu). Her mother is heterozygous for the novel mutation, while the brother is heterozygous for the previously described mutation. In summary, we describe an alkaptonuric patient with ocular ochronosis and a novel HGD mutation, c.821C>T, p.Pro274Leu.

  16. NRAMP1 and VDR gene polymorphisms in susceptibility to pulmonary tuberculosis among Andhra Pradesh population in India: a case-control study.

    Science.gov (United States)

    Medapati, Rooth Vasantha; Suvvari, Sridevi; Godi, Sudhakar; Gangisetti, Paddaiah

    2017-06-05

    The aim of the present study was to evaluate the association of NRAMP1 -3'UTR, 274-CT,VDR- Fok1 VDR-Taq1 Polymorphisms with the risk of pulmonary tuberculosis. A case -control study was conducted on Andhra Pradesh Population of India. Analysis of gene polymorphisms of NRAMP1 gene (3'UTR, 274CT) and VDR gene (Fok1 and Taq1) was done by using Polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP) in Tuberculosis (TB) patients and healthy controls. The obtained results were observed using 2% Agarose Gel electrophoresis and analysed statistically using Chi-square test and Odds Ratio. Statistical significance was observed between the patients and the controls in the NRAMP1-3'UTR (P = 0.005; OR = 2.997; 95% CI = 1.019-8.813) and VDR-Taq1 (P  0.05). 3'UTR-NRAMP1 gene and VDR-Taq1 gene Polymorphisms are statistically associated with the susceptibility of TB in Andhra Pradesh Population in India.

  17. Occupational exposure in prostate permanent implants with I-125 seeds

    Energy Technology Data Exchange (ETDEWEB)

    Fdez Garcia, J.; Luna, V.; Sancho, J. M. g.; Martinez, J.; Galiano, P. S.; Jimenez, I.; Prada, P.; Juan, G.; Vivanco, J.

    2002-07-01

    Prostate brachytherapy is one of the techniques increasing faster in the environment of the radiotherapy and will probably go on increasing in the future. There are two forms in their use; by means of remote afterloading high dose rate (HDR) with Ir-192 radioactive sources or by means of permanent implant by manual/automatic afterloading of low dose rate (LDR) with seeds of I-125 or Pd-103. Iodine-125 has a half life of 59.4 days and it decays by electron capture with emissions of characteristic photons and electrons. The electrons are absorbed by the titanium wall of the I-125 seed. The principal photon emissions are 27.4 and 31.4 keV X-rays and a 35.5 keV gamma ray. Besides 22.1 and 25.2 keV fluorescent X-rays are also emitted resulting from interactions of the iodine-125 photons with the silver rod. The resulting average photon energy is approximately 27.4 keV. (Author)

  18. Corrigendum to “Geometric Arveson–Douglas conjecture” [Adv. Math. 274 (2015) 606–630

    Czech Academy of Sciences Publication Activity Database

    Engliš, Miroslav; Eschmeier, J.

    2015-01-01

    Roč. 278, June (2015), s. 254 ISSN 0001-8708 Institutional support: RVO:67985840 Keywords : Arveson- Douglas conjecture * generalized Toeplitz operator Subject RIV: BA - General Mathematics Impact factor: 1.405, year: 2015 http://www.sciencedirect.com/science/article/pii/S000187081500119X

  19. 33 CFR Appendix A to Part 274 - Preventive Safety Measures in Handling of Pesticides

    Science.gov (United States)

    2010-07-01

    ... wearing. Special care is required to prevent contamination of the inside of gloves. 9. Approved... containers should be disposed of by breaking. Chop holes in top, bottom, and sides of metal containers or...

  20. 47 CFR 25.274 - Procedures to be followed in the event of harmful interference.

    Science.gov (United States)

    2010-10-01

    ... records shall be made available to an FCC representative on request. (d) Where the suspected source of the... the operations of another earth station shall take reasonable measures to determine whether its... station are the source of the interference, the licensee of that earth station shall take all measures...

  1. File list: NoD.Neu.05.AllAg.Brain [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available NoD.Neu.05.AllAg.Brain mm9 No description Neural Brain ERX161927,ERX161926,ERX16192...274,SRX298040,ERX402277,ERX402292,ERX402281 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/NoD.Neu.05.AllAg.Brain.bed ...

  2. Variation in working effort in Danish Little Owls Athene noctua

    DEFF Research Database (Denmark)

    Holsegård-Rasmussen, Miriam H.; Sunde, Peter; Thorup, K.

    2009-01-01

    with extinction. The study is based on 143 one-hour surveys of breeding and 274 surveys of non-breeding Little Owls (27 territorial individuals on 14 territories). Working effort is calculated as the total linear distance between all observed consecutive telemetry fixes during one-hour surveys (Minimum Flight...

  3. Estimating Cost and Quality Implications of an Online Solution for the Army ROTC Military History Requirement

    Science.gov (United States)

    2010-06-11

    some campuses. At some schools, the global economic downturn has resulted in a reduction of both the number of courses and sections offered at...International Journal on ELearning 5, no. 2: 265-274. 77 Welsh, Elizabeth T., Connie R. Wanberg, Kenneth G. Brown, and Marcia J. Simmering. 2003. E

  4. Modelling of Effects of Operating Conditions and Coal Reactivity on Temperature of Burning Particles in Fluidized Bed Combustion

    Czech Academy of Sciences Publication Activity Database

    Svoboda, Karel; Hartman, Miloslav; Pohořelý, Michael; Trnka, Otakar

    2004-01-01

    Roč. 1, č. 2 (2004), s. 261-274 ISSN 1211-1910 R&D Projects: GA AV ČR IAA4072201; GA AV ČR IAA4072001 Institutional research plan: CEZ:AV0Z4072921 Keywords : fluidized bed combustion * char temperature * modelling Subject RIV: DI - Air Pollution ; Quality

  5. Utilization of MRI for Cerebral White Matter Injury in a Hypobaric Swine Model-Validation of Technique

    Science.gov (United States)

    2017-05-23

    fractional anisotropy on white matter integrity assessment and application in schizophrenia . Neuroimage Clin 2013; 3: 18–26. 26. Kluytmans M, van der Grond J...Heterogeneity of brain lesions in pediatric traumatic brain injury. Neuropsychology 2013; 27(4): 438–51. 36. Fazekas F, Kleinert R, Offenbacher H, et

  6. Community Based Health Insurance Schemes and Protection of the ...

    African Journals Online (AJOL)

    The objectives of this study are two folds: firstly to explore the magnitude of catastrophic expenditure, and secondly to determine its contributing factor,s including the protective impact of the voluntary community based health insurance schemes in Tanzania. The study covered 274 respondents. Study findings have shown ...

  7. Compositional Analysis and Antioxidant Activity of Volatile ...

    African Journals Online (AJOL)

    Compositional Analysis and Antioxidant Activity of Volatile. Components of Two Salvia spp. F Forouzin*, R Jamei and R Heidari. Department of Biology, Faculty of Science, Urmia University, West Azerbaijan, Iran. *For correspondence: Email: f_forouzin@yahoo.com, rjamei274@gmail.com, r.heidari@mail.urmia.ac.ir; Tel: ...

  8. Avipoxvirus infection in wild birds: new findings from Slovakia and Poland

    Czech Academy of Sciences Publication Activity Database

    Literák, I.; Halouzka, R.; Hromádko, M.; Honza, Marcel; Pinowska, B.; Haman, A.

    2001-01-01

    Roč. 70, č. 3 (2001), s. 339-344 ISSN 0001-7213 Institutional research plan: CEZ:MSM 161700001 Keywords : cutaneous lesion Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.274, year: 2001 http://vfu-www.vfu.cz/acta-vet/vol70/pdf/70_339.pdf

  9. Larvae of trombiculid mites (Acarina: Trombiculidae) in wild birds in Slovak and Polish Carpathians

    Czech Academy of Sciences Publication Activity Database

    Literák, I.; Honza, Marcel; Pinowska, B.; Haman, A.

    2001-01-01

    Roč. 70, č. 4 (2001), s. 479-483 ISSN 0001-7213 Institutional research plan: CEZ:MSM 161700001 Keywords : Passerines * parasites * Trombiculidae Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.274, year: 2001 http://vfu-www.vfu.cz/acta-vet/vol70/pdf/70_479.pdf

  10. The influence of prior knowledge on the retrieval-directed function of note taking in prior knowledge activation

    NARCIS (Netherlands)

    Wetzels, Sandra; Kester, Liesbeth; Van Merriënboer, Jeroen; Broers, Nick

    2010-01-01

    Wetzels, S. A. J., Kester, L., Van Merriënboer, J. J. G., & Broers, N. J. (2011). The influence of prior knowledge on the retrieval-directed function of note taking in prior knowledge activation. British Journal of Educational Psychology, 81(2), 274-291. doi: 10.1348/000709910X517425

  11. 76 FR 13536 - Airworthiness Directives; Bombardier, Inc. Model CL-600-2C10 (Regional Jet Series 700, 701, & 702...

    Science.gov (United States)

    2011-03-14

    ...., Monday through Friday, except Federal holidays. For service information identified in this proposed AD...., Monday through Friday, except Federal holidays. The AD docket contains this proposed AD, the regulatory..., 135, 139, 142, 145, 146, 266, 268, 271, 274, 276, 277, 280, 282 through 285 inclusive, 290, 292, 294...

  12. Photo-production of neutral kaons on C-12 in the threshold region

    Czech Academy of Sciences Publication Activity Database

    Watanabe, T.; Bydžovský, Petr; Dobashi, K.; Endo, S.; Fujii, Y.; Hashimoto, O.; Ishikawa, T.; Itoh, K.; Kanda, H.

    2007-01-01

    Roč. 651, č. 4 (2007), s. 269-274 ISSN 0370-2693 R&D Projects: GA ČR GA202/05/2142 Institutional research plan: CEZ:AV0Z10480505 Keywords : photo-production * neutral kaon * quasi-free reaction Subject RIV: BE - Theoretical Physics Impact factor: 4.189, year: 2007

  13. Industrialization and Household Complexity in Rural Taiwan.

    Science.gov (United States)

    Lavely, William

    1990-01-01

    In 274 Taiwanese townships, farm household complexity in 1960 and 1970 was positively related to the proportion of the labor force in nonagricultural occupations. The close proximity of industry to family farms in Taiwan has reduced rural to urban migration usually associated with industrialization. Contains 46 references. (Author/SV)

  14. A Static Model of Abiotic Predictors and Forest Ecosystem Receptor Designed Using Dimensionality Reduction and Regression Analysis

    Czech Academy of Sciences Publication Activity Database

    Samec, P.; Rychtecká, P.; Tuček, P.; Bojko, J.; Zapletal, Miloš; Cudlín, Pavel

    2016-01-01

    Roč. 22, č. 2 (2016), s. 259-274 ISSN 1392-1355 R&D Projects: GA MŠk(CZ) LO1415 Institutional support: RVO:67179843 Keywords : forest state monitoring * EMEP-LRTAP * floodplain * mountain forests * canonical correlation analysis Subject RIV: EH - Ecology, Behaviour Impact factor: 0.635, year: 2016

  15. Perturbation of m-isometries by nilpotent operators

    Czech Academy of Sciences Publication Activity Database

    Bermúdez, T.; Martinón, A.; Müller, Vladimír; Noda, J. A.

    2014-01-01

    Roč. 2014, September (2014), s. 745479 ISSN 1085-3375 R&D Projects: GA ČR(CZ) GA14-07880S Institutional support: RVO:67985840 Keywords : pertubation * m-isometries Subject RIV: BA - General Mathematics Impact factor: 1.274, year: 2013 http://www.hindawi.com/journals/ aaa /2014/745479/

  16. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Nine hundred and fifty-one samples were analysed for the presence of 12 MEFV mutations by PCR and reverse-hybridization (FMF StripAssay, ViennaLab, Vienna, Austria). Confirmatory dideoxy sequencing of allMEFV gene exons was performed for 39 patients. Fifty-seven (27.4%) healthy individual carried mutant MEFV ...

  17. Relationship between starch and lipid accumulation induced by nutrient depletion and replenishment in the microalga Parachlorella kessleri

    Czech Academy of Sciences Publication Activity Database

    Fernandes, B.; Teixeira, J.; Dragone, G.; Vicente, A. A.; Kawano, S.; Bišová, Kateřina; Přibyl, Pavel; Zachleder, Vilém; Vítová, Milada

    2013-01-01

    Roč. 144, SEP 2013 (2013), s. 268-274 ISSN 0960-8524 R&D Projects: GA MŠk LH12145; GA TA ČR TE01020080 Institutional support: RVO:61388971 ; RVO:67985939 Keywords : Lipids * Nutrient depletion * Nutrient replenishment Subject RIV: EE - Microbiology, Virology Impact factor: 5.039, year: 2013

  18. Direct Detection of the Asteroidal YORP Effect

    Czech Academy of Sciences Publication Activity Database

    Lowry, S.C.; Fitzsimmons, A.; Pravec, Petr; Vokrouhlický, D.; Boehnhardt, H.; Taylor, P.A.; Margot, J. L.; Galád, Adrián; Irwin, M.; Irwin, J.; Kušnirák, Peter

    2007-01-01

    Roč. 316, č. 5822 (2007), s. 272-274 ISSN 0036-8075 R&D Projects: GA AV ČR IAA3003204 Institutional research plan: CEZ:AV0Z10030501 Keywords : asteroids rotation * near- Earth objects Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 26.372, year: 2007

  19. 17 CFR 249.332 - Form N-Q, quarterly schedule of portfolio holdings of registered management investment company.

    Science.gov (United States)

    2010-04-01

    ... of portfolio holdings of registered management investment company. 249.332 Section 249.332 Commodity... management investment company. This form shall be used by registered management investment companies, other than small business investment companies registered on Form N-5 (§§ 239.24 and 274.5 of this chapter...

  20. Download this PDF file

    African Journals Online (AJOL)

    Department of Human Anatomy, Ahmadu Bello University, Zaria, Nigeria. Reprim requests in: Dr. S. S, Adebisi, Department of Human Anatomy, Altmadu Belle University, Zaria,. Nigeria. li-mail: sanzbisi®abueduJtg. ABSTRACT .... 1968; 274. Olson 1A. The origin of lateral cutaneous nerve of forearm and its implication for.

  1. Does Environmental Enrichment Exposure Prior to Injury Influence Biomarkers Associated with Chronic Stage TBI?

    Science.gov (United States)

    2012-12-01

    release; distribution unlimited. 88 ABW/PA Cleared 03/25/2013; 88ABW-2013-1398. enrichment (Grundy et al., 2000; Kohara et al., 2001). BDNF is an...learning and Memory. 69(3):274-289 Kohara , K., Kitamura, A., Morishima, M., Tsumoto, T. (2001). Activity- dependent transfer of brain-derived

  2. Different habitats within a region contain evolutionary heritage from different epochs depending on the abiotic environment

    Czech Academy of Sciences Publication Activity Database

    Bartish, Igor V.; Ozinga, W.A.; Bartish, M. I.; Wamelink, G. W. W.; Hennekens, S.M.; Prinzing, A.

    2016-01-01

    Roč. 25, č. 3 (2016), s. 274-285 ISSN 1466-822X Grant - others:AV ČR(CZ) Fellowship J. E. Purkyně Institutional support: RVO:67985939 Keywords : museums and cradles of diversity * palaeoecology * macroevolutionary ecology Subject RIV: EH - Ecology, Behaviour Impact factor: 6.045, year: 2016

  3. Neonatal Morbidity And Mortality In Calabar, Nigeria: A Hospital ...

    African Journals Online (AJOL)

    Background: The morbidity and mortality pattern amongst neonates admitted into the University of Calabar Teaching Hospital were reviewed from 1st June 2003 to 30th November 2004. Results: The major indications for admission for inborn babies were infections (27.4%), jaundice (21%) and low birth weight (LBW) ...

  4. 28 CFR 68.57 - Judicial review of the final agency order of an Administrative Law Judge in cases arising under...

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Judicial review of the final agency order of an Administrative Law Judge in cases arising under section 274B. 68.57 Section 68.57 Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED) RULES OF PRACTICE AND PROCEDURE FOR ADMINISTRATIVE HEARINGS...

  5. Expressivity of apomixis in 2n + n hybrids from an apomictic and a sexual parent: insights into variation detected in Pilosella (Asteraceae: Lactuceae)

    Czech Academy of Sciences Publication Activity Database

    Krahulcová, Anna; Krahulec, František; Rosenbaumová, R.

    2011-01-01

    Roč. 24, č. 1 (2011), s. 263-274 ISSN 0934-0882 R&D Projects: GA ČR GA206/08/0890 Institutional research plan: CEZ:AV0Z60050516 Keywords : inheritance of apomixis * residual sexuality * unreduced hybrids Subject RIV: EF - Botanics Impact factor: 1.869, year: 2011

  6. 75 FR 873 - Extramural Support Reimbursement of Travel and Subsistence Expenses Toward Living Organ Donation...

    Science.gov (United States)

    2010-01-06

    ... Support Reimbursement of Travel and Subsistence Expenses Toward Living Organ Donation Program AGENCY... of making living donations of their organs. For example, if the community thinks lost wages and... donation of the organ.'' 42 U.S.C. 274e(c)(2). As the Secretary considers rulemaking, she will consider...

  7. Social Concepts and Judgments: A Semantic Differential Analysis of the Concepts Feminist, Man, and Woman

    Science.gov (United States)

    Pierce, W. David; Sydie, R. A.; Stratkotter, Rainer

    2003-01-01

    Male and female participants (N = 274) made judgments about the social concepts of "feminist," "man," and "woman" on 63 semantic differential items. Factor analysis identified three basic dimensions termed evaluative, potency, and activity as well as two secondary factors called expressiveness and sexuality. Results for the evaluative dimension…

  8. 76 FR 58830 - Announcement of Funding Awards; Fair Housing Initiatives Program Fiscal Year (FY) 2008

    Science.gov (United States)

    2011-09-22

    ... Mid-Florida Housing Partnership, Inc.: 1834 Mason Avenue, Daytona (368) 274-4441 4 100,000.00 Beach... Education and Outreach Initiative/National Media Campaign Component National Fair Housing Alliance: 1212 New... Mamarock Avenue, (914) 428-4507 2 261,895.00 White Plains, NY 10605 HELP Social Services Corporation: 5...

  9. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. B N Singh. Articles written in Journal of Biosciences. Volume 34 Issue 2 June 2009 pp 263-274 Articles. Variations in morphological and life-history traits under extreme temperatures in Drosophila ananassae · Seema Sisodia B N Singh · More Details Abstract Fulltext PDF.

  10. Fungal diversity notes 111-252-taxonomic and phylogenetic contributions to fungal taxa

    Czech Academy of Sciences Publication Activity Database

    Ariyawansa, H. A.; Hyde, K. D.; Jayasiri, C.; Buyck, B.; Thilini Chethana, K. W.; Dai, D. Q.; Dai, Y. C.; Daranagama, D. A.; Jayawardena, R. S.; Lücking, R.; Ghobad-Nejhad, M.; Niskanen, T.; Thambugala, K. M.; Voigt, K.; Zhao, R. L.; Li, G. J.; Doilom, M.; Boonmee, S.; Yang, Z. L.; Cai, Q.; Cui, Y. Y.; Bahkali, A. H.; Chen, J.; Cui, B.K.; Chen, J.; Dayarathne, M. C.; Dissanayake, A. J.; Ekanayaka, A. H.; Hashimoto, A.; Hongsanan, S.; Gareth Jones, E. B.; Larsson, E.; Li, W. J.; Li, Q. R.; Liu, J. K.; Luo, Z. L.; Maharachchikumbura, S.S.; Mapook, A.; McKenzie, E.; Norphanphoun, C.; Konta, S.; Pang, K. L.; Perera, R. H.; Phookamsak, R.; Phukhamsakda, C.; Pinruan, U.; Randrianjohany, E.; Singtripop, C.; Tanaka, K.; Tian, C. M.; Tibpromma, S.; Abdel-Wahab, M. A.; Wanasinghe, N. N.; Zhang, J. F.; Zhang, H.; Abdel-Aziz, F. A.; Wedin, M.; Westberg, M.; Ammirati, J. F.; Bulgakov, T. S.; Lima, D. X.; Callaghan, T. M.; Callac, P.; Chang, C. H.; Coca, L. F.; Dal-Forno, M.; Dollhofer, V.; Fliegerová, Kateřina; Greiner, K.; Griffith, G. W.; Ho, H.M.; Hofstetter, V.; Jeewon, R.; Kang, J. C.; Wen, T. C.; Kirk, P.M.; Kytövuori, I.; Lawrey, J. D.; Xing, J. P.; Li, H.; Liu, X.; Liimatainen, K.; Thorsten Lumbsch, H.; Matsumura, M.; Moncada, B.; Nuankaew, S.; Parnmen, S.; de Azevedo Santiago, A. L. C. M.; Sommai, S.; Song, Y.; de Souza, C. A. F.; de Souza-Motta, C. M.; Su, H. Y.; Suetrong, S.; Wang, Y.; Wei, S. F.; Wen, T. Ch.; Yuan, H. S.; Zhou, L. W.; Réblová, Martina; Fournier, J.; Camporesi, E.; Luangsa-ard, J. J.; Tasanathai, K.; Khonsanit, A.; Thanakitpipattana, D.; Somrithipol, S.; Diederich, P.; Millanes, A. M.; Common, R. S.; Stadler, M.; Yan, J. Y.; Li, X. H.; Lee, H. W.; Nguyen, T. T. T.; Lee, H. B.; Battistin, E.; Marsico, O.; Vizzini, A.; Vila, J.; Ercole, E.; Eberhardt, U.; Simonini, G.; Wen, H. A.; Chen, X. H.; Miettinen, O.; Spirin, V.; Hernawati, Dr.

