40 CFR 272.2050-272.2099 - [Reserved
2010-07-01
... 40 Protection of Environment 26 2010-07-01 2010-07-01 false [Reserved] 272.2050-272.2099 Section 272.2050-272.2099 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) APPROVED STATE HAZARDOUS WASTE MANAGEMENT PROGRAMS South Carolina §§ 272.2050-272.2099 [Reserved] ...
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Application. 27.2 Section 27.2 Public Lands: Interior Office of the Secretary of the Interior NONDISCRIMINATION IN ACTIVITIES CONDUCTED UNDER... II OF PUBLIC LAW 93-153 § 27.2 Application. This part applies to all activities, including...
2010-01-01
... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Authority. 272.1 Section 272.1 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) FEDERAL OPEN MARKET COMMITTEE RULES OF PROCEDURE § 272.1 Authority. This part is issued by the Federal Open Market Committee (the Committee) pursuant to the...
40 CFR 35.272 - Funding coordination.
2010-07-01
... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Funding coordination. 35.272 Section 35.272 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GRANTS AND OTHER FEDERAL ASSISTANCE....272 Funding coordination. Recipients must use the lead-based paint program funding in a way that...
48 CFR 719.272 - Small disadvantaged business policies.
2010-10-01
... business policies. 719.272 Section 719.272 Federal Acquisition Regulations System AGENCY FOR INTERNATIONAL DEVELOPMENT SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 719.272 Small disadvantaged business... subcontracting with small disadvantaged businesses and other disadvantaged enterprises based on provisions of the...
32 CFR 272.3 - Definition of basic research.
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false Definition of basic research. 272.3 Section 272...) MISCELLANEOUS ADMINISTRATION AND SUPPORT OF BASIC RESEARCH BY THE DEPARTMENT OF DEFENSE § 272.3 Definition of... increasing fundamental knowledge and understanding in those fields of the physical, engineering...
36 CFR 272.4 - Commercial use.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Commercial use. 272.4 Section... OWLâ SYMBOL § 272.4 Commercial use. (a) General. The Chief may authorize the Commercial manufacture... charge, royalty charge, or payment in kind which is reasonably related to the commercial value has been...
47 CFR 25.272 - General inter-system coordination procedures.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false General inter-system coordination procedures. 25.272 Section 25.272 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical Operations § 25.272 General inter-system coordination...
Kirbach, U W; Gregorich, K E; Lee, D M; Ninov, V; Omtvedt, J P; Patin, J B; Seward, N K; Strellis, D A; Sudowe, R; Türler, A; Wilk, P A; Zielinski, P M; Hoffman, D C; Nitsche, H
2002-01-01
The Cryo-Thermochromatographic Separator (CTS) was designed and constructed for rapid, continuous on-line separation and simultaneous detection of highly volatile compounds of short-lived alpha-decaying isotopes of osmium and hassium (Hs, Z=108). A flowing carrier gas containing the volatile species is passed through a channel formed by two facing rows of 32 alpha-particle detectors, cooled to form a temperature gradient extending from 247 K at the channel entrance down to 176 K at the exit. The volatile species adsorb onto the SiO sub 2 -coated detector surfaces at a characteristic deposition temperature and are identified by their observed alpha-decay energies. The CTS was tested on-line with OsO sub 4 prepared from sup 1 sup 6 sup 9 sup - sup 1 sup 7 sup 3 Os isotopes produced in sup 1 sup 1 sup 8 sup , sup 1 sup 2 sup 0 Sn( sup 5 sup 6 Fe, 3,4,5n) reactions. An adsorption enthalpy for OsO sub 4 of -40.2+-1.5 kJ/mol on SiO sub 2 was deduced by comparing the measured deposition distribution with Monte Carlo...
7 CFR 272.10 - ADP/CIS Model Plan.
2010-01-01
... 7 Agriculture 4 2010-01-01 2010-01-01 false ADP/CIS Model Plan. 272.10 Section 272.10 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE... benefit computation (including but not limited to all household members' names, addresses, dates of birth...
Protein expression of Myt272-3 recombinant clone and in silico ...
African Journals Online (AJOL)
Purpose: To investigate the expression of Myt272-3 recombinant protein and also to predict a possible protein vaccine candidate against Mycobacterium tuberculosis. Methods: Myt272-3 protein was expressed in pET30a+-Myt272-3 clone. The purity of the protein was determined using Dynabeads® His-Tag Isolation ...
14 CFR 272.5 - Determination of essential air service.
2010-01-01
... (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS ESSENTIAL AIR SERVICE TO THE FREELY ASSOCIATED STATES § 272.5 Determination of essential air service. Procedures for the determination of essential air service under this... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Determination of essential air service. 272...
14 CFR 272.6 - Considerations in the determination of essential air service.
2010-01-01
... essential air service. 272.6 Section 272.6 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS ESSENTIAL AIR SERVICE TO THE FREELY ASSOCIATED STATES § 272.6 Considerations in the determination of essential air service. (a) In the determination of...
2010-01-01
... and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS ESSENTIAL AIR SERVICE TO THE FREELY ASSOCIATED STATES § 272.1 Purpose. Paragraph 5 of Article IX... Transportation (Department), as successor to the Civil Aeronautics Board (Board), to guarantee essential air...
2010-01-01
... Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS ESSENTIAL AIR SERVICE TO THE FREELY ASSOCIATED STATES § 272.2 Applicability. This part establishes the provisions applicable to the Department's guarantee of essential air service to places in the...
Dendritic cell activation and maturation induced by recombinant calreticulin fragment 39-272.
Li, Yue; Zeng, Xiaoli; He, Lijuan; Yuan, Hui
2015-01-01
Dendritic cells (DC) are the most potent antigen-presenting cells for initiating immune responses. DC maturation can be induced by exposing of immature DC to pathogen products or pro-inflammatory factor, which dramatically enhances the ability of DC to activate Ag-specific T cells. In this study, a recombinant calreticulin fragment 39-272 (rCRT/39-272) covering the lectin-like N domain and partial P domain of murine CRT has been expressed and purified in Escherichia coli. Functional analysis studies revealed that rCRT/39-272 has potent immunostimulatory activities in both activating human monocytes and B cells to secrete cytokines. rCRT/39-272 can drive the activation of bone marrow derived DC in TLR4/CD14 dependent way, as indicated by secretion of cytokines IL-12/IL-23 (p40) and IL-1β. Exposure of DC to rCRT/39-272 induces P-Akt, suggesting that rCRT/39-272 induces maturation of DC through PI3K/Akt signaling pathway. The results suggest that soluble rCRT/39-272 is a potent stimulatory agent to DC maturation in TLR4/CD14 and PI3K/Akt dependent pathway. It may play important roles in initiating cellular immunity in vivo and the T cell response in vitro. Thus it could be used for study of DC-based tumor vaccines.
2010-01-01
... Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS ESSENTIAL AIR SERVICE TO THE FREELY ASSOCIATED STATES § 272.12 Termination. These provisions shall terminate on October 1, 1998, unless the program of essential air service to the Federated States of...
Anti-proliferative activity of the quassinoid NBT-272 in childhood medulloblastoma cells
Directory of Open Access Journals (Sweden)
Helson Lawrence
2007-01-01
Full Text Available Abstract Background With current treatment strategies, nearly half of all medulloblastoma (MB patients die from progressive tumors. Accordingly, the identification of novel therapeutic strategies remains a major goal. Deregulation of c-MYC is evident in numerous human cancers. In MB, over-expression of c-MYC has been shown to correlate with anaplasia and unfavorable prognosis. In neuroblastoma – an embryonal tumor with biological similarities to MB – the quassinoid NBT-272 has been demonstrated to inhibit cellular proliferation and to down-regulate c-MYC protein expression. Methods To study MB cell responses to NBT-272 and their dependence on the level of c-MYC expression, DAOY (wild-type, empty vector transfected or c-MYC transfected, D341 (c-MYC amplification and D425 (c-MYC amplification human MB cells were used. The cells were treated with different concentrations of NBT-272 and the impact on cell proliferation, apoptosis and c-MYC expression was analyzed. Results NBT-272 treatment resulted in a dose-dependent inhibition of cellular proliferation (IC50 in the range of 1.7 – 9.6 ng/ml and in a dose-dependent increase in apoptotic cell death in all human MB cell lines tested. Treatment with NBT-272 resulted in up to 90% down-regulation of c-MYC protein, as demonstrated by Western blot analysis, and in a significant inhibition of c-MYC binding activity. Anti-proliferative effects were slightly more prominent in D341 and D425 human MB cells with c-MYC amplification and slightly more pronounced in c-MYC over-expressing DAOY cells compared to DAOY wild-type cells. Moreover, treatment of synchronized cells by NBT-272 induced a marked cell arrest at the G1/S boundary. Conclusion In human MB cells, NBT-272 treatment inhibits cellular proliferation at nanomolar concentrations, blocks cell cycle progression, induces apoptosis, and down-regulates the expression of the oncogene c-MYC. Thus, NBT-272 may represent a novel drug candidate to inhibit
34 CFR 272.10 - What types of projects may be funded?
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false What types of projects may be funded? 272.10 Section... Activities Does the Secretary Fund Under This Program? § 272.10 What types of projects may be funded? (a) The Secretary may award funds to DACs for projects offering technical assistance (including training) to school...
12 CFR 272.4 - Committee actions.
2010-01-01
... and Banking FEDERAL RESERVE SYSTEM (CONTINUED) FEDERAL OPEN MARKET COMMITTEE RULES OF PROCEDURE § 272... System Open Market Account. All communications of recommended actions and votes under this paragraph... execution of any operations pursuant to the action, the action is null and void unless it is ratified and...
37 CFR 2.72 - Amendments to description or drawing of the mark.
2010-07-01
... drawing of the mark. 2.72 Section 2.72 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND....72 Amendments to description or drawing of the mark. (a) In an application based on use in commerce under section 1(a) of the Act, the applicant may amend the description or drawing of the mark only if...
20 CFR 404.272 - Indexes we use to measure the rise in the cost-of-living.
2010-04-01
... cost-of-living. 404.272 Section 404.272 Employees' Benefits SOCIAL SECURITY ADMINISTRATION FEDERAL OLD-AGE, SURVIVORS AND DISABILITY INSURANCE (1950- ) Computing Primary Insurance Amounts Cost-Of-Living Increases § 404.272 Indexes we use to measure the rise in the cost-of-living. (a) The bases. To measure...
50 CFR 216.272 - Permissible methods of taking.
2010-10-01
...) (iii) Pinnipeds: (A) Northern elephant seal (Mirounga angustirostris)—4795 (an average of 959 annually... of the species listed in § 216.272(c)(1)(ii)(D) through (G) over the course of the 5-year regulations. ...
Solvent extraction of thorium from nitrate medium by TBP, Cyanex272 and their mixture
International Nuclear Information System (INIS)
Mostaan Shaeri; Ahmad Rahbar Kelishami; Meisam Torab-Mostaedi
2015-01-01
The extraction behavior of thorium(IV) has been investigated with tri-butyl phosphate (TBP) and bis(2,4,4-trimethylpentyl) phosphinic acid (Cyanex272) in kerosene from nitrate medium. The effect of operating variables including time, aqueous phase acidity (pH), extractant concentration and temperature were investigated. This study also examined the synergistic enhancement of the extraction of thorium(IV) from nitrate medium by mixtures of TBP and Cyanex272 for the first time. The optimum synergistic enhancement factor of 3.86 was obtained at a Cyanex272/TBP molar ratio of 1:4. (author)
36 CFR 27.2 - Commercial and industrial activities.
2010-07-01
... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Commercial and industrial... INTERIOR CAPE COD NATIONAL SEASHORE; ZONING STANDARDS § 27.2 Commercial and industrial activities. No commercial or industrial districts may be established within the Cape Cod National Seashore. ...
14 CFR 272.8 - Obligation to continue service.
2010-01-01
... PROCEEDINGS) ECONOMIC REGULATIONS ESSENTIAL AIR SERVICE TO THE FREELY ASSOCIATED STATES § 272.8 Obligation to... eligible Freely Associated State place below the level of essential air service to such place, whether or not the Department has previously determined the level of essential air service to such place, the...
Tushar, L.; Sasi Jyothsna, T. S.; Sasikala, C.; Ramana, C. V.
2015-01-01
We announce the draft genome sequence of Clostridium sp. JC272, isolated from a sediment sample collected from marine habitats of Gujarat, India. Clostridium sp. JC272 is an obligate anaerobe and has the ability to produce antimicrobial compounds. The genome sequence indicates the strain?s capability of producing small peptides (microcins), which are potential novel antibiotics.
Avila-Fernandez, A.; Cantalapiedra, D.; Aller, E.; Vallespin, E.; Aguirre-Lamban, J.; Blanco-Kelly, F.; Corton, M.; Riveiro-Alvarez, R.; Allikmets, R.; Trujillo-Tiebas, M.J.; Millan, J.M.; Cremers, F.P.M.; Ayuso, C.
2010-01-01
PURPOSE: Retinitis pigmentosa (RP) is a genetically heterogeneous disorder characterized by progressive loss of vision. The aim of this study was to identify the causative mutations in 272 Spanish families using a genotyping microarray. METHODS: 272 unrelated Spanish families, 107 with autosomal
14 CFR 272.7 - Notice of discontinuance of service.
2010-01-01
... PROCEEDINGS) ECONOMIC REGULATIONS ESSENTIAL AIR SERVICE TO THE FREELY ASSOCIATED STATES § 272.7 Notice of... of essential air service for such place, the level of service specified in Order 80-9-63; and (2) If the Department has made a determination of essential air service for such place, that level of...
The synthesis of the deformed superheavy elements 107 to 111
International Nuclear Information System (INIS)
Armbuster, P.
1995-01-01
By inflight separation, implantation into Si-detector arrays, and correlation analysis of subsequent α-decay chains many isotopes were discovered at GSI since 1980, among others the elements Nielsbohriurn, Hassium and Meitnerium. The sensitivity of the method allows to identify an element by one decay chain, as we demonstrated for the case of 266 Mt. After a break of our work during the time when the new accelerator system SIS-FRS-ESR was installed (1989-1993) at GSI, and many improvements of our system EZR-UNILAC-SHIP accomplished, we restarted element synthesis in 1994. The synthesis of the isotopes 269 110, 271 110, and 272 111 of the new elements Z--110 and Z=l11 was a first success at the end of 1994. This discovery is in the center of this presentation. The reaction mechanism, a one-step, cold and compact rearrangement process at a level of some 10 -36 cm 2 is discussed. Cross sections and excitation functions systematically studied allow to extrapolate to the next element Z=112, which seems not to be out of reach
7 CFR 272.11 - Systematic Alien Verification for Entitlements (SAVE) Program.
2010-01-01
... 7 Agriculture 4 2010-01-01 2010-01-01 false Systematic Alien Verification for Entitlements (SAVE... FOR PARTICIPATING STATE AGENCIES § 272.11 Systematic Alien Verification for Entitlements (SAVE... and Naturalization Service (INS), in order to verify the validity of documents provided by aliens...
14 CFR 272.3 - Places eligible for guaranteed essential air service.
2010-01-01
... TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS ESSENTIAL AIR SERVICE TO THE FREELY ASSOCIATED STATES § 272.3 Places eligible for guaranteed essential air service. (a) Subject to the provisions of this part... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Places eligible for guaranteed essential...
Lu, Qinghong; Ku, Mannching Sherry
2012-03-01
The stability in solution of HKI-272 (Neratinib) was studied as a function of pH. The drug is most stable from pH 3 to 4, and degradation rate increases rapidly around pH 6 and appears to approach a maximum asymptotic limit in the range of pH 812. Pseudo first-order reaction kinetics was observed at all pH values. The structure of the major degradation product indicates that it is formed by a cascade of reactions within the dimethylamino crotonamide group of HKI-272. It is assumed that the rate-determining step is the initial isomerization from allyl amine to enamine functionality, followed by hydrolysis and subsequent cyclization to a stable lactam. The maximum change in degradation rate as a function of pH occurs at about pH 6, which corresponds closely to the theoretical pKa value of the dimethylamino group of HKI-272 when accounting for solvent/temperature effects. The observed relationship between pH and degradation rate is discussed, and a self-catalyzed mechanism for the allylamine-enamine isomerization reaction is proposed. The relevance of these findings to other allylamine drugs is discussed in terms of the relative stability of the allylic anion intermediate through which, the isomerization occurs.
75 FR 29975 - Expansion of Foreign-Trade Zone 272; Lehigh Valley, Pennsylvania
2010-05-28
... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [Order No. 1679] Expansion of Foreign-Trade Zone 272; Lehigh Valley, Pennsylvania Pursuant to its authority under the Foreign-Trade Zones Act of June... Bethlehem, Pennsylvania, adjacent to the Philadelphia Customs and Border Protection port of entry (FTZ...
Collective dipole motion in highly excited (272)Hs (Z=108) nuclei
Tveter, TS; Gaardhoje, JJ; Maj, A; Ramsay, T; Atac, A; Bacelar, J; Bracco, A; Buda, A; Camera, F; Herskind, B; Korten, W; Krolas, W; Menthe, A; Million, B; Nifenecker, H; Pignanelli, M; Pinston, JA; vanderPloeg, H; Schussler, F; Sletten, G
1996-01-01
The heavy nucleus (272)(108)Hs (Z = 108) and its evaporation daughters were produced using the reaction Th-232(Ar-40, gamma xn) with beam energies 10.5 and 15.0 MeV/A. The giant dipole resonance gamma radiation from the hot composite system prior to fission has been isolated using a differential
Liquid-liquid extraction of uranium (VI) using Cyanex 272 in kerosene from sodium salicylate medium
International Nuclear Information System (INIS)
Kamble, Pravin N.; Mohite, Baburao S.; Suryavanshi, Vishal J.; Salunkhe, Suresh T.
2015-01-01
Liquid-liquid extraction of uranium (VI) from sodium salicylate media using Cyanex 272 in kerosene has been carried out. Uranium (VI) was quantitatively extracted from 1x10 -4 M sodium salicylate with 5x10 -4 M Cyanex 272 in kerosene. It was stripped quantitatively from the organic phase with 4M HCl and determined spectrophotometrically with arsenazo(III) at 600 nm. The effects of concentrations of sodium salicylate, metal ions and strippants have been studied. Separation of uranium (VI) from other elements was achieved from binary as well as from multicomponent mixtures. The method is simple, rapid and selective with good reproducibility (approximately ±2%). (author)
2010-07-01
... coastal zone consistency certification, what can I do? 250.272 Section 250.272 Mineral Resources MINERALS... objects to the DPP's or DOCD's coastal zone consistency certification, what can I do? If an affected State objects to the coastal zone consistency certification accompanying your proposed or disapproved DPP or...
Liquid-liquid extraction of uranium(VI) using Cyanex 272 in toluene from sodium salicylate medium
International Nuclear Information System (INIS)
Madane, Namdev S.; Nikam, Gurunath H.; Jadhav, Deepali V.; Mohite, Baburao S.
2011-01-01
Liquid-liquid extraction of U(VI) from sodium salicylate media using Cyanex 272 in toluene has been carried out. Uranium(VI) was quantitatively extracted from 1 x 10 -3 M sodium salicylate with 5 x 10 -4 M Cyanex 272 in toluene. It was stripped quantitatively from the organic phase with 1M HCl and determined spectrophotometrically with arsenazo(III) at 660 nm. The effect of concentrations of sodium salicylate, extractant, diluents, metal ion and strippants have been studied. Separation of uranium(VI) from other elements was achieved from binary as well as from multicomponent mixtures. The method was extended to determination of uranium(VI) in geological samples. The method is simple, rapid and selective with good reproducibility (approximately ± 2%). (author)
Directory of Open Access Journals (Sweden)
Amer, S.