    2015-01-01

    Roč. 75, č. 1 (2015), s. 27-274 ISSN 1560-2745 R&D Projects: GA ČR GAP506/12/0038 Institutional support: RVO:67985904 ; RVO:67985939 Keywords : fungi * taxonomy * new genus Subject RIV: EE - Microbiology, Virology; EF - Botanics (BU-J) Impact factor: 6.991, year: 2015

  11. Large-scale meta-analysis of genome-wide association data identifies six new risk loci for Parkinson's disease

    NARCIS (Netherlands)

    Nalls, Mike A.; Pankratz, Nathan; Lill, Christina M.; Do, Chuong B.; Hernandez, Dena G.; Saad, Mohamad; DeStefano, Anita L.; Kara, Eleanna; Bras, Jose; Sharma, Manu; Schulte, Claudia; Keller, Margaux F.; Arepalli, Sampath; Letson, Christopher; Edsall, Connor; Stefansson, Hreinn; Liu, Xinmin; Pliner, Hannah; Lee, Joseph H.; Cheng, Rong; Ikram, M. Arfan; Ioannidis, John P. A.; Hadjigeorgiou, Georgios M.; Bis, Joshua C.; Martinez, Maria; Perlmutter, Joel S.; Goate, Alison; Marder, Karen; Fiske, Brian; Sutherland, Margaret; Xiromerisiou, Georgia; Myers, Richard H.; Clark, Lorraine N.; Stefansson, Kari; Hardy, John A.; Heutink, Peter; Chen, Honglei; Wood, Nicholas W.; Houlden, Henry; Payami, Haydeh; Brice, Alexis; Scott, William K.; Gasser, Thomas; Bertram, Lars; Eriksson, Nicholas; Foroud, Tatiana; Singleton, Andrew B.; Plagnol, Vincent; Sheerin, Una-Marie; Simón-Sánchez, Javier; Lesage, Suzanne; Sveinbjörnsdóttir, Sigurlaug; Barker, Roger; Ben-Shlomo, Yoav; Berendse, Henk W.; Berg, Daniela; Bhatia, Kailash; de Bie, Rob M. A.; Biffi, Alessandro; Bloem, Bas; Bochdanovits, Zoltan; Bonin, Michael; Bras, Jose M.; Brockmann, Kathrin; Brooks, Janet; Burn, David J.; Charlesworth, Gavin; Chinnery, Patrick F.; Chong, Sean; Clarke, Carl E.; Cookson, Mark R.; Cooper, J. Mark; Corvol, Jean Christophe; Counsell, Carl; Damier, Philippe; Dartigues, Jean-François; Deloukas, Panos; Deuschl, Günther; Dexter, David T.; van Dijk, Karin D.; Dillman, Allissa; Durif, Frank; Dürr, Alexandra; Edkins, Sarah; Evans, Jonathan R.; Foltynie, Thomas; Dong, Jing; Gardner, Michelle; Gibbs, J. Raphael; Gray, Emma; Guerreiro, Rita; Harris, Clare; van Hilten, Jacobus J.; Hofman, Albert; Hollenbeck, Albert; Holton, Janice; Hu, Michele; Huang, Xuemei; Wurster, Isabel; Mätzler, Walter; Hudson, Gavin; Hunt, Sarah E.; Huttenlocher, Johanna; Illig, Thomas; Jónsson, Pálmi V.; Lambert, Jean-Charles; Langford, Cordelia; Lees, Andrew; Lichtner, Peter; Limousin, Patricia; Lopez, Grisel; Lorenz, Delia; McNeill, Alisdair; Moorby, Catriona; Moore, Matthew; Morris, Huw R.; Morrison, Karen E.; Mudanohwo, Ese; O'Sullivan, Sean S.; Pearson, Justin; Pétursson, Hjörvar; Pollak, Pierre; Post, Bart; Potter, Simon; Ravina, Bernard; Revesz, Tamas; Riess, Olaf; Rivadeneira, Fernando; Rizzu, Patrizia; Ryten, Mina; Sawcer, Stephen; Schapira, Anthony; Scheffer, Hans; Shaw, Karen; Shoulson, Ira; Sidransky, Ellen; Smith, Colin; Spencer, Chris C. A.; Stefánsson, Hreinn; Bettella, Francesco; Stockton, Joanna D.; Strange, Amy; Talbot, Kevin; Tanner, Carlie M.; Tashakkori-Ghanbaria, Avazeh; Tison, François; Trabzuni, Daniah; Traynor, Bryan J.; Uitterlinden, André G.; Velseboer, Daan; Vidailhet, Marie; Walker, Robert; van de Warrenburg, Bart; Wickremaratchi, Mirdhu; Williams, Nigel; Williams-Gray, Caroline H.; Winder-Rhodes, Sophie; Stefánsson, Kári; Hardy, John; Factor, S.; Higgins, D.; Evans, S.; Shill, H.; Stacy, M.; Danielson, J.; Marlor, L.; Williamson, K.; Jankovic, J.; Hunter, C.; Simon, D.; Ryan, P.; Scollins, L.; Saunders-Pullman, R.; Boyar, K.; Costan-Toth, C.; Ohmann, E.; Sudarsky, L.; Joubert, C.; Friedman, J.; Chou, K.; Fernandez, H.; Lannon, M.; Galvez-Jimenez, N.; Podichetty, A.; Thompson, K.; Lewitt, P.; Deangelis, M.; O'Brien, C.; Seeberger, L.; Dingmann, C.; Judd, D.; Marder, K.; Fraser, J.; Harris, J.; Bertoni, J.; Peterson, C.; Rezak, M.; Medalle, G.; Chouinard, S.; Panisset, M.; Hall, J.; Poiffaut, H.; Calabrese, V.; Roberge, P.; Wojcieszek, J.; Belden, J.; Jennings, D.; Marek, K.; Mendick, S.; Reich, S.; Dunlop, B.; Jog, M.; Horn, C.; Uitti, R.; Turk, M.; Ajax, T.; Mannetter, J.; Sethi, K.; Carpenter, J.; Dill, B.; Hatch, L.; Ligon, K.; Narayan, S.; Blindauer, K.; Abou-Samra, K.; Petit, J.; Elmer, L.; Aiken, E.; Davis, K.; Schell, C.; Wilson, S.; Velickovic, M.; Koller, W.; Phipps, S.; Feigin, A.; Gordon, M.; Hamann, J.; Licari, E.; Marotta-Kollarus, M.; Shannon, B.; Winnick, R.; Simuni, T.; Videnovic, A.; Kaczmarek, A.; Williams, K.; Wolff, M.; Rao, J.; Cook, M.; Fernandez, M.; Kostyk, S.; Hubble, J.; Campbell, A.; Reider, C.; Seward, A.; Camicioli, R.; Carter, J.; Nutt, J.; Andrews, P.; Morehouse, S.; Stone, C.; Mendis, T.; Grimes, D.; Alcorn-Costa, C.; Gray, P.; Haas, K.; Vendette, J.; Sutton, J.; Hutchinson, B.; Young, J.; Rajput, A.; Klassen, L.; Shirley, T.; Manyam, B.; Simpson, P.; Whetteckey, J.; Wulbrecht, B.; Truong, D.; Pathak, M.; Frei, K.; Luong, N.; Tra, T.; Tran, A.; Vo, J.; Lang, A.; Kleiner- Fisman, G.; Nieves, A.; Johnston, L.; So, J.; Podskalny, G.; Giffin, L.; Atchison, P.; Allen, C.; Martin, W.; Wieler, M.; Suchowersky, O.; Furtado, S.; Klimek, M.; Hermanowicz, N.; Niswonger, S.; Shults, C.; Fontaine, D.; Aminoff, M.; Christine, C.; Diminno, M.; Hevezi, J.; Dalvi, A.; Kang, U.; Richman, J.; Uy, S.; Sahay, A.; Gartner, M.; Schwieterman, D.; Hall, D.; Leehey, M.; Culver, S.; Derian, T.; Demarcaida, T.; Thurlow, S.; Rodnitzky, R.; Dobson, J.; Lyons, K.; Pahwa, R.; Gales, T.; Thomas, S.; Shulman, L.; Weiner, W.; Dustin, K.; Singer, C.; Zelaya, L.; Tuite, P.; Hagen, V.; Rolandelli, S.; Schacherer, R.; Kosowicz, J.; Gordon, P.; Werner, J.; Serrano, C.; Roque, S.; Kurlan, R.; Berry, D.; Gardiner, I.; Hauser, R.; Sanchez-Ramos, J.; Zesiewicz, T.; Delgado, H.; Price, K.; Rodriguez, P.; Wolfrath, S.; Pfeiffer, R.; Davis, L.; Pfeiffer, B.; Dewey, R.; Hayward, B.; Johnson, A.; Meacham, M.; Estes, B.; Walker, F.; Hunt, V.; O'Neill, C.; Racette, B.; Swisher, L.; Dijamco, Cheri; Conley, Emily Drabant; Dorfman, Elizabeth; Tung, Joyce Y.; Hinds, David A.; Mountain, Joanna L.; Wojcicki, Anne; Lew, M.; Klein, C.; Golbe, L.; Growdon, J.; Wooten, G. F.; Watts, R.; Guttman, M.; Goldwurm, S.; Saint-Hilaire, M. H.; Baker, K.; Litvan, I.; Nicholson, G.; Nance, M.; Drasby, E.; Isaacson, S.; Burn, D.; Pramstaller, P.; Al-hinti, J.; Moller, A.; Sherman, S.; Roxburgh, R.; Slevin, J.; Perlmutter, J.; Mark, M. H.; Huggins, N.; Pezzoli, G.; Massood, T.; Itin, I.; Corbett, A.; Chinnery, P.; Ostergaard, K.; Snow, B.; Cambi, F.; Kay, D.; Samii, A.; Agarwal, P.; Roberts, J. W.; Higgins, D. S.; Molho, Eric; Rosen, Ami; Montimurro, J.; Martinez, E.; Griffith, A.; Kusel, V.; Yearout, D.; Zabetian, C.; Clark, L. N.; Liu, X.; Lee, J. H.; Taub, R. Cheng; Louis, E. D.; Cote, L. J.; Waters, C.; Ford, B.; Fahn, S.; Vance, Jeffery M.; Beecham, Gary W.; Martin, Eden R.; Nuytemans, Karen; Pericak-Vance, Margaret A.; Haines, Jonathan L.; DeStefano, Anita; Seshadri, Sudha; Choi, Seung Hoan; Frank, Samuel; Psaty, Bruce M.; Rice, Kenneth; Longstreth, W. T.; Ton, Thanh G. N.; Jain, Samay; van Duijn, Cornelia M.; Verlinden, Vincent J.; Koudstaal, Peter J.; Singleton, Andrew; Cookson, Mark; Hernandez, Dena; Nalls, Michael; Zonderman, Alan; Ferrucci, Luigi; Johnson, Robert; Longo, Dan; O'Brien, Richard; Traynor, Bryan; Troncoso, Juan; van der Brug, Marcel; Zielke, Ronald; Weale, Michael; Ramasamy, Adaikalavan; Dardiotis, Efthimios; Tsimourtou, Vana; Spanaki, Cleanthe; Plaitakis, Andreas; Bozi, Maria; Stefanis, Leonidas; Vassilatis, Dimitris; Koutsis, Georgios; Panas, Marios; Lunnon, Katie; Lupton, Michelle; Powell, John; Parkkinen, Laura; Ansorge, Olaf

    2014-01-01

    We conducted a meta-analysis of Parkinson's disease genome-wide association studies using a common set of 7,893,274 variants across 13,708 cases and 95,282 controls. Twenty-six loci were identified as having genome-wide significant association; these and 6 additional previously reported loci were

  12. Assessment of the level of farm labor availability and productivity in ...

    African Journals Online (AJOL)

    Assessment of the level of farm labor availability and productivity in Imo state, Nigeria. OC Korie. Abstract. No Abstract. International Journal of Tropical Agriculture and Food Systems Vol. 1 (3) 2007: pp. 270-274. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

  13. CASTLE BRAVO: Fifty Years of Legend and Lore. A Guide to Off-Site Radiation Exposures

    Science.gov (United States)

    2013-01-31

    depressions , may grow rapidly from small beginnings—from small perturbations in a broad, unstable air stream—has led to the suggestion that the...Hygiene and Toxicology 25(7)253–274. ——. 1974. Paper presented in Radiology Centennial . Radiology Centennial , Inc., Reston, VA. Fehner, T. R., and F. G

  14. Spin Rate of Asteroid (54509) 2000 PH5 Increasing Due to the YORP Effect

    Czech Academy of Sciences Publication Activity Database

    Taylor, P.A.; Margot, J. L.; Vokrouhlický, D.; Scheeres, D.J.; Pravec, Petr; Lowry, S.C.; Fitzsimmons, A.; Nolan, M. C.; Ostro, S. J.; Benner, L. A. M.; Giorgini, J. D.; Magri, C.

    2007-01-01

    Roč. 316, č. 5822 (2007), s. 274-277 ISSN 0036-8075 Grant - others:GA ČR(CZ) GA205/99/0255 Institutional research plan: CEZ:AV0Z10030501 Keywords : asteroids rotation * near-Earth objects * radar observations Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 26.372, year: 2007

  15. New sections in Taraxacum

    Czech Academy of Sciences Publication Activity Database

    Kirschner, Jan; Štěpánek, Jan

    2004-01-01

    Roč. 39, č. 3 (2004), s. 259-274 ISSN 0015-5551 R&D Projects: GA AV ČR KSK6005114; GA ČR GA206/02/0346 Institutional research plan: CEZ:AV0Z6005908 Keywords : Asteraceae * Compositae * Lactuceae Subject RIV: EF - Botanics Impact factor: 0.968, year: 2004

  16. The Oberbeck-Boussinesq approximation as a singular limit of the full Navier-Stokes-Fourier system

    Czech Academy of Sciences Publication Activity Database

    Feireisl, Eduard; Novotný, A.

    2009-01-01

    Roč. 11, č. 2 (2009), s. 274-302 ISSN 1422-6928 R&D Projects: GA ČR GA201/05/0164 Institutional research plan: CEZ:AV0Z10190503 Keywords : singular limit * Navier-Stokes-Fourier system * Oberbeck -Boussinesq approximation Subject RIV: BA - General Mathematics Impact factor: 1.214, year: 2009

  17. Performance of first-trimester combined test for Down syndrome in different maternal age groups: reason for adjustments in screening policy?

    NARCIS (Netherlands)

    Engels, Melanie A. J.; Heijboer, A. C.; Blankenstein, Marinus A.; van Vugt, John M. G.

    2011-01-01

    To evaluate the performance of the first-trimester combined test (FCT) in different maternal age groups and to discuss whether adjustments in screening policies should be made. In this retrospective study data (n = 26 274) from a fetal medicine center on FCT (maternal age, fetal NT, free β-human

  18. Review of invasive grapevine aphid, Aphis illinoisensis Shimer, and native parasitoids in the Mediterranean (Hemiptera, Aphididae; Hymenoptera, Braconidae, Aphidiinae)

    Czech Academy of Sciences Publication Activity Database

    Havelka, Jan; Shukshuk, A. H.; Ghaliow, M. E.; Laamari, M.; Kavallieratos, N. G.; Tomanović, Ž.; Rakhshani, E.; Pons, X.; Starý, Petr

    2011-01-01

    Roč. 63, č. 1 (2011), s. 269-274 ISSN 0354-4664 Grant - others:Ministry of Science and Technological Development of the Republic of Serbia(CS) 43001 Institutional research plan: CEZ:AV0Z50070508 Keywords : invasions * Aphis illinoisensis * grapevine Subject RIV: EH - Ecology, Behaviour Impact factor: 0.360, year: 2011

  19. The Study of Relationship between Organizational Culture and Organizational Belonging in Employees of Varamin County Office of Education

    Science.gov (United States)

    Tabatabaee, Seyed Mahmoud; Koohi, Amirhasan; Ghandali, Abbas; Tajik, Tayebeh

    2016-01-01

    The purpose of the present research is to study the relationship between organizational culture and organizational belonging among employees of Varamin County ministry of education. This is a descriptive-survey study. The statistical population is consisted of all 274 official and contract employees of ministry of education in Varamin County of…

  20. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. G Anandalingam. Articles written in Sadhana. Volume 30 Issue 2-3 April-June 2005 pp 257-274. Pricing strategies for information goods · Siva Viswanathan G Anandalingam · More Details Abstract Fulltext PDF. Digital or information goods are becoming the norm across a wide variety of ...

  1. The effect of diazinon on haematological indices of common carp (Cyprinus carpio L.)

    Czech Academy of Sciences Publication Activity Database

    Svoboda, M.; Lusková, Věra; Drastichová, J.; Žlábek, V.

    2001-01-01

    Roč. 70, č. 4 (2001), s. 457-465 ISSN 0001-7213 Institutional research plan: CEZ:MSM 162700004 Keywords : common carp * acute toxicity * haematology Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.274, year: 2001 http://vfu-www.vfu.cz/acta-vet/vol70/pdf/70_457.pdf

  2. The impact and cost-effectiveness of the Amref Health Africa-Smile ...

    African Journals Online (AJOL)

    Introduction: Cleft lip with or without cleft palate (CLP) is a congenital malformation that causes significant morbidity in low and middle income countries. Amref Health Africa has partnered with Smile Train to provide CLP surgeries since 2006. Methods: We analyzed anonymized data of 37,274 CLP patients from the Smile ...

  3. Motivational strategies of sport coaches in South Africa | Le Roux ...

    African Journals Online (AJOL)

    The purpose of this investigation was to establish what techniques or strategies are used by sports coaches in South Africa to motivate their athletes/players. Altogether 780 questionnaires were distributed to sports coaches, of which 274 were used for the interpretation of the data collected. A factor analysis showed that ...

  4. OMPHALOCELE AND GASTROSCHISIS IN EUROPE - A SURVEY OF 3-MILLION BIRTHS 1980-1990

    NARCIS (Netherlands)

    CALZOLARI, E; DOLK, H; MILAN, M; LECHAT, M; LEURQUIN, P; GOYENS, S; ASTOLFI, G; VOLPATO, S; AYME, S; CALABRO, A; CLEMENTI, M; TENCONI, R; CORNEL, M; CUSCHIERI, A; GARCIAMINAUR, S; GARNE, E; GILLEROT, Y; GOUJARD, J; HANSENKOENIG, D; ROULLEAUX, M; HOWARD, PJ; JOHNSON, Z; LILLIS, DF; NEVIN, NC; PEXIEDER, T; PIERINI, A; STOLL, C; STONE, DH

    1995-01-01

    A total of 732 cases of omphalocele and 274 cases of gastroschisis was registered in 21 regional registers in Europe (EUROCAT registers) during the period 1980-1990. The total prevalence rates were 2.52 pes 10,000 for omphalocele and 0.94 per 10,000 for gastroschisis. There was significant

  5. 40 CFR 60.276a - Recordkeeping and reporting requirements.

    Science.gov (United States)

    2010-07-01

    ... at values exceeding ±15 percent of the value established under § 60.274a(c) or operation at flow... device, and continuous monitoring equipment; (4) Flow diagram of process and emission capture equipment... calculations. (g) The owner or operator shall maintain records of all shop opacity observations made in...

  6. 75 FR 27934 - Qualified Nonpersonal Use Vehicles

    Science.gov (United States)

    2010-05-19

    ... law to carry firearms, execute search warrants, and to make arrests (other than merely a citizen's... safety officer vehicles occurring after May 19, 2010. FOR FURTHER INFORMATION CONTACT: Don Parkinson at... final Income Tax Regulations under section 274(i) added by section 2(b) of Public Law 99-44 (May 24...

  7. On adaptive time stepping for large-scale parabolic problems: Computer simulation of heat and mass transfer in vacuum freeze-drying

    Czech Academy of Sciences Publication Activity Database

    Georgiev, K.; Kosturski, N.; Margenov, S.; Starý, Jiří

    2009-01-01

    Roč. 226, č. 2 (2009), s. 268-274 ISSN 0377-0427 Institutional research plan: CEZ:AV0Z30860518 Keywords : Vacuum freeze drying * Zeolites * Heat and mass transfer * Finite element method * MIC(0) preconditioning Subject RIV: BA - General Mathematics Impact factor: 1.292, year: 2009 http://apps.isiknowledge.com

  8. 76 FR 69306 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2011-11-08

    ... Securities and Exchange Commission (the ``Commission'') has submitted to the Office of Management and Budget... ``Investment Company Act'') requires a registered management investment company (``fund'') to (1) file a report with the Commission on Form N-CSR (17 CFR 249.331 and 274.128) not later than 10 days after the...

  9. The Role of Perceived Maternal Favoritism in Sibling Relations in Midlife

    Science.gov (United States)

    Suitor, J. Jill; Sechrist, Jori; Plikuhn, Mari; Pardo, Seth T.; Gilligan, Megan; Pillemer, Karl

    2009-01-01

    Data were collected from 708 adult children nested within 274 later-life families from the Within-Family Differences Study to explore the role of perceived maternal favoritism in the quality of sibling relations in midlife. Mixed-model analyses revealed that regardless of which sibling was favored, perceptions of current favoritism and…

  10. CO2 supersaturation and net heterotrophy in a tropical estuary (Cochin, India): Influence of anthropogenic effect - Carbon dynamics in tropical estuary

    Digital Repository Service at National Institute of Oceanography (India)

    Gupta, G.V.M.; Thottathil, S.D.; Balachandran, K.K.; Madhu, N.V.; Madeswaran, P.; Nair, S.

    of pCO sub(2) (up to 6000 mu atm) and CO sub(2) effluxes (up to 274 mmolC m sup(-2) d sup(-1)) especially during monsoon. A first-order estimate of the carbon mass balance shows that net production of dissolved inorganic carbon is an order of magnitude...

  11. Before Smith’s Mill: Archaeological and Geological Investigations, Smithville Lake, Missouri. Volume 1. Text.

    Science.gov (United States)

    1982-06-01

    undecorated, plain surfaced utilitarian vessel, with loop handles on some specimens. The exceptions to this stereotype are few. A rare example of lip...latter. All are mammalian remains but none are classifiable as to family or genus . Falk describes the samples from both 23 CL 274 and 276 as consisting

  12. Handbook of Accelerator Physics and Engineering (sections 2.7.1 - 2.7.5 and 7.6.2)

    Energy Technology Data Exchange (ETDEWEB)

    Roser, T.

    1999-04-19

    The sections written by this author are: 2.7.1- Thomas - BMT equation; 2.2.2- Spinor Algebra; 2.7.3- Spin Rotators and Siberian Snakes; 2.7.4- Ring with Spin Rotator and Siberian Snakes; 2.7.5- Depolarizing Resonances and Spin Flippers; & 7.6.2- Proton Beam Polarimeters

  13. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences; Volume 119; Issue 3. Issue front cover thumbnail. Volume 119, Issue 3. May 2007, pages 219-274. pp 219-230. Engineering macrocyclic figure-eight motif · V Haridas Harinder Singh Yogesh K Sharma Kashmiri Lal · More Details Abstract Fulltext PDF. The design and ...

  14. School Processes That Can Drive Scaling-Up of an Innovation or Contribute to Its Abandonment

    Science.gov (United States)

    Newman, Denis; Zacamy, Jenna; Lazarev, Valeriy; Lin, Li

    2017-01-01

    This five-year study focused on school processes that promoted the scaling-up of a high school academic literacy framework, Reading Apprenticeship, developed by WestEd's Strategic Literacy Initiative (SLI). Implementing an innovative strategy for scaling-up involving school-based cross-disciplinary teacher teams, SLI brought the framework to 274

  15. Influence of antiviral therapy on survival of patients with hepatitis B ...

    African Journals Online (AJOL)

    The mortality rates in two groups were evaluated with Kaplan-Meier estimate. ... 274 (76.9 %) died, with 89 patients belonging to the antiviral group while the ... TACE is different from systemic ... and identification of study participants was not ..... Table 3: Cox regression analysis to deteermine variables associated with overall ...

  16. Burnout and Competency Development in Pre-Service Teacher Training

    Science.gov (United States)

    Rodríguez-Hidalgo, Antonio J.; Calmaestra, Juan; Dios, Irene

    2014-01-01

    Introduction: The burnout syndrome negatively affects the students' academic performance. The relation between academic burnout and the self-perception of skills in initial teacher training is subjected to analysis. Method: A sample of 274 students (average age = 20,61 years old) from the Bachelor Degree in Early Childhood Education and the…

  17. Is the golden hour optimally used in South Africa for children ...

    African Journals Online (AJOL)

    Results. Fifty-five children were included in the final analysis. The median duration of stay in the Trauma Unit was 205 minutes (interquartile range 135 - 274). Conclusion. Several factors were identified that unnecessarily prolonged the time that patients stayed in the trauma unit following arrival in hospital for polytrauma ...

  18. EST Table: FS910254 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS910254 E_FL_fufe_19K18_F_0 10/09/28 87 %/274 aa ref|NP_001098702.1| nanos-like pr...otein [Bombyx mori] gb|ABS17681.1| nanos-like protein [Bombyx mori] 10/09/12 low homology 10/08/29 n.h 10/09

  19. Human Papilloma Virus Vaccination: Knowledge, Attitude and ...

    African Journals Online (AJOL)

    adedamla

    More than eighty percent of the 274,000 deaths resulting from ... 70% of cervical cancer worldwide. ... among Female Medical and Dental Students in a Tertiary Institution ... other than 16 and 18 are responsible for up to 30%. 7 ... Modeling studies have shown that if fully ... Several studies have documented poor knowledge.

  20. Multimammate rat (Mastomys natalensis), Tristram's jird (Meriones tristrami) and Wagner's gerbil (Gerbillus dasyurus) as laboratory models of acute neosporosis

    Czech Academy of Sciences Publication Activity Database

    Hůrková-Hofmannová, L.; Václavek, P.; Škorič, M.; Fictum, P.; Modrý, David

    2007-01-01

    Roč. 82, č. 3 (2007), s. 377-381 ISSN 0034-5288 R&D Projects: GA ČR GD524/03/H133 Institutional research plan: CEZ:AV0Z60220518 Keywords : Neosporosis * Apicomplexa * rodents * multimammate rat * jird * gerbil Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.274, year: 2007

  1. 78 FR 53386 - Federal Motor Vehicle Safety Standards; Occupant Crash Protection

    Science.gov (United States)

    2013-08-29

    ... ``on'' position (49 U.S.C. 30124). \\2\\ We note that the statutory prohibition restricting the use of... fuel efficient with lower emissions. The petitioner estimated that a 7 pound vehicle weight reduction (by removing knee bolsters) would result in carbon dioxide (CO 2 ) savings between 274-406 metric tons...

  2. Impairment of mitochondrial function of rat hepatocytes by high fat diet and oxidative stress

    Czech Academy of Sciences Publication Activity Database

    Garnol, T.; Endlicher, R.; Kučera, O.; Drahota, Zdeněk; Červinková, Z.

    2014-01-01

    Roč. 63, č. 2 (2014), s. 271-274 ISSN 0862-8408 R&D Projects: GA MŠk(CZ) LL1204 Grant - others:Univerzita Karlova(CZ) PRVOUK P37/02 Institutional support: RVO:67985823 Keywords : hepatocytes * high fat diet * mitochondrial activities * ROS Subject RIV: ED - Physiology Impact factor: 1.293, year: 2014

  3. COMMUNITY HEALTH & PRIMARY HEALTH CARE

    African Journals Online (AJOL)

    user

    Contraceptive Methods Awareness and Use among Women of. Reproductive Age in an .... and traditional methods is about 5 percent. A report has ... population growth, poverty reduction and. 16 ..... Total. Yes (%). No (%). Percent (%). Singles. 61(70). 26(30). 87(100). X2 = 1.274 df .... This study set out to assess the level of.

  4. Diffusion-controlled reactions modeling in Geant4-DNA

    Czech Academy of Sciences Publication Activity Database

    Karamitros, M.; Luan, S.; Bernal, M. A.; Allison, J.; Baldacchino, G.; Davídková, Marie; Francis, Z.; Friedland, W.; Ivanchenko, A.; Ivanchenko, V.; Mantero, A.; Nieminen, P.; Santin, G.; Tran, H. N.; Stepan, V.; Incerti, S.

    2014-01-01

    Roč. 274, OCT (2014), s. 841-882 ISSN 0021-9991 Institutional support: RVO:61389005 Keywords : chemical kinetics simulation * radiation chemistry * Fokker-Planck equation * Smoluchowski diffusion equation * Brownian bridge * dynamical time steps * k-d tree * radiolysis * radiobiology * Geant4-DNA * Brownian dynamics Subject RIV: BO - Biophysics Impact factor: 2.434, year: 2014

  5. Predictors and prognostic impact of recurrent myocardial infarction in patients with left ventricular dysfunction, heart failure, or both following a first myocardial infarction

    DEFF Research Database (Denmark)

    Thune, Jens Jakob; Signorovitch, James E; Kober, Lars

    2011-01-01

    recurrent MI in 10,599 patients with left ventricular dysfunction, heart failure, or both following a first MI from the Valsartan in Acute Myocardial Infarction Trial (VALIANT) cohort. During a median follow-up of 27.4 months, 861 patients (9.6%) had a recurrent MI. The median time to recurrence was 136...

  6. 76 FR 59663 - Limitations of Duty- and Quota-Free Imports of Apparel Articles Assembled in Beneficiary Sub...

    Science.gov (United States)

    2011-09-27

    ... of Apparel Articles Assembled in Beneficiary Sub-Saharan African Countries From Regional and Third... Acceleration Act of 2004, Pub. L. 108-274; Division D, Title VI, section 6002 of the Tax Relief and Health Care... beneficiary sub-Saharan African countries. Section 112(b)(3) of TDA 2000 provides duty- and quota-free...

  7. 8 CFR 270.3 - Penalties.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Penalties. 270.3 Section 270.3 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS PENALTIES FOR DOCUMENT FRAUD § 270.3 Penalties. (a) Criminal penalties. Nothing in section 274C of the Act shall be construed to diminish or...

  8. 10 CFR 150.7 - Persons in offshore waters not exempt.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Persons in offshore waters not exempt. 150.7 Section 150.7... AGREEMENT STATES AND IN OFFSHORE WATERS UNDER SECTION 274 Continued Commission Regulatory Authority in Offshore Waters § 150.7 Persons in offshore waters not exempt. Persons in offshore waters are not exempt...

  9. ELT Research in Turkey: A Content Analysis of Selected Features of Published Articles

    Science.gov (United States)

    Yagiz, Oktay; Aydin, Burcu; Akdemir, Ahmet Selçuk

    2016-01-01

    This study reviews a selected sample of 274 research articles on ELT, published between 2005 and 2015 in Turkish contexts. In the study, 15 journals in ULAKBIM database and articles from national and international journals accessed according to convenience sampling method were surveyed and relevant articles were obtained. A content analysis was…

  10. Medical Informatics Impact of Information Society in Health Care Development

    Czech Academy of Sciences Publication Activity Database

    Zvárová, Jana

    2005-01-01

    Roč. 9, - (2005), s. 269-274 ISSN 1335-2393. [YBERC 2005. Young Biomedical Engineers and Researchers Conference. Stará Lesná, 13.07.2005-15.07.2005] Institutional research plan: CEZ:AV0Z10300504 Keywords : medical informatics * information society * telemedicine * education * research and development Subject RIV: BD - Theory of Information

  11. Directionality of large-scale resting-state brain networks during eyes open and eyes closed conditions

    NARCIS (Netherlands)

    Zhang, Delong; Liang, Bishan; Wu, Xia; Wang, Zengjian; Xu, Pengfei; Chang, Song; Liu, Bo; Liu, Ming; Huang, Ruiwang

    2015-01-01

    The present study examined directional connections in the brain among resting-state networks (RSNs) when the participant had their eyes open (E0) or had their eyes closed (EC). The resting state fMRI data were collected from 20 healthy participants (9 males, 20.17 +/- 2.74 years) under the EO and EC

  12. Cold exposure and associated metabolic changes in adult tropical beetles exposed to fluctuating thermal regimes

    Czech Academy of Sciences Publication Activity Database

    Lalouette, L.; Košťál, Vladimír; Colinet, H.; Gagneul, D.; Renault, D.

    2007-01-01

    Roč. 274, č. 7, (2007), s. 1759-1767 ISSN 1742-464X Grant - others:Biodiversity Research Centre of the Université Catholique de Louvain(BE) BRC 111 Institutional research plan: CEZ:AV0Z50070508 Keywords : amino acid * fluctuating thermal regime * insect Subject RIV: ED - Physiology Impact factor: 3.396, year: 2007

  13. 77 FR 63418 - Additional Designations, Foreign Narcotics Kingpin Designation Act

    Science.gov (United States)

    2012-10-16

    ... significant foreign narcotics traffickers as identified by the President. In addition, the Secretary of the..., Zapopan, Jalisco C.P. 45238, Mexico; Cancun, Quintana Roo, Mexico; R.F.C. SRC-080222-274 (Mexico) [SDNTK..., Guadalajara, Jalisco C.P. 44130, Mexico; R.F.C. UNI-031118-2I6 (Mexico) [SDNTK]. In addition, OFAC is...

  14. 40 CFR 60.276 - Recordkeeping and reporting requirements.

    Science.gov (United States)

    2010-07-01

    ... values exceeding ±15 percent of the value established under § 60.274(c) or operation at flow rates lower...; (4) Flow diagram of process and emission capture equipment including other equipment or process(es... or operator shall maintain records of all shop opacity observations made in accordance with § 60.273...

  15. 75 FR 28642 - Limiting Mountain Lion Predation on Desert Bighorn Sheep on Kofa National Wildlife Refuge, Yuma...

    Science.gov (United States)

    2010-05-21

    ... DEPARTMENT OF THE INTERIOR Fish and Wildlife Service [FWS-R2-R-2009-N274] [22570-1261-0000-K2] Limiting Mountain Lion Predation on Desert Bighorn Sheep on Kofa National Wildlife Refuge, Yuma and La Paz Counties, AZ AGENCY: Fish and Wildlife Service, Interior. ACTION: Notice of availability of the final...

  16. Associations between somatic cell count patterns and the incidence of clinical mastitis

    NARCIS (Netherlands)

    Haas, de Y.; Barkema, H.W.; Schukken, Y.H.; Veerkamp, R.F.

    2005-01-01

    Associations between clinical mastitis (CM) and the proportional distribution of patterns in somatic cell count (SCC) on a herd level were determined in this study. Data on CM and SCC over a 12-month period from 274 Dutch herds were used. The dataset contained parts of 29,719 lactations from 22,955

  17. Completing Records-Based Research Within the Military: A User’s Guide

    Science.gov (United States)

    2013-03-01

    40:2072–2077, 2012. 13. Scher, D. L., Belmont, P. J., Jr., Mountcastle, S., et al. The incidence of primary hip osteoarthritis in active duty US...B. S., et al. Guidelines were developed for data collection from medical records for use in retrospective analyses. J. Clin. Epidemiol. 58:269–274

  18. Convention on the physical protection of nuclear material

    International Nuclear Information System (INIS)

    1991-09-01

    The document refers to the Convention on the Physical Protection of Nuclear Material (IAEA-INFCIRC-274). Part I contains the status list as of September 6, 1991; Part II contains the texts of reservations/declarations made upon expressing consent to be bound; Part III contains the texts of reservations/declarations made upon signature

  19. 75 FR 60067 - Limitations of Duty- and Quota-Free Imports of Apparel Articles Assembled in Beneficiary Sub...

    Science.gov (United States)

    2010-09-29

    ... COMMITTEE FOR THE IMPLEMENTATION OF TEXTILE AGREEMENTS Limitations of Duty- and Quota-Free Imports... New 12-Month Cap on Duty- and Quota-Free Benefits. DATES: Effective Date: October 1, 2010. FOR FURTHER... 2004, Pub. L. 108-274; Division D, Title VI, section 6002 of the Tax Relief and Health Care Act of 2006...

  20. Latino Adolescents' Mental Health: Exploring the Interrelations among Discrimination, Ethnic Identity, Cultural Orientation, Self-Esteem, and Depressive Symptoms

    Science.gov (United States)

    Umana-Taylor, Adriana J.; Updegraff, Kimberly A.

    2007-01-01

    Guided by a risk and resilience framework, the current study used cross-sectional data to examine the degree to which Latino adolescents' (N=274; M age=16.3; 47.1% female) self-esteem, ethnic identity, and cultural orientations mediated or moderated the relation between perceived discrimination and depressive symptoms. Utilizing a multiple group…

  1. Competitive fitness of influenza B viruses with neuraminidase inhibitor-resistant substitutions in a coinfection model of the human airway epithelium.

    Science.gov (United States)

    Burnham, Andrew J; Armstrong, Jianling; Lowen, Anice C; Webster, Robert G; Govorkova, Elena A

    2015-04-01

    Influenza A and B viruses are human pathogens that are regarded to cause almost equally significant disease burdens. Neuraminidase (NA) inhibitors (NAIs) are the only class of drugs available to treat influenza A and B virus infections, so the development of NAI-resistant viruses with superior fitness is a public health concern. The fitness of NAI-resistant influenza B viruses has not been widely studied. Here we examined the replicative capacity and relative fitness in normal human bronchial epithelial (NHBE) cells of recombinant influenza B/Yamanashi/166/1998 viruses containing a single amino acid substitution in NA generated by reverse genetics (rg) that is associated with NAI resistance. The replication in NHBE cells of viruses with reduced inhibition by oseltamivir (recombinant virus with the E119A mutation generated by reverse genetics [rg-E119A], rg-D198E, rg-I222T, rg-H274Y, rg-N294S, and rg-R371K, N2 numbering) or zanamivir (rg-E119A and rg-R371K) failed to be inhibited by the presence of the respective NAI. In a fluorescence-based assay, detection of rg-E119A was easily masked by the presence of NAI-susceptible virus. We coinfected NHBE cells with NAI-susceptible and -resistant viruses and used next-generation deep sequencing to reveal the order of relative fitness compared to that of recombinant wild-type (WT) virus generated by reverse genetics (rg-WT): rg-H274Y > rg-WT > rg-I222T > rg-N294S > rg-D198E > rg-E119A ≫ rg-R371K. Based on the lack of attenuated replication of rg-E119A in NHBE cells in the presence of oseltamivir or zanamivir and the fitness advantage of rg-H274Y over rg-WT, we emphasize the importance of these substitutions in the NA glycoprotein. Human infections with influenza B viruses carrying the E119A or H274Y substitution could limit the therapeutic options for those infected; the emergence of such viruses should be closely monitored. Influenza B viruses are important human respiratory pathogens contributing to a significant portion

  2. Novel antibody binding determinants on the capsid surface of serotype O foot-and-mouth disease virus

    Science.gov (United States)

    Asfor, Amin S.; Upadhyaya, Sasmita; Knowles, Nick J.; King, Donald P.; Paton, David J.