1995-12-01
Full Text Available A comparative study is made of the extractants D2EHPA and Cyanex 272 for the zinc and minor metal extraction from aqueous concentrated ammonium chloride solutions, as those of the leaching liquors of the CENIM-LNETI process. Extraction equilibrium data for zinc are presented as extraction isotherms at constant pH and at a temperature of 50 °C. Zinc extraction and coextraction of minor metal ions as Cu, Ca, Pb, Mg, Cd, Co, Ni and Hg are studied. Mercury does not extract from concentrated ammonium chloride solutions. Cyanex 272 shows a better selectivity for zinc with regard to the minor metals than D2EHPA, which is especially remarkable for calcium, the most coextracted element by D2EHPA. Nickel and cadmium coextraction is negligible for both extractants. The possible use of the Cyanex 272 as an alternative to D2EHPA is considered.
Se realiza un estudio comparativo del comportamiento del D2EHPA y del Cyanex 272 durante la extracción del cinc y otros metales minoritarios de soluciones acuosas concentradas de cloruro amónico, como las de las soluciones de lixiviación del proceso CENIM-LNETI. Se presentan los datos de equilibrio de extracción del cinc en forma de isotermas de extracción a una temperatura de 50 °C y pH constante y se estudia la coextracción de los metales minoritarios Cu, Ca, Pb, Mg, Cd, Co, Ni y Hg. El mercurio no se extrae de las soluciones concentradas de cloruro amónico. La selectividad del Cyanex 272 para el cinc respecto de esos metales minoritarios es mejor que la del D2EHPA, siendo verdaderamente notable para el calcio, que es la impureza que más se coextrae con el D2EHPA. La coextracción de níquel y de cadmio es muy pequeña para ambos extractantes. Se considera la posibilidad del uso alternativo del Cyanex 272 en lugar del D2EHPA.
Yuliusman; Huda, M.; Ramadhan, I. T.; Farry, A. R.; Wulandari, P. T.; Alfia, R.
2018-03-01
In this study was conducted to recover nickel metal from spent nickel catalyst resulting from hydrotreating process in petroleum industry. The nickel extraction study with the emulsion liquid membrane using Cyanex 272 as an extractant to extract and separate nickel from the feed phase solution. Feed phase solution was preapred from spent catalyst using sulphuric acid. Liquid membrane consists of a kerosene as diluent, a Span 80 as surfactant, a Cyanex 272 as carrier and sulphuric acid solutions have been used as the stripping solution. The important parameters governing the permeation of nickel and their effect on the separation process have been studied. These parameters are surfactant concentration, extractant concentration feed phase pH. The optimum conditions of the emulsion membrane making process is using 0.06 M Cyanex 272, 8% w/v SPAN 80, 0.05 M H2SO4, internal phase extractant / phase volume ratio: 1/1, and stirring speed 1150 rpm for 60 Minute that can produce emulsion membrane with stability level above 90% after 4 hours. In the extraction process with optimum condition pH 6 for feed phase, ratio of phase emulsion/phase of feed: 1/2, and stirring speed 175 rpm for 15 minutes with result 81.51% nickel was extracted.
Load test of the 272E Building high bay roof deck and support structure
International Nuclear Information System (INIS)
McCoy, R.M.
1994-01-01
The 272E Building high bay roof area was load tested according to the approved load-test procedure. The 272E Building is located in the 200 East Area of the Hanford Site and has the following characteristics: Roof deck -- wood decking supported by 4 x 14 timber purlins; Roof membrane -- tar and gravel; Roof slope -- flat (<10 deg); and Roof elevation -- maximum height of about 63 ft. The 272 Building was visited in August 1992 for a visual inspection. During this inspection, cracked areas were visible in the decking, but it was not possible to determine whether these cracks extended completely through the decking, which is 2-in. thick. The building was revisited in March 1994 for the purpose of writing this test report. Because the roof requires personnel access, a test was determine to be the best way to qualify the roof. The pre-test briefing consisted of filling out the pre-test checklist, discussing proper lifting techniques, reviewing the fall-protection plan, reviewing the job hazards analysis, and reviewing the robot travel path. The load-test results consist of visual observations and the test engineer's conclusions. Visual observations found no adverse conditions such as large deflections or permanent deformations. No deflection measurements were recorded because the tar and gravel on roof get displaced by the robot tracks; the result is large variations in deflection measurements. The conclusions are that the roof has been qualified for 500-lb total roof load and that the ''No Roof Access'' signs can be changed to ''Roof Access Restricted'' signs
Polonikov, A V; Solodilova, M A; Ivanov, V P; Shestakov, A M; Ushachev, D V; Vialykh, E K; Vasil'eva, O V; Poliakova, N V; Antsupov, V V; Kabanina, V A; Kupriianova, Ia S; Bulgakova, I V; Kozhukhov, M A; Tevs, D S
2011-01-01
To study associations of C825T (rs5443) and G272S (rs16932941) polymorphisms of GNB3 gene in Russian population of the Central Chernozem region with essential hypertension (EH) risk; to elicit the role of environmental risk factors in realization of EH predisposition in this gene genotypes carriers. We studied DNA samples obtained from 205 EH patients and 207 healthy individuals. EH patients were treated in Kursk hospitals. Genotyping of GNB3 gene polymorphisms was conducted by polymerase chain reaction and restriction analysis. Prevalence of 82ST allele of GNB3 gene in EH patients and healthy individual was 0.334 and 0.295, respectively, of 272S allele--0.037 and 0.058, respectively. We found no significant differences by prevalence of genotypes of gene GNB3 polymorphisms C825T and G272S in EH patients and healthy individuals. Non-smoking carriers of 272GS genotype had a low risk of EH (OR 0.42 in 95% CI from 0.18 to 0.97; p = 0.04). Smokers had no protective effect of this genotype. The protective effect of 272GS genotype was also found in individuals with low or moderate alcohol drinking habits (OR 0.29 in 95% CI from 0.11 to 0.77, p = 0.02) and in individuals without chronic exposure to stress (OR 0.29 in 95% CI from 0.09 to 0.91, p = 0.04). In contrast, hard drinkers and patients exposed to chronic stress had no protective effect of heterozygous genotype 272GS of gene GNB3. G272S polymorphism of GNB3 gene can be considered as a new genetic marker of predisposition to EH. The protective effect depends of environmental factors associated with high risk to develop EH.
Evidence for the formation of sodium hassate(VIII)
International Nuclear Information System (INIS)
Zweidorf, A. von; Angert, R.; Bruechle, W.; Buerger, S.; Eberhardt, K.; Eichler, R.; Hummrich, H.; Jaeger, E.; Kling, H.O.; Kratz, J.V.; Kuczewski, B.; Langrock, G.; Mendel, M.; Rieth, U.; Schaedel, M.; Schausten, B.; Schimpf, E.; Thoerle, P.; Trautmann, N.; Tsukada, K.; Wiehl, N.; Wirth, G.
2004-01-01
Hassium, element 108, was produced in the fusion reaction between 26 Mg and 248 Cm. The hassium recoils were oxidized in-situ to a highly volatile oxide, presumably HsO 4 , and were transported in a mixture of He and O 2 to a deposition and detection system. The latter consisted of 16 silicon PIN-photodiodes facing a layer of NaOH, which served, in the presence of a certain partial pressure of water in the transport gas, as reactive surface for the deposition of the volatile tetroxides. Six correlated α-decay chains of Hs were detected in the first 5 detectors centred around detection position 3. In analogy to OsO 4 , which forms Na 2 [OsO 4 (OH) 2 ], an osmate(VIII), with aqueous NaOH, HsO 4 presumably was deposited as Na 2 [HsO 4 (OH) 2 ], a hassate(VIII). (orig.)
Directory of Open Access Journals (Sweden)
Lenhard, Z.
2008-09-01
Full Text Available The extraction and separation of cobalt(II and nickel(II from sulphate solutions with different initial volume fractions of commercial organophosphorus extractants Cyanex 302, Cyanex 272 and their mixture, in kerosene as diluent, were investigated. Prepared samples contained the mixture of cobalt(II and nickel(II in mass concentrations chosen to approximate the mass concentrations of the two metals in solutions obtained by leaching typical low-grade ores or waste materials with sulphuric acid. The experiments were carried out at two concentration ratios of nickel to cobalt(ζNi/Co, 25 and 125. The latter ratio was chosen as model for the solutions of naturally occurring ores and other materials in which the concentration of nickel is much higher than that of cobalt. In all cases, the concentration of cobalt was approximately y= 0.15 g L–1, and the concentration of nickel was approximately g= 3.80 g L–1 (at ζNi/Co = 25 and 18.80 g L–1 (at ζNi/Co = 125. Other initial values were based on conditions found to be optimal in previous investigations, and kept constant in all experiments: pH0= 8, θ0 = 25 °C, phase volume ratio organic to aqueous ψ = 1 and 0.5, contact time 2 minutes.The tested fractions of extractants (Cyanex 302 or Cyanex 272, diluted in kerosene, were j = 2.5, 5.0, 7.5 and φ = 10 %. The studies of the mixture of extractants were carried out at two sets of fractions. In the first set, the fraction of Cyanex 302 was kept at φ = 10 %, and Cyanex 272 was varied in the range φ = 2.5 –10 %. In the second set, the mass concentration of each of the two extractants was varied in the range φ = 2.5–10 % so that the total fraction of the two extractants always added up to φ= 10 %.The obtained results describe the influences of type and initial volume fraction of extractant on the separation and extraction of cobalt and nickel. Under the investigated range of conditions, Cyanex 302 outperformed Cyanex 272 in cobalt
International Nuclear Information System (INIS)
Madane, N.S.; Mohite, B.S.
2011-01-01
A simple and selective spectrophotometric method has been developed for the extraction and separation of thorium(IV) from sodium salicylate media using Cyanex 272 in kerosene. Thorium(IV) was quantitatively extracted by 5 x 10 -4 M Cyanex 272 in kerosene from 1 x 10 -5 M sodium salicylate medium. The extracted thorium(IV) was stripped out quantitatively from the organic phase with 4.0 M hydrochloric acid and determined spectrophotometrically with arsenazo(III) at 620 nm. The effect of concentrations of sodium salicylate, extractant, diluents, metal ion and strippants has been studied. Separation of thorium(IV) from other elements was achieved from binary as well as multicomponent mixtures such as uranium(VI), strontium(II), rubidium(I), cesium(I), potassium(I), Sodium(I), lithium(I), lead(II), barium(II), beryllium(II) etc. Using this method separation and determination of thorium(IV) in geological and real samples has been carried out. The method is simple, rapid and selective with good reproducibility (approximately ±2%). (author)
Directory of Open Access Journals (Sweden)
Xiao-Yan He
2017-10-01
Full Text Available Calreticulin (CRT, a multifunctional Ca2+-binding glycoprotein mainly located in the endoplasmic reticulum, is a tumor-associated antigen that has been shown to play protective roles in angiogenesis suppression and anti-tumor immunity. We previously reported that soluble CRT (sCRT was functionally similar to heat shock proteins or damage-associated molecular patterns in terms of ability to activate myeloid cells and elicit strong inflammatory cytokine production. In the present study, B16 melanoma cell lines expressing recombinant CRT fragment 39-272 (sCRT/39-272 in secreted form (B16-CRT, or recombinant enhanced green fluorescence protein (rEGFP (B16-EGFP, were constructed for investigation on the roles of sCRT in tumor development. When s.c. inoculated into C57BL/6 mice, the B16-CRT cells were significantly more aggressive (in terms of solid tumor growth rate than B16-EGFP controls in a TLR4- and myeloid-derived suppressor cells (MDSC-dependent manner. The B16-CRT-bearing mice showed increased Gr1+ MDSC infiltration in tumor tissues, accelerated proliferation of CD11b+Ly6G+Ly6Clow (G-MDSC precursors in bone marrow, and higher percentages of G-MDSCs in spleen and blood, which was mirrored by decreased percentage of dendritic cells (DC in periphery. In in vitro studies, recombinant sCRT/39-272 was able to promote migration and survival of tumor-derived MDSCs via interaction with TLR4, inhibit MDSC differentiation into DC, and also elicit expression of inflammatory proteins S100A8 and S100A9 which are essential for functional maturation and chemotactic migration of MDSCs. Our data provide solid evidence for CRT as a double-edged sword in tumor development.
14 CFR 272.9 - Selection of a carrier to provide essential air service and payment of compensation.
2010-01-01
... SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS ESSENTIAL AIR SERVICE TO THE FREELY ASSOCIATED STATES § 272.9 Selection of a carrier to provide essential air service and... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Selection of a carrier to provide essential...
EXTRACTION OF COPPER FROM LEACH LIQUOR OF METALLIC COMPONENT IN DISCARDED CELL PHONE BY CYANEX® 272
Directory of Open Access Journals (Sweden)
ALAFARA A. BABA
2016-06-01
Full Text Available Discarded cell phones contribute significantly to the amount of electronic waste generation whilst some of its components are toxic and recoverable. Also, due to the increasing demand for Cu(II in building/construction, electrical and as chemical tool in freshwater, it is imperative to develop low cost and ecofriendly technique as a substitute for the conventional treatments such as reduction-roasting route at elevated temperatures. In the present study, the hydrometallurgical operations involving leaching, solvent extraction and precipitation for the recovery of Cu(II by Cyanex® 272 in kerosene was examined. Various parameters affecting the extraction of Cu(II such as pH, extractant concentration and phase ratio were optimized. At optimal conditions, about 96.3 % Cu(II was extracted into the organic phase by 0.2 mol/L Cyanex® 272 at equilibrium pH 5.0 and aqueous to organic phase ratio 1:1. The stripping of the loaded organic was carried out by 0.1 mol/L HCl solution and stripping efficiency of 98 % was obtained. By McCabe Thiele diagram, four stages are required for complete extraction of Cu(II.
Ávila-Fernández, Almudena; Cantalapiedra, Diego; Aller, Elena; Vallespín, Elena; Aguirre-Lambán, Jana; Blanco-Kelly, Fiona; Corton, M; Riveiro-Álvarez, Rosa; Allikmets, Rando; Trujillo-Tiebas, María José; Millán, José M; Cremers, Frans P M; Ayuso, Carmen
2010-12-03
Retinitis pigmentosa (RP) is a genetically heterogeneous disorder characterized by progressive loss of vision. The aim of this study was to identify the causative mutations in 272 Spanish families using a genotyping microarray. 272 unrelated Spanish families, 107 with autosomal recessive RP (arRP) and 165 with sporadic RP (sRP), were studied using the APEX genotyping microarray. The families were also classified by clinical criteria: 86 juveniles and 186 typical RP families. Haplotype and sequence analysis were performed to identify the second mutated allele. At least one-gene variant was found in 14% and 16% of the juvenile and typical RP groups respectively. Further study identified four new mutations, providing both causative changes in 11% of the families. Retinol Dehydrogenase 12 (RDH12) was the most frequently mutated gene in the juvenile RP group, and Usher Syndrome 2A (USH2A) and Ceramide Kinase-Like (CERKL) were the most frequently mutated genes in the typical RP group. The only variant found in CERKL was p.Arg257Stop, the most frequent mutation. The genotyping microarray combined with segregation and sequence analysis allowed us to identify the causative mutations in 11% of the families. Due to the low number of characterized families, this approach should be used in tandem with other techniques.
International Nuclear Information System (INIS)
Kamila, Susmita; Jena, Satyaban; Swain, Bipin Bihari
2005-01-01
Acoustical investigations for the binary mixtures of phosphinic acid (Cyanex 272), used as liquid-liquid extractant, have been made in various diluents such as benzene, toluene, and xylene from ultrasonic velocity and density measurements at temperature 303.15 K and atmospheric pressure. This study involves evaluation of different thermo-acoustic parameters along with the excess properties, which are interpreted in the light of molecular interaction between a polar extractant, Cyanex 272 with non-polar diluent, benzene and weakly polar diluents, toluene and xylene. The excess values are correlated using Redlich-Kister polynomial equation, and corresponding adjustable parameters are derived
Liu, Yang; Jeon, Ho Seok; Lee, Man Seung
2015-09-01
The possibility of separation of Pr and Nd from La in a chloride leaching solution of monazite sand has been investigated by using a binary mixture of Cyanex 272 (bis(2,4,4-trimethylpentyl) phosphinic acid) and Alamine 336 (tri-octyl/decyl amine). The binary mixture showed synergism on the extraction of the three metals and led to an increase in the separation factor between Pr/Nd and La compared to Cyanex 272 alone. Although the addition of chloride ion into aqueous increased the extraction of the metals, this addition had negative effect on the separation of Nd/Pr and La. McCabe-Thiele diagrams for the extraction of Pr and Nd with the binary mixture were constructed. Stripping of metals from the loaded organic phase was achieved with 0.7 M HCl. The difference in the solvent extraction of the rare earth elements from chloride solution between the binary mixture and saponified extractants was also discussed.
Genotyping-by-sequencing data of 272 crested wheatgrass (Agropyron cristatum genotypes
Directory of Open Access Journals (Sweden)
Pingchuan Li
2017-12-01
Full Text Available Crested wheatgrass [Agropyron cristatum L. (Gaertn.] is an important cool-season forage grass widely used for early spring grazing. However, the genomic resources for this non-model plant are still lacking. Our goal was to generate the first set of next generation sequencing data using the genotyping-by-sequencing technique. A total of 272 crested wheatgrass plants representing seven breeding lines, five cultivars and five geographically diverse accessions were sequenced with an Illumina MiSeq instrument. These sequence datasets were processed using different bioinformatics tools to generate contigs for diploid and tetraploid plants and SNPs for diploid plants. Together, these genomic resources form a fundamental basis for genomic studies of crested wheatgrass and other wheatgrass species. The raw reads were deposited into Sequence Read Archive (SRA database under NCBI accession SRP115373 (https://www.ncbi.nlm.nih.gov/sra?term=SRP115373 and the supplementary datasets are accessible in Figshare (10.6084/m9.figshare.5345092. Keywords: Crested wheatgrass, Genotyping-by-sequencing, Diploid, Tetraploid, Raw sequence data
Measurement of polarization in K-p elastic scattering between 0.955 GeV/c and 1.272 GeV/c
International Nuclear Information System (INIS)
Bryant, H.C.; Carter, A.A.; Coupland, M.
1979-11-01
The polarization parameter has been measured for K - p elastic scattering at nine incident beam momenta between 0.955 GeV/c and 1.272 GeV/c covering the centre of mass angular range -0.9 < costheta*<+0.9. Experimental results and coefficients of Legendre polynomial fits to the data are presented and compared with other measurements and a partial wave analysis. (author)
Granell, Susana; Serra-Juhé, Clara; Martos-Moreno, Gabriel Á.; Díaz, Francisca; Pérez-Jurado, Luis A.; Baldini, Giulia; Argente, Jesús
2012-01-01
Heterozygous mutations in the melanocortin-4 receptor (MC4R) gene represent the most frequent cause of monogenic obesity in humans. MC4R mutation analysis in a cohort of 77 children with morbid obesity identified previously unreported heterozygous mutations (P272L, N74I) in two patients inherited from their obese mothers. A rare polymorphism (I251L, allelic frequency: 1/100) reported to protect against obesity was found in another obese patient. When expressed in neuronal cells, the cell surface abundance of wild-type MC4R and of the N74I and I251L variants and the cAMP generated by these receptors in response to exposure to the agonist, α-MSH, were not different. Conversely, MC4R P272L was retained in the endoplasmic reticulum and had reduced cell surface expression and signaling (by ≈3-fold). The chemical chaperone PBA, which promotes protein folding of wild-type MC4R, had minimal effects on the distribution and signaling of the P272L variant. In contrast, incubation with UBE-41, a specific inhibitor of ubiquitin activating enzyme E1, inhibited ubiquitination of MC4R P272L and increased its cell surface expression and signaling to similar levels as wild-type MC4R. UBE41 had much less profound effects on MC4R I316S, another obesity-linked MC4R variant trapped in the ER. These data suggest that P272L is retained in the ER by a propensity to be ubiquitinated in the face of correct folding, which is only minimally shared by MC4R I316S. Thus, studies that combine clinical screening of obese patients and investigation of the functional defects of the obesity-linked MC4R variants can identify specific ways to correct these defects and are the first steps towards personalized medicine. PMID:23251400
Yuliusman; Ramadhan, I. T.; Huda, M.
2018-03-01
Catalyst are often used in the petroleum refinery industry, especially cobalt-based catalyst such as CoMoX. Every year, Indonesia’s oil industry produces around 1350 tons of spent hydrodesulphurization catalyst in which cobalt makes up for 7%wt. of them. Cobalt is a non-renewable and highly valuable resource. Taking into account the aforementioned reasons, this research was made to recover cobalt from spent hydrodesulphurization catalyst so that it can be reused by industries needing them. The methods used in the recovery of cobalt from the waste catalyst leach solution are liquid-liquid extraction using a synergistic system of VersaticTM 10 and Cyanex®272. Based on the experiments done using the aforementioned methods and materials, the optimum condition for the extraction process: concentration of VersaticTM 10 of 0.35 M, Cyanex®272 of 0.25 M, temperature of 23-25°C (room temperature), and pH of 6 with an extraction percentage of 98.80% and co-extraction of Ni at 93.51%.
Wang, Lijun; Liu, Cong; Meng, Xia; Niu, Yue; Lin, Zhijing; Liu, Yunning; Liu, Jiangmei; Qi, Jinlei; You, Jinling; Tse, Lap Ah; Chen, Jianmin; Zhou, Maigeng; Chen, Renjie; Yin, Peng; Kan, Haidong
2018-04-28
Ambient sulfur dioxide (SO 2 ) remains a major air pollutant in developing countries, but epidemiological evidence about its health effects was not abundant and inconsistent. To evaluate the associations between short-term exposure to SO 2 and cause-specific mortality in China. We conducted a nationwide time-series analysis in 272 major Chinese cities (2013-2015). We used the over-dispersed generalized linear model together with the Bayesian hierarchical model to analyze the data. Two-pollutant models were fitted to test the robustness of the associations. We conducted stratification analyses to examine potential effect modifications by age, sex and educational level. On average, the annual-mean SO 2 concentrations was 29.8 μg/m 3 in 272 cities. We observed positive and associations of SO 2 with total and cardiorespiratory mortality. A 10 μg/m 3 increase in two-day average concentrations of SO 2 was associated with increments of 0.59% in mortality from total non-accidental causes, 0.70% from total cardiovascular diseases, 0.55% from total respiratory diseases, 0.64% from hypertension disease, 0.65% from coronary heart disease, 0.58% from stroke, and 0.69% from chronic obstructive pulmonary disease. In two-pollutant models, there were no significant differences between single-pollutant model and two-pollutant model estimates with fine particulate matter, carbon monoxide and ozone, but the estimates decreased substantially after adjusting for nitrogen dioxide, especially in South China. The associations were stronger in warmer cities, in older people and in less-educated subgroups. This nationwide study demonstrated associations of daily SO 2 concentrations with increased total and cardiorespiratory mortality, but the associations might not be independent from NO 2 . Copyright © 2018 Elsevier Ltd. All rights reserved.
The total angular moment selectivity in 7Li(α, α) 7Li(4.63 MeV, 7/2-) reaction at Eα = 27.2 MeV
International Nuclear Information System (INIS)
Dmitrenko, V.N.; Kozyr', Yu.E.
1995-01-01
The DWBA calculation of tensor polarisation of residual nuclei for direct inelastic scattering 7 Li(α, α) 7 Li(4.63 MeV, 7/2 - ) gives the lest approximation to experimental data at selected total angular moment and parity values J π 13/2 + . The microscopic coupled channel calculation also predicts a significant role of total angular moment states with J ≥ 13/2. at E α 27.2 MeV
Directory of Open Access Journals (Sweden)
Jie Wang
2014-01-01
Full Text Available Background. To simplify traditional Chinese medicine syndrome differentiation and allow researchers to master syndrome differentiation for hypertension, this paper retrospectively studied the literature and analyzed syndrome elements corresponding to hypertension syndromes. Methods. Six databases including PubMed, EMBASE, Chinese Bio-Medical Literature Database, Chinese National Knowledge Infrastructure, Chinese Scientific Journal Database, and Wan-fang Data were searched from 1/January/2003 to 30/October/2013. We included all clinical literature testing hypertension syndromes and retrospectively studied the hypertension literature published from 2003 to 2013. Descriptive statistics calculated frequencies and percentages. Results. 13,272 patients with essential hypertension were included. Clinical features of hypertension could be attributed to 11 kinds of syndrome factors. Among them, seven syndrome factors were excess, while four syndrome factors were deficient. Syndrome targets were mainly in the liver and related to the kidney and spleen. There were 33 combination syndromes. Frequency of single-factor syndromes was 31.77% and frequency of two-factor syndromes was 62.26%. Conclusions. Excess syndrome factors of hypertension patients include yang hyperactivity, blood stasis, phlegm turbidity, internal dampness, and internal fire. Deficient syndrome factors of hypertension patients are yin deficiency and yang deficiency. Yin deficiency with yang hyperactivity, phlegm-dampness retention, and deficiency of both yin and yang were the three most common syndromes in clinical combination.
ECG changes in factory workers exposed to 27.2 MHz radiofrequency radiation.
Chen, Qingsong; Xu, Guoyong; Lang, Li; Yang, Aichu; Li, Shilin; Yang, Liwen; Li, Chaolin; Huang, Hanlin; Li, Tao
2013-05-01
To research the effect of 27.2 MHz radiofrequency radiation on electrocardiograms (ECG), 225 female workers operating radiofrequency machines at a shoe factory were chosen as the exposure group and 100 female workers without exposure from the same factory were selected as the control group. The 6 min electric field strength that the female workers were exposed to was 64.0 ± 25.2 V/m (mean ± SD), which exceeded 61 V/m, the International Commission on Non-Ionizing Radiation Protection reference root mean square levels for occupational exposure. A statistical difference was observed between the exposed group and the control group in terms of the rate of sinus bradycardia (χ(2) = 11.48, P = 0.003). When several known risk factors for cardiovascular disease were considered, including smoking, age, alcohol ingestion habit, and so on, the exposure duration was not an effective factor for ECG changes, sinus arrhythmia, or sinus bradycardia according to α = 0.05, while P = 0.052 for sinus arrhythmia was very close to 0.05. We did not find any statistical difference in heart rate, duration of the QRS wave (ventricular depolarization), or corrected QT intervals (between the start of the Q wave and end of the T wave) between the exposed and control groups. Occupational exposure to radiofrequency radiation was not found to be a cause of ECG changes after consideration of the confounding factors. Copyright © 2012 Wiley Periodicals, Inc.
Ambient Ozone Pollution and Daily Mortality: A Nationwide Study in 272 Chinese Cities.
Yin, Peng; Chen, Renjie; Wang, Lijun; Meng, Xia; Liu, Cong; Niu, Yue; Lin, Zhijing; Liu, Yunning; Liu, Jiangmei; Qi, Jinlei; You, Jinling; Zhou, Maigeng; Kan, Haidong
2017-11-21
Few large multicity studies have been conducted in developing countries to address the acute health effects of atmospheric ozone pollution. We explored the associations between ozone and daily cause-specific mortality in China. We performed a nationwide time-series analysis in 272 representative Chinese cities between 2013 and 2015. We used distributed lag models and over-dispersed generalized linear models to estimate the cumulative effects of ozone (lagged over 0-3 d) on mortality in each city, and we used hierarchical Bayesian models to combine the city-specific estimates. Regional, seasonal, and demographic heterogeneity were evaluated by meta-regression. At the national-average level, a 10-μg/m 3 increase in 8-h maximum ozone concentration was associated with 0.24% [95% posterior interval (PI): 0.13%, 0.35%], 0.27% (95% PI: 0.10%, 0.44%), 0.60% (95% PI: 0.08%, 1.11%), 0.24% (95% PI: 0.02%, 0.46%), and 0.29% (95% PI: 0.07%, 0.50%) higher daily mortality from all nonaccidental causes, cardiovascular diseases, hypertension, coronary diseases, and stroke, respectively. Associations between ozone and daily mortality due to respiratory and chronic obstructive pulmonary disease specifically were positive but imprecise and nonsignificant. There were no statistically significant differences in associations between ozone and nonaccidental mortality according to region, season, age, sex, or educational attainment. Our findings provide robust evidence of higher nonaccidental and cardiovascular mortality in association with short-term exposure to ambient ozone in China. https://doi.org/10.1289/EHP1849.
Development of a SISAK extraction system for chemical studies of element 108, hassium
Energy Technology Data Exchange (ETDEWEB)
Samadani, F.; Alstad, J.; Bjoernstad, T.; Stavsetra, L.; Omtvedt, J.P. [Oslo Univ. (Germany). Dept. of Chemistry
2010-07-01
A liquid-liquid extraction system suitable for studies of chemical properties of Hs (element 108), in the form of HsO{sub 4}, was developed using {gamma}-emitting isotopes of its homologue Os. The system is targeted for the fast on-line extraction system SISAK, which operates in a continuous manner and is suitable for liquid-phase studies of transactinide elements. The distribution of OsO{sub 4} between various dilute NaOH solutions and toluene was studied. Both batch and SISAK on-line experiments were performed to develop an appropriate system. From analysis of the extraction curves equilibrium constants for the formation of the presumed complexes, Na[OsO{sub 4}(OH)] and Na{sub 2}[OsO{sub 4}(OH){sub 2}], were obtained: K{sub 1} = (1 {+-} 0.5) x 10{sup 4} and K{sub 2} = 12 {+-} 8, respectively. The SISAK system includes a liquid-scintillation detection system for {alpha} measurements. Due to quenching effects it is not possible to perform direct measurement of the aqueous phase {alpha}'s. Therefore, a two-stage extraction method that provides an indirect measurement of the activity in the aqueous phase was developed as part of the proposed system for Hs: Acidification of the raffinate from the first stage result in recovery of OsO{sub 4}, which is highly extractable into toluene. The yield of extraction in the second step, from 0.01 M NaOH solution after acidification with H{sub 2}SO{sub 4} solution, was (90 {+-} 3)%. (orig.)
Development of a SISAK extraction system for chemical studies of element 108, hassium
International Nuclear Information System (INIS)
Samadani, F.; Alstad, J.; Bjoernstad, T.; Stavsetra, L.; Omtvedt, J.P.
2010-01-01
A liquid-liquid extraction system suitable for studies of chemical properties of Hs (element 108), in the form of HsO 4 , was developed using γ-emitting isotopes of its homologue Os. The system is targeted for the fast on-line extraction system SISAK, which operates in a continuous manner and is suitable for liquid-phase studies of transactinide elements. The distribution of OsO 4 between various dilute NaOH solutions and toluene was studied. Both batch and SISAK on-line experiments were performed to develop an appropriate system. From analysis of the extraction curves equilibrium constants for the formation of the presumed complexes, Na[OsO 4 (OH)] and Na 2 [OsO 4 (OH) 2 ], were obtained: K 1 = (1 ± 0.5) x 10 4 and K 2 = 12 ± 8, respectively. The SISAK system includes a liquid-scintillation detection system for α measurements. Due to quenching effects it is not possible to perform direct measurement of the aqueous phase α's. Therefore, a two-stage extraction method that provides an indirect measurement of the activity in the aqueous phase was developed as part of the proposed system for Hs: Acidification of the raffinate from the first stage result in recovery of OsO 4 , which is highly extractable into toluene. The yield of extraction in the second step, from 0.01 M NaOH solution after acidification with H 2 SO 4 solution, was (90 ± 3)%. (orig.)
From bohrium to copernicium and beyond SHE research at SHIP
Energy Technology Data Exchange (ETDEWEB)
Münzenberg, G., E-mail: G.Muenzenberg@gsi.de [GSI Helmholtzzentrum für Schwerionenforschung, Planckstrasse 1, 64291 Darmstadt (Germany); Manipal Centre for Natural Sciences, Manipal University, Manipal 576104, Karnataka (India)
2015-12-15
Heavy-element research with SHIP at GSI is reviewed including the discovery of the chemical elements bohrium to copernicium, experimental developments, cold fusion of heavy ions, and the discovery of a shell region around hassium. Elements bohrium and heavier are located beyond the limit of liquid-drop stability. They exist by shell stabilization. A universal, sensitive, and fast method: in-flight separation and identification of single atomic nuclei has been developed with the velocity filter SHIP and the detector system to measure decay sequences of individual atoms. Research with single atomic nuclei including detection methods, identification, and physics results will be discussed. Experiments with actinide targets as well as prospects with NUSTAR at FAIR will be addressed.
Final report on CCQM-K27.2: Second Subsequent study: determination of ethanol in aqueous media
Schantz, Michele M.; Parris, Reenie M.; May, Willie E.; Rosso, Adriana; Puglisi, Celia; Marques Rodrigues Caixeiro, Janaína; Massiff, Gabriela; Camacho Frías, Evangelina; Pérez Urquiza, Melina; Archer, Marcellé; Visser, M. S.; deVos, Betty-Jayne
2013-01-01
subsequent study (nominal concentrations of 0.2 mg/g, 1 mg/g, 3 mg/g and 60 mg/g). The three participants in the CCQM-K27-Subsequent key comparison demonstrated their ability to measure ethanol in aqueous matrix in the concentration range of 0.2 mg/g to 60 mg/g. A report on this project has been approved by the CCQM and can be found at the BIPM website. A second follow-on key comparison, CCQM-K27.2 Second Subsequent, was initiated in 2006 to accommodate laboratories that had not been ready to benchmark their methods in the previous two CCQM-K27 studies. Two levels of ethanol in water were used in the second subsequent study ranging in concentration between 0.5 mg/g and 4 mg/g. Four of the five participants in the CCQM-K27.2 Second Subsequent key comparison demonstrated their ability to measure ethanol in aqueous matrix in that concentration range. Main text. To reach the main text of this paper, click on Final Report. Note that this text is that which appears in Appendix B of the BIPM key comparison database kcdb.bipm.org/. The final report has been peer-reviewed and approved for publication by the CCQM, according to the provisions of the CIPM Mutual Recognition Arrangement (CIPM MRA).
DEFF Research Database (Denmark)
Benzon Larsen, Signe; Vogel, Ulla Birgitte; Christensen, Jane
2010-01-01
Alcohol is a risk factor for breast cancer. We wanted to determine if ADH polymorphisms which modify the rate of ethanol oxidation to acetaldehyde, were associated with breast cancer risk. We matched 809 postmenopausal breast cancer cases with 809 controls, nested within the prospective Diet......, Cancer and Health study. Among variant allele carriers of ADH1C Arg(272)Gln, alcohol intake increased the risk of breast cancer with 14% (95% CI: 1.04-1.24) per 10g alcohol/day, but not among homozygous wild type carriers (p for interaction=0.06). Thus, slow oxidation of ethanol seemed to be associated...
Thomazo, C; Ader, M; Philippot, P
2011-03-01
Although nitrogen is a key element in organic molecules such as nucleic acids and proteins, the timing of the emergence of its modern biogeochemical cycle is poorly known. Recent studies on the antiquity of the nitrogen cycle and its interaction with free oxygen suggests the establishment of a complete aerobic N biogeochemical cycle with nitrification, denitrification, and nitrogen fixation at about 2.68 Gyr. Here, we report new bulk nitrogen isotope data for the 2.72 billion-year-old sedimentary succession of the Tumbiana Formation (Pilbara Craton, Western Australia). The nitrogen isotopic compositions vary widely from +8.6‰ up to +50.4‰ and are inversely correlated with the very low δ(13)C values of associated organic matter defining the Fortescue excursion (down to about -56‰). We propose that this (15)N-enrichment records the onset of nitrification coupled to the continuous removal of its derivatives (nitrite and nitrate) by denitrification. This finding implies an increase in the availability of electron acceptors and probably oxygen in the Tumbiana depositional environment, 300 million years before the oxygenation of the Earth's atmosphere. © 2011 Blackwell Publishing Ltd.
Fine Particulate Air Pollution and Daily Mortality. A Nationwide Analysis in 272 Chinese Cities.
Chen, Renjie; Yin, Peng; Meng, Xia; Liu, Cong; Wang, Lijun; Xu, Xiaohui; Ross, Jennifer A; Tse, Lap A; Zhao, Zhuohui; Kan, Haidong; Zhou, Maigeng
2017-07-01
Evidence concerning the acute health effects of air pollution caused by fine particulate matter (PM 2.5 ) in developing countries is quite limited. To evaluate short-term associations between PM 2.5 and daily cause-specific mortality in China. A nationwide time-series analysis was performed in 272 representative Chinese cities from 2013 to 2015. Two-stage Bayesian hierarchical models were applied to estimate regional- and national-average associations between PM 2.5 concentrations and daily cause-specific mortality. City-specific effects of PM 2.5 were estimated using the overdispersed generalized additive models after adjusting for time trends, day of the week, and weather conditions. Exposure-response relationship curves and potential effect modifiers were also evaluated. The average of annual mean PM 2.5 concentration in each city was 56 μg/m 3 (minimum, 18 μg/m 3 ; maximum, 127 μg/m 3 ). Each 10-μg/m 3 increase in 2-day moving average of PM 2.5 concentrations was significantly associated with increments in mortality of 0.22% from total nonaccidental causes, 0.27% from cardiovascular diseases, 0.39% from hypertension, 0.30% from coronary heart diseases, 0.23% from stroke, 0.29% from respiratory diseases, and 0.38% from chronic obstructive pulmonary disease. There was a leveling off in the exposure-response curves at high concentrations in most, but not all, regions. The associations were stronger in cities with lower PM 2.5 levels or higher temperatures, and in subpopulations with elder age or less education. This nationwide investigation provided robust evidence of the associations between short-term exposure to PM 2.5 and increased mortality from various cardiopulmonary diseases in China. The magnitude of associations was lower than those reported in Europe and North America.
International Nuclear Information System (INIS)
Ahmed, M.; El Dessouky, S.I.; El-Nadi, Y.A.; Daoud, J.A.; Saad, E.A.
2008-01-01
The paper aims to study the extraction and separation of Cd(II), Co(II) and Ni(II) from their mixtures in hydrochloric acid medium with CYANEX 923 in kerosene. Preliminary investigations showed that only Cd(II) is extracted with CYANEX 923 while Co(II) and Ni(II) are not extracted. Different parameters affecting the extraction of Cd(II) with CYANEX 923 such as hydrochloric acid, hydrogen ion, extractant and metal concentrations, temperature investigations were also investigated. The stoichiometry of the extracted metal species investigated was found to be HCdCl 3 . 2 CYANEX 923. The stripping of the extracted Cd(II) species is obtained with 0.1 M HCl solution. Co(II) was found to be extracted with CYANEX 272 at ph 5.8 leaving Ni(II) in the solution. A developed process for the sequential of Cd(II), Co(II) and Ni(II) from their mixture in hydrochloric acid medium is proposed
An Investigation of Comet Hale-Bopp at 21.6 and 27.2 AU from the Sun
Kramer, Emily A.; Fernandez, Y. R.; Kelley, M. S.; Woodney, L. M.; Lisse, C. M.