    2014-01-01

    Five neutralizing antigenic sites have been described for serotype O foot-and-mouth disease viruses (FMDV) based on monoclonal antibody (mAb) escape mutant studies. However, a mutant virus selected to escape neutralization of mAb binding at all five sites was previously shown to confer complete cross-protection with the parental virus in guinea pig challenge studies, suggesting that amino acid residues outside the mAb binding sites contribute to antibody-mediated in vivo neutralization of FMDV. Comparison of the ability of bovine antisera to neutralize a panel of serotype O FMDV identified three novel putative sites at VP2-74, VP2-191 and VP3-85, where amino acid substitutions correlated with changes in sero-reactivity. The impact of these positions was tested using site-directed mutagenesis to effect substitutions at critical amino acid residues within an infectious copy of FMDV O1 Kaufbeuren (O1K). Recovered viruses containing additional mutations at VP2-74 and VP2-191 exhibited greater resistance to neutralization with both O1K guinea pig and O BFS bovine antisera than a virus that was engineered to include only mutations at the five known antigenic sites. The changes at VP2-74 and VP3-85 are adjacent to critical amino acids that define antigenic sites 2 and 4, respectively. However VP2-191 (17 Å away from VP2-72), located at the threefold axis and more distant from previously identified antigenic sites, exhibited the most profound effect. These findings extend our knowledge of the surface features of the FMDV capsid known to elicit neutralizing antibodies, and will improve our strategies for vaccine strain selection and rational vaccine design. PMID:24584474

  3. Nebraska's forests, 2005: statistics, methods, and quality assurance

    Science.gov (United States)

    Patrick D. Miles; Dacia M. Meneguzzo; Charles J. Barnett

    2011-01-01

    The first full annual inventory of Nebraska's forests was completed in 2005 after 8,335 plots were selected and 274 forested plots were visited and measured. This report includes detailed information on forest inventory methods, and data quality estimates. Tables of various important resource statistics are presented. Detailed analysis of the inventory data are...

  4. 77 FR 14036 - Draft Environmental Impact Statement for Experimental Removal of Barred Owls to Benefit...

    Science.gov (United States)

    2012-03-08

    ... whether to move forward with future management of barred owls. The action alternatives vary by the number... now outnumber spotted owls in many portions of the northern spotted owl's range (Pearson and Livezey..., p. 51; Pearson and Livezey 2003, p. 274; Courtney et al., pp. 7-27 through 7-31; Gremel 2005, pp. 9...

  5. 78 FR 44588 - Experimental Removal of Barred Owls To Benefit Threatened Northern Spotted Owls; Final...

    Science.gov (United States)

    2013-07-24

    ... spotted owl populations and to test the feasibility and efficiency of barred owl removal as a management... outnumber spotted owls in many portions of the northern spotted owl's range (Pearson and Livezey 2003, p.... 51; Pearson and Livezey 2003, p. 274; Courtney et al., pp. 7-27 through 7-31; Gremel 2005, pp. 9, 11...

  6. Homogenization of the evolutionary Navier-Stokes system

    Czech Academy of Sciences Publication Activity Database

    Feireisl, Eduard; Namlyeyeva, Yuliya; Nečasová, Šárka

    2016-01-01

    Roč. 149, č. 1 (2016), s. 251-274 ISSN 0025-2611 R&D Projects: GA ČR GA13-00522S Institutional support: RVO:67985840 Keywords : Navier-Stokes system Subject RIV: BA - General Mathematics Impact factor: 0.607, year: 2016 http://link.springer.com/article/10.1007%2Fs00229-015-0778-y

  7. Carl Napoleon Balling. Kvasný chemik a cukrovarník

    Czech Academy of Sciences Publication Activity Database

    Jindra, Jiří

    2018-01-01

    Roč. 112, č. 4 (2018), s. 274 ISSN 0009-2770 Institutional support: RVO:68378114 Keywords : Carl Napoleon Balling * chemistry * sugar industry Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings) Impact factor: 0.387, year: 2016

  8. Quarter Dates Location(s) Purpose Transportation and Travel ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC CRDI

    Dates. Location(s). Purpose. Transportation and Travel. Accommodation,. Meals and Other. Hospitality. Total. Expenses. Quarter 1. May 15. Ottawa, ON. Meetings. May 20 to 21. Washington DC. Conference. 11,364.93. 3,274.71. 53.50. 14,693.14. May 5 to June 5. Kenya and England. Meetings. June 18 to 21. Winnipeg, MB.

  9. Supervision Anxiety as a Predictor for Organizational Cynicism in Teachers

    Science.gov (United States)

    Gündüz, Hasan Basri; Ömür, Yunus Emre

    2016-01-01

    The purpose of this is study is to reveal how the anxiety that the teachers who work in the Beyoglu district of Istanbul experience, due to the supervision process, predict their organizational cynicism levels. With this respect, the study was conducted on 274 teachers with the relational screening model. The "Supervision Anxiety Scale"…

  10. Language Learning Strategies of Language e-Learners in Turkey

    Science.gov (United States)

    Solak, Ekrem; Cakir, Recep

    2015-01-01

    The purpose of this study was to determine the use of language learning strategies of e-learners and to understand whether there were any correlations between language learning strategies and academic achievement. Participants of the study were 274?e-learners, 132 males and 142 females, enrolled in an e-learning program from various majors and…

  11. Proceedings – Mathematical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Proceedings – Mathematical Sciences; Volume 119; Issue 3. Issue front cover thumbnail. Volume 119, Issue 3. June 2009, pages 267-410. pp 267-274. A Finer Classification of the Unit Sum Number of the Ring of Integers of Quadratic Fields and Complex Cubic Fields · Nahid Ashrafi · More Details Abstract ...

  12. Kuidas kirjutatakse ajalugu? / Roger Chartier ; interv. Marek Tamm

    Index Scriptorium Estoniae

    Chartier, Roger

    2007-01-01

    Kirjanduslikest tekstidest sotsiaalajaloo uurimisallikana, juhuse ja paratamatuse vahekorrast ajaloos ja Prantsuse revolutsiooni käsitlusest Pariisi õppe- ja teaduskeskuse Ecole des Hautes Etudes en Sciences Sociales professori R. Chartier'i teostes. Varem ilm.: Tekstid, praktikad ja lugejad : intervjuu Roger Chartier'ga // Chartier, Roger. Prantsuse revolutsiooni kultuurilised lätted. - Tallinn, 2002. - Lk. 274-290

  13. 75 FR 64752 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2010-10-20

    .... Form N-CSR (17 CFR 249.331 and 274.128) is a combined reporting form used by management investment..., Washington, DC 20549-0213. Extension: Form N-CSR, SEC File No. 270-512, OMB Control No. 3235-0570. Notice is... Securities and Exchange Commission (the ``Commission'') has submitted to the Office of Management and Budget...

  14. 78 FR 58351 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2013-09-23

    .... Form N-CSR (17 CFR 249.331 and 274.128) is a combined reporting form used by registered management..., Washington, DC 20549-0213 Extension: Form N-CSR; OMB Control No. 3235-0570, SEC File No. 270-512 Notice is... Securities and Exchange Commission (the ``Commission'') has submitted to the Office of Management and Budget...

  15. 75 FR 50784 - Proposed Collection; Comment Request

    Science.gov (United States)

    2010-08-17

    ... Office of Management and Budget for extension and approval. Form N-CSR (17 CFR 249.331 and 274.128) is a combined reporting form used by management investment companies to file certified shareholder reports under..., Washington, DC 20549-0213. Extension: Form N-CSR; SEC File No. 270-512; OMB Control No. 3235-0570. Notice is...

  16. 78 FR 43250 - Proposed Collection; Comment Request

    Science.gov (United States)

    2013-07-19

    ... Office of Management and Budget for extension and approval. Form N-CSR (17 CFR 249.331 and 274.128) is a combined reporting form used by registered management investment companies (``funds'') to file certified..., Washington, DC 20549-0213. Extension: Form N-CSR. SEC File No. 270-512, OMB Control No. 3235-0570 Notice is...

  17. Digestibility by lambs offered alfalfa hay treated with a propionic acid hay preservative and baled at different concentrations of moisture

    Science.gov (United States)

    Eighteen crossbred wether lambs (76.1 ± 8.18 lb initial BW) were used for a 2 period digestion study to evaluate the effect of hay preservative concentration (0, 0.56, or 0.98% buffered propionic acid) and hay moisture concentration at baling (19.6, 23.8, or 27.4% moisture) on digestibility of alfal...

  18. The Impact of Leisure-Time Television on School Learning: A Research Synthesis.

    Science.gov (United States)

    Williams, Patricia A.; And Others

    1982-01-01

    To integrate empirical findings concerning the impact of leisure time television viewing on student achievement in grades K-12, 274 correlations were assembled from 23 studies. The effects were slightly positive for up to 10 hours of viewing a week, but beyond 10 hours the effects are negative and increasingly more deleterious. (Author/BW)

  19. Morphogenesis and bone integration of the mouse mandibular third molar

    Czech Academy of Sciences Publication Activity Database

    Chlastáková, Ivana; Lungová, V.; Wells, K.; Tucker, A. S.; Radlanski, R.J.; Míšek, Ivan; Matalová, Eva

    2011-01-01

    Roč. 119, č. 4 (2011), s. 265-274 ISSN 0909-8836 R&D Projects: GA AV ČR IAA600450904; GA ČR GC524/08/J032 Institutional research plan: CEZ:AV0Z50450515 Keywords : 3D models * apoptosis * osteoclast activity Subject RIV: ED - Physiology Impact factor: 1.878, year: 2011

  20. A switched-beam millimeter-wave array with MIMO configuration for 5G applications

    KAUST Repository

    Ikram, M.; Sharawi, M. S.; Klionovski, Kirill; Shamim, Atif

    2018-01-01

    B measured bandwidth of 830 MHz (27.4 GHZ–28.23 GHz). It is fabricated on a commercially available RO3003 substrate with dielectric constant of 3.3 and height of 0.13 mm, respectively. The dimensions of the board are equal to 150 mm3 × 100 mm3 × 0.13 mm3

  1. Resistance of Akt kinases to dephosphorylation through ATP-dependent conformational plasticity.

    Science.gov (United States)

    Chan, Tung O; Zhang, Jin; Rodeck, Ulrich; Pascal, John M; Armen, Roger S; Spring, Maureen; Dumitru, Calin D; Myers, Valerie; Li, Xue; Cheung, Joseph Y; Feldman, Arthur M

    2011-11-15

    Phosphorylation of a threonine residue (T308 in Akt1) in the activation loop of Akt kinases is a prerequisite for deregulated Akt activity frequently observed in neoplasia. Akt phosphorylation in vivo is balanced by the opposite activities of kinases and phosphatases. Here we describe that targeting Akt kinase to the cell membrane markedly reduced sensitivity of phosphorylated Akt to dephosphorylation by protein phosphatase 2A. This effect was amplified by occupancy of the ATP binding pocket by either ATP or ATP-competitive inhibitors. Mutational analysis revealed that R273 in Akt1 and the corresponding R274 in Akt2 are essential for shielding T308 in the activation loop against dephosphorylation. Thus, occupancy of the nucleotide binding pocket of Akt kinases enables intramolecular interactions that restrict phosphatase access and sustain Akt phosphorylation. This mechanism provides an explanation for the "paradoxical" Akt hyperphosphorylation induced by ATP-competitive inhibitor, A-443654. The lack of phosphatase resistance further contributes insight into the mechanism by which the human Akt2 R274H missense mutation may cause autosomal-dominant diabetes mellitus.

  2. BanII dimorphic site located in the third intron of the human apolipoprotein AI (APOA1) gene

    Energy Technology Data Exchange (ETDEWEB)

    Coleman, R T; Kresnak, M T; Frossard, P M

    1988-02-11

    A 0.7kb fragment generated by AvaII digestion of pBL13AI, a 0.965kb full-length human apolipoprotein AI cDNA was cloned into the EcoRI site of pBR322. The apoAI cDNA was isolated from a lambdagt10 human fetal liver cDNA library. BanII (GPuGCPyC) (International Biotechnologies, Inc.) identifies two invariant bands at 1122bp and 417bp, and a single two-allele polymorphism with bands at either 274bp or 452bp. The human apolipoprotein AI-CIII-AIV gene complex has been localized on the long arm of chromosome 11 by Southern blot analysis of human-chinese hamster cell hybrids. Co-dominant segregation has been observed in two families (13 individuals). The BanII restriction map was constructed from DNA sequence data of the human apoAI gene. The 452bp fragment is generated by the loss of a BanII dimorphic site in the third intron of the apoAI gene, between the 178bp and the 274bp fragments.

  3. Sutureless vascular anastomoses by N-butyl-2 cyanoacrylate adhesive: an experimental animal study.

    Science.gov (United States)

    Saba, D; Yilmaz, M; Yavuz, H; Noyan, S; Avci, B; Ercan, A; Ozkan, H; Cengiz, M

    2007-01-01

    The purpose of this animal study was to find out whether sutureless anastomoses using N-butyl-2-cyanoacrylate were effective in the suppression of neointimal hyperplasia or not. Ten male adult mongrel dogs were used in this animal study. The animals were randomly divided into a control group (n = 5) and a study group (n = 5). The study group underwent sutureless anastomoses using N-buthyl-2-cyanoacrylate adhesive. Infrarenal aortoaortic graft was interposed using polytetrafluoroethylene. In the study group, the mean intimal thickness at the proximal anastomosis was 27.4 +/- 1.94 microm and 27.4 +/- 1.51 microm at the distal anastomosis. In the control group, the mean intimal thickness was 138.4 +/- 5.02 mum at the proximal anastomosis and 67.6 +/- 6.42 microm at the distal anastomosis. Intimal thickness at the proximal and distal anastomoses in the control group was significantly (p anastomoses using with N-butyl-2-cyanoacrylate adhesive might be a good alternative to conventional suture technique. Copyright 2007 S. Karger AG, Basel.

  4. Effect of component compression on the initial performance of an IPV nickel-hydrogen cell

    Science.gov (United States)

    Gahn, Randall F.

    1987-01-01

    An experimental method was developed for evaluating the effect of component compression on the charge and discharge voltage characteristics of a 3 1/2 in. diameter boiler plate cell. A standard boiler plate pressure vessel was modified by the addition of a mechanical feedthrough on the bottom of the vessel which permitted different compressions to be applied to the components without disturbing the integrity of the stack. Compression loadings from 0.94 to 27.4 psi were applied by suspending weights from the feedthrough rod. Cell voltages were measured for 0.96-C, 55-min charge and for 1.37-C, 35-min and 2-C, 24-min discharges. An initial change in voltage performance on both charge and discharge as the loading increased was attributed to seating of the components. Subsequent variation of the compression from 2.97 to 27.4 psi caused only minor changes in either the charge or the discharge voltages. Several one month open-circuit voltage stands and 1100 cycles under LEO conditions at the maximum loading have produced no change in performance.

  5. 77 FR 28588 - Proposed Priorities-American Overseas Research Centers Program; CFDA Number 84.274A

    Science.gov (United States)

    2012-05-15

    .... scholars conducting overseas research that is vital to understanding the history, culture, economy... facilitate networking and collaborations via conferences, teaching opportunities for visiting faculty, and... and teaching at their home institutions. Proposed Priority 2--Projects that Provide Research, Teaching...

  6. 7 CFR 274.10 - Use of identification cards and redemption of coupons by eligible households.

    Science.gov (United States)

    2010-01-01

    ... separate form. The household shall not be required to travel to a food stamp office to execute an emergency... Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE FOOD STAMP AND FOOD DISTRIBUTION..., shall present the household's ID card at issuance points, retail food stores or meal services in order...

  7. Interpersonal Problem Solving, Self-Compassion and Personality Traits in University Students

    Science.gov (United States)

    Arslan, Coskun

    2016-01-01

    The aim of this study was to investigate interpersonal problem solving in terms of self-compassion and personality traits. The participants were 570 (274 females and 296 males) who participated in the research voluntarily. The mean age of the participants was 21.54 years (between 17-32 years old) with a standard deviation of 2.68 years. Data were…

  8. Investigating Forest Inventory and Analysis-collected tree-ring data from Utah as a proxy for historical climate

    Science.gov (United States)

    R. Justin DeRose; W. Shih-Yu (Simon) Wang; John D. Shaw

    2012-01-01

    Increment cores collected as part of the periodic inventory in the Intermountain West were examined for their potential to represent growth and be a proxy for climate (precipitation) over a large region (Utah). Standardized and crossdated time-series created from pinyon pine (n=249) and Douglas-fir (n=274) increment cores displayed spatiotemporal patterns in growth...

  9. Origin of slow low-temperature luminescence in undoped and Ce-doped Y.sub.2./sub.SiO.sub.5./sub. and Lu.sub.2./sub.SiO.sub.5./sub. single crystals

    Czech Academy of Sciences Publication Activity Database

    Jarý, Vítězslav; Krasnikov, A.; Nikl, Martin; Zazubovich, S.

    2015-01-01

    Roč. 252, č. 2 (2015), s. 274-281 ISSN 0370-1972 R&D Projects: GA ČR GAP204/12/0805 Institutional support: RVO:68378271 Keywords : decay kinetics * luminescence * Lu 2 SiO 5 * time-resolved spectra * Y 2 SiO 5 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.522, year: 2015

  10. The used of palladium nanoparticles supported on MCM-41 mesoporous molecular sieves in Heck reaction: A comparison of basic and neutral supports

    Czech Academy of Sciences Publication Activity Database

    Demel, Jan; Čejka, Jiří; Štěpnička, P.

    2007-01-01

    Roč. 274, 1-2 (2007), s. 127-132 ISSN 1381-1169 R&D Projects: GA ČR GA104/05/0192; GA MŠk(CZ) LC06070 Institutional research plan: CEZ:AV0Z40400503 Keywords : bifunctional catalysts * supported catalysts * palladium * nanoparticles * MCM-41 Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.707, year: 2007

  11. The 2008 West Bohemia earthquake swarm in the light of the WEBNET network

    Czech Academy of Sciences Publication Activity Database

    Fischer, T.; Horálek, Josef; Michálek, Jan; Boušková, Alena

    2010-01-01

    Roč. 14, č. 4 (2010), s. 665-682 ISSN 1383-4649 Grant - others:GA MŠk(CZ) specifický-výzkum; Norway Grants(NO) A/CZ0046/2/0015 Institutional research plan: CEZ:AV0Z30120515 Keywords : earthquake swarm * seismic network * seismicity Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 1.274, year: 2010

  12. Heavy metal concentrations in, and human health risk assessment ...

    African Journals Online (AJOL)

    Water, sediment and fish samples were collected for six months and heavy metals were determined using an Atomic Absorption Spectrometer. Fe ranked highest in water and sediment, with concentrations of 2.74 mg l−1 and 61.60 mg kg−1, respectively. Metals followed the magnitude of Fe > Mn > Ni > V > Pb in the water ...

  13. Scale-up study of oxalic acid pretreatment of agricultural lignocellulosic biomass for the production of bioethanol

    Science.gov (United States)

    Jae-Won Lee; Carl J. Houtman; Hye-Yun Kim; In-Gyu Choi; Thomas W. Jeffries

    2011-01-01

    Building on our laboratory-scale optimization, oxalic acid was used to pretreat corncobs on the pilotscale. The hydrolysate obtained after washing the pretreated biomass contained 32.55 g/l of xylose, 2.74 g/l of glucose and low concentrations of inhibitors. Ethanol production, using Scheffersomyces stipitis, from this hydrolysate was 10.3 g/l, which approached the...

  14. The Role of the Telomere End Protection Complex in Telomere Main

    Science.gov (United States)

    2003-06-01

    identification of putative substrates of ATM kinase family members. J Biol Chem, 1999. 274(53): p. 37538-43. 9. Lei, M., E.R. Podell , P. Baumann, and T.R. Cech...DNA self-recognition in the structure of Pot1 bound to telomeric single-stranded DNA. Nature, 2003. 426(6963): p. 198-203. 10. Lei, M., E.R. Podell

  15. Fulltext PDF

    Indian Academy of Sciences (India)

    compounds have been further characterized by IR, UV–Vis spectra, elemental analysis and thermostability tests. QSAR study of prolylcarboxypeptidase inhibitors by genetic algorithm: ... X-ray single crystal diffraction, FT-IR, TGA and elemental analysis. HN. N. H3CO. Cu2+. OH-. A274 nm. Ac2O (1.2 mmol), neat, r.t.. CMK-5.