2010-05-01
Comet Hale-Bopp offered us an unprecedented opportunity to observe a large, bright comet in great detail. Since its 1997 perihelion, continued observations have let us observe how its activity has changed over time. Here we present 2005 and 2008 Spitzer Space Telescope observations of Hale-Bopp that show coma and tail, which is uncommon given its heliocentric distance -- 21.6 AU in 2005 and 27.2 AU in 2008. We have images at 24 µm (obtained with MIPS, the Multiband Imaging Photometer for Spitzer) that show thermal emission from the dust, and we are using dynamical models [1,2] to explain the dust morphology and constrain the dust's properties. Preliminary work suggests that the motion of the dust cannot be solely due to the effects of gravity and radiation pressure, which generally are the dominant forces. We investigate the role of other possible driving forces such as the so-called rocket force [3]. Our science goals are to: understand the comet's activity mechanism, constrain the age of the dust, find the size of the grains, and compare properties of the dust we see now to those of the dust seen in the 1990s. Our overarching goal is to use Hale-Bopp and other distant, active comets to understand cometary activity and the structure of cometary nuclei, which is related to icy planetesimal formation and evolution. We acknowledge support from the NSF, NASA and the Spitzer Science Center for this work. References: [1] Kelley, M.S., et al. 2008, Icarus 193, 572, [2] Lisse, C.M., et al. 1998, ApJ 496, 971, [3] Reach, W.T., et al. 2009, Icarus 203, 571.
Bao, Zhao-Shi; Chen, Hui-Min; Yang, Ming-Yu; Zhang, Chuan-Bao; Yu, Kai; Ye, Wan-Lu; Hu, Bo-Qiang; Yan, Wei; Zhang, Wei; Akers, Johnny; Ramakrishnan, Valya; Li, Jie; Carter, Bob; Liu, Yan-Wei; Hu, Hui-Min; Wang, Zheng; Li, Ming-Yang; Yao, Kun; Qiu, Xiao-Guang; Kang, Chun-Sheng; You, Yong-Ping; Fan, Xiao-Long; Song, Wei Sonya; Li, Rui-Qiang; Su, Xiao-Dong; Chen, Clark C; Jiang, Tao
2014-11-01
Studies of gene rearrangements and the consequent oncogenic fusion proteins have laid the foundation for targeted cancer therapy. To identify oncogenic fusions associated with glioma progression, we catalogued fusion transcripts by RNA-seq of 272 gliomas. Fusion transcripts were more frequently found in high-grade gliomas, in the classical subtype of gliomas, and in gliomas treated with radiation/temozolomide. Sixty-seven in-frame fusion transcripts were identified, including three recurrent fusion transcripts: FGFR3-TACC3, RNF213-SLC26A11, and PTPRZ1-MET (ZM). Interestingly, the ZM fusion was found only in grade III astrocytomas (1/13; 7.7%) or secondary GBMs (sGBMs, 3/20; 15.0%). In an independent cohort of sGBMs, the ZM fusion was found in three of 20 (15%) specimens. Genomic analysis revealed that the fusion arose from translocation events involving introns 3 or 8 of PTPRZ and intron 1 of MET. ZM fusion transcripts were found in GBMs irrespective of isocitrate dehydrogenase 1 (IDH1) mutation status. sGBMs harboring ZM fusion showed higher expression of genes required for PIK3CA signaling and lowered expression of genes that suppressed RB1 or TP53 function. Expression of the ZM fusion was mutually exclusive with EGFR overexpression in sGBMs. Exogenous expression of the ZM fusion in the U87MG glioblastoma line enhanced cell migration and invasion. Clinically, patients afflicted with ZM fusion harboring glioblastomas survived poorly relative to those afflicted with non-ZM-harboring sGBMs (P < 0.001). Our study profiles the shifting RNA landscape of gliomas during progression and reveled ZM as a novel, recurrent fusion transcript in sGBMs. © 2014 Bao et al.; Published by Cold Spring Harbor Laboratory Press.
IVO, a device for In situ Volatilization and On-line detection of products from heavy ion reactions
Duellmann, C E; Eichler, R; Gäggeler, H W; Jost, D T; Piguet, D; Türler, A
2002-01-01
A new gaschromatographic separation system to rapidly isolate heavy ion reaction products in the form of highly volatile species is described. Reaction products recoiling from the target are stopped in a gas volume and converted in situ to volatile species, which are swept by the carrier gas to a chromatography column. Species that are volatile under the given conditions pass through the column. In a cluster chamber, which is directly attached to the exit of the column, the isolated volatile species are chemically adsorbed to the surface of aerosol particles and transported to an on-line detection system. The whole set-up was tested using short-lived osmium (Os) and mercury (Hg) nuclides produced in heavy ion reactions to model future chemical studies with hassium (Hs, Z=108) and element 112. By varying the temperature of the isothermal section of the chromatography column between room temperature and -80 deg. C, yield measurements of given species can be conducted, yielding information about the volatility o...
Chemical experiments with superheavy elements.
Türler, Andreas
2010-01-01
Unnoticed by many chemists, the Periodic Table of the Elements has been extended significantly in the last couple of years and the 7th period has very recently been completed with eka-Rn (element 118) currently being the heaviest element whose synthesis has been reported. These 'superheavy' elements (also called transactinides with atomic number > or = 104 (Rf)) have been artificially synthesized in fusion reactions at accelerators in minute quantities of a few single atoms. In addition, all isotopes of the transactinide elements are radioactive and decay with rather short half-lives. Nevertheless, it has been possible in some cases to investigate experimentally chemical properties of transactinide elements and even synthesize simple compounds. The experimental investigation of superheavy elements is especially intriguing, since theoretical calculations predict significant deviations from periodic trends due to the influence of strong relativistic effects. In this contribution first experiments with hassium (Hs, atomic number 108), copernicium (Cn, atomic number 112) and element 114 (eka-Pb) are reviewed.
Developments for transactinide chemistry experiments behind the gas-filled separator TASCA
Energy Technology Data Exchange (ETDEWEB)
Even, Julia
2011-12-13
Topic of this thesis is the development of experiments behind the gas-filled separator TASCA (TransActinide Separator and Chemistry Apparatus) to study the chemical properties of the transactinide elements. In the first part of the thesis, the electrodepositions of short-lived isotopes of ruthenium and osmium on gold electrodes were studied as model experiments for hassium. From literature it is known that the deposition potential of single atoms differs significantly from the potential predicted by the Nernst equation. This shift of the potential depends on the adsorption enthalpy of therndeposited element on the electrode material. If the adsorption on the electrode-material is favoured over the adsorption on a surface made of the same element as the deposited atom, the electrode potential is shifted to higher potentials. This phenomenon is called underpotential deposition. Possibilities to automatize an electro chemistry experiment behind the gas-filled separator were explored for later studies with transactinide elements. The second part of this thesis is about the in-situ synthesis of transition-metal-carbonyl complexes with nuclear reaction products. Fission products of uranium-235 and californium-249 were produced at the TRIGA Mainz reactor and thermalized in a carbon-monoxide containing atmosphere. The formed volatile metal-carbonyl complexes could be transported in a gas-stream. Furthermore, short-lived isotopes of tungsten, rhenium, osmium, and iridium were synthesised at the linear accelerator UNILAC at GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt. The recoiling fusion products were separated from the primary beam and the transfer products in the gas-filled separator TASCA. The fusion products were stopped in the focal plane of TASCA in a recoil transfer chamber. This chamber contained a carbon-monoxide - helium gas mixture. The formed metal-carbonyl complexes could be transported in a gas stream to various experimental setups. All
Liu, Cong; Yin, Peng; Chen, Renjie; Meng, Xia; Wang, Lijun; Niu, Yue; Lin, Zhijing; Liu, Yunning; Liu, Jiangmei; Qi, Jinlei; You, Jinling; Kan, Haidong; Zhou, Maigeng
2018-01-01
Evidence of the acute health effects of ambient carbon monoxide air pollution in developing countries is scarce and mixed. We aimed to evaluate short-term associations between carbon monoxide and daily cardiovascular disease mortality in China. We did a nationwide time-series analysis in 272 major cities in China from January, 2013, to December, 2015. We extracted daily cardiovascular disease mortality data from China's Disease Surveillance Points system. Data on daily carbon monoxide concentrations for each city were obtained from the National Urban Air Quality Real-time Publishing Platform. City-specific associations between carbon monoxide concentrations and daily mortality from cardiovascular disease, coronary heart disease, and stroke were estimated with over-dispersed generalised linear models. Bayesian hierarchical models were used to obtain national and regional average associations. Exposure-response association curves and potential effect modifiers were evaluated. Two-pollutant models were fit to evaluate the robustness of the effects of carbon monoxide on cardiovascular mortality. The average annual mean carbon monoxide concentration in these cities from 2013 to 2015 was 1·20 mg/m 3 , ranging from 0·43 mg/m 3 to 2·45 mg/m 3 . For a 1 mg/m 3 increase in average carbon monoxide concentrations on the present day and previous day (lag 0-1), we observed significant increments in mortality of 1·12% (95% posterior interval [PI] 0·42-1·83) from cardiovascular disease, 1·75% (0·85-2·66) from coronary heart disease, and 0·88% (0·07-1·69) from stroke. These associations did not vary substantially by city, region, and demographic characteristics (age, sex, and level of education), and the associations for cardiovascular disease and coronary heart disease were robust to the adjustment of criteria co-pollutants. We did not find a threshold below which carbon monoxide exposure had no effect on cardiovascular disease mortality. This analysis is, to our
Ito, Yoshinori; Suenaga, Mitsukuni; Hatake, Kiyohiko; Takahashi, Shunji; Yokoyama, Masahiro; Onozawa, Yusuke; Yamazaki, Kentaro; Hironaka, Shuichi; Hashigami, Kiyoshi; Hasegawa, Hirotaka; Takenaka, Nobuko; Boku, Narikazu
2012-04-01
Neratinib (HKI-272), a potent, irreversible, small-molecule, orally administered, pan-ErbB inhibitor that blocks signal transduction via inhibition of three epidermal growth factor receptors [ErbB1, ErbB2 (Her2) and ErbB4], is being developed for the treatment of solid tumors, including breast cancer. This Phase 1 dose-escalation study assessed the safety, tolerability, maximum-tolerated dose, antitumor activity and pharmacokinetics of neratinib in Japanese patients with advanced solid tumors. Patients received neratinib 80, 160, 240 or 320 mg orally; each patient enrolled in only one dose cohort. Patients received a single dose in week 1, followed by daily continuous doses. Blood samples collected were on days 1 and 21 for pharmacokinetic analyses. Twenty-one patients were enrolled (3 breast cancer; 17 colorectal cancer; 1 gastric cancer). Neratinib-related adverse events (all grades) included diarrhea (20 patients), fatigue (14 patients), nausea and abdominal pain (9 patients each) and anorexia (8 patients). Grade ≥3 neratinib-related adverse events in two or more patients were diarrhea and anorexia (two patients each). Dose-limiting toxicities were diarrhea and anorexia (two patients, 320 mg dose). The maximum-tolerated dose and recommended dose was neratinib 240 mg once daily. Of 21 evaluable patients, 2 with breast cancer had partial response, 3 had stable disease ≥24 weeks, 7 had stable disease ≥16 weeks and 9 had progressive disease. Pharmacokinetic analyses indicated that neratinib exposures increased with dose. The safety, efficacy and pharmacokinetic profiles of neratinib are consistent with those reported for non-Japanese patients and warrant further investigation of neratinib in Japanese patients with solid tumors.
Chemistry of superheavy elements
International Nuclear Information System (INIS)
Schaedel, M.
2012-01-01
The chemistry of superheavy elements - or transactinides from their position in the Periodic Table - is summarized. After giving an overview over historical developments, nuclear aspects about synthesis of neutron-rich isotopes of these elements, produced in hot-fusion reactions, and their nuclear decay properties are briefly mentioned. Specific requirements to cope with the one-atom-at-a-time situation in automated chemical separations and recent developments in aqueous-phase and gas-phase chemistry are presented. Exciting, current developments, first applications, and future prospects of chemical separations behind physical recoil separators ('pre-separator') are discussed in detail. The status of our current knowledge about the chemistry of rutherfordium (Rf, element 104), dubnium (Db, element 105), seaborgium (Sg, element 106), bohrium (Bh, element 107), hassium (Hs, element 108), copernicium (Cn, element 112), and element 114 is discussed from an experimental point of view. Recent results are emphasized and compared with empirical extrapolations and with fully-relativistic theoretical calculations, especially also under the aspect of the architecture of the Periodic Table. (orig.)
Wong, Kwok-K; Fracasso, Paula M; Bukowski, Ronald M; Lynch, Thomas J; Munster, Pamela N; Shapiro, Geoffrey I; Jänne, Pasi A; Eder, Joseph P; Naughton, Michael J; Ellis, Matthew J; Jones, Suzanne F; Mekhail, Tarek; Zacharchuk, Charles; Vermette, Jennifer; Abbas, Richat; Quinn, Susan; Powell, Christine; Burris, Howard A
2009-04-01
The dose-limiting toxicities, maximum tolerated dose, pharmacokinetic profile, and preliminary antitumor activity of neratinib (HKI-272), an irreversible pan ErbB inhibitor, were determined in patients with advanced solid tumors. Neratinib was administered orally as a single dose, followed by a 1-week observation period, and then once daily continuously. Planned dose escalation was 40, 80, 120, 180, 240, 320, 400, and 500 mg. For pharmacokinetic analysis, timed blood samples were collected after administration of the single dose and after the first 14 days of continuous daily administration. Dose-limiting toxicity was grade 3 diarrhea, which occurred in one patient treated with 180 mg and in four patients treated with 400 mg neratinib; hence, the maximum tolerated dose was determined to be 320 mg. Other common neratinib-related toxicities included nausea, vomiting, fatigue, and anorexia. Exposure to neratinib was dose dependent, and the pharmacokinetic profile of neratinib supports a once-a-day dosing regimen. Partial response was observed for 8 (32%) of the 25 evaluable patients with breast cancer. Stable disease >or=24 weeks was observed in one evaluable breast cancer patient and 6 (43%) of the 14 evaluable non-small cell lung cancer patients. The maximum tolerated dose of once-daily oral neratinib is 320 mg. The most common neratinib-related toxicity was diarrhea. Antitumor activity was observed in patients with breast cancer who had previous treatment with trastuzumab, anthracyclines, and taxanes, and tumors with a baseline ErbB-2 immunohistochemical staining intensity of 2+ or 3+. The antitumor activity, tolerable toxicity profile, and pharmacokinetic properties of neratinib warrant its further evaluation.
75 FR 20387 - Amended Certification Regarding Eligibility To Apply for Worker Adjustment Assistance
2010-04-19
..., Meadville, Pennsylvania. TA-W-71,272C, Crucible Materials Corporation, Crucible Service Center, Troy..., Pennsylvania; Troy, Michigan; Butler, Wisconsin; Miamisburg, Ohio; Chicago, Illinois; Minneapolis, Minnesota...); Troy, Michigan (TA-W-71,272C); Butler, Wisconsin (TA-W-71,272D); Miamisburg, Ohio (TA-W-71,272E...
Decay properties of nuclei close to Z = 108 and N = 162
International Nuclear Information System (INIS)
Dvorak, Jan
2007-01-01
The goal of the research conducted in the frame of this thesis was to investigate the decay properties of the nuclides 269-271 Hs and their daughters using an improved chemical separation and detection system. Shell stabilization was predicted in the region around Z=108 and N=162 in calculations, taking into account possible higher orders of deformations of the nuclei. The nucleus 270 Hs with a closed proton and a closed neutron deformed shell, was predicted to be ''deformed doubly magic''. Nuclei around 270 Hs can be produced only via fusion reactions at picobarn levels, resulting in a production rates of few atoms per day. Investigating short-lived nuclei using rapid chemical separation and subsequent on-line detection methods provides an independent and alternative means to electromagnetic on-line separators. Chemical separation of Hs in the form of HsO 4 provides an excellent tool to study the formation reactions and nuclear structure in this region of the chart of nuclides due to a high overall efficiency and a very high purification factor. The goal was accomplished, as element 108, hassium, was produced in the reaction 248 Cm( 26 Mg,xn) 274-x Hs and chemically isolated. After gas phase separation of HsO 4 , 26 genetically linked decay chains have been observed. These were attributed to decays of three different Hs isotopes produced in the 3-5n evaporation channels. The known decay chain of 269 Hs, the 5n evaporation product, serves as an anchor point, thus allowing the unambiguous assignment of the observed decay chains to the 5n, 4n, and 3n channels, respectively. Decay properties of five nuclei have been unambiguously established for the first time, including the one for the the doubly-magic nuclide 270 Hs. This hassium isotope is the next doubly magic nucleus after the well known 208 Pb and the first experimentally observed even-even nucleus on the predicted N=162 neutron shell. The observed decay properties provide strong indications for enhanced nuclear
Dworschak, G C; Crétolle, C; Hilger, A; Engels, H; Korsch, E; Reutter, H; Ludwig, M
2017-05-01
Partial duplications of the long arm of chromosome 3, dup(3q), are a rare but well-described condition, sharing features of Cornelia de Lange syndrome. Around two thirds of cases are derived from unbalanced translocations, whereas pure dup(3q) have rarely been reported. Here, we provide an extensive review of the literature on dup(3q). This search revealed several patients with caudal malformations and anomalies, suggesting that caudal malformations or anomalies represent an inherent phenotypic feature of dup(3q). In this context, we report a patient with a pure de novo duplication 3q26.32-q27.2. The patient had the clinical diagnosis of Currarino syndrome (CS) (characterized by the triad of sacral anomalies, anorectal malformations and a presacral mass) and additional features, frequently detected in patients with a dup(3q). Mutations within the MNX1 gene were found to be causative in CS but no MNX1 mutation could be detected in our patient. Our comprehensive search for candidate genes located in the critical region of the duplication 3q syndrome, 3q26.3-q27, revealed a so far neglected phenotypic overlap of dup(3q) and the Pierpont syndrome, associated with a mutation of the TBL1XR1 gene on 3q26.32. © 2016 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
Light Curve Solution of the Contact Binary AW UMa
Directory of Open Access Journals (Sweden)
J. H. Jeong
1997-12-01
Full Text Available A total of 1088 observations (272 in B,272 in V, 272 in R, and 272 in I were made from January to February in 1995 at Chungbuk National University observatory(CbNUO. We constructed BVRI light curves with our data. The photometric solution of these light curves was obtained by means of the Wilson-Devinney method. Our result was compared with those by previous investigators.
Awada, A; Dirix, L; Manso Sanchez, L; Xu, B; Luu, T; Diéras, V; Hershman, D L; Agrapart, V; Ananthakrishnan, R; Staroslawska, E
2013-01-01
Neratinib (HKI-272) is a potent irreversible pan-ErbB tyrosine kinase inhibitor with clinical activity in patients with ErbB2/HER2-positive breast cancer. Phase I of this open-label, phase I/II study investigated the maximum tolerated dose (MTD) of oral neratinib (160 or 240 mg/day) plus vinorelbine (25 mg/m2; days 1 and 8 of each 21-day cycle) in patients with solid tumors. Phase II assessed the safety, clinical activity, and pharmacokinetics of the combination in patients with HER2-positive metastatic breast cancer; the primary efficacy end point was objective response (OR). In phase I (n=12), neratinib (240 mg) plus vinorelbine (25 mg/m2) was established as the MTD. In phase II, 79 patients with HER2-positive metastatic breast cancer were treated at the MTD. The most common treatment-related adverse events were diarrhea (96%), neutropenia (54%), and nausea (50%). Three patients discontinued treatment due to diarrhea. No clinically important skin side-effects were observed. The OR rate in assessable phase II patients was 41% (no prior lapatinib) and 8% (prior lapatinib). There was no evidence of pharmacokinetic interaction between neratinib and vinorelbine. Neratinib plus vinorelbine showed promising antitumor activity and no unexpected toxic effects in HER2-positive metastatic breast cancer patients. Trial registration ClinicalTrials.gov #NCT00706030.