  16. 76 FR 33982 - Airworthiness Directives; Bombardier, Inc. Model CL-600-2C10 (Regional Jet Series 700, 701, & 702...

    Science.gov (United States)

    2011-06-10

    ... office between 9 a.m. and 5 p.m., Monday through Friday, except Federal holidays. The AD docket contains..., 139, 142, 145, 146, 266, 268, 271, 274, 276, 277, 280, 282 through 285 inclusive, 290, 292, 294, 297, 299, 307, 309, 320, 337, 400, 402, 403, 410, 412, 418, 421 through 428 inclusive, 430, 435 through 439...

  17. Reliability of the Children's Attitudes Toward the Environment Scale.

    Science.gov (United States)

    Kim, Sang-Min; Zeman, Catherine; Kostareva, Olga

    2007-08-01

    The Children's Attitudes toward the Environment Scale, developed by Musser and Malkus (1994), gave Cronbach alpha .73 and .83 at pretest and 3-wk. later for 274 children and a test-retest r of only .47. While Cronbach alpha was similar to the value reported by the test developers, it is close to the low end of acceptability.

  18. CYCLIC STRAIN LOCALIZATION IN CAST NICKEL BASED SUPERALLOY INCONEL 792-5A AT ROOM TEMPERATURE

    Czech Academy of Sciences Publication Activity Database

    Petrenec, Martin; Man, Jiří; Obrtlík, Karel; Polák, Jaroslav

    308/2005, č. 86 (2005), s. 269-274 ISSN 1429-6055. [Metody oceny struktury oraz wlasności materialów i wyrobów. Ustroń-Jaszowiec, 07.12.2005-09.12.2005] Institutional research plan: CEZ:AV0Z20410507 Keywords : low cycle fatigue * superalloy * cyclic strain localization Subject RIV: JL - Materials Fatigue, Friction Mechanics

  19. Aerial Application of Acetaminophen treated Baits for Control of Brown Treesnakes

    Science.gov (United States)

    2016-01-22

    This procedure followed NWRC Analytical Method 96B -Determination of Acetaminophen in Tablets. Brown tree snake and non-target animal carcasses ...274 viii ACRONYM LIST APHIS Animal and Plant Health Inspection Service ATOC Aviation and Training Operations Center...native rodent abundance, and impacts to non-target animals . TECHNOLOGY DESCRIPTION Thawed DNM were treated by inserting an 80 mg acetaminophen

  20. Radial redistribution of gas connected to a distant galaxy versus galaxy encounter

    Czech Academy of Sciences Publication Activity Database

    Palouš, Jan; Jungwiert, Bruno; Jáchym, Pavel; Růžička, Adam

    2001-01-01

    Roč. 277, - (2001), s. 489 ISSN 0004-640X R&D Projects: GA AV ČR KSK1003601; GA AV ČR IAA3003705 Institutional research plan: CEZ:AV0Z1003909 Keywords : N-body codes * kinematics and dynamics ISM * galaxies * interactions Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 0.274, year: 2001

  1. El eco mallorquín de George Sand

    Directory of Open Access Journals (Sweden)

    M. Carme Figuerola

    2009-04-01

    Full Text Available A propósito de la obra de Llorenç Villalonga, Un été à Majorque. Roman traduit et présenté par Marie-France Borot (Clermont-Ferrand, Presses Universitaires Blaise Pascal, coll. «Cahiers romantiques»n° 15, 2008; 274 páginas, ISBN: 978-2-84516-390-4.

  2. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Reaction probabilities are reported up to a total energy of ∼ 3.0 eV, slightly above the energetic minimum of the seam of conical intersections at ∼ 2.74 eV. Reaction probabilities are calculated up to the total angular momentum, = 20 and for each value of , the projection quantum number is varied from 0 to min (, ...

  3. Hydrogeochemical and anthropogenic influence on the quality of ...

    African Journals Online (AJOL)

    Sixty percent (60%) of the groundwater samples were slightly acidic (5.5-6.4) and were different from the WHO (2004) standard for drinking water. Electrical conductivity values (3-274 μS/cm) and total dissolved solids (7.66 to 248.30 mg/l) for groundwater sources were low and signified low mineralisation and freshwater ...

  4. Arabidopsis EST1/SMG7-like protein is a novel regulator of meiotic cell cycle progression

    Czech Academy of Sciences Publication Activity Database

    Riehs, N.; Akimcheva, S.; Bulánková, P.; Idol, R.; Široký, Jiří; Shippen, D.; Schweizer, D.; Říha, K.

    2007-01-01

    Roč. 274, č. 1 (2007), s. 71 ISSN 1742-464X. [32nd FEBS Congress - Molecular Machines. 07.07.2007-12.07.2007, Vienna] R&D Projects: GA ČR(CZ) GA522/06/0380 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : meiosis * Arabidopsis * cell cycle Subject RIV: BO - Biophysics

  5. Physiopathologie et Pathologie des Affections du Rachis en Medecine Aerospatiale (Physiopathology and Pathology of Affections of the Spine in Aerospace Medicine),

    Science.gov (United States)

    1981-04-01

    blassuras en r6sultant. R.G. SNYDER (230) observe que 90 individus survivant aprbs des chutes libres variant entre 30 et 274 m~tres, 9 sont vivants apr~a...ea. Cette affection touchant i’homme jeune, n’a pas une r6partition gdographinue uniforme. Elle intdrease particui~rement ins sujets vivant autour du

  6. Conformational changes of the cytoplasmic part of Na+/K+-ATPase induced by the ligand binding

    Czech Academy of Sciences Publication Activity Database

    Kubala, Martin; Gryčová, Lenka; Lánský, Zdeněk; Otyepka, M.

    2007-01-01

    Roč. 274, Suppl.1 (2007), s. 127-127 ISSN 1742-464X. [FEBS Congress Molecular Machines /32./. 07.07.2007-12.07.2007, Vienna] R&D Projects: GA ČR(CZ) GA203/07/0564 Institutional research plan: CEZ:AV0Z50110509 Keywords : cpo1 * Na+/K+- ATPase * molecular dynamic simulations * fluorescence quenching Subject RIV: BO - Biophysics

  7. 76 FR 77029 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2011-12-09

    ... hours of fund accounting personnel at a total cost of $206.25 to prepare each Form N-17f-2;\\1\\ and (ii... Securities and Exchange Commission (the ``Commission'') has submitted to the Office of Management and Budget...-17f-2 (17 CFR 274.220) under the Investment Company Act is entitled ``Certificate of Accounting of...

  8. 17 CFR 270.30a-3 - Controls and procedures.

    Science.gov (United States)

    2010-04-01

    ... and procedures, within the 90-day period prior to the filing date of each report on Form N-CSR (§§ 249... to be disclosed by the investment company on Form N-CSR (§§ 249.331 and 274.128 of this chapter) and... include, without limitation, controls and procedures designed to ensure that information required to be...

  9. Hard X-ray activity of IGR J17473-2721

    DEFF Research Database (Denmark)

    Kuulkers, E.; Shaw, S.; Beckmann, V.

    2008-01-01

    Persistent X-ray activity has been reported by Swift/XRT (ATel #1459) and RXTE/PCA (ATel #1460) from the transient IGR J17473-2721 (= XTE J1747-274; ATels #467, #498) after the detection of an X-ray burst by SuperAGILE (ATel #1445). We report the detection of persistent activity at 18-100 keV wit...

  10. Linear optical absorption response of poly(vinylidene fluoride - trifluoroethylene) copolymers to high gamma dose

    International Nuclear Information System (INIS)

    Medeiros, Adriana S.

    2009-01-01

    Poly(vinylidene fluoride) [PVDF] is a semicrystalline linear homopolymer composed by the repetition of CH 2 - CF 2 monomers. The Poly(vinylidene fluoride-trifluoroethylene) [P(VDF-TrFE)] is a copolymer which is obtained with the random introduction of fluorinated CHF-CF 2 monomers in the PVDF main chain. PVDF, and also its copolymers with TrFE contents ranging from 18 to 63 wt. %, have long been studied for their striking ferroelectric properties and their applications in actuators, transducers and ferroelectric memory. Recent research work around the world have demonstrated that, for TrFE contents ranging from with 30 to 50 wt. %, the copolymer can have its ferroelectric properties modified by high doses of ionizing radiation, with the appearing of radio-induced relaxor ferroelectric features. These studies have lead us to investigate the possible use of these copolymers as high dose dosemeters, once the reported amount of induced C=C conjugated bonds after X-ray, UV and gamma irradiation seems to be a function of the delivered radiation dose. In a first investigation for doses ranging from 0.1 to 100 kGy we found out a linear relation between the gamma radiation dose and the absorption peak intensities in the UV region of the spectrum, i.e., at 223 and 274 nm. The absorption peak at 223 nm is the most sensitive to gamma rays and can be used for detecting gamma doses ranging from 0.3 to 75 kGy. Simultaneously, the absorption peak at 274 nm can be used for doses ranging from 1 to 100 kGy. Now, in the present work, we extended the investigation to gamma doses up to 3 MGy. Particularly, this study is focused in the optical absorption peak at 274 nm, corresponding to the radio-induction of triplets of conjugated C=C double bonds. The investigation revealed a linear correlation between the gamma dose and peak intensity at 274 nm for gamma doses ranging from 0.1 to more than 750 KGy, with a huge extension of the original usable dose range. Calorimetric data revealed a

  11. Impact of Positive Emotions Enhancement on Physiological Processes and Psychological Functioning in Military Pilots

    Science.gov (United States)

    2009-10-01

    behavioral therapy for bulimia nervosa: time course and mechanisms of change. Journal of Clinical consulting Psychology 2002, 20, 267-274. [44...RTO-MP-HFM-181 14 - 1 Impact of Positive Emotions Enhancement on Physiological Processes and Psychological Functioning in Military Pilots...practical tool using different techniques in order to improve regulation of emotions before, during and after actions [3]. This psychological training is

  12. Investigating the Usefulness of Operator Aids for Autonomous Unmanned Ground Vehicles Performing Reconnaissance Tasks

    Science.gov (United States)

    2013-09-01

    23 Appendix C. Example of Guilford−Zimmerman Spatial Orientation Assessment 25 Appendix D. Example of NASA - TLX Perceived Workload Assessment 27...4 Figure 3. Means plot for NASA - TLX scores by experimental condition (1= Short-Term Planner and Obstacle Map; 2= Short-Term...12 Figure 4. Means plot for NASA - TLX Mental Workload scores by experimental condition (1= Short-Term Planner

  13. Babesia microti (Piroplasmida: Babesiidae) in nymphal Ixodes ricinus (Acari: Ixodidae) in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Rudolf, Ivo; Golovchenko, Maryna; Šikutová, Silvie; Rudenko, Natalia; Grubhoffer, Libor; Hubálek, Zdeněk

    2005-01-01

    Roč. 52, č. 3 (2005), s. 274-276 ISSN 0015-5683 R&D Projects: GA ČR(CZ) GA206/03/0726 Institutional research plan: CEZ:AV0Z60930519; CEZ:AV0Z60220518 Keywords : Babesia microti * Ixodes ricinus Subject RIV: EE - Microbiology, Virology Impact factor: 1.138, year: 2005 http://folia.paru.cas.cz/pdfs/showpdf.php?pdf=20766

  14. High light acclimation of Chromera velia points to photoprotective NPQ

    Czech Academy of Sciences Publication Activity Database

    Belgio, Erica; Trsková, Eliška; Kotabová, Eva; Ewe, Daniela; Prášil, Ondřej; Kaňa, Radek

    2018-01-01

    Roč. 135, 1-3 SI (2018), s. 263-274 ISSN 0166-8595 R&D Projects: GA MŠk(CZ) LO1416; GA ČR(CZ) GA16-10088S; GA ČR(CZ) GJ17-02363Y Institutional support: RVO:61388971 Keywords : Nonphotochemical quenching * Photoinhibition * Chromera velia alga Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 3.864, year: 2016

  15. Objective of the regulatory system for the physical protection of facilities and nuclear materials

    International Nuclear Information System (INIS)

    Polo, Rolando

    1996-01-01

    During the work that is developed in our country in order to have a regulatory system, recommendation on the issue have been considered. Such recommendation are gathered in the informative regulation 225 rev, 3 of the IAEA and the requirements are collected in the Informative Regulation 274 rev 1 of the IAEA, as well as the good national and international practices

  16. Yeast plasma membrane Na/H antiporter - importance of OH groups in the 5th tms for activity and substrate specificity

    Czech Academy of Sciences Publication Activity Database

    Zimmermannová, Olga; Sychrová, Hana

    2007-01-01

    Roč. 274, Suppl.1 (2007), s. 127-127 ISSN 1742-464X. [FEBS Congress Molecular Machines /32./. 07.07.2007-12.07.2007, Vienna] R&D Projects: GA MŠk(CZ) LC531; GA AV ČR(CZ) IAA5011407 Institutional research plan: CEZ:AV0Z50110509 Keywords : cpo1 * Na/H antiporter * yeast * substrate specificity Subject RIV: EE - Microbiology, Virology

  17. Cloning and characterization of Sapp2p, the second aspartic proteinase isoenzyme from Candida parapsilosis

    Czech Academy of Sciences Publication Activity Database

    Merkerová, M.; Dostál, Jiří; Hradilek, Martin; Pichová, Iva; Hrušková-Heidingsfeldová, Olga

    2006-01-01

    Roč. 6, č. 7 (2006), s. 1018-1026 ISSN 1567-1356 R&D Projects: GA ČR(CZ) GA203/05/0038; GA ČR(CZ) GA303/04/0432; GA MŠk(CZ) LC531 Institutional research plan: CEZ:AV0Z40550506 Keywords : aspartic proteinase * Candida parapsilosis * zymogen conversion Subject RIV: CE - Biochemistry Impact factor: 2.274, year: 2006

  18. The richness and diversity of Lepidoptera species in different ...

    African Journals Online (AJOL)

    The family Nymphalidae was the most dominant one in the parc with 32.48%. The diversity index (H' and H'max) and the equitability (E) calculated for the 6 types of habitats is H'= 2,74 bits, H'max = 4,09 bits and E = 0,67 bits, meaning that the Lepidoptera species are at equilibrium with the different types of habitat which ...

  19. Precision Index in the Multivariate Context

    Czech Academy of Sciences Publication Activity Database

    Šiman, Miroslav

    2014-01-01

    Roč. 43, č. 2 (2014), s. 377-387 ISSN 0361-0926 R&D Projects: GA MŠk(CZ) 1M06047 Institutional support: RVO:67985556 Keywords : data depth * multivariate quantile * process capability index * precision index * regression quantile Subject RIV: BA - General Mathematics Impact factor: 0.274, year: 2014 http://library.utia.cas.cz/separaty/2014/SI/siman-0425059.pdf

  20. Studying dynamic events in the developing myocardium

    Czech Academy of Sciences Publication Activity Database

    Vostárek, František; Šaňková, Barbora; Sedmera, David

    2014-01-01

    Roč. 115, č. 2-3 (2014), s. 261-269 ISSN 0079-6107 R&D Projects: GA ČR(CZ) GAP302/11/1308; GA ČR(CZ) GA13-12412S Institutional support: RVO:67985823 Keywords : optical mapping * calcium imaging * high-speed cameras * embryo * heart * cardiac conduction system Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery Impact factor: 2.274, year: 2014

  1. Trinity River Bottom Sediment Reconnaissance Study. Phase I. Plan of Work. Appendices,

    Science.gov (United States)

    1976-11-30

    Reservoir at mid-lake n818.01 C Cedar Creek Reservoir at Kings Creek Arm at SH 0818.02 CS 274 south of Kemp Trinity River at SH 34 southwest of Rosser...I 1-3 Centrifuge, cont’d. 1. Timer, brake, adjustable speed 2. Top speed = 3200 RPM Shaka 1. 1/3 hp electric motor, Dayton Electric Manufacturing Co

  2. The effect of sex, slaughter weight and weight gains in PEN-AR-LAN ...

    African Journals Online (AJOL)

    The aim of the study was to determine the effect of sex, body weight and growth rates on basic fattening and slaughter indexes in PEN-AR-LAN fatteners. The research was conducted on 274 PEN-ARLAN hybrid fatteners coming from sows of the Naïma maternal line and was sired by boars of the P-76 meat line. Recorded ...

  3. Novel flavonolignan hybrid antioxidants: From enzymatic preparation to molecular rationalization

    Czech Academy of Sciences Publication Activity Database

    Vavříková, Eva; Křen, Vladimír; Ježová-Kalachová, Lubica; Biler, M.; Chantemargue, B.; Pyszková, M.; Riva, S.; Kuzma, Marek; Valentová, Kateřina; Ulrichová, J.; Vrba, J.; Trouillas, P.; Vacek, J.

    2017-01-01

    Roč. 127, FEB 15 (2017), s. 263-274 ISSN 0223-5234 R&D Projects: GA MŠk(CZ) LD14096; GA MŠk(CZ) LD15084; GA ČR(CZ) GA15-03037S Institutional support: RVO:61388971 Keywords : Silybin * Vitamin C * Enzymatic coupling Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology Impact factor: 4.519, year: 2016

  4. Just health: meeting health needs fairly

    National Research Council Canada - National Science Library

    Daniels, Norman

    2008-01-01

    ... Protection Medical Professionalism and the Care We Should Get 7 8 161 191 218 part iii uses 9 Fairness in Health Sector Reform Accountability for Reasonableness in Developing Countries: Two Applications Reducing Health Disparities: No Simple Matter Priority Setting and Human Rights 10 11 12 243 274 297 313 vP1: KAE CUNY1073-FM CUNY1073/Daniels 978 0 52...

  5. Adaptation response surfaces for managing wheat under perturbed climate and COinf2/infin a Mediterranean environment

    Czech Academy of Sciences Publication Activity Database

    Ruiz-Ramos, M.; Ferrise, R.; Rodríguez, A.; Lorite, I. J.; Bindi, M.; Carter, T. R.; Fronzek, S.; Palosuo, T.; Pirttioja, N. K.; Baranowski, P.; Buis, S.; Cammarano, D.; Chen, Y.; Dumont, B.; Ewert, F.; Gaiser, T.; Hlavinka, Petr; Hoffmann, H.; Höhn, J.; Jurečka, František; Kersebaum, K. C.; Krzyszczak, J.; Lana, M.; Mechiche-Alami, A.; Minet, J.; Montesino, M.; Nendel, C.; Porter, J. R.; Ruget, F.; Semenov, M. A.; Steinmetz, Z.; Stratonovitch, P.; Supit, I.; Tao, F.; Trnka, Miroslav; de Wit, H. A.; Rötter, R. P.

    2018-01-01

    Roč. 159, JAN (2018), s. 260-274 ISSN 0308-521X R&D Projects: GA MŠk(CZ) LO1415; GA MZe QJ1310123 Institutional support: RVO:86652079 Keywords : AOCK concept * Crop model ensemble * Mediterranean cropping system * Rainfed * Sensitivity analysis * Wheat adaptation Subject RIV: DG - Athmosphere Sciences, Meteorology OBOR OECD: Meteorology and atmospheric sciences Impact factor: 2.571, year: 2016

  6. The quality of the Florisbad spring-water in relation to the quality of ...

    African Journals Online (AJOL)

    drinie

    2001-01-01

    Jan 1, 2001 ... Nitrate. 0.733. 1.186. 0.901. 2.335. 4.807. Phosphate. 1.929. 0.100. 0.010. 0.010 ..... depth of 34 m, that six of the holes produced slightly saline water, and that ... Nitrogen. -. -. -. 27.4. 18.500. -. Methane. -. -. -. 6.9. 71.500. -. STABLE ... Ammonium bicarbonate (NH4HCO3) ... Aluminum oxide (Al2O3). 1.610.

  7. Utopia Cracks and Polygons

    Science.gov (United States)

    2003-01-01

    MGS MOC Release No. MOC2-339, 23 April 2003This Mars Global Surveyor (MGS) Mars Orbiter Camera (MOC) image shows a pattern of polygonal cracks and aligned, elliptical pits in western Utopia Planitia. The picture covers an area about 3 km (about 1.9 mi) wide near 44.9oN, 274.7oW. Sunlight illuminates the scene from the left.