Directory of Open Access Journals (Sweden)
Osiris Marroquin Belaunzaran
Full Text Available HLA-B27 is a common genetic risk factor for the development of Spondyloarthritides (SpA. HLA-B27 can misfold to form cell-surface heavy chain homodimers (B272 and induce pro-inflammatory responses that may lead to SpA pathogenesis. The presence of B272 can be detected on leukocytes of HLA-B27+ Ankylosing spondylitis (AS patients and HLA-B27 transgenic rats. We characterized a novel B272-specific monoclonal antibody to study its therapeutic use in HLA-B27 associated disorders.The monoclonal HD5 antibody was selected from a phage library to target cell-surface B272 homodimers and characterized for affinity, specificity and ligand binding. The immune modulating effect of HD5 was tested in HLA-B27 transgenic rats. Onset and progression of disease profiles were monitored during therapy. Cell-surface B272 and expansion of pro-inflammatory cells from blood, spleen and draining lymph nodes were assessed by flow cytometry.HD5 bound B272 with high specificity and affinity (Kd = 0.32 nM. HD5 blocked cell-surface interaction of B272 with immune regulatory receptors KIR3DL2, LILRB2 and Pirb. In addition, HD5 modulated the production of TNF from CD4+ T-cells by limiting B272 interactions in vitro. In an HLA-B27 transgenic rat model repetitive dosing of HD5 reduced the expansion of pro-inflammatory CD4+ T-cells, and decreased the levels of soluble TNF and number of cell-surface B272 molecules.HD5 predominantly inhibits early TNF production and expansion of pro-inflammatory CD4+ T-cells in HLA-B27 transgenic rats. Monoclonal antibodies targeting cell-surface B272 propose a new concept for the modulation of inflammatory responses in HLA-B27 related disorders.
Marroquin Belaunzaran, Osiris; Kleber, Sascha; Schauer, Stefan; Hausmann, Martin; Nicholls, Flora; Van den Broek, Maries; Payeli, Sravan; Ciurea, Adrian; Milling, Simon; Stenner, Frank; Shaw, Jackie; Kollnberger, Simon; Bowness, Paul; Petrausch, Ulf; Renner, Christoph
2015-01-01
Objectives HLA-B27 is a common genetic risk factor for the development of Spondyloarthritides (SpA). HLA-B27 can misfold to form cell-surface heavy chain homodimers (B272) and induce pro-inflammatory responses that may lead to SpA pathogenesis. The presence of B272 can be detected on leukocytes of HLA-B27+ Ankylosing spondylitis (AS) patients and HLA-B27 transgenic rats. We characterized a novel B272–specific monoclonal antibody to study its therapeutic use in HLA-B27 associated disorders. Methods The monoclonal HD5 antibody was selected from a phage library to target cell-surface B272 homodimers and characterized for affinity, specificity and ligand binding. The immune modulating effect of HD5 was tested in HLA-B27 transgenic rats. Onset and progression of disease profiles were monitored during therapy. Cell-surface B272 and expansion of pro-inflammatory cells from blood, spleen and draining lymph nodes were assessed by flow cytometry. Results HD5 bound B272 with high specificity and affinity (Kd = 0.32 nM). HD5 blocked cell-surface interaction of B272 with immune regulatory receptors KIR3DL2, LILRB2 and Pirb. In addition, HD5 modulated the production of TNF from CD4+ T-cells by limiting B272 interactions in vitro. In an HLA-B27 transgenic rat model repetitive dosing of HD5 reduced the expansion of pro-inflammatory CD4+ T-cells, and decreased the levels of soluble TNF and number of cell-surface B272 molecules. Conclusion HD5 predominantly inhibits early TNF production and expansion of pro-inflammatory CD4+ T-cells in HLA-B27 transgenic rats. Monoclonal antibodies targeting cell-surface B272 propose a new concept for the modulation of inflammatory responses in HLA-B27 related disorders. PMID:26125554
Wegrzecki, Maciej; Bar, Jan; Budzyński, Tadeusz; CieŻ, Michal; Grabiec, Piotr; Kozłowski, Roman; Kulawik, Jan; Panas, Andrzej; Sarnecki, Jerzy; Słysz, Wojciech; Szmigiel, Dariusz; Wegrzecka, Iwona; Wielunski, Marek; Witek, Krzysztof; Yakushev, Alexander; Zaborowski, Michał
2013-07-01
The paper discusses the design of charged-particle detectors commissioned and developed at the Institute of Electron Technology (ITE) in collaboration with foreign partners, used in international research on transactinide elements and to build personal radiation protection devices in Germany. Properties of these detectors and the results obtained using the devices are also presented. The design of the following epiplanar detector structures is discussed: ♢ 64-element chromatographic arrays for the COMPACT (Cryo On-line Multidetector for Physics And Chemistry of Transactinides) detection system used at the GSI Helmholtzzentrum für Schwerionenforschung in Darmstadt (GSI) for research on Hassium, Copernicium and Flerovium, as well as elements 119 and 120, ♢ 2-element flow detectors for the COLD (Cryo On-Line Detector) system used for research on Copernicium and Flerovium at the Joint Institute for Nuclear Research, Dubna, ♢ detectors for a radon exposimeter and sensors for a neutron dosimeter developed at the Institut für Strahlenschutz, Helmholtz Zentrum München. The design of planar detectors - single-sided and double-sided strip detectors for the Focal Plane Detector Box used at GSI for research on Flerovium and elements 119 and 120 is also discussed.
2010-07-01
... services; (ii) Provided any portion of the funds for the purchase of such property or services; or (iii) Will reimburse such recipient or party for the purchase of such property or services; or (2) For the... representative who must conform to the standards of conduct and ethics required of practitioners before the...
2010-01-01
... time until a quorum is in attendance. (d) Attendance at meetings. Attendance at Committee meetings is... discussion of, the economic and financial situation and outlook; Committee discussion of monetary policy and...
2010-07-01
... mixture has been ignited, or has been found with a permissible flame safety lamp, or has been determined... enclosure and/or flame arrester(s). Also the enclosure and/or flame arrester(s) shall prevent the discharge...
2010-01-01
... considers in evaluating the amount and type of credit requested. (e) Decision center means the place where... purchase, permanent financing for construction, or the refinancing of residential real property which the.... Where the bank in its judgment relies substantially upon other factors, such as the general credit...
32 CFR 272.5 - Responsibilities.
2010-07-01
... Director of Defense Research and Engineering, under the Under Secretary of Defense for Acquisition, Technology, and Logistics (USD(AT&L)), shall: (1) Provide technical leadership and oversight, issue guidance...
Decay properties of nuclei close to Z = 108 and N = 162
Energy Technology Data Exchange (ETDEWEB)
Dvorak, Jan
2007-07-12
The goal of the research conducted in the frame of this thesis was to investigate the decay properties of the nuclides {sup 269-271}Hs and their daughters using an improved chemical separation and detection system. Shell stabilization was predicted in the region around Z=108 and N=162 in calculations, taking into account possible higher orders of deformations of the nuclei. The nucleus {sup 270}Hs with a closed proton and a closed neutron deformed shell, was predicted to be ''deformed doubly magic''. Nuclei around {sup 270}Hs can be produced only via fusion reactions at picobarn levels, resulting in a production rates of few atoms per day. Investigating short-lived nuclei using rapid chemical separation and subsequent on-line detection methods provides an independent and alternative means to electromagnetic on-line separators. Chemical separation of Hs in the form of HsO{sub 4} provides an excellent tool to study the formation reactions and nuclear structure in this region of the chart of nuclides due to a high overall efficiency and a very high purification factor. The goal was accomplished, as element 108, hassium, was produced in the reaction {sup 248}Cm({sup 26}Mg,xn){sup 274-x}Hs and chemically isolated. After gas phase separation of HsO{sub 4}, 26 genetically linked decay chains have been observed. These were attributed to decays of three different Hs isotopes produced in the 3-5n evaporation channels. The known decay chain of {sup 269}Hs, the 5n evaporation product, serves as an anchor point, thus allowing the unambiguous assignment of the observed decay chains to the 5n, 4n, and 3n channels, respectively. Decay properties of five nuclei have been unambiguously established for the first time, including the one for the the doubly-magic nuclide {sup 270}Hs. This hassium isotope is the next doubly magic nucleus after the well known {sup 208}Pb and the first experimentally observed even-even nucleus on the predicted N=162 neutron shell. The
Developments for transactinide chemistry experiments behind the gas-filled separator TASCA
International Nuclear Information System (INIS)
Even, Julia
2011-01-01
Topic of this thesis is the development of experiments behind the gas-filled separator TASCA (TransActinide Separator and Chemistry Apparatus) to study the chemical properties of the transactinide elements. In the first part of the thesis, the electrodepositions of short-lived isotopes of ruthenium and osmium on gold electrodes were studied as model experiments for hassium. From literature it is known that the deposition potential of single atoms differs significantly from the potential predicted by the Nernst equation. This shift of the potential depends on the adsorption enthalpy of therndeposited element on the electrode material. If the adsorption on the electrode-material is favoured over the adsorption on a surface made of the same element as the deposited atom, the electrode potential is shifted to higher potentials. This phenomenon is called underpotential deposition. Possibilities to automatize an electro chemistry experiment behind the gas-filled separator were explored for later studies with transactinide elements. The second part of this thesis is about the in-situ synthesis of transition-metal-carbonyl complexes with nuclear reaction products. Fission products of uranium-235 and californium-249 were produced at the TRIGA Mainz reactor and thermalized in a carbon-monoxide containing atmosphere. The formed volatile metal-carbonyl complexes could be transported in a gas-stream. Furthermore, short-lived isotopes of tungsten, rhenium, osmium, and iridium were synthesised at the linear accelerator UNILAC at GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt. The recoiling fusion products were separated from the primary beam and the transfer products in the gas-filled separator TASCA. The fusion products were stopped in the focal plane of TASCA in a recoil transfer chamber. This chamber contained a carbon-monoxide - helium gas mixture. The formed metal-carbonyl complexes could be transported in a gas stream to various experimental setups. All
Reference: 272 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available m L et al. 2005 Oct. Plant J. 44(1):114-27. The specification of epidermal (L1) identity occurs early during...s within the suspensor. Markers for L1 identity, ACR4 and ATML1, are not expressed in homozygous mutant embr...ng seedlings showed a specific loss of epidermal cell identity within large portions of the cotyledons. In a
Publications | Page 272 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. ... in Communicating Agricultural Biotechnology in Africa: Case Studies of Burkina Faso and Kenya ...
Publications | Page 272 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Fighting the violet vampire. In the fields of sub-Saharan Africa, Alan Watson and McGill University's Weed Research Group are battling devastating parasites — naturally. Something big was happening in these agricultural fields of.
Mechanisms and timing of replacement dental lamina regression
Czech Academy of Sciences Publication Activity Database
Dosedělová, H.; Dumková, J.; Lesot, H.; Glocová, K.; Hampl, A.; Tucker, A.; Buchtová, Marcela
2013-01-01
Roč. 296, special feature (2013), s. 272-272 ISSN 1932-8486. [International Congress of Vertebrate Morphology /10./. 08.07.2013-12.07.2013, Barcelona] Institutional support: RVO:67985904 Keywords : dental lamina Subject RIV: FF - HEENT, Dentistry
40 CFR 63.110 - Applicability.
2010-07-01
... of 40 CFR parts 260 through 272. The owner or operator shall keep a record of the information used to... 272. (f) Overlap with the Vinyl Chloride NESHAP. (1) After the compliance dates specified in § 63.100...
Fishman, Mayer N.; Thompson, John A.; Pennock, Gregory K.; Gonzalez, Rene; Diez, Luz M.; Daud, Adil I.; Weber, Jeffery S.; Huang, Bee Y.; Tang, Shamay; Rhode, Peter R.; Wong, Hing C.
2014-01-01
Purpose ALT-801 is a bifunctional fusion protein comprising interleukin-2 (IL-2) linked to a soluble, single-chain T cell receptor domain that recognizes a peptide epitope (aa264-272) of the human p53 antigen displayed on cancer cells in the context of HLA-A*0201 (p53+/HLA-A*0201). We evaluated the safety, pharmacokinetics and pharmacodynamics of ALT-801 in p53+/HLA-A*0201 patients with metastatic malignancies. Experimental Design p53+/HLA-A*0201 patients were treated with ALT-801 on a schedule of 4 daily 15-minute intravenous infusions, then 10 days rest and 4 more daily infusions. Cohorts of patients were treated at 0.015, 0.040, and 0.080 mg/kg/dose. Results Four, sixteen, and six patients were treated at the 0.015, 0.04 and 0.08 mg/kg cohorts, respectively. Two dose limiting toxicities (a grade 4 transient thrombocytopenia and a myocardial infarction) in the 0.08 mg/kg cohort established the maximum tolerated dose (MTD) at 0.04 mg/kg. Patients treated at the MTD experienced toxicities similar to those associated with high-dose IL-2 but of lesser severity. The serum half-life of ALT-801 was 4 hours and ALT-801 serum recovery was as expected based on the dose administered. ALT-801 treatment induced an increase of serum interferon-γ but not tumor necrosis factor-α. Response assessment showed 10 subjects with stable disease at at least 11 weeks, and in one who had melanoma metastasis, there is an ongoing complete absence of identifiable disease after resection of radiographically identified lesions. Conclusion This first-in-man study defines an ALT-801 regimen that can be administered safely and is associated with immunological changes of potential antitumor relevance. PMID:21994418
Alzheimer's Disease Facts and Figures
Full Text Available alz.org | Find Your Chapter 24/7 Helpline: 1.800.272.3900 Find your chapter: search by state In My Area | ... us 24/7 Helpline: 1-800-272-3900 Find Your Local Chapter Get Involved Make a donation ...
Optimal government policies in models with heterogeneous agents
Czech Academy of Sciences Publication Activity Database
Boháček, Radim; Kejak, Michal
-, č. 272 (2005), s. 1-55 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : optimal macroeconomic policy * optimal taxation * distribution of wealth and income Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp272.pdf
Chemistry of the superheavy elements.
Schädel, Matthias
2015-03-13
The quest for superheavy elements (SHEs) is driven by the desire to find and explore one of the extreme limits of existence of matter. These elements exist solely due to their nuclear shell stabilization. All 15 presently 'known' SHEs (11 are officially 'discovered' and named) up to element 118 are short-lived and are man-made atom-at-a-time in heavy ion induced nuclear reactions. They are identical to the transactinide elements located in the seventh period of the periodic table beginning with rutherfordium (element 104), dubnium (element 105) and seaborgium (element 106) in groups 4, 5 and 6, respectively. Their chemical properties are often surprising and unexpected from simple extrapolations. After hassium (element 108), chemistry has now reached copernicium (element 112) and flerovium (element 114). For the later ones, the focus is on questions of their metallic or possibly noble gas-like character originating from interplay of most pronounced relativistic effects and electron-shell effects. SHEs provide unique opportunities to get insights into the influence of strong relativistic effects on the atomic electrons and to probe 'relativistically' influenced chemical properties and the architecture of the periodic table at its farthest reach. In addition, they establish a test bench to challenge the validity and predictive power of modern fully relativistic quantum chemical models. © 2015 The Author(s) Published by the Royal Society. All rights reserved.
Czech Academy of Sciences Publication Activity Database
Vašíček, Zdeněk; Janssen, N. M. M.; Klein, J.
2016-01-01
Roč. 86, č. 3 (2016), s. 265-272 ISSN 0208-9068 Institutional support: RVO:68145535 Keywords : Lamellaptychi * Berriasian/Valanginian * Vocontian Basin * Betic Cordillera Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.833, year: 2016 http://www.asgp.pl/sites/default/files/volumes/86_3_265_272.pdf
Comparison of Rapid Malaria Test and Laboratory Microscopy ...
African Journals Online (AJOL)
Michael Horsfall
ABSTRACT: Blood samples collected from 272 volunteers in two communities of Bayelsa State in the Niger. Delta area were investigated for falciparum malaria parasite using the rapid test based on the detection of soluble antigen and laboratory microscopy test. The data showed that out of the 272 samples collected, ...
Idala: An unnamed Function Peptide Vaccine for Tuberculosis ...
African Journals Online (AJOL)
Purpose: To evaluate Myt272 protein antigenicity and immunogenicity by trial vaccination in mice and its in silico analysis as a potential peptide vaccine for tuberculosis. Methods: Myt272 gene, which has 100 % identity with Mycobacterium tuberculosis H37Rv unknown function gene Rv3424c, was ligated by genomic ...
29 CFR 1910.272 - Grain handling facilities.
2010-07-01
... shall provide training to employees at least annually and when changes in job assignment will expose... agriculture schools, industry associations, union organizations, and insurance groups. 4. Hot Work Permit The... Methods for D-C Resistance or Conductance of Insulating Materials”; and, the International Standards...
48 CFR 538.272 - MAS price reductions.
2010-10-01
... maintain during the contract period the negotiated price/discount relationship (and/or term and condition relationship) between the eligible ordering activities and the offeror's customer or category of customers on... customers) that results in a less advantageous relationship between the eligible ordering activities and...
38 CFR 17.272 - Benefits limitations/exclusions.
2010-07-01
... fabric versus synthetic fabric and vegetable-dyed shoes). (51) Food, food substitutes, vitamins or other... services in excess of 30 days in any fiscal year (or in an admission), in the case of a patient nineteen... excess of 23 visits in a fiscal year unless a waiver for extended coverage is granted in advance. (62...
7 CFR 272.5 - Program informational activities.
2010-01-01
... creed, national origin or political belief. (c) Program informational activities for low-income..., application procedures, and benefits of the Food Stamp Program. Program informational materials used in such... the socio-economic and demographic characteristics of the target population, types of media used...
46 CFR 272.24 - Subsidy repair summaries.
2010-10-01
... an Operator in the following manner: This is to certify that, to the best of my knowledge and belief... completed, and the price is fair and reasonable (exceptions are listed on separate page). (c) Categorization... reasonableness of the prices for the submitted work. With respect to any claims for M&R performed outside the...
38 CFR 21.272 - Veteran-student services.
2010-07-01
... eligible to receive a work-study allowance. (Authority: 38 U.S.C. 3104(a)(4), 3485) (b) Selection criteria... by the Chapter 30 rate; (2) Motivation of the veteran; and (3) Compatibility of the work assignment with the veteran's physical condition. (Authority: 38 U.S.C. 3104(a)(4), 3108(f), 3485) (c) Utilization...
38 CFR 3.272 - Exclusions from income.
2010-07-01
.... Amounts equal to expenses paid by a veteran or surviving spouse pursuing a course of education or... section 2(b) of such Code); and (2) If the child is pursuing a course of postsecondary education or... Therapeutic and Rehabilitation Activities Fund as a result of participation in a therapeutic or rehabilitation...
272--11 Dec 2009 [final version].indd
African Journals Online (AJOL)
2009-12-11
Dec 11, 2009 ... e o lo g ic a l S tu d ie s http://www.hts.org.za. HTS. Original Research. A rtic le # .... of departure is only possible due to an extra-biblical maxim, to ... John Hart points out ...... Jean-Pierre Changeaux and the philosopher Paul Ricoeur, is ..... De Cruchy, J.W., 1986, The church struggle in South Africa, Collins.
40 CFR 1065.272 - Nondispersive ultraviolet analyzer.
2010-07-01
... measure NOX concentration in raw or diluted exhaust for batch or continuous sampling. We generally accept... high concentrations to interfere with proper operation. (b) Component requirements. We recommend that... other gaseous measurements and the engine's known or assumed fuel properties. The target value for any...
7 CFR 272.2 - Plan of operation.
2010-01-01
... next year, State agencies shall consider major corrective action objectives, existing program strengths... Plan of Operation. The State and FNS (USDA) further agree to fully comply with any changes in Federal... belief, religion, handicap, or national origin, be excluded from participation in, be denied the benefits...
Human betacoronavirus 2c EMC/2012-related viruses in bats, Ghana and Europe.
Annan, Augustina; Baldwin, Heather J; Corman, Victor Max; Klose, Stefan M; Owusu, Michael; Nkrumah, Evans Ewald; Badu, Ebenezer Kofi; Anti, Priscilla; Agbenyega, Olivia; Meyer, Benjamin; Oppong, Samuel; Sarkodie, Yaw Adu; Kalko, Elisabeth K V; Lina, Peter H C; Godlevska, Elena V; Reusken, Chantal; Seebens, Antje; Gloza-Rausch, Florian; Vallo, Peter; Tschapka, Marco; Drosten, Christian; Drexler, Jan Felix
2013-03-01
We screened fecal specimens of 4,758 bats from Ghana and 272 bats from 4 European countries for betacoronaviruses. Viruses related to the novel human betacoronavirus EMC/2012 were detected in 46 (24.9%) of 185 Nycteris bats and 40 (14.7%) of 272 Pipistrellus bats. Their genetic relatedness indicated EMC/2012 originated from bats.
1983-01-01
PARKIN LOT MAINTENANCE YUIA ARIZONA 82 82 ZILLOENS HEIAN ASSOCIATES YUMA ARIZONA 272 272 20,462 13,094 6,681 60 627 1,359,748 428,327 353,827 545,807...INC MORGANZA LOUISIANA 335 335 1,715 29 1,686 RAYS CONSTRUCTION CO NAIRN LOUISIANA 400 400 400 400 MARY LOU FASHIONS NATCHITOCHES LOUISIANA 193 193 193
Human Betacoronavirus 2c EMC/2012–related Viruses in Bats, Ghana and Europe
Annan, Augustina; Baldwin, Heather J.; Corman, Victor Max; Klose, Stefan M.; Owusu, Michael; Nkrumah, Evans Ewald; Badu, Ebenezer Kofi; Anti, Priscilla; Agbenyega, Olivia; Meyer, Benjamin; Oppong, Samuel; Sarkodie, Yaw Adu; Kalko, Elisabeth K.V.; Lina, Peter H.C.; Godlevska, Elena V.; Reusken, Chantal; Seebens, Antje; Gloza-Rausch, Florian; Vallo, Peter; Tschapka, Marco; Drosten, Christian
2013-01-01
We screened fecal specimens of 4,758 bats from Ghana and 272 bats from 4 European countries for betacoronaviruses. Viruses related to the novel human betacoronavirus EMC/2012 were detected in 46 (24.9%) of 185 Nycteris bats and 40 (14.7%) of 272 Pipistrellus bats. Their genetic relatedness indicated EMC/2012 originated from bats. PMID:23622767
Developing a Hybrid Virtualization Platform Design for Cyber Warfare Training and Education
2010-06-01
25 2.7.2. Virtual Distributed Ethernet ( VDE ) ...................................................... 26 2.7.3...ability to work with the network independent of the actual underlying physical topology. 26 2.7.2. Virtual Distributed Ethernet ( VDE ) 2.7.2.1...Virtual Distributed Ethernet ( VDE ) is an abstraction of the networking components involved in a typical Ethernet network [18]. It allows for virtual
Superheavy element chemistry. Achievements and perspectives
International Nuclear Information System (INIS)
Schaedel, M.
2007-01-01
Superheavy elements have been synthesized and chemically characterized one-atom-at-a-time up to element 108. Presently, the quest for element 112 is one of the hottest topics in this field. The transactinide elements 104 to 108 are members of group 4 to 8 of the Periodic Table and element 112 belongs into group 12. Chemical properties of some of these elements, like elements 104 and 105, show stunning deviations from simple extrapolations within their respective group while others exhibit great similarities with their lighter homologues elements. First experiments to investigate seaborgium (Sg, element 106) in aqueous solution were performed. Again, in large international collaborations at the GSI, several gas-phase chemistry experiments were performed with hassium (Hs, element 108). Recently, the highly efficient and very clean separation of Hs was applied for nuclear studies of various Hs nuclides investigating their cross section and their nuclear decay properties in the region of the doubly-magic 270 Hs (Z=108, N=162). To overcome certain limitations of the presently used on-line chemical separations the new TransActinide Separation and Chemistry Apparatus (TASCA) - with a gas-filled recoil separator as a front-end tool - was designed and built at the GSI in a collaborative effort. Presently in its commissioning phase, TASCA shall be a key instrument for a big leap into quantitatively and qualitatively new experiments in the region of superheavy elements. (author)
NCBI nr-aa BLAST: CBRC-TTRU-01-0021 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TTRU-01-0021 ref|ZP_05556351.1| competence protein ComEC [Lactobacillus jensen...ii 27-2-CHN] ref|ZP_05862090.1| competence protein ComEC [Lactobacillus jensenii 115-3-CHN] gb|EEU21212.1| competence... protein ComEC [Lactobacillus jensenii 27-2-CHN] gb|EEX24089.1| competence protein ComEC [Lactobacillus jensenii 115-3-CHN] ZP_05556351.1 0.18 25% ...
Anonymous Agencies, Backstreet Businesses and Covert Collectives
DEFF Research Database (Denmark)
Krause Hansen, Hans; Schoeneborn, Dennis
2015-01-01
Book review of: Anonymous Agencies, Backstreet Businesses and Covert Collectives: rethinking Organizations in the 21st Century, C. R. Scott. Stanford, CA: Stanford University Press, 2013. 272 pp. £45.90. ISBN 9780804781381......Book review of: Anonymous Agencies, Backstreet Businesses and Covert Collectives: rethinking Organizations in the 21st Century, C. R. Scott. Stanford, CA: Stanford University Press, 2013. 272 pp. £45.90. ISBN 9780804781381...
Tong, Yixin; Park, So Hyun; Wu, Di; Xu, Wenhao; Guillot, Stacey J.; Jin, Li; Li, Xudong; Wang, Yalin; Lin, Chyuan-Sheng; Fu, Zheng
2017-01-01
Human endocrine-cerebro-osteodysplasia (ECO) syndrome, caused by the loss-of-function mutation R272Q in the ICK (intestinal cell kinase) gene, is a neonatal-lethal developmental disorder. To elucidate the molecular basis of ECO syndrome, we constructed an Ick R272Q knock-in mouse model that recapitulates ECO pathological phenotypes. Newborns bearing Ick R272Q homozygous mutations die at birth due to respiratory distress. Ick mutant lungs exhibit not only impaired branching morphogenesis associated with reduced mesenchymal proliferation, but also significant airspace deficiency in primitive alveoli concomitant with abnormal interstitial mesenchymal differentiation. ICK dysfunction induces elongated primary cilia and perturbs ciliary Hedgehog signaling and autophagy during lung sacculation. Our study identifies an essential role for ICK in lung development and advances the mechanistic understanding of ECO syndrome. PMID:28380258
DEFF Research Database (Denmark)
Craft, George E; Graham, Mark E; Bache, Nicolai
2008-01-01
: serines 250, 252, 262, 268, 272, 276, 285, 293, 496, 514, 539, and 626 and Thr-310. These were distributed into two clusters around the proline-rich domain and the C-terminal Src homology 3 domain. Hierarchical phosphorylation of Ser-262 preceded phosphorylation of Ser-268, -272, -276, and -285. Off......, incorporating 16 and 23% of the 32P. The multiple phosphopeptides containing Ser-268, Ser-276, Ser-272, and Ser-285 had 27% of the 32P. Evidence for a role for at least one proline-directed protein kinase and one non-proline-directed kinase was obtained. Four phosphosites predicted for non-proline...... that are either dynamically turning over or constitutively phosphorylated in nerve terminals and improve understanding of the role of individual amphI sites or phosphosite clusters in synaptic SVE....
Work-family conflict and job burnout among correctional staff.
Lambert, Eric G; Hogan, Nancy L
2010-02-01
Work-family conflict and job burnout are both issues for 272 correctional staff (response rate of 68%). The two major forms of work-family conflict are work-on-family conflict and family-on-work conflict. Multivariate analysis of survey data from 272 correctional staff at a state prison indicated work-on-family conflict had a significant positive relation with job burnout, while family-on-work conflict did not.
Nonlinear current-voltage characteristics of WO3-x nano-/micro-rods
Shen, Zhenguang; Peng, Zhijian; Zhao, Zengying; Fu, Xiuli
2018-04-01
A series of crystalline tungsten oxide nano-/micro-rods with different compositions of WO3, WO2.90, W19O55 (WO2.89) and W18O49 (WO2.72) but identical morphology feature were first prepared. Then, various nanoscaled electrical devices were fabricated from them by micro-fabrication through a focused ion beam technique. Interestingly, the devices from the oxygen-deficient WO3-x display significantly nonlinear current-voltage characteristics. The calculated nonlinear coefficients of the WO2.90, WO2.83, and WO2.72 varistors are 2.52, 3.32 and 4.91, respectively. The breakdown voltage of the WO2.90, WO2.83, and WO2.72 varistors are 1.93, 1.28 and 0.93 V, respectively. Such WO3-x nano-varistors might be promising for low-voltage electrical/electronic devices.
46 CFR 272.23 - Examples of ineligible expenses.
2010-10-01
... loading of stores, the landing and sorting of laundry, pilot service, tug charges, removing surplus... or otherwise equip a vessel for its intended subsidized service which MARAD determines should have been performed before the initial entry of the vessel into subsidized service; (b) Convenience items...
Translations on Narcotics and Dangerous Drugs, Number 272
1976-11-18
including "marihuana" paper, and a stapler. On 18 September. 28 Luis, who said that he was a receptionist at Comodoro Hotel ( Duque de Caxias Avenue...people. Two hours later the five men from Sinaloa were arrested at the Elba Hotel. They were identified as Efrain Zazueta Beltran, Pedro Salazar Ramirez...national ring of drug traffickers known as the "French Connection" entered the state penitentiary today to begin serving their terms. They are: Pedro
40 CFR 180.272 - Tribuphos; tolerances for residues.
2010-07-01
...: Commodity Parts per million Cattle, fat 0.15 Cattle, meat 0.02 Cattle, meat byproducts 0.02 Cotton, gin byproducts 40.0 Cotton, undelinted seed 4.0 Goat, fat 0.15 Goat, meat 0.02 Goat, meat byproducts 0.02 Hog, fat 0.15 Hog, meat 0.02 Hog, meat byproducts 0.02 Horse, fat 0.15 Horse, meat 0.02 Horse, meat...
40 CFR 97.272 - Out of control periods.
2010-07-01
... Out of control periods. (a) Whenever any monitoring system fails to meet the quality-assurance and.... (b) Audit decertification. Whenever both an audit of a monitoring system and a review of the initial... certification or recertification application submission and at the time of the audit, the Administrator will...
40 CFR 96.272 - Out of control periods.
2010-07-01
... the quality-assurance and quality-control requirements or data validation requirements of part 75 of... appendix D to part 75 of this chapter. (b) Audit decertification. Whenever both an audit of a monitoring... the time of the audit, the permitting authority or, for a CAIR SO2 opt-in unit or a unit for which a...
Lifescience Database Archive (English)
Full Text Available AAATACATCTGATGAAA CATGTTATCAATGCTTTGGCGCAACTTAAAGATGGCATTNGNTAANGCTGAAAAAGCAAA GCCTGGTANCACTCACAGTTTACATCGCACAAATCATANA...CTCACAGTTTACATCGCACAAATCATANAAACCCT sequence update 2001. 6. 1 Translated Amino Acid sequence ---XNGAAVTQQQA...TGATGAAA CATGTTATCAATGCTTTGGCGCAACTTAAAGATGGCATTNGNTAANGCTGAAAAAGCAAA GCCTGGTANCA
Lifescience Database Archive (English)
Full Text Available NIDGLKNVQTICYNNMSQCYLKEKKVPMLW*lqkkh*nyhqmilkhsl eklklyl*wrnmmklskiskks Translate...IAK YNKALRYLDCCSNIDGLKNVQTICYNNMSQCYLKEKKVPMLW*lqkkh*nyhqmilkhsl eklklyl*wrnmmklskiskks Homology vs CSM-cDNA
1935 15' Quad #272 Aerial Photo Mosaic Index
Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...
12 CFR 272.2 - Functions of the Committee.
2010-01-01
... and domestic and international economic and financial developments, and other pertinent information... takes actions from time-to-time to regulate and direct the open market operations of the Reserve banks...
46 CFR 272.42 - Audit requirements and procedures.
2010-10-01
... procedures. (a) Required audit. In connection with the audit of the Operator's subsidizable expenses, the... of audit results. Upon completion of the audit by the Office of Inspector General, the MARAD Office of Financial Approvals shall notify the Operator of the audit results, including any items disallowed...
Lifescience Database Archive (English)
Full Text Available KEEIEKMVADAEKFKQQDE HKKIVLNQRINWKIMHSLLKIQLKMKKLQPKFQIQINQLLNLKLKVYSNG*nqikpqkrm nmkir*kp*kqlsiqimsxlxqeggmp...IQLKMKKLQPKFQIQINQLLNLKLKVYSNG*nqikpqkrm nmkir*kp*kqlsiqimsxlxqeggmpqgggtarwyvk F
29 CFR 1952.272 - Level of Federal enforcement.
2010-07-01
... case of temporary emergency standards promulgated under section 6(c) of the Act (29 U.S.C. 665(c)), in... sections 18(e) and (f) of the Act (29 U.S.C. 667(e) and (f)). Federal OSHA will also retain authority for... operations. The OSHA Regional Administrator will make a prompt recommendation for the resumption of the...
7 CFR 272.1 - General terms and conditions.
2010-01-01
... participating State or political subdivision shall decrease any assistance otherwise provided an individual or... the conversion process as required), shall be subject to standard QC review procedures. When the QC... shall issue press releases to the news media advising of the impending program changes. (v) For the...
Page 1 272 Ethiopian Journal of Environmental Studies ...
African Journals Online (AJOL)
USER
2015-03-24
Mar 24, 2015 ... Department of Science Laboratory Technology, University of Jos, P.M.B. 2084, Jos, Plateau ..... Lowlands: A Field Guide 4th Edition, ... Entomology and Guide to insect. Identification,. Feline. Press ... University of California.
Vázquez Fresno, Rosa; Llorach, Rafael; Alcaro, Francesca; Rodríguez Martínez, Miguel Ángel; Vinaixa Crevillent, Maria; Chiva Blanch, Gemma; Estruch Riba, Ramon; Correig Blanchar, Xavier; Andrés Lacueva, Ma. Cristina
2012-01-01
Moderate wine consumption is associated with health-promoting activities. An H-NMR-based metabolomic approach was used to identify urinary metabolomic differences of moderate wine intake in the setting of a prospective, randomized, crossover, and controlled trial. Sixty-one male volunteers with high cardiovascular risk factors followed three dietary interventions (28 days): dealcoholized red wine (RWD) (272mL/day, polyphenol control), alcoholized red wine (RWA) (272mL/day) and gin (GIN) (100m...
Directory of Open Access Journals (Sweden)
Xin Zhang
2016-09-01
Full Text Available A simple and high-throughput assay to detect fungicide resistance is required for large-scale monitoring of the emergence of resistant strains of Botrytis cinerea. Using suspension array technology performed on a Bio-Plex 200 System, we developed a single-tube allele-specific primer extension (ASPE assay that can simultaneously detect eight alleles in one reaction. These eight alleles include E198 and 198A of the β-Tubulin gene (BenA, H272 and 272Y of the Succinate dehydrogenase iron–sulfur subunit gene (SdhB, I365 and 365S of the putative osmosensor histidine kinase gene (BcOS1, and F412 and 412S of the 3-ketoreductase gene (erg27. This assay was first established and optimized with eight plasmid templates containing the DNA sequence variants BenA-E198, BenA-198A, SdhB-H272, SdhB-272Y, BcOS1-I365, BcOS1-365S, erg27-F412, and erg27-412S. Results indicated that none of the probes showed cross-reactivity with one another. The minimum limit of detection for these genotypes was one copy per test. Four mutant plasmids were mixed with 10 ng/μL wild-type genomic DNA in different ratios. Detection sensitivity of mutant loci was 0.45% for BenA-E198A, BcOS1-I365S, and erg27-F412S, and was 4.5% for SdhB-H272Y. A minimum quantity of 0.1 ng of genomic DNA was necessary to obtain reliable results. This is the first reported assay that can simultaneously detect mutations in BenA, SdhB, BcOS1, and erg27.