  8. Nikkaji Dictionary: ジオキサジンバイオレット [MeCab user dictionary for science technology term[Archive

    Lifescience Database Archive (English)

    Full Text Available MeCab user dictionary for science technology term ジオキサジンバイオレット 名詞 一般 * * * * ジオキサジンバイオレット ... Nikkaji J1.274B 200906061557206375 C CA06 UNKNOWN_1 ジオキサジンバイオレット

  9. Characterisation of Zygosaccharomyces rouxii Na+/H+ antiporters

    Czech Academy of Sciences Publication Activity Database

    Přibylová, Lenka; Papoušková, Klára; Sychrová, Hana; de Montigny, J.

    2007-01-01

    Roč. 274, Suppl.1 (2007), s. 127-127 ISSN 1742-464X. [FEBS Congress Molecular Machines /32./. 07.07.2007-12.07.2007, Vienna] R&D Projects: GA ČR(CZ) GA204/05/0028 Institutional research plan: CEZ:AV0Z50110509 Keywords : cpo1 * Zygosaccharomyces rouxii * Na+/H+ antiporters * salt tolerance Subject RIV: EB - Genetics ; Molecular Biology

  10. Activation of trans geometry in bifunctional mononuclear platinum complexes by a non-bulky methylamine ligand

    Czech Academy of Sciences Publication Activity Database

    Frýbortová, M.; Nováková, Olga; Štěpánková, Jana; Novohradský, Vojtěch; Gibson, D.; Kašpárková, Jana; Brabec, Viktor

    2013-01-01

    Roč. 126, SEP2013 (2013), s. 46-54 ISSN 0162-0134 R&D Projects: GA ČR(CZ) GAP301/10/0598; GA ČR(CZ) GA13-08273S Institutional research plan: CEZ:AV0Z50040702 Institutional support: RVO:68081707 Keywords : HETEROCYCLIC AMINE LIGAND * INTERSTRAND CROSS-LINKS * DNA-BINDING MODE Subject RIV: BO - Biophysics Impact factor: 3.274, year: 2013

  11. Effect of corn silage particle size and level of soybean oil on ruminal ...

    African Journals Online (AJOL)

    To determine the effects of two corn silage particle size (coarse particle with geometric mean of 5.83 ± 2.47 mm and fine particle with geometric mean of 4.74 ± 2.74 mm) and two levels of soybean oil (0 and 4% of DM) on ruminal mat composition, distribution and consistency, four two years fistulated ruminant Zel ewes (BW ...

  12. Northwest Territories Power Corporation annual report 1992/93

    International Nuclear Information System (INIS)

    1993-06-01

    The Northwest Territories Power Corporation is a crown corporation of the government of the Northwest Territories. The Corporation operates diesel and hydroelectric production facilities to provide utility services on a self-sustaining basis in the Northwest Territories. Total revenue for 1992/93 amounted to $98,327,000 with $90,274,000 coming from the sale of power. Financial statements are presented. 3 figs

  13. Caramiphen edisylate as Adjunct to Standard Therapy attenuates soman-induced Seizures and Cognitive Deficits in Rats

    Science.gov (United States)

    2014-06-16

    705. Maren S. Pavlovian fear conditioning as a behavioral assay for hippocampus and amygdala function: cautions and caveats. Eur J Neurosci 2008;28... conditioning . Hear Res 2011;274:61–74. Weissman BA, Raveh L. Therapy against organophosphate poisoning: the importance of anticholinergic drugs with...whichmay lead to neuropathological damage and behavioral deficits. Caramiphen edisylate is an anticholinergic drug with antiglutamatergic properties

  14. Different depth intermittent sand filters for laboratory treatment of synthetic wastewater with concentrations close to measured septic tank effluent.

    Science.gov (United States)

    Rodgers, M; Walsh, G; Healy, M G

    2011-01-01

    The objective of this study was to apply hydraulic and chemical oxygen demand (COD) loading rates at the upper limits of the design criteria for buried sand filters to test the sand filter depth design criteria. Over a 274-day study duration, synthetic effluent with a strength of domestic wastewater was intermittently dosed onto two sand filters of 0.2 m diameter, with depths of 0.3 and 0.4 m. Hydraulic and organic carbon loading rates of 105 L m(-2) d(-1) and 40 g COD m(-2) d(-1), respectively, were applied to the filters. The filters did not clog and had good effluent removal capabilities for 274 and 190 days, respectively. However, the 0.3 m-deep filter did experience a reduced performance towards the end of the study period. In the 0.3 and 0.4 m-deep filters, the effluent COD and SS concentrations were less than 86 and 31 mg L(-1), respectively, and nitrification was nearly complete in both these columns. Ortho-phosphorus (PO(4)-P) removal in fine sand and laterite 'upflow' filters, receiving effluent from the 0.3 m-deep filter, was 10% and 44%, respectively.

  15. Evidence for fluctuations in statistical model cross sections from the study of {sup 27}Al(d,{alpha}) {sup 25}Mg reaction; Mise en evidence des fluctuations de sections efficaces du modele statistique par l'etude de la reaction {sup 27}Al(d,{alpha}) {sup 25}Mg

    Energy Technology Data Exchange (ETDEWEB)

    Papineau born Heller, L [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1965-06-01

    A complete set of experimental data has been obtained for the reaction {sup 27}Al(d, {alpha}){sup 25}Mg for excitation energies in the compound nucleus {sup 29}Si between 19.7 and 27.4 MeV, in order to compare with the theoretical predictions of the statistical model of nuclear reactions including fluctuations. Numerical calculations of the theoretical cross sections were made and contributions to methods of analysis of fluctuating excitation functions are given. The results confirm strong evidence for statistical fluctuations in nuclear cross sections. (author) [French] On a obtenu un ensemble complet de donnees experimentales de la reaction {sup 27}Al(d, {alpha}){sup 25}Mg pour des energies d'excitation du noyau compose {sup 29}Si comprises entre 19,7 et 27,4 MeV, permettant la comparaison avec les previsions theoriques du modele statistique des reactions nucleaires dans sa version complete comprenant les fluctuations. Des calculs numeriques de sections efficaces theoriques ont ete effectues et des contributions ont ete apportees aux methodes d'analyse de fonctions d'excitation presentant des fluctuations. Les resultats ont clairement confirme l'existence de fluctuations statistiques de sections efficaces. (auteur)

  16. The Brightest of Reionizing Galaxies Survey: Constraints on the Bright End of the z ~ 8 Luminosity Function

    Science.gov (United States)

    Bradley, L. D.; Trenti, M.; Oesch, P. A.; Stiavelli, M.; Treu, T.; Bouwens, R. J.; Shull, J. M.; Holwerda, B. W.; Pirzkal, N.

    2012-12-01

    We report the discovery of 33 Lyman-break galaxy candidates at z ~ 8 detected in Hubble Space Telescope Wide Field Camera 3 (WFC3) imaging as part of the Brightest of Reionizing Galaxies (BoRG) pure-parallel survey. The ongoing BoRG survey currently has the largest area (274 arcmin2) with Y 098 (or Y 105), J 125, and H 160 band coverage needed to search for z ~ 8 galaxies, about three times the current CANDELS area, and slightly larger than what will be the final CANDELS wide component with Y 105 data (required to select z ~ 8 sources). Our sample of 33 relatively bright Y 098-dropout galaxies have J 125-band magnitudes between 25.5 and 27.4 mag. This is the largest sample of bright (J 125 universe. Based on observations made with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy under NASA contract NAS5-26555. These observations are associated with programs 11519, 11520, 11524, 11528, 11530, 11533, 11534, 11541, 11700, 11702, 12024, 12025, and 12572.

  17. Proteome dynamics and physiological responses to short-term salt stress in Leymus chinensis leaves.

    Directory of Open Access Journals (Sweden)

    Jikai Li

    Full Text Available Salt stress is becoming an increasing threat to global agriculture. In this study, physiological and proteomics analysis were performed using a salt-tolerant grass species, Leymus chinensis (L. chinensis. The aim of this study is to understand the potential mechanism of salt tolerance in L. chinensis that used for crop molecular breeding. A series of short-term (<48 h NaCl treatments (0 ~ 700 mM were conducted. Physiological data indicated that the root and leaves growth were inhibited, chlorophyll contents decreased, while hydraulic conductivity, proline, sugar and sucrose were accumulated under salt stress. For proteomic analysis, we obtained 274 differentially expressed proteins in response to NaCl treatments. GO analysis revealed that 44 out of 274 proteins are involved in the biosynthesis of amino acids and carbon metabolism. Our findings suggested that L. chinensis copes with salt stress by stimulating the activities of POD, SOD and CAT enzymes, speeding up the reactions of later steps of citrate cycle, and synthesis of proline and sugar. In agreement with our physiological data, proteomic analysis also showed that salt stress depress the expression of photosystem relevant proteins, Calvin cycle, and chloroplast biosynthesis.

  18. Changes in the epidemiology of acute appendicitis and appendectomy in Danish children 1996-2004

    DEFF Research Database (Denmark)

    Andersen, S B; Paerregaard, A; Larsen, K

    2009-01-01

    PURPOSE: Aim of the study was to describe changes in the epidemiology of acute appendicitis in Danish children between 0-19 years of age for the period 1996-2004. METHODS: The study was based on discharge diagnoses taken from the Danish National Patient Registry of all 28 274 patients with a diag......PURPOSE: Aim of the study was to describe changes in the epidemiology of acute appendicitis in Danish children between 0-19 years of age for the period 1996-2004. METHODS: The study was based on discharge diagnoses taken from the Danish National Patient Registry of all 28 274 patients...... with a diagnosis of acute uncomplicated or complicated appendicitis, and/or a registered procedure code of appendectomy. These data were computed together with data on the background population, and incidences were calculated. RESULTS: A significant decrease in the incidence of acute uncomplicated appendicitis...... was found for all age groups (range, 13-36%). The decrease was present for both sexes, but most prominent in girls. The incidence of complicated acute appendicitis decreased by 10%. CONCLUSION: The incidence of acute appendicitis is declining. The incidence of uncomplicated appendicitis appears...

  19. Stress-relaxation tests in the work-hardening regime of tungsten single crystals below 300 K

    International Nuclear Information System (INIS)

    Brunner, D.

    2008-01-01

    The influence of work hardening on the results of stress-relaxation tests was studied for highly pure tungsten single crystals isothermally deformed at four temperatures of 274, 241, 131, and 78 K. A method accounting for strong work hardening on the determination of the strain-rate sensitivity from stress-relaxation tests is introduced by establishing special diagrams of SR tests denoted as YX diagrams

  20. Differences in the Fitness Levels of Urban and Rural Middle School Students in Croatia

    Science.gov (United States)

    Novak, Dario; Bernstein, Eve R.; Podnar, Hrvoje; Vozzolo, Yolanda

    2015-01-01

    Background: It is known that suburban youth are more fit than urban youth in Croatia. Method: Differences (p < 0.05) in fitness levels and motor abilities of 9,164 (F = 4,671, M = 4,493) Croatian children (age range: 11-14 years) from urban (F = 1,380, M = 1,268), mixed rural-urban (F = 274, M = 289), and rural (F = 3017, M = 2936) areas were…

  1. Naturalized alien flora of the world: species diversity, taxonomic and phylogenetic patterns, geographic distribution and global hotspots of plant invasion

    Czech Academy of Sciences Publication Activity Database

    Pyšek, Petr; Pergl, Jan; Essl, F.; Lenzer, B.; Dawson, W.; Kreft, H.; Weigelt, P.; Winter, M.; Kartesz, J.; Nishino, M.; Antonova, L. A.; Barcelona, J. F.; Cabezas, F. J.; Cárdenas, D.; Cárdenas-Toro, J.; Castanol, N.; Chacón, E.; Chatelain, C.; Dullinger, S.; Ebel, A. L.; Figueiredo, E.; Fuentes, N.; Genovesi, P.; Groom, Q. J.; Henderson, L.; Inderjit, Dr.; Kupriyanov, A.; Masciadri, S.; Maurel, N.; Meerman, J.; Morozova, O.; Moser, D.; Nickrent, D. L.; Nowak, P. M.; Pagad, S.; Patzelt, A.; Pelser, P. B.; Seebens, H.; Shu, W.-S.; Thomas, J.; Velayos, M.; Weber, E.; Wieringa, J. J.; Baptiste, M. P.; van Kleunen, M.

    2017-01-01

    Roč. 89, č. 3 (2017), s. 203-274 ISSN 0032-7786 R&D Projects: GA ČR GB14-36079G Grant - others:AV ČR(CZ) AP1002 Program:Akademická prémie - Praemium Academiae Institutional support: RVO:67985939 Keywords : GloNAF * alien plants * biogeography Subject RIV: EH - Ecology, Behaviour OBOR OECD: Plant sciences, botany Impact factor: 3.000, year: 2016

  2. 78 FR 45213 - Medicaid Program; State Allotments for Payment of Medicare Part B Premiums for Qualifying...

    Science.gov (United States)

    2013-07-26

    ... 9,166,126 NA NA 6,691,552......... 3.6701 3,027,397......... NA 12,830,281 New Mexico 10 0.75 5,468... whose incomes are at least 120% but less than 135% of federal poverty level. Source: Census Bureau... 9,901,642 NA NA 11,318,885........ 7.0247 7,274,411......... NA 13,946,116 New Mexico 9 0.62 4,774...

  3. Identification of Candidate Zero Maintenance Paving Materials. Volume 1

    Science.gov (United States)

    1977-05-01

    Con Azufre," Proceedings, Second Interna- tional Seminar on Concrete Technology, Inscituto de Ingenieria Civil de la Universidad Autonoma de Nuevo Leon...Seminar on Concrete Technology, ]nstituto de Ingenieria Civil de la Univarsidad Autonoma de Nuevo Leon, Monterrey, Mexico, Mcr 1975, pp 261-274. 49...Seminario Internacional Sobre Technologia del Concrete, Insti- tute de Ingenieria Civil de la Universidad Autononia de Nuevo Leon, Monterrey, N. L., Mexico

  4. Beyond the Washington Consensus: Promoting Economic Growth and Minimizing the Threat of Violence in Latin America through Social Development

    Science.gov (United States)

    2012-03-01

    pp. 247–274. Mankiw , N. Gregory, David Romer, and David N. Weil. “A Contribution to the Empirics of Economic Growth.” The Quarterly Journal...WASHINGTON CONSENSUS: PROMOTING ECONOMIC GROWTH AND MINIMIZING THE THREAT OF VIOLENCE IN LATIN AMERICA THROUGH SOCIAL DEVELOPMENT by Eric J. Blomberg...Washington Consensus: Promoting Economic Growth and Minimizing the Threat of Violence in Latin America through Social Development 5. FUNDING NUMBERS

  5. Annual Progress Report FY-91. Volume 1 and 2.

    Science.gov (United States)

    1992-03-12

    Yancy LTC MC. The Effect of Face Mask CPAP on 258 Radionuclide Ventilation Perfusion Scanning of the Lung in the Setting of Postoperative...infarction, 109, 111, 464 myocardial ischemia, 464 nail bands, 125 narcolepsy, 274 narcotics, 458, 461 nasal CPAP , 257, 258 natural history, 46, 53, 101...formalin-fixed, paraffin-embedded) or flash frozen for immune cell phenotyping. Routine histochemistry, special stains, and immune cell phenotyping

  6. Parallel single-cell analysis of active caspase-3/7 in apoptotic and non-apoptotic cells

    Czech Academy of Sciences Publication Activity Database

    Ledvina, Vojtěch; Janečková, Eva; Matalová, Eva; Klepárník, Karel

    2017-01-01

    Roč. 409, č. 1 (2017), s. 269-274 ISSN 1618-2642 R&D Projects: GA ČR(CZ) GA14-28254S Institutional support: RVO:68081715 ; RVO:67985904 Keywords : single-cell analysis * bioluminescence * apoptosis * caspase-3/7 Subject RIV: CB - Analytical Chemistry , Separation; EB - Genetics ; Molecular Biology (UZFG-Y) OBOR OECD: Analytical chemistry ; Developmental biology (UZFG-Y) Impact factor: 3.431, year: 2016

  7. Reaction of tricyclopentadienyl uranium chloride (C5H5)3UCl with triethylaluminium Al(C2H5)3

    International Nuclear Information System (INIS)

    Vasil'ev, V.K.; Sokolov, V.N.; Kondratenkov, G.P.

    1977-01-01

    The mechanism of reaction of tricyclopentadienyluranchloride with triethylaluminium was studied by the NMR 1 method. The kinetic and thermodynamic parameters of this reaction (k=(6+-1)x10 5 sec -1 , E=27+-4 kJ/molxK) were estimated from the temperature dependence of the chemical shifts with due regard for the paramagnetic shift and the half-width of the averaged-signal line

  8. Non-linear time reversal ultrasonic pseudo-tomography

    Czech Academy of Sciences Publication Activity Database

    Převorovský, Zdeněk; Vejvodová, Šárka; Krofta, Josef; Převorovský, David

    2011-01-01

    Roč. 6, 3/4 (2011), s. 206-213 ISSN 1741-8410. [NDT in Progress. Praha, 05.11.2007-07.11.2007] R&D Projects: GA MPO(CZ) FR-TI1/274 Institutional research plan: CEZ:AV0Z20760514 Keywords : NDT * nonlinear elastic wave spectroscopy * time reversal mirrors * ultrasonic pseudo-tomography Subject RIV: BI - Acoustics http://www.inderscience.com/offer.php?id=43216

  9. Spectral Classification of MASTER J174041.78+272632.4

    Science.gov (United States)

    Silverman, J. M.; Cohen, D. P.; Filippenko, A. V.

    2012-06-01

    We report that inspection of a CCD spectrum (range 340-1000 nm), obtained on June 27.4 UT with the Shane 3-m reflector (+ Kast spectrograph) at Lick Observatory, shows that MASTER J174041.78+272632.4 (ATel #4213) is a Galactic variable star. Hydrogen Balmer absorption superposed with weak, narrow emission is detected at redshift 0. The spectrum roughly resembles that of a B[e] star.

  10. Evaluation de la mise en oeuvre des mesures de radioprotection ...

    African Journals Online (AJOL)

    Résultats : Sur les 62 services de radiologie recensés, 27.4% avaient des surfaces des salles comprises entre 10-20 m2 et 87.6% avaient des parois en briques pleines. Les portes des services étaient en bois dans 67.7% et en aluminium dans 32.3%. La grande majorité (95.2%) de ses portes étaient plombées.

  11. A Proposed Cosmology of Identity in the Sociotechnical Ecosystem of Homeland Security

    Science.gov (United States)

    2017-12-01

    Directions in the Sociology and History of Technology (Cambridge, MA: MIT Press, 1987), 274. 21 Robert Ardrey, The Hunting Hypothesis: A Personal Conclusion...E., Thomas P. Hughes, and Trevor J. Pinch, eds. The Social Construction of Technological Systems: New Directions in the Sociology and History of...explores how identity and technology interact in the context of terrorism and conflict. This relationship is important to understand because

  12. Convention on the physical protection of nuclear material

    International Nuclear Information System (INIS)

    1990-08-01

    The document refers to the Convention on the Physical Protection of Nuclear Material (INFCIRC/274). Part I contains reservations/declarations made upon or following signature and Part II contains reservations/declarations made upon or following deposit of instrument of consent to be bound. The status of signature, ratification, acceptance, approval or accession by States or organizations as of 31 July 1990 is presented in an attachment

  13. Prediktivní řízení pro mechatronické systémy

    Czech Academy of Sciences Publication Activity Database

    Belda, Květoslav; Böhm, Josef

    2007-01-01

    Roč. 50, č. 4 (2007), s. 272-274 ISSN 0005-125X R&D Projects: GA ČR GP102/06/P275; GA ČR(CZ) GA102/05/0271 Institutional research plan: CEZ:AV0Z10750506 Keywords : predictive control * mechatronic systems * model-based control * real-time control Subject RIV: BC - Control Systems Theory http://library.utia.cas.cz/separaty/historie/belda-0081426.pdf

  14. Reactions of H2O3 in the pulse-irradiated Fe(II)-O2 system

    DEFF Research Database (Denmark)

    Sehested, Knud; Bjergbakke, Erling; Lang Rasmussen, O.

    1969-01-01

    G(Fe(III)] is measured in pulse-irradiated O2-saturated solutions of 20 to 160 μMFe(II), at the p H's 0.46, 1.51, and 2.74 H2SO4 and HClO4 and with dose rates between 1 and 8 krad/1 μsec pulse. Based on homogeneous kinetics, the results are interpreted by a system of 18 reactions. The formation...

  15. Resistência a antimicrobianos de Escherichia coli isolada de dejetos suínos em esterqueiras

    OpenAIRE

    Silva,F.F.P.; Santos,M.A.A.; Schmidt,V.

    2008-01-01

    The antimicrobial resistance of 96 Escherichia coli strains isolated from a stabilization pond system on a pig-breeding farm was evaluated. Strains were tested for their resistance against 14 antimicrobial using the agar diffusion method. E. coli strains showed resistance to tetracycline (82.3%), nalidixic acid (64%), ampicilin (41%), sulfamethoxazole/trimethoprin (36%), sulfonamide (34%), cloranphenicol (274%), ciprofloxacin (19%), cefaclor (16%), streptomicyn (7.3%), neomicyn (1%), amoxacil...

  16. Antibiotic-resistance of Escherichia coli isolates from stored pig slurry

    OpenAIRE

    Silva, F.F.P.; Santos, M.; Schmidt, Veronica

    2008-01-01

    The antimicrobial resistance of 96 Escherichia coli strains isolated from a stabilization pond system on a pig-breeding farm was evaluated. Strains were tested for their resistance against 14 antimicrobial using the agar diffusion method. E. coli strains showed resistance to tetracycline (82.3%), nalidixic acid (64%), ampicilin (41%), sulfamethoxazole/trimethoprin (36%), sulfonamide (34%), cloranphenicol (274%), ciprofloxacin (19%), cefaclor (16%), streptomicyn (7.3%), neomicyn (1%), amoxacil...

  17. Parallel single-cell analysis of active caspase-3/7 in apoptotic and non-apoptotic cells

    Czech Academy of Sciences Publication Activity Database

    Ledvina, Vojtěch; Janečková, Eva; Matalová, Eva; Klepárník, Karel

    2017-01-01

    Roč. 409, č. 1 (2017), s. 269-274 ISSN 1618-2642 R&D Projects: GA ČR(CZ) GA14-28254S Institutional support: RVO:68081715 ; RVO:67985904 Keywords : single-cell analysis * bioluminescence * apoptosis * caspase-3/7 Subject RIV: CB - Analytical Chemistry, Separation; EB - Genetics ; Molecular Biology (UZFG-Y) OBOR OECD: Analytical chemistry; Developmental biology (UZFG-Y) Impact factor: 3.431, year: 2016

  18. Nonlinear elastic wave spectroscopy in symbiosis with time reversal for localization of defects: TR-NEWS

    Czech Academy of Sciences Publication Activity Database

    Dos Santos, S.; Vejvodová, Šárka; Převorovský, Zdeněk

    2009-01-01

    Roč. 19, č. 2 (2009), s. 14-14 ISSN 1213-3825. [NDT in PROGRESS. 12.11.2009-14.11.2009, Praha] R&D Projects: GA ČR GA106/07/1393; GA MPO(CZ) FR-TI1/274 Institutional research plan: CEZ:AV0Z20760514 Keywords : nonlinear elastic wave spectroscopy (NEWS) * ESAM * time reversal (TR) * TR-NEWS imaging * tomography * DORT Subject RIV: BI - Acoustics

  19. Alternative Fuels Data Center: Alaska Transportation Data for Alternative

    Science.gov (United States)

    fuels Fuel Public Private Biodiesel (B20 and above) 0 0 Compressed Natural Gas (CNG) 1 0 Electric 8 0 Coast Region National Average per unit sold per GGE per unit sold per GGE Biodiesel (B20) $3.01/gallon $2.74/GGE $2.84/gallon $2.58/GGE Biodiesel (B99-B100) $3.61/gallon $3.57/GGE $3.48/gallon $3.45/GGE

  20. Effects of the free fatty acid content in yellow grease on performance, carcass characteristics, and serum lipids in broilers.

    Science.gov (United States)

    Wu, H; Gong, L M; Guo, L; Zhang, L Y; Li, J T

    2011-09-01

    This study was conducted to investigate whether the free fatty acid (FFA) content of yellow grease would influence the performance and carcass characteristics of broiler chicks. A total of 432 one-day-old, male Arbor Acres broilers were randomly allotted to 1 of 4 treatments, with each treatment being applied to 6 pens of 18 chicks. The dietary treatments were based on corn and soybean meal and were supplemented with either soybean oil (2.86% FFA) or yellow grease with a low (2.74%), medium (12.59%), or high (19.05%) FFA content. The fat sources were supplemented at 1.5% of the diet during the starter phase (0 to 21 d) and at 3.0% of the diet during the grower phase (22 to 42 d). From d 0 to 42, the BW gains of chicks fed diets containing soybean oil and yellow grease with 2.74% FFA were similar. As the FFA level in the yellow grease increased, the BW gain of chicks decreased (P dressing percentage and the percentage of breast muscle in the carcass were significantly (P < 0.01) lower for broilers fed any yellow grease diet compared with birds fed soybean oil. In contrast, abdominal fat was significantly increased in diets containing yellow grease. These results demonstrate that the performance of birds fed yellow grease with a low content of FFA was essentially equal to that of birds fed soybean oil. However, because yellow grease samples containing FFA levels greater than 2.74% negatively affected bird performance, producers should exercise caution with regard to feeding broilers yellow grease with an elevated FFA content. In 42-d-old broilers, serum total cholesterol and low-density lipoprotein cholesterol levels were elevated in birds fed yellow grease, regardless of the dietary level. In contrast, serum high-density lipoprotein cholesterol and triglyceride levels were unaffected by dietary treatment. Although dietary FFA may influence triglyceride-rich lipoprotein metabolism in broilers, an explanation for the observed effects remains elusive.

  1. [Prevalence of vegetarians and vegetarian's health dietary behavior survey in Shanghai].

    Science.gov (United States)

    Mao, Xuanxia; Shen, Xiuhua; Tang, Wenjing; Zhao, Ye; Wu, Fan; Zhu, Zhenni; Tang, Qingya; Cai, Wei

    2015-03-01

    To assess the prevalence of vegetarians in the whole Shanghai population, and to know the vegetarians' brief and behavior on diet, nutrition and health. First, a multi-staged, stratified, clustered random sampling design was used. A total representative sample of 4 004 Shanghai resident subjects were asked if they were vegetarians and what type of vegetarian they were by a well-designed questionnaire. Second, from ten vegetarian restaurants located in Shanghai. 473 adult vegetarians completed a questionnaire about vegetarian status, among whom 274 vegetarians completed a detailed questionnaire about their brief and behaviors on diet, nutrition and health status. Of 4 004 subjects, 0.77% were vegetarians (0.45% were lacto-vegetarians and 0. 12% were vegans). The average age was 65. 0 years. 74. 2% of the vegetarians were female. Of 473 vegetarians, 70. 2% of the vegetarians had college or higher education. Compared to vegans, lacto-ovo-vegetarians were significantly younger and had higher educational level. The main reasons for choosing a vegetarian lifestyle were religion (49. 3%) and health (31. 3%). Furthermore, more vegan tend to be Buddhist. Vegetarians were more concerned about their health (209/274, 76. 5%) , the consumption of balance diets (183/274, 66. 8%). Comparing with lacto-ovo-vegetarians (58. 3%) more vegans (70. 4%) believed in that vegetarian diet is a kind of healthy dietary pattern and will not have any nutrients deficiency (P = 0. 037). Vegetarians consumed more healthy foods (e. g.,whole grains, vegetables, soy products, and nuts) than the general population (P < 0. 01). Only 5. 8% of the vegetarians took dietary supplements. 0. 77% of population in Shanghai was vegetarian. The two main reasons for adopting a vegetarian lifestyle were religion and health. The vegetarians tend to have more nutrition knowledge, better attitude and behavior on health. However, most of the vegetarians had not realized the nutrient deficiency risk of vegetarian

  2. Clonal dissemination, emergence of mutator lineages and antibiotic resistance evolution in Pseudomonas aeruginosa cystic fibrosis chronic lung infection.

    Directory of Open Access Journals (Sweden)

    Carla López-Causapé

    Full Text Available Chronic respiratory infection by Pseudomonas aeruginosa is a major cause of mortality in cystic fibrosis (CF. We investigated the interplay between three key microbiological aspects of these infections: the occurrence of transmissible and persistent strains, the emergence of variants with enhanced mutation rates (mutators and the evolution of antibiotic resistance. For this purpose, 10 sequential isolates, covering up to an 8-year period, from each of 10 CF patients were studied. As anticipated, resistance significantly accumulated overtime, and occurred more frequently among mutator variants detected in 6 of the patients. Nevertheless, highest resistance was documented for the nonmutator CF epidemic strain LES-1 (ST-146 detected for the first time in Spain. A correlation between resistance profiles and resistance mechanisms evaluated [efflux pump (mexB, mexD, mexF, and mexY and ampC overexpression and OprD production] was not always obvious and hypersusceptibility to certain antibiotics (such as aztreonam or meropenem was frequently observed. The analysis of whole genome macrorestriction fragments through Pulsed-Field Gel Electrophoresis (PFGE revealed that a single genotype (clone FQSE-A produced persistent infections in 4 of the patients. Multilocus Sequence typing (MLST identified clone FQSE-A as the CF epidemic clone ST-274, but striking discrepancies between PFGE and MLST profiles were evidenced. While PFGE macrorestriction patterns remained stable, a new sequence type (ST-1089 was detected in two of the patients, differing from ST-274 by only two point mutations in two of the genes, each leading to a nonpreviously described allele. Moreover, detailed genetic analyses revealed that the new ST-1089 is a mutS deficient mutator lineage that evolved from the epidemic strain ST-274, acquired specific resistance mechanisms, and underwent further interpatient spread. Thus, presented results provide the first evidence of interpatient dissemination

  3. Quimioprofilaxis para evitar la colonización materna por estreptococo grupo B: consecuencias de no adoptar la recomendación internacional Maternal chemoprophylaxis against group B Streptococcus colonization: the consequences of not adopting the international recommendation

    Directory of Open Access Journals (Sweden)

    Jesús Reyna-Figueroa

    2008-04-01

    Full Text Available OBJETIVO: Conocer el criterio para la quimioprofilaxis en mujeres embarazadas colonizadas con Streptococcus agalactiae (SGB y las repercusiones de la infección en México. MATERIAL Y MÉTODOS: Se identificó a mujeres embarazadas con SGB mediante el cultivo cervicovaginal y/o urinario en una revisión de cinco años. Se formaron dos grupos: con uso de quimioprofilaxis, el primero, y sin uso de la misma, el segundo. Con base en la utilización de la prueba de ji cuadrada se determinó la diferencia de proporciones. La aproximación de ji cuadrada para la distribución de Poisson comparó los promedios de la infección neonatal. RESULTADOS: Se notificaron 274 cultivos positivos para SGB en 261 pacientes; 165 (60.2% cervicovaginales, 109 (39.7% urinarios, y en 13 pacientes (4.7% se obtuvo resultado positivo en ambos. De las 261 pacientes, 53 (5.6% recibieron profilaxis intraparto (pOBJECTIVE: To know the criteria which determine the chemoprophylaxis on pregnant women colonized by Streptococcus agalactiae (GBS and the impact in our environment. MATERIAL AND METHODS: A retrospective analysis, identifying pregnant women with isolation of Streptococcus agalactiae on screening cultures, cervical swabs and urine culture. Two groups were analyzed, group 1 received chemoprophylaxis, and group 2 without chemoprophylaxis. Chi square was used to asses the difference between proportions. Chi square approximation to Poisson distribution was used to compare the means of neonatal infection. RESULTS: A total of 274 cultures were reported with GBS isolation, on 261 patients; 165 (60.2% cervical swabs, 109 (39.7% urine culture and 13 patients from 274 (4.7% had positive culture on both specimens. Of this 261 patients, 53 (5.6% received chemoprophylaxis during labor (p<0.05. The CDC criteria were followed accuracy on 29.2%. CONCLUSIONS: There have not been established criteria for screening colonization by GBS in Mexican pregnant women.

  4. Antiviral drug profile of human influenza A & B viruses circulating in India: 2004-2011

    Directory of Open Access Journals (Sweden)

    V A Potdar

    2014-01-01

    Full Text Available Background & objectives: Recent influenza antiviral resistance studies in South East Asia, Europe and the United States reveal adamantane and neuraminidase inhibitor (NAIs resistance. This study was undertaken to evaluate antiviral resistance in influenza viruses isolated from various parts of India, during 2004 to 2011. Methods: Influenza viruses were analyzed genetically for known resistance markers by M2 and NA gene sequencing. Influenza A/H1N1 (n=206, A/H3N2 (n=371 viruses for amantadine resistance and A/H1N1 (n=206, A/H3N2 (n=272 and type B (n=326 for oseltamivir resistance were sequenced. Pandemic (H1N1 (n= 493 isolates were tested for H274Y mutation by real time reverse transcription (rRT-PCR. Randomly selected resistant and sensitive influenza A/H1N1 and A/H3N2 viruses were confirmed by phenotypic assay. Results: Serine to asparagine (S3IN mutation was detected in six isolates of 2007-2008.One dual-resistant A/H1N1 was detected for the first time in India with leucine to phenylalanine (L26F mutation in M2 gene and H274Y mutation in NA gene. A/H3N2 viruses showed an increase in resistance to amantadine from 22.5 per cent in 2005 to 100 per cent in 2008 onwards with S3IN mutation. Fifty of the 61 (82% A/H1N1 viruses tested in 2008-2009 were oseltamivir resistant with H274Y mutation, while all A/H3N2, pandemic A/H1N1 and type B isolates remained sensitive. Genetic results were also confirmed by phenotypic analysis of randomly selected 50 resistant A/H1N1 and 40 sensitive A/H3N2 isolates. Interpretation & conclusions: Emergence of influenza viruses resistant to amantadine and oseltamivir in spite of negligible usage of antivirals emphasizes the need for continuous monitoring of antiviral resistance.

  5. In vitro Embryogenesis Derived from Shoot Tips in Mass Propagation of Two Selected-Clones of Phalaenopsis

    Directory of Open Access Journals (Sweden)

    Budi WINARTO

    2016-09-01

    Full Text Available Phalaenopsis is of high economic value and market demand in Indonesia; however, orchid products are mostly imported from other countries. ‘Kristina Dwi’ (KD 69.274 and ‘Dedeh’ (D 802.28 are two selected clones with high potential utilized and developed commercially. To support their commercialization, a reliable in vitro propagation protocol is essential.  In the current study, an in vitro mass propagation protocol for KD 69.274 and D 802.28 clones was successfully established using shoot tips as explant sources. A high number of embryos, up to 8.2 embryos per explant, with 58.5% explant regeneration, and 3.5 regenerated-explants in average were regenerated from shoot tips of KD 69.274 clone cultured on  half-strength Murashige and Skoog (MS medium, with full strength micro, Fe-chellate and vitamin containing 0.5 mg/L thidiazuruon (TDZ and 0.25 mg/L N6-benzyladenine (BA. The initial embryos were proliferated by culturing embryos individually on half-strength MS medium with 0.13 mg/L TDZ and 0.25 mg/L BA and resulted in high embryo regeneration up to 91.4%, with 10.2 embryos per explant and no embryo browning. The embryos were multiplied under periodical subcultures of 3 months each, resulting in gradual increasing number of embryos from the first subculture till the fifth subculture, with 23.6 embryos produced, then declined afterward. The embryos were easily germinated on half-strength MS medium with full strength of vitamin and hormone free, with 73.9% embryo germination and 14.9 germinated embryos. Healthy plantlets were stimulated on the same medium with 2 g/L activated charcoal (AC and successfully acclimatized on Cycas rumphii bulk, with 88.3% survival plantlets. Finally, it can be summarized that a new in vitro mass propagation protocol, as new alternative choice for Phalaenopsis propagation, was successfully established.

  6. El mito del Político (268 D-274 E y la historia de las religiones

    Directory of Open Access Journals (Sweden)

    Giovanni Casadio

    1996-06-01

    Full Text Available The importance of a religious-historical approach for an appropriate understanding of the myth in Plato's Statesman has not been sufficiently emphasized yet. The myth substantially describes the life of the world as two revolutions of the same circle, the ane forward and the ather backward. In the forward revolution God accompanies the world; during the latter he remains in his watch-tower. Within the framework of this myth, which establishes the current philosophical doctrine of the alternating world-periods, we find more or less developed allusions to other well-known themes of the Greek lore: the Golden age, the kingdom of Cronus, the Earth-born Men (gegeneis ... My aim is to reassess the specificity of this Platonic mythopoeia setting it in the general context of ancient religion. In the first part I characterize the motif of the absence of God against the background of the phenomenological -and historical- category of the deus otiosus (with examples derived from the middle-Platonic and gnostic domains. In the second part 1 consider the problem of the source (or sources of evil: apparently the corporeal principle (τὸ σωματοειδές, more properly the state of precosmical chaos. Finally, the question is raised of Plato's dualism in this context: whether radical or mitigated.

  7. Results from a hadron jet experiment at √s = 19.4 and 27.4 GeV

    International Nuclear Information System (INIS)

    Arenton, M.W.; Chen, H.F.; Corcoran, M.

    1984-01-01

    In Fermilab experiment E609 we have studied the production of high p/sub t/ hadron jets by beams of protons at 200 and 400 GeV/c and pions at 200 GeV/c. Results for the single-jet and di-jet cross sections are given and are compared to QCD predictions. Leading-particle charge ratios from di-jet events are given and compared to QCD-motivated predictions. Evidence is presented concerning a higher twist effect in πp interactions as predicted by Berger and Brodsky. Preliminary results on high transverse energy events from nuclear targets are given. Finally, we present comparisons of our pp high E/sub t/ data with predictions from two Monte Carlo models. 12 references

  8. Survey of 274 patients with conjunctival neoplastic lesions in Farabi Eye Hospital, Tehran 2006–2012

    Directory of Open Access Journals (Sweden)

    Fahimeh Asadi-Amoli

    2015-03-01

    Conclusion: SCC is the most common conjunctival epithelial neoplasm in this study, and its prevalence in males is nearly two times higher than in females. The high percentage of squamous cell carcinoma can likely be attributed to elevated sun exposure and ultraviolet light in Iran.

  9. Three-and four-wave model of modulation instability fiber laser

    Czech Academy of Sciences Publication Activity Database

    Honzátko, Pavel; Peterka, Pavel; Kaňka, Jiří

    2002-01-01

    Roč. 4, č. 5 (2002), s. S135-S139 ISSN 1464-4258 R&D Projects: GA ČR GA102/99/0393; GA ČR GA102/98/P235 Institutional research plan: CEZ:AV0Z2067918 Keywords : fibre lasers * optical pulse generation * multiwave mixing Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.274, year: 2002 http://www.ufe.cz/~peterka/opera/Honzatko02_oa2560.pdf

  10. The Use of Multi-Criteria Evaluation and Network Analysis in the Area Development Planning Process

    Science.gov (United States)

    2013-03-01

    investigated in information richness theory , also referred to as media richness theory . Fundamentally, this theory addresses “the ability of information to... neoclassical economics in the 1970s (Carver, 2007). This development was driven by a need to adequately weigh the negative impacts of ill defined consequences...Media Richness Theory in the New Media: The Effects of Cues, Feedback, and Task Equivocality. Information System Research , 256-274. Department of

  11. Support for the Microgenderome: Associations in a Human Clinical Population

    OpenAIRE

    Amy Wallis; Henry Butt; Michelle Ball; Donald P. Lewis; Dorothy Bruck

    2016-01-01

    The ?microgenderome? provides a paradigm shift that highlights the role of sex differences in the host-microbiota interaction relevant for autoimmune and neuro-immune conditions. Analysis of cross-sectional self-report and faecal microbial data from 274 patients with Myalgic Encephalomyelitis/Chronic Fatigue Syndrome (ME/CFS) suggests that commensal gut microorganisms may play both protective and deleterious roles in symptom expression. Results revealed significant sex-specific interactions b...