International Nuclear Information System (INIS)
Aguilar Alvarez, Estela Yamileth
2007-01-01
Xylella fastidiosa is a plant pathogenic bacterium that causes diseases in different crops. Symptoms similar to those caused by citrus variegated chlorosis (CVC) were observed in sweet orange trees which served as shade and fences in coffee plantations in Costa Rica, in 2002. A total of 35 citrus trees and 24 vines from eight different districts and 3 respectively were evaluated by 'double antibody sandwich enzyme-linked immunosorbent assay' (DASELISA), resulting in 21 citrus and 19 positive vid. From four citrus trees and six of vines, were obtained six isolates and seven isolates respectively in solid medium, whose morphological and biochemical characteristics coincided with those reported in the literature as characteristic of X. fastidiosa. The identity of the isolates is confirmed by the chain polymerase reaction (PCR) using primers 272-1/272-2int and RST31/RST33. Three isolates from Grecia (Alajuela Province) amplified a band of 500pb using specific primers 272-2int/CVC-1 for strains of X. fastidiosa that cause CVC. The genetic variability of isolates from each other in comparison with isolates of coffee in Costa Rica, U.S. grapes and citrus in Brazil have been studied using techniques of random amplification polymorphism DNA (RAPD) and length polymorphisms of restriction fragments (RFLPs) of the products obtained with primers int/272-2int JB-1/JB-2 and 272-1. The results showed a clear separation between citrus isolates of Costa Rica; and, an association of three of them with the strains of citrus in Brasil. Also, an association between strains of coffee of Costa Rica with grape vines in the U.S. An association of molecular analysis confirmed the data variance. (author) [es
Martins-Melo, Francisco Rogerlândio; Lima, Mauricélia da Silveira; Alencar, Carlos Henrique; Ramos, Alberto Novaes; Heukelbach, Jorg
2014-06-01
Visceral leishmaniasis (VL)-HIV/AIDS co-infection is an emerging health problem with high case fatality. This study presents the epidemiological and clinical aspects of deaths related to VL-HIV/AIDS co-infection in Brazil. This was a nationwide population-based study based on mortality data obtained from the Brazilian Mortality Information System. We included all deaths between 2000 and 2011 (about 12.5 million), and analyzed those in which VL and HIV/AIDS were mentioned in the same death certificate. VL and HIV/AIDS were mentioned in 272 deaths. HIV/AIDS was the underlying cause in 59.6% (162/272) of deaths by VL-HIV/AIDS co-infection, and VL the underlying cause in 39.3% (107/272). Predominating characteristics were: male gender (79.0%, 215/272), age 30-39 years (41.0%, 111/271), brown race/color (61.6%, 159/258) and residence in the Northeast region (47.4%, 129/272). Average annual age-adjusted mortality rate was 0.13 deaths/1 000 000 inhabitants. Deaths were distributed in 20 of 27 Brazilian states. There was an increasing trend of mortality (annual percent change: 16.4%). Infectious/parasitic (58.8%) and respiratory (51.1%) diseases/disorders, particularly sepsis, respiratory failure and pneumonia, were most commonly associated with deaths related to this co-infection. VL-HIV/AIDS co-infection is an increasing public health problem in Brazil. The systematic description of the epidemiological characteristics and magnitude of mortality related to VL-HIV/AIDS co-infection reflects the need to intensify control measures and disease surveillance. © The Author 2014. Published by Oxford University Press on behalf of Royal Society of Tropical Medicine and Hygiene. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Zhang, Xin; Xie, Fei; Lv, Baobei; Zhao, Pengxiang; Ma, Xuemei
2016-01-01
A simple and high-throughput assay to detect fungicide resistance is required for large-scale monitoring of the emergence of resistant strains of Botrytis cinerea . Using suspension array technology performed on a Bio-Plex 200 System, we developed a single-tube allele-specific primer extension assay that can simultaneously detect eight alleles in one reaction. These eight alleles include E198 and 198A of the β-Tubulin gene ( BenA ), H272 and 272Y of the Succinate dehydrogenase iron-sulfur subunit gene ( SdhB) , I365 and 365S of the putative osmosensor histidine kinase gene ( BcOS1 ), and F412 and 412S of the 3-ketoreductase gene ( erg27 ). This assay was first established and optimized with eight plasmid templates containing the DNA sequence variants BenA- E198, BenA- 198A, SdhB- H272, SdhB- 272Y, BcOS1- I365, BcOS1- 365S, erg27 -F412, and erg27 -412S. Results indicated that none of the probes showed cross-reactivity with one another. The minimum limit of detection for these genotypes was one copy per test. Four mutant plasmids were mixed with 10 ng/μL wild-type genomic DNA in different ratios. Detection sensitivity of mutant loci was 0.45% for BenA- E198A, BcOS1- I365S, and erg27 -F412S, and was 4.5% for SdhB- H272Y. A minimum quantity of 0.1 ng of genomic DNA was necessary to obtain reliable results. This is the first reported assay that can simultaneously detect mutations in BenA , SdhB , BcOS1 , and erg27 .
Zhang, Xin; Xie, Fei; Lv, Baobei; Zhao, Pengxiang; Ma, Xuemei
2016-01-01
A simple and high-throughput assay to detect fungicide resistance is required for large-scale monitoring of the emergence of resistant strains of Botrytis cinerea. Using suspension array technology performed on a Bio-Plex 200 System, we developed a single-tube allele-specific primer extension (ASPE) assay that can simultaneously detect eight alleles in one reaction. These eight alleles include E198 and 198A of the β-Tubulin gene (BenA), H272 and 272Y of the Succinate dehydrogenase iron–sulfur...
Simon, J. I.; Simon, S. B.; Nguyen, A. N.; Ross, D. K.; Messenger, S.
2017-01-01
We conducted NanoSIMS O-isotopic imaging of a primitive spinel-rich CAI spherule (27-2) from the MIL 090019 CO3 chondrite. Inclusions such as 27-2 are proposed to record inner nebula processes during an epoch of rapid solar nebula evolution. Mineralogical and textural analyses suggest that this CAI formed by high temperature reactions, partial melting, and condensation. This CAI exhibits radial O-isotopic heterogeneity among multiple occurrences of the same mineral, reflecting interactions with distinct nebular O-isotopic reservoirs.
Design criteria tank farm storage and staging facility. Revision 1
International Nuclear Information System (INIS)
Lott, D.T.
1994-01-01
Tank Farms Operations must store/stage material and equipment until work packages are ready to work. Consumable materials are also required to be stored for routine and emergency work. Connex boxes and open storage is currently used for much of the storage because of the limited space at 272AW and 272WA. Safety issues based on poor housekeeping and material deteriorating due to weather damage has resulted from this inadequate storage space. It has been determined that a storage building in close proximity to the Tank Farm work force would be cost effective. Project W-402 and W-413 will provide a storage/staging area in 200 East and West Areas by the construction of two new storage facilities. The new facilities will be used by Operations, Maintenance and Materials groups to adequately store material and equipment. These projects will also furnish electrical services to the facilities for lighting and HVAC. Fire Protection shall be extended to the 200 East facility from 272AW if necessary
Role of membrane Hsp70 in radiation sensitivity of tumor cells
International Nuclear Information System (INIS)
Murakami, Naoya; Kühnel, Annett; Schmid, Thomas E.; Ilicic, Katarina; Stangl, Stefan; Braun, Isabella S.; Gehrmann, Mathias; Molls, Michael; Itami, Jun; Multhoff, Gabriele
2015-01-01
The major stress-inducible heat shock protein 70 (Hsp70) is frequently overexpressed in the cytosol and integrated in the plasma membrane of tumor cells via lipid anchorage. Following stress such as non-lethal irradiation Hsp70 synthesis is up-regulated. Intracellular located Hsp70 is known to exert cytoprotective properties, however, less is known about membrane (m)Hsp70. Herein, we investigate the role of mHsp70 in the sensitivity towards irradiation in tumor sublines that differ in their cytosolic and/or mHsp70 levels. The isogenic human colon carcinoma sublines CX + with stable high and CX − with stable low expression of mHsp70 were generated by fluorescence activated cell sorting, the mouse mammary carcinoma sublines 4 T1 (4 T1 ctrl) and Hsp70 knock-down (4 T1 Hsp70 KD) were produced using the CRISPR/Cas9 system, and the Hsp70 down-regulation in human lung carcinoma sublines H1339 ctrl/H1339 HSF-1 KD and EPLC-272H ctrl/EPLC-272H HSF-1 KD was achieved by small interfering (si)RNA against Heat shock factor 1 (HSF-1). Cytosolic and mHsp70 was quantified by Western blot analysis/ELISA and flow cytometry; double strand breaks (DSBs) and apoptosis were measured by flow cytometry using antibodies against γH2AX and real-time PCR (RT-PCR) using primers and antibodies directed against apoptosis related genes; and radiation sensitivity was determined using clonogenic cell surviving assays. CX + /CX − tumor cells exhibited similar cytosolic but differed significantly in their mHsp70 levels, 4 T1 ctrl/4 T1 Hsp70 KD cells showed significant differences in their cytosolic and mHsp70 levels and H1339 ctrl/H1339 HSF-1 KD and EPLC-272H ctrl/EPLC-272H HSF-1 KD lung carcinoma cell sublines had similar mHsp70 but significantly different cytosolic Hsp70 levels. γH2AX was significantly up-regulated in irradiated CX − and 4 T1 Hsp70 KD with low basal mHsp70 levels, but not in their mHsp70 high expressing counterparts, irrespectively of their cytosolic Hsp70 content. After
DEFF Research Database (Denmark)
Sturm, Bob L.
2013-01-01
A critical review of the book: An Introduction to Audio Content Analysis: Applications in Signal Processing and Music Informatics, by Alexander Lerch, October 2012, Wiley-IEEE Press. ISBN: 978-1-118-26682-3, Hardcover, 272 pages, 503 references. List price $125.00......A critical review of the book: An Introduction to Audio Content Analysis: Applications in Signal Processing and Music Informatics, by Alexander Lerch, October 2012, Wiley-IEEE Press. ISBN: 978-1-118-26682-3, Hardcover, 272 pages, 503 references. List price $125.00...
ORF Alignment: NC_003076 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available DTKKISAVSIFFETMPYRLDENTGYID 180 ... Query: 272 SPFEYADVVTTTTHKSLRGPRGAMIFFRKGLKEINKQGKEVMYDYEDRINQAVFPGLQGG 331... ... SPFEYADVVTTTTHKSLRGPRGAMIFFRKGLKEINKQGKEVMYDYEDRINQAVFPGLQGG Sbjct: 241 SPFEYADVVTTTTHKSLRGPRGAMIF
ORF Alignment: NC_004578 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available GEAERRVEGLASEWGNPEIAALNLVAIDCRADASA 211 ... PAVIAGLLRERGLGPSRMTVLEHLGGEAERRVEGLASEWGNPEIAALNLVAIDCRADA...SA Sbjct: 1 ... PAVIAGLLRERGLGPSRMTVLEHLGGEAERRVEGLASEWGNPEIAALNLVAIDCRADASA 60 ... Query: 272 TCRAMAIEADEGRQQLI
Artificial Boundary Conditions for Finite Element Model Update and Damage Detection
2017-03-01
otherwise, Equation (2.58), even if it seems overdetermined, can have linear dependent rows and ends up being underdetermined. 2. Methods Using...0i iM , (2.62) where i and i are the solutions to Equation (2.5), and i from (2.6) is mass normalized. Differentiating ...known that: i iM , (2.72) where [Λ] is the diagonal eigenvalue matrix. From matrix algebra , the Equation (2.72
Design criteria tank farm storage and staging facility
International Nuclear Information System (INIS)
Lott, D.T.
1995-01-01
Tank Farms Operations must store/stage material and equipment until work packages are ready to work. Consumable materials are also required to be stored for routine and emergency work. Safety issues based on poor housekeeping and material deterioration due to weather damage has resulted from inadequate storage space. It has been determined that a storage building in close proximity to the Tank Farm work force would be cost effective. This document provides the design criteria for the design of the storage and staging buildings near 272AW and 272WA buildings
All projects related to | Page 272 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
2012-03-16
How can science, technology, and innovation contribute to poverty reduction and inclusive development, especially in Brazil, Russia, India, China, and South Africa, otherwise known as the BRICS countries? Start Date: March 16, 2012. End Date: September 16, 2013. Topic: SCIENCE AND TECHNOLOGY POLICY, ...
7 CFR 2.72 - Chairman, World Agricultural Outlook Board.
2010-01-01
... OF AGRICULTURE AND GENERAL OFFICERS OF THE DEPARTMENT Delegations of Authority by the Chief Economist... (a)(7), the following delegations of authority are made by the Chief Economist to the Chairman, World... following authority is reserved to the Chief Economist: Review all proposed decisions having substantial...
BKR 27(2) pp. 89-97 (Sunmonu et al)
African Journals Online (AJOL)
Femi J. Olorunniji
2015-06-30
Jun 30, 2015 ... are used as analgesic and in the treatment of sexual diseases, malaria, dysentery, stroke, heart failure, gonorrhea, arthritis, diabetes, snake bites ..... Traditional Medical Development for medical and dental primary. Health care .... of coronary artery disease in patients with type 1 diabetes mellitus,” American.
Neratinib (HKI-272) in the treatment of breast cancer.
López-Tarruella, Sara; Jerez, Yolanda; Márquez-Rodas, Iván; Martín, Miguel
2012-06-01
Neratinib is an orally available, small, irreversible, pan-HER kinase inhibitor. HER-2-positive breast cancer is a breast cancer subtype with an increasing body of knowledge regarding potential targeted drug combinations that are significantly improving outcomes through a biologically tailored therapy approach; neratinib emerges as a promising tool in this context. This article reviews the molecular and clinical development of neratinib, an example of a covalent drug, from preclinical models to Phase III clinical trials, focusing on breast cancer treatment. The potential combinations of neratinib with chemotherapy in the metastatic, adjuvant and even neoadjuvant settings are appraised. These results and future perspectives will be discussed.
BKR 27(2) pp. 85-88 (Adekanle et al)
African Journals Online (AJOL)
Femi J. Olorunniji
2015-06-30
Jun 30, 2015 ... several disease states in adult and infants. Reactive oxygen species (ROS) are generated spontaneously in cells during metabolism and are implicated in the aetiology of different degenerative diseases, such as heart diseases, stroke, rheumatoid arthritis, diabetes and cancer (Oloyede and. Afolabi, 2012).
20 CFR 702.272 - Informal recommendation by district director.
2010-04-01
... LONGSHOREMEN'S AND HARBOR WORKERS' COMPENSATION ACT AND RELATED STATUTES ADMINISTRATION AND PROCEDURE Claims... any wage loss suffered as the result of the discharge or discrimination. The district director may... of the Chief Administrative Law Judge for hearing pursuant to § 702.317. [42 FR 45302, Sept. 9, 1977] ...
BKR 27(2) pp. 56-62 (Omage et al)
African Journals Online (AJOL)
Femi J. Olorunniji
2015-06-30
Jun 30, 2015 ... creatinine in normal experimental rabbits. Kingsley ... 0.05) lower serum creatinine. Treatment with ... heart failure and arterial aneurysm, and is a leading cause of chronic renal ... At severely high pressure, defined as mean ...
BKR 27(2) pp. 63-67 (Ejike et al)
African Journals Online (AJOL)
Femi J. Olorunniji
2015-06-30
Jun 30, 2015 ... (Ejike and Ezeanyika, 2008; Bastien et al., 2014). The body mass index (BMI) is the .... Mei Z, Grummer-Strawm LM, Pietrobelli A, Goulding A,. Goran MI, Dietz WH. ... Nutrition Examination Survey (1988-1994). Am J Clin Nutr;.
BKR 27(2) pp. 106-110 (Mohammed et al)
African Journals Online (AJOL)
Femi J. Olorunniji
2015-06-30
Jun 30, 2015 ... conventional feeds (crop by-products) are fundamental to farming systems that ... groundnut haulm, groundnut cake, fish meal, limestone, common salt and premix .... peel meal in place of maize base diets. Pakistan Journal of.
7 CFR 272.4 - Program administration and personnel requirements.
2010-01-01
... from unauthorized creation or tampering, the State agency shall establish an organizational structure..., tapes, or similar memory devices. The issuance unit shall provide certified households with the...
BKR 27(2) pp. 68-75 (Muhammad et al)
African Journals Online (AJOL)
Femi J. Olorunniji
2015-06-30
Jun 30, 2015 ... 2Department of Animal Science, University of Maiduguri. P.M.B. 1056, Borno State, ..... Parasitic and Infectious Diseases, Proceeding of American. Animals Hospital Association, South Bend, IN. Anon (1980). Guide to the care ...
BKR 27(2) pp. 76-84 (Mordi et al)
African Journals Online (AJOL)
Femi J. Olorunniji
2015-06-30
Jun 30, 2015 ... Hepatoprotective effects of palm oil and coconut water in the serum of Wistar rats ..... enzymes are indicative of cellular leakage and loss of functional integrity of cell ..... Detection of Hair in Food. Regulatory Toxicology and.
BKR 27(2) pp. 98-105 (Ugbaja et al)
African Journals Online (AJOL)
Femi J. Olorunniji
2015-06-30
Jun 30, 2015 ... Vitamins C and E attenuate lipid dystrophy in tissues of rats administered .... weeks for acclimation prior to experimental treatment. The rats were ..... fluoride and aluminium in liver and gastrocnemium muscle of female mice.
Santo, Karla; Richtering, Sarah S; Chalmers, John; Thiagalingam, Aravinda; Chow, Clara K; Redfern, Julie
2016-12-02
There are a growing number of mobile phone apps available to support people in taking their medications and to improve medication adherence. However, little is known about how these apps differ in terms of features, quality, and effectiveness. We aimed to systematically review the medication reminder apps available in the Australian iTunes store and Google Play to assess their features and their quality in order to identify high-quality apps. This review was conducted in a similar manner to a systematic review by using a stepwise approach that included (1) a search strategy; (2) eligibility assessment; (3) app selection process through an initial screening of all retrieved apps and full app review of the included apps; (4) data extraction using a predefined set of features considered important or desirable in medication reminder apps; (5) analysis by classifying the apps as basic and advanced medication reminder apps and scoring and ranking them; and (6) a quality assessment by using the Mobile App Rating Scale (MARS), a reliable tool to assess mobile health apps. We identified 272 medication reminder apps, of which 152 were found only in Google Play, 87 only in iTunes, and 33 in both app stores. Apps found in Google Play had more customer reviews, higher star ratings, and lower cost compared with apps in iTunes. Only 109 apps were available for free and 124 were recently updated in 2015 or 2016. Overall, the median number of features per app was 3.0 (interquartile range 4.0) and only 18 apps had ≥9 of the 17 desirable features. The most common features were flexible scheduling that was present in 56.3% (153/272) of the included apps, medication tracking history in 54.8% (149/272), snooze option in 34.9% (95/272), and visual aids in 32.4% (88/272). We classified 54.8% (149/272) of the included apps as advanced medication reminder apps and 45.2% (123/272) as basic medication reminder apps. The advanced apps had a higher number of features per app compared with the
Tóth, Réka; Fiatal, Szilvia; Petrovski, Beáta; McKee, Martin; Adány, Róza
2011-01-01
The aim of this study was to analyze the combined effect of the most frequent alcohol dehydrogenase polymorphisms (Arg48His and Arg370Cys in ADH1B, Arg272Gln and Ile350Val in ADH1C) on the alcohol use habits, alcohol dependence and chronic liver diseases in Hungary. The study included men, aged 45-64 years. Altogether, 241 cases with chronic liver disease (CLD) and 666 randomly selected controls without CLD were analysed for all four polymorphisms. Associations between the polymorphisms, individually, and in combination, and excessive and problem drinking and CLD, were assessed using logistic regression. In this study we have identified a novel mutation, called ADH1B Arg370His. The ADH1C Arg272Gln and Ile350Val showed almost complete linkage. The 272Gln/35Val allele increased the risk of excessive and problem drinking in homozygous form (OR=1.582, p=0.035, CI=1.034-2.421, OR=1.780, p=0.016, CI=1.113-2.848, respectively). The joint analysis showed that when combined with the wild type ADH1C Arg272/Ile350 allele, the ADH1B 48His is protective against CLD (OR=0.368, p=0.019, CI=0.159-0.851). The results obtained in the study help not only to clarify the effects of different ADH SNPs but to better understand how these polymorphisms modify each other's effects in the development of alcoholism and related diseases.
Tank farms essential drawing plan
International Nuclear Information System (INIS)
Domnoske-Rauch, L.A.
1998-01-01
The purpose of this document is to define criteria for selecting Essential Drawings, Support Drawings, and Controlled Print File (CPF) drawings and documents for facilities that are part of East and West Tank Farms. Also, the drawings and documents that meet the criteria are compiled separate listings. The Essential Drawing list and the Support Drawing list establish a priority for updating technical baseline drawings. The CPF drawings, denoted by an asterisk (*), defined the drawings and documents that Operations is required to maintain per the TWRS Administration Manual. The Routing Boards in Buildings 272-WA and 272-AW are not part of the CPF
ORF Alignment: NC_002696 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ily [imported] - ... Caulobacter crescentus ... Length = 100 ... Query: 213 RIKRFID...DNLCDPELSVGRVAGALGVSPRYVQMVFAGMATTPLAYIXXXXXXXXXXXXXX 272 ... RIKRFIDDNLCDPELSVGRVAGALGV...SPRYVQMVFAGMATTPLAYI ... Sbjct: 1 ... RIKRFIDDNLCDPELSVGRVAGALGVSPRYVQMVFAGMATTPLAYIRRKRLERAARALRE 60 ...