  12. Experimental Investigation of Latent Heat Thermal Energy Storage for Bi-Modal Solar Thermal Propulsion (Briefing Charts)

    Science.gov (United States)

    2014-07-01

    handled by the “enthalpy method” ** Movie File to Be Added Here** DISTRIBUTION STATEMENT A: Approved for public release; distribution is...irreparable damage to quartz chamber window • Gradually increase power until thermal equilibrium is achieved • Use “shutter curtain” to quickly cut...274 0.4 289 0.8 312 1 322 • Incomplete dissociation will lower performance • Equilibrium calculations for 1500 K solar thermal thruster

  13. Emergency Support Function 15 Standard Operating Procedures

    Science.gov (United States)

    2013-08-01

    External Affairs Officer for Planning and Products (AEPP) Reports to the ESF #15 EAO and oversees all activities involving research and writing ...PAD, their desire and capability to support media embeds. 2.7.4 Freelance media will be authorized access if they are selected by a news...coordination with other Federal, State, tribal, territorial and local and private-sector counterparts as appropriate. 3.2 Research and writing This is

  14. Works notice

    CERN Multimedia

    GS Department

    2009-01-01

    We would like to inform you that renovation work on the road lighting equipment will take place on the Meyrin site between 19 October and 18 December 2009. During this period, traffic will be disrupted on the Schrödinger, Perrin and Siegbahn roads, ie from Building 274 to Building 188. We request that you comply with the road signs and thank you for your understanding. GS-SEM Group

  15. The Role of Perceived Maternal Favoritism in Sibling Relations in Midlife

    OpenAIRE

    Suitor, J. Jill; Sechrist, Jori; Plikuhn, Mari; Pardo, Seth T.; Gilligan, Megan; Pillemer, Karl

    2009-01-01

    Data were collected from 708 adult children nested within 274 later-life families from the Within-Family Differences Study to explore the role of perceived maternal favoritism in the quality of sibling relations in midlife. Mixed-model analyses revealed that regardless of which sibling was favored, perceptions of current favoritism and recollections of favoritism in childhood reduced closeness among siblings. Recollections of maternal favoritism in childhood were more important than perceptio...

  16. Turkish ELT students' willingness to communicate in English

    OpenAIRE

    Şener, Sabriye

    2014-01-01

    This paper aims to present the willingness to communicate (WTC) in English of the English Language Teaching Department (ELT) students of Çanakkale Onsekiz Mart University inside and outside the class. Additionally, the relationships among students’ willingness to communicate in English, their linguistic self-confidence, motivation, attitudes toward international community, and personality will be presented. To this end, quantitative data were gathered from 274 students studying at the departm...

  17. Analysis of Conflict Centers in Projects Procured with Traditional and Integrated Methods in Nigeria

    OpenAIRE

    Martin O. Dada

    2012-01-01

    Conflicts in any organization can either be functional or dysfunctional and can contribute to or detract from the achievement of organizational or project objectives. This study investigated the frequency and intensity of conflicts, using five conflict centers, on projects executed with either the integrated or traditional method in Nigeria. Questionnaires were administered through purposive and snowballing techniques on 274 projects located in twelve states of Nigeria and Abuja. 94 usable ...

  18. Regulation of the Metabolism of Polyunsaturated Fatty Acids and Butyrate in Colon Cancer Cells

    Czech Academy of Sciences Publication Activity Database

    Hofmanová, Jiřina; Vaculová, Alena; Kozubík, Alois

    2013-01-01

    Roč. 14, č. 3 (2013), s. 274-288 ISSN 1389-2010 R&D Projects: GA ČR(CZ) GA524/07/1178; GA ČR(CZ) GA301/07/1557; GA ČR(CZ) GAP301/11/1730 Institutional research plan: CEZ:AV0Z50040702 Institutional support: RVO:68081707 Keywords : NF-KAPPA-B * HUMAN COLORECTAL - CANCER * INFLAMMATORY BOWEL DISEASES Subject RIV: BO - Biophysics Impact factor: 2.511, year: 2013

  19. Convention on the physical protection of nuclear materials

    International Nuclear Information System (INIS)

    1997-01-01

    The document refers to the Convention on the Physical Protection of Nuclear Material (IAEA-INFCIRC-274), including in Part I the status list of signature, ratification, acceptance, approval, accession or succession by States or organizations as of 31 December 1996, in Part II the texts of reservations/declarations made upon or following expressing consent to be bound, and in Part III the texts of reservations/declarations made upon signature

  20. Special Advanced Studies for Pollution Prevention. Delivery Order 0046: Advanced Studies in Pollution Prevention Chrome Replacements for Internal and Small Parts

    Science.gov (United States)

    1999-01-01

    rms. The deposit must be easily strippable . Good corrosion protection would be a plus. The finished surface must have low friction characteristics and...34Multiple-layer alloy plating", ASM Handbook, Vol. 5, 274 11994). Paae 33 Anode wrap (pad) / 7.2.4. Brush plat!ng Brush plating (or selective plating...aircraft exterior skins. Table 12. Summary information -Brush plating Process name Selective Plating/Brush Plating Description Selected area electroplating

  1. Demographic corrections for the modified Telephone Screening for Cognitive Status

    OpenAIRE

    Dennett, Kathryn; Tometich, Danielle; Duff, Kevin

    2013-01-01

    Despite the growing use of the modified Telephone Interview for Cognitive Status (mTICS) as a cognitive screening instrument, it does not yet have demographic corrections. Demographic data, mTICS, and a neuropsychological battery were collected from 274 community dwelling older adults with intact cognition or mild cognitive impairments. Age, education, premorbid intellect, and depression were correlated with mTICS scores. Using regression equations, age and education significantly predicted m...

  2. Facebook Addiction Levels of Students in the Physical Education and Sport Department

    OpenAIRE

    Cetin YAMAN

    2016-01-01

    Time spent using various technological equipment increases every day with rapid technology development. Unfortunately, technology addiction is becoming an important issue. Especially with the development and ubiquity of mobile technologies, social media addiction is expanding. The aim of this study is to measure the Facebook addiction levels of 274 students at the Physical Education and Sports Teaching Department in a public university in Turkey and to examine their Facebook ad...

  3. THREE PLANETS ORBITING WOLF 1061

    Energy Technology Data Exchange (ETDEWEB)

    Wright, D. J.; Wittenmyer, R. A.; Tinney, C. G.; Bentley, J. S.; Zhao, Jinglin, E-mail: duncan.wright@unsw.edu.au [Department of Astronomy and Australian Centre for Astrobiology, School of Physics, University of New South Wales, NSW 2052 (Australia)

    2016-02-01

    We use archival HARPS spectra to detect three planets orbiting the M3 dwarf Wolf 1061 (GJ 628). We detect a 1.36 M{sub ⊕} minimum-mass planet with an orbital period P = 4.888 days (Wolf 1061b), a 4.25 M{sub ⊕} minimum-mass planet with orbital period P = 17.867 days (Wolf 1061c), and a likely 5.21 M{sub ⊕} minimum-mass planet with orbital period P = 67.274 days (Wolf 1061d). All of the planets are of sufficiently low mass that they may be rocky in nature. The 17.867 day planet falls within the habitable zone for Wolf 1061 and the 67.274 day planet falls just outside the outer boundary of the habitable zone. There are no signs of activity observed in the bisector spans, cross-correlation FWHMs, calcium H and K indices, NaD indices, or Hα indices near the planetary periods. We use custom methods to generate a cross-correlation template tailored to the star. The resulting velocities do not suffer the strong annual variation observed in the HARPS DRS velocities. This differential technique should deliver better exploitation of the archival HARPS data for the detection of planets at extremely low amplitudes.

  4. A food basket investigation during the autumn of 1994

    International Nuclear Information System (INIS)

    Moere, H.; Falk, R.; Svedjemark, G.A.; Becker, W.; Brugaard Konde, Aa.

    1995-10-01

    During the autumn of 1994 an investigation of foodstuffs has been accomplished to assess the average intake of 137 Cs by the Swedish population due to the Chernobyl accident. A standardized food basket has been collected from two grocers in 10 localities, of which the majority came from areas with the highest fallout. The estimated maximum intake of 137 Cs was 815 Bq/year in the inland of the county of Vaesterbotten. The population weighted average intake for the fallout affected counties was 435 Bq/year. The rest of the county received an intake of 235 Bq/year. The population weighted average of the intake for the whole county was estimated to 274 Bq/year. From this intake the calculated body burden would be 1.3 Bq/kg for the average citizen. Whole-body measurements of a sample of the population gave 2.0 Bq/kg. A plausible explanation would be that 40% of the intake of 137 Cs can have its origin from the 10% of the consumption of foodstuffs that are home produced or collected for the average individual in Sweden. The average intake of 274 Bq/year gives a committed effective dose equivalent of 3.6 μSv. 6 refs, 10 tabs

  5. A food basket investigation during the autumn of 1994; Matkorgsundersoekning hoesten 1994

    Energy Technology Data Exchange (ETDEWEB)

    Moere, H.; Falk, R.; Svedjemark, G.A. [Swedish Radiation Protection Inst., Stockholm (Sweden); Becker, W.; Brugaard Konde, Aa. [National Food Administration, Uppsala (Sweden)

    1995-10-01

    During the autumn of 1994 an investigation of foodstuffs has been accomplished to assess the average intake of {sup 137}Cs by the Swedish population due to the Chernobyl accident. A standardized food basket has been collected from two grocers in 10 localities, of which the majority came from areas with the highest fallout. The estimated maximum intake of {sup 137}Cs was 815 Bq/year in the inland of the county of Vaesterbotten. The population weighted average intake for the fallout affected counties was 435 Bq/year. The rest of the county received an intake of 235 Bq/year. The population weighted average of the intake for the whole county was estimated to 274 Bq/year. From this intake the calculated body burden would be 1.3 Bq/kg for the average citizen. Whole-body measurements of a sample of the population gave 2.0 Bq/kg. A plausible explanation would be that 40% of the intake of {sup 137}Cs can have its origin from the 10% of the consumption of foodstuffs that are home produced or collected for the average individual in Sweden. The average intake of 274 Bq/year gives a committed effective dose equivalent of 3.6 {mu}Sv. 6 refs, 10 tabs.

  6. Different Spectrophotometric Methods for Simultaneous Determination of Trelagliptin and Its Acid Degradation Product

    Science.gov (United States)

    Hassan, Mostafa A.; Zaghary, Wafaa A.

    2018-01-01

    New spectrophotometric and chemometric methods were carried out for the simultaneous assay of trelagliptin (TRG) and its acid degradation product (TAD) and applied successfully as a stability indicating assay to recently approved Zafatek® tablets. TAD was monitored using TLC to ensure complete degradation. Furthermore, HPLC was used to confirm dealing with one major acid degradation product. The proposed methods were developed by manipulating zero-order, first-derivative, and ratio spectra of TRG and TAD using simultaneous equation, first-derivative, and mean-centering methods, respectively. Using Spectra Manager II and Minitab v.14 software, the absorbance at 274 nm–260.4 nm, amplitudes at 260.4 nm–274.0 nm, and mean-centered values at 287.6 nm–257.2 nm were measured against methanol as a blank for TRG and TAD, respectively. Linearity and the other validation parameters were acceptable at concentration ranges of 5–50 μg/mL and 2.5–25 μg/mL for TRG and TAD, respectively. Using one-way analysis of variance (ANOVA), the optimized methods were compared and proved to be accurate for the simultaneous assay of TRG and TAD. PMID:29629213

  7. Information and shared decision-making are top patients' priorities

    Directory of Open Access Journals (Sweden)

    Bronstein Alexander

    2006-02-01

    Full Text Available Abstract Background The profound changes in medical care and the recent stress on a patient-centered approach mandate evaluation of current patient priorities. Methods Hospitalized and ambulatory patients at an academic medical center in central Israel were investigated. Consecutive patients (n = 274 indicated their first and second priority for a change or improvement in their medical care out of a mixed shortlist of 6 issues, 3 related to patient-physician relationship (being better informed and taking part in decisions; being seen by the same doctor each time; a longer consultation time and 3 issues related to the organizational aspect of care (easier access to specialists/hospital; shorter queue for tests; less charges for drugs. Results Getting more information from the physician and taking part in decisions was the most desirable patient choice, selected by 27.4% as their first priority. The next choices – access and queue – also relate to more patient autonomy and control over that of managed care regulations. Patients studied were least interested in continuity of care, consultation time or cost of drugs. Demographic or clinical variables were not significantly related to patients' choices. Conclusion Beyond its many benefits, being informed by their doctor and shared decision making is a top patient priority.

  8. Characterization of potassium channel modulators with QPatch automated patch-clamp technology: system characteristics and performance

    DEFF Research Database (Denmark)

    Kutchinsky, Jonatan; Friis, Søren; Asmild, Margit

    2003-01-01

    Planar silicon chips with 1-2-microm etched holes (average resistance: 2.04 +/- 0.02 MOmega in physiological buffer, n = 274) have been developed for patch-clamp recordings of whole-cell currents from cells in suspension. An automated 16-channel parallel screening system, QPatch 16, has been deve......-response relationship characterizations of verapamil and rBeKm-1 blockage of hERG currents provided IC(50) values similar to values reported in the literature....

  9. Indirect immunofluorescence staining of Chlamydia trachomatis inclusions in microculture plates with monoclonal antibodies.

    Science.gov (United States)

    Zapata, M; Chernesky, M; Mahony, J

    1984-06-01

    Indirect immunofluorescence (IF) staining, using a monoclonal antibody, detected two- to fourfold more inclusions than did iodine staining. Of 274 clinical specimens, 53 (19.3%) were positive by IF on passage 1 as compared with 33 (12%) by iodine staining (P less than 0.005). IF-stained inclusions in McCoy cells in the bottom of microculture wells were readily viewed with a long-focal-length objective at a magnification of 250 X.

  10. Indirect immunofluorescence staining of Chlamydia trachomatis inclusions in microculture plates with monoclonal antibodies.

    OpenAIRE

    Zapata, M; Chernesky, M; Mahony, J

    1984-01-01

    Indirect immunofluorescence (IF) staining, using a monoclonal antibody, detected two- to fourfold more inclusions than did iodine staining. Of 274 clinical specimens, 53 (19.3%) were positive by IF on passage 1 as compared with 33 (12%) by iodine staining (P less than 0.005). IF-stained inclusions in McCoy cells in the bottom of microculture wells were readily viewed with a long-focal-length objective at a magnification of 250 X.

  11. Nitrate levels modulate denitrification activity in tropical mangrove sediments (Goa, India)

    Digital Repository Service at National Institute of Oceanography (India)

    Fernandes, S.O.; LokaBharathi, P.A.

    .M., & Bundrick, C.M. (1998). Potential sediment denitrification rates in estuaries of Northern Gulf of Mexico. Journal of environmental quality, 27(4), 859-868. Gruber, N., & Sarmiento, J.L. (1997). Global. Biogeochemical Cycles, 11, 235-266. Hahndel, R... of inorganic nitrogen in mangrove sediments (Terminos Lagoon, Mexico). Limnology and Oceanography, 41, 284-296. Sardessai, S. (1993). Dissolved, particulate and sedimentary humic acids in the mangroves and estuarine ecosystem of Goa, west coast of India...

  12. Governance by Diffusion: Transnational Municipal Networks and the Spread of Local Climate Strategies in Europe

    OpenAIRE

    Lukas Hakelberg

    2014-01-01

    Cities have become crucial actors for the global governance of climate change. Their increased activity in this field is reflected by the rising number of adoptions of local climate strategies in an original sample of 274 European cities from 1992 to 2009. Using event history analysis, I find that this spread is promoted by transnational municipal networks (TMNs) successfully deploying strategies for governance by diffusion, their impact exceeding that of most alternative explanatory factors ...

  13. Gclust Server: 39999 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 39999 PHRA_96382 Cluster Sequences Related Sequences(274) 2009 C_scaffold_74000010;... no annotation 2 1.00e-28 0.0 22.22 0.0 0.0 0.0 0.0 Show 39999 Cluster ID 39999 Sequence ID PHRA_96382 Link ...un: 0 Syn: 0 Glv: 0 Tel: 0 YelA: 0 YelB: 0 S63: 0 S79: 0 S81: 0 S93: 0 S96: 0 S99

  14. Circles in the spectrum and the geometry of orbits: a numerical ranges approach

    Czech Academy of Sciences Publication Activity Database

    Müller, Vladimír; Tomilov, Y.

    2018-01-01

    Roč. 274, č. 2 (2018), s. 433-460 ISSN 0022-1236 R&D Projects: GA ČR(CZ) GA14-07880S EU Projects: European Commission(XE) 318910 - AOS Institutional support: RVO:67985840 Keywords : spectrum * orbits of linear operators * numerical range * convergence of operator iterates Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 1.254, year: 2016 http://www.sciencedirect.com/science/article/pii/S0022123617304111?via%3Dihub

  15. Spectrophotometric estimation of ethamsylate and mefenamic acid from a binary mixture by dual wavelength and simultaneous equation methods

    OpenAIRE

    Goyal Anju; Singhvi I

    2008-01-01

    Two simple, accurate, economical and reproducible spectrophotometric methods for simultaneous estimation of two-component drug mixture of ethamsylate and mefenamic acid in combined tablet dosage form have been developed. The first developed method involves formation and solving of simultaneous equation using 287.6 nm and 313.2 nm as two wavelengths. Second developed method is based on two wavelength calculation. Two wavelengths selected for estimation of ethamsylate were 274.4 nm and 301.2 nm...

  16. Organizational age cultures: The interplay of chief executive officers age and attitudes toward younger and older employees

    OpenAIRE

    Zacher, Hannes; Gielnik, Michael

    2014-01-01

    This article investigates the interactive effects of chief executive officer (CEO) age and CEO attitudes toward younger and older employees on organisational age cultures. Data was collected from 66 CEOs of small and medium-sized businesses and 274 employees. Results were consistent with expectations based on organisational culture and upper echelons theories. The relationship between CEO age and organisational age culture for younger employees was negative for CEOs with a less positive attit...

  17. Baseline test data for the EVA electric vehicle. [low energy consumption automobiles

    Science.gov (United States)

    Harhay, W. C.; Bozek, J.

    1976-01-01

    Two electric vehicles from Electric Vehicle Associates were evaluated for ERDA at the Transportation Research Center of Ohio. The vehicles, loaded to a gross vehicle weight of 3750 pounds, had a range of 56.3 miles at a steady speed of 25 mph and a 27.4 miles range during acceleration-deceleration tests to a top speed of 30 mph. Energy consumption varied from 0.48 kw-hr/mi. to 0.59 kw-hr/mi.

  18. Classes and Castles: Impact of Social Stratification on Housing Inequality in Post-Socialist States

    Czech Academy of Sciences Publication Activity Database

    Lux, Martin; Sunega, Petr; Katrňák, Tomáš

    2013-01-01

    Roč. 29, č. 2 (2013), s. 274-288 ISSN 0266-7215 R&D Projects: GA ČR GA403/09/1915 Institutional research plan: CEZ:AV0Z70280505 Keywords : social stratification * housing classes * transition countries Subject RIV: AO - Sociology, Demography Impact factor: 1.031, year: 2013 http://esr.oxfordjournals.org/content/early/2011/07/29/esr.jcr060.abstract?keytype=ref&ijkey=2UAFdmbxp7jS5D6

  19. 非行少年と一般少年の比較 : 性格,親子関係に関して

    OpenAIRE

    高木, 秀明

    1985-01-01

    The purpose of this study is to investigate the causes of juvenile delinquency by comparing juvenile delinquents and nondelinquents with respect to their character and their relationship with their parents. The subjects were 274 juvenile delinquents, that is juveniles who had received warnings from policemen, were sent to child consultation centers or a juvenile classification home, or were enrolled in a juvenile reform school, and 1,188 nondelinquent high school students. The following resul...

  20. The Cancer Genome Atlas Comprehensive Molecular Characterization of Renal Cell Carcinoma

    OpenAIRE

    Christopher J. Ricketts; Aguirre A. De Cubas; Huihui Fan; Christof C. Smith; Martin Lang; Ed Reznik; Reanne Bowlby; Ewan A. Gibb; Rehan Akbani; Rameen Beroukhim; Donald P. Bottaro; Toni K. Choueiri; Richard A. Gibbs; Andrew K. Godwin; Scott Haake

    2018-01-01

    Summary: Renal cell carcinoma (RCC) is not a single disease, but several histologically defined cancers with different genetic drivers, clinical courses, and therapeutic responses. The current study evaluated 843 RCC from the three major histologic subtypes, including 488 clear cell RCC, 274 papillary RCC, and 81 chromophobe RCC. Comprehensive genomic and phenotypic analysis of the RCC subtypes reveals distinctive features of each subtype that provide the foundation for the development of sub...