Bold, Krysten W; Hanrahan, Tess H; O'Malley, Stephanie S; Fucito, Lisa M
2016-05-18
Identifying novel ways to recruit smokers for treatment studies is important. In particular, certain subgroups of adult smokers, such as heavy-drinking smokers, are at increased risk for serious medical problems and are less likely to try quitting smoking, so drawing this hard-to-reach population into treatment is important for improving health outcomes. This study examined the utility of Facebook advertisements to recruit smokers and heavy-drinking smokers for treatment research and evaluated smoking and alcohol use and current treatment goals among those who responded to the Web-based survey. Using Facebook's advertising program, 3 separate advertisements ran for 2 months targeting smokers who were thinking about quitting. Advertisements were shown to adult (at least 18 years of age), English-speaking Facebook users in the greater New Haven, Connecticut, area. Participants were invited to complete a Web-based survey to determine initial eligibility for a smoking cessation research study. Advertisements generated 1781 clicks and 272 valid, completed surveys in 2 months, with one advertisement generating the most interest. Facebook advertising was highly cost-effective, averaging $0.27 per click, $1.76 per completed survey, and $4.37 per participant meeting initial screening eligibility. On average, those who completed the Web-based survey were 36.8 (SD 10.4) years old, and 65.8% (179/272) were female. Advertisements were successful in reaching smokers; all respondents reported daily smoking (mean 16.2 [SD 7.0] cigarettes per day). The majority of smokers (254/272, 93.4%) were interested in changing their smoking behavior immediately. Many smokers (161/272, 59.2%) also reported heavy alcohol consumption at least once a month. Among smokers interested in reducing their alcohol use, more were heavy drinkers (45/56, 80.4%) compared to non-heavy drinkers (11/56, 19.6%; χ(2)[1,N=272]=13.0, PSocial media advertisements designed to target smokers were cost-effective and
Hanrahan, Tess H; O'Malley, Stephanie S; Fucito, Lisa M
2016-01-01
Background Identifying novel ways to recruit smokers for treatment studies is important. In particular, certain subgroups of adult smokers, such as heavy-drinking smokers, are at increased risk for serious medical problems and are less likely to try quitting smoking, so drawing this hard-to-reach population into treatment is important for improving health outcomes. Objective This study examined the utility of Facebook advertisements to recruit smokers and heavy-drinking smokers for treatment research and evaluated smoking and alcohol use and current treatment goals among those who responded to the Web-based survey. Methods Using Facebook’s advertising program, 3 separate advertisements ran for 2 months targeting smokers who were thinking about quitting. Advertisements were shown to adult (at least 18 years of age), English-speaking Facebook users in the greater New Haven, Connecticut, area. Participants were invited to complete a Web-based survey to determine initial eligibility for a smoking cessation research study. Results Advertisements generated 1781 clicks and 272 valid, completed surveys in 2 months, with one advertisement generating the most interest. Facebook advertising was highly cost-effective, averaging $0.27 per click, $1.76 per completed survey, and $4.37 per participant meeting initial screening eligibility. On average, those who completed the Web-based survey were 36.8 (SD 10.4) years old, and 65.8% (179/272) were female. Advertisements were successful in reaching smokers; all respondents reported daily smoking (mean 16.2 [SD 7.0] cigarettes per day). The majority of smokers (254/272, 93.4%) were interested in changing their smoking behavior immediately. Many smokers (161/272, 59.2%) also reported heavy alcohol consumption at least once a month. Among smokers interested in reducing their alcohol use, more were heavy drinkers (45/56, 80.4%) compared to non-heavy drinkers (11/56, 19.6%; χ2[1,N=272]=13.0, Padvertisements designed to target smokers
Energy Technology Data Exchange (ETDEWEB)
Ko, M. S.; Kim, S. H.; Park, K. H.; Kim, H. D.; Kim, H. W. [Kyunghee Univ., Youngin (Korea, Republic of)
2002-05-01
In this research, extraction of small fraction of radioactive elements from mixed contaminated working dress has been conducted by organic solvent extraction, but use of organic solvents has created secondary wastes. In this study, liquid/supercritical fluid CO{sub 2}, an environmentally friendly solvent, was used to extract five metals(Co, Cu, Pb, Cd, Zn). Using five metals selective ligand Cyanex-272 and NaDDC, the most optimized extraction conditions were founded 20 .deg. C, 100atm and complexed ratio(Cyanex-272: 100mg, NaDDC:5mg). The results suggest the possibility of utilizing supercritical fluid technology for extraction of metals from contaminated working dress.
The catalytic activity of several tungsten oxides for the oxidation of propene
International Nuclear Information System (INIS)
De Rossi, S.; Schiavello, M.; Rome Univ.; Iguchi, E.; Tilley, R.J.D.
1976-01-01
A study has been made of the catalytic oxidation of propene over the oxides WO 3 , WOsub(2,95), WOsub(2,90), WOsub(2,72) and Wo 2 , which were selected because they possess specific features of chemical and structural interest rather than for their catalytic ability. It was found that the oxides WOsub(2,95), WOsub(2,90) and WOsub(2,72) all selectively produce acrolein in small amounts. The oxides WO 3 and WO 2 were non-selective and rather inactive. The results are discussed in terms of a mechanism involving both variable valence in the crystal and the specific structural geometry of these compounds. (orig.) [de
40 CFR 272.2201 - Texas State-Administered Program: Final Authorization.
2010-07-01
... Recycling Act, sections 371.0025(b) and (c), 371.024(a), 371.024(c) and (d), 371.026(a) and (b), 371.028... title (relating to Purpose) * * * § 55.21 of this title (relating to Requests for Contested Case..., sections 361.131 through 140; Chapter 371, Texas Oil Collection, Management, and Recycling Act, sections...
46 CFR 272.12 - Determining the condition of eligible vessels.
2010-10-01
... vessel may be surveyed at the first United States port of call; (b) At the commencement of the first...) During the dry docking period incident to the vessel's American Bureau of Shipping Special Surveys; (g...
People and things. CERN Courier, Mar 1987, v. 27(2)
Energy Technology Data Exchange (ETDEWEB)
Anon.
1987-03-15
The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. A symposium to celebrate the sixtieth birthday of T. D. Lee and to commemorate the thirtieth anniversary of the discovery of parity (left-right symmetry) nonconservation was held at Columbia in November. Last year's traditional annual summer Workshop on High Energy Physics and Field Theory was held in Protvino near Serpukhov, USSR, under the sponsorship of the Institute for High Energy Physics. A special symposium at the University of Timisoara, Roumania, in November marked the 50th anniversary of the landmark contributions to the physics of vector fields by the Roumanian theoretician Alexandru Proca (1897-1955). The Computer Applications in Nuclear and Plasma Sciences Technical Committee of the Nuclear and Plasma Physics Society, US Institute of Electrical and Electronics Engineers, has set up a new individual award 'for outstanding professional contributions to the profession of using computers in nuclear and/or plasma scientific research', regardless of nationality.
40 CFR 272.1351 - Montana State-Administered Program: Final Authorization.
2010-07-01
... the EPA Regional Administrator on December 25, 1993, and the Enforcement Agreement between EPA Region... Annotated (MCA) 2005, Title 30, “Trade and Commerce”: Chapter 14, “Unfair Trade Practices and Consumer... Agreement and Enforcement Agreement. The Memorandum of Agreement between EPA Region 8 and the State of...
People and things. CERN Courier, Mar 1987, v. 27(2)
International Nuclear Information System (INIS)
Anon.
1987-01-01
The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. A symposium to celebrate the sixtieth birthday of T. D. Lee and to commemorate the thirtieth anniversary of the discovery of parity (left-right symmetry) nonconservation was held at Columbia in November. Last year's traditional annual summer Workshop on High Energy Physics and Field Theory was held in Protvino near Serpukhov, USSR, under the sponsorship of the Institute for High Energy Physics. A special symposium at the University of Timisoara, Roumania, in November marked the 50th anniversary of the landmark contributions to the physics of vector fields by the Roumanian theoretician Alexandru Proca (1897-1955). The Computer Applications in Nuclear and Plasma Sciences Technical Committee of the Nuclear and Plasma Physics Society, US Institute of Electrical and Electronics Engineers, has set up a new individual award 'for outstanding professional contributions to the profession of using computers in nuclear and/or plasma scientific research', regardless of nationality
Jablonska, Ewa; Markart, Philipp; Zakrzewicz, Dariusz; Preissner, Klaus T; Wygrecka, Malgorzata
2010-04-09
Coagulation factor XII (FXII) is a liver-derived serine protease involved in fibrinolysis, coagulation, and inflammation. The regulation of FXII expression is largely unknown. Transforming growth factor-beta1 (TGF-beta1) is a multifunctional cytokine that has been linked to several pathological processes, including tissue fibrosis by modulating procoagulant and fibrinolytic activities. This study investigated whether TGF-beta1 may regulate FXII expression in human lung fibroblasts. Treatment of human lung fibroblasts with TGF-beta1 resulted in a time-dependent increase in FXII production, activation of p44/42, p38, JNK, and Akt, and phosphorylation and translocation into the nucleus of Smad3. However, TGF-beta1-induced FXII expression was repressed only by the JNK inhibitor and JNK and Smad3 antisense oligonucleotides but not by MEK, p38, or phosphoinositide 3-kinase blockers. JNK inhibition had no effect on TGF-beta1-induced Smad3 phosphorylation, association with Smad4, and its translocation into the nucleus but strongly suppressed Smad3-DNA complex formation. FXII promoter analysis revealed that the -299/+1 region was sufficient for TGF-beta1 to induce FXII expression. Sequence analysis of this region detected a potential Smad-binding element at position -272/-269 (SBE-(-272/-269)). Chromatin immunoprecipitation and streptavidin pulldown assays demonstrated TGF-beta1-dependent Smad3 binding to SBE-(-272/-269). Mutation or deletion of SBE-(-272/-269) substantially reduced TGF-beta1-mediated activation of the FXII promoter. Clinical relevance was demonstrated by elevated FXII levels and its co-localization with fibroblasts in the lungs of patients with acute respiratory distress syndrome. Our results show that JNK/Smad3 pathway plays a critical role in TGF-beta1-induced FXII expression in human lung fibroblasts and implicate its possible involvement in pathological conditions characterized by elevated TGF-beta1 levels.
Directory of Open Access Journals (Sweden)
Juan Roberto Rodriguez-Madoz
Full Text Available The combination of defined factors with small molecules targeting epigenetic factors is a strategy that has been shown to enhance optimal derivation of iPSCs and could be used for disease modelling, high throughput screenings and/or regenerative medicine applications. In this study, we showed that a new first-in-class reversible dual G9a/DNMT1 inhibitor compound (CM272 improves the efficiency of human cell reprogramming and iPSC generation from primary cells of healthy donors and patient samples, using both integrative and non-integrative methods. Moreover, CM272 facilitates the generation of human iPSC with only two factors allowing the removal of the most potent oncogenic factor cMYC. Furthermore, we demonstrated that mechanistically, treatment with CM272 induces heterochromatin relaxation, facilitates the engagement of OCT4 and SOX2 transcription factors to OSKM refractory binding regions that are required for iPSC establishment, and enhances mesenchymal to epithelial transition during the early phase of cell reprogramming. Thus, the use of this new G9a/DNMT reversible dual inhibitor compound may represent an interesting alternative for improving cell reprogramming and human iPSC derivation for many different applications while providing interesting insights into reprogramming mechanisms.
Energy Technology Data Exchange (ETDEWEB)
Kayama, Koichiro; Hashimoto, Yasuhiko; Suzuki, Kenji; Matsuo, Hideki (Himeji Inst. of Tech., Hyogo (Japan) Fukushin Electric Co., Ltd., Hyogo (Japan))
1989-12-25
NiW {sub 2} B {sub 2} (M phase), existing in trinary Ni-W-B system, was measured in standard Gibbs free energy (GF) of formation in the temperature range from 1273K to 1423K by an electromotive force method (EMF) with use of solid oxide electrolyte. First, oxide phase in equilibrium with three-phase M-W-Ni solid solution region was confirmed to be B {sub 2} O {sub 3}. Binary Ni-W system solid solution in equilibrium with M phase and W phase is constant in composition with Ni-16.4mo1%W in the above temperature range. WO {sub 2} and WO {sub 2.72} were actually measured in GF. As Ni-W solid solution is in equilibrium with WO {sub 2} and WO {sub 2.72}, binary Ni-W system was measured in activity by the EMF, and Ni-16.4mo1%W solid solution was calculated in GF of mixing by use of the above measured GF of WO {sub 2} and WO {sub 2.72}. Finally with use of sample in M-W-Ni solid solution region, M phase was calculated in GF by the EMF. The result of those calculations were expressed with experimental formulas. 19 refs., 10 figs., 3 tabs.
Cobalt products from real waste fractions of end of life lithium ion batteries.
Pagnanelli, Francesca; Moscardini, Emanuela; Altimari, Pietro; Abo Atia, Thomas; Toro, Luigi
2016-05-01
An innovative process was optimized to recover Co from portable Lithium Ion Batteries (LIB). Pilot scale physical pretreatment was performed to recover electrodic powder from LIB. Co was extracted from electrodic powder by a hydrometallurgical process including the following main stages: leaching (by acid reducing conditions), primary purification (by precipitation of metal impurities), solvent extraction with D2EPHA (for removal of metal impurities), solvent extraction with Cyanex 272 (for separation of cobalt from nickel), cobalt recovery (by precipitation of cobalt carbonate). Tests were separately performed to identify the optimal operating conditions for precipitation (pH 3.8 or 4.8), solvent extraction with D2EHPA (pH 3.8; Mn/D2EHPA=4; 10% TBP; two sequential extractive steps) and solvent extraction with Cyanex 272 (pH 3.8; Cyanex/Cobalt=4, 10% TBP, one extractive step). The sequence of optimized process stages was finally performed to obtain cobalt carbonate. Products with different degree of purity were obtained depending on the performed purification steps (precipitation with or without solvent extraction). 95% purity was achieved by implementation of the process including the solvent extraction stages with D2EHPA and Cyanex 272 and final washing for sodium removal. Copyright © 2016 Elsevier Ltd. All rights reserved.
Rodriguez-Madoz, Juan Roberto; San Jose-Eneriz, Edurne; Rabal, Obdulia; Zapata-Linares, Natalia; Miranda, Estibaliz; Rodriguez, Saray; Porciuncula, Angelo; Vilas-Zornoza, Amaia; Garate, Leire; Segura, Victor; Guruceaga, Elizabeth; Agirre, Xabier; Oyarzabal, Julen; Prosper, Felipe
2017-01-01
The combination of defined factors with small molecules targeting epigenetic factors is a strategy that has been shown to enhance optimal derivation of iPSCs and could be used for disease modelling, high throughput screenings and/or regenerative medicine applications. In this study, we showed that a new first-in-class reversible dual G9a/DNMT1 inhibitor compound (CM272) improves the efficiency of human cell reprogramming and iPSC generation from primary cells of healthy donors and patient samples, using both integrative and non-integrative methods. Moreover, CM272 facilitates the generation of human iPSC with only two factors allowing the removal of the most potent oncogenic factor cMYC. Furthermore, we demonstrated that mechanistically, treatment with CM272 induces heterochromatin relaxation, facilitates the engagement of OCT4 and SOX2 transcription factors to OSKM refractory binding regions that are required for iPSC establishment, and enhances mesenchymal to epithelial transition during the early phase of cell reprogramming. Thus, the use of this new G9a/DNMT reversible dual inhibitor compound may represent an interesting alternative for improving cell reprogramming and human iPSC derivation for many different applications while providing interesting insights into reprogramming mechanisms.
ORF Alignment: NC_002950 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Porphyromonas gingivalis W83] ... Length = 134 ... Query: 272 PFSVEDVNSIVPGTLMESLGIRCTKIARGYVEATMPVDIRT...RQPMGILHGGASLAFAETL 331 ... PFSVEDVNSIVPGTLMESLGIRCTKIARGYVEATMPVDIRTR...QPMGILHGGASLAFAETL Sbjct: 1 ... PFSVEDVNSIVPGTLMESLGIRCTKIARGYVEATMPVDIRTRQPMGILHGGASLAFAETL 60 ... Query: 392 KLICTCRVLNSILK 405 ... KLICTCRVLNSILK Sbjct: 121 KLICTCRVLNSILK 134
ORF Alignment: NC_003228 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available oides fragilis ... NCTC 9343] ... Length = 126 ... Query: 213 TAKEVMTSRLDVVDLDIRT...PFKDVIQCIIDNAYSRIPIYSGTRDNIKGVLYIKDLLPHLN 272 ... TAKEVMTSRLDVVDLDIRTPFKDVIQCIIDNAYSRIPIYS...GTRDNIKGVLYIKDLLPHLN Sbjct: 1 ... TAKEVMTSRLDVVDLDIRTPFKDVIQCIIDNAYSRIPIYSGTRDNIKGVLYIKDLLPHLN 60 ... Query: 333 VGEIHD 338 ... VGEIHD Sbjct: 121 VGEIHD 126
Directory of Open Access Journals (Sweden)
Patricia Ponce de León
2005-06-01
Full Text Available Previous experiences have demonstrated the same ABO system and P system antigens in A. lumbricoides extracts and in their hosts. The aim was to show the behavior of an A. lumbricoides extract from an O Group patient against monoclonal antibodies of different specificities. Agglutination Inhibition Tests were carried out facing the extract against monoclonal antibodies (anti A 2.23; anti B 2.54; anti B 2.62; anti AB 2.39 and anti H 2.72 in optimal concentrations. Suspensions of O Group fresh red cells were used as revealing system. The extract only inhibited the agglutination of anti H 2.72 with O erythrocytes. The semiquantitative Agglutination Inhibition Test of the extract was made against two series of anti H 2.72 dilutions by using O Group fresh red cells as revealing system. A difference of five dilutions between the titers of both series has been observed and the presence of H Antigen in the extract has been significantly confirmed. The fact that the extract did not inhibit the agglutination against anti A, anti B and anti AB has corroborated our previous observations about absence of A and B epitopes in A. lumbricoides extracts from O Group patients. The results of the preceding studies and this experience have demonstrated the membrane glycoconjugated importance in A. lumbricoides. They could be involved in molecular mimicry for this parasite.Experiencias previas han demostrado los mismos antígenos del Sistema ABO y del Sistema P en extractos de A. lumbricoides y en sus huéspedes. El objetivo fue mostrar el comportamiento de un extracto de A. lumbricoides de un paciente Grupo O frente a anticuerpos monoclonales de diferentes especificidades. Se hicieron pruebas de Inhibición de la Aglutinación enfrentando el extracto contra anticuerpos monoclonales (anti A 2.23; anti B 2.54; anti B 2.62; anti AB 2.39 y anti H 2.72 en dosis óptimas. El sistema revelador fue una suspensión fresca de eritrocitos Grupo O. El extracto sólo inhibió la
International Nuclear Information System (INIS)
Hauk, Pricila; Guzzo, Cristiane R.; Ho, Paulo L.; Farah, Chuck S.
2009-01-01
Recombinant selenomethionine-labelled LipL32, the major surface protein of pathogenic Leptospira, has been purified and crystallized. Data sets from two crystals were collected, one of which diffracted to 2.25 Å resolution. LipL32 is a major surface protein that is expressed during infection by pathogenic Leptospira. Here, the crystallization of recombinant LipL32 21–272 , which corresponds to the mature LipL32 protein minus its N-terminal lipid-anchored cysteine residue, is described. Selenomethionine-labelled LipL32 21–272 crystals diffracted to 2.25 Å resolution at a synchrotron source. The space group was P3 1 21 or P3 2 21 and the unit-cell parameters were a = b = 126.7, c = 96.0 Å
Modulární laboratorní fluorová linka v ÚOCHB AV ČR
Czech Academy of Sciences Publication Activity Database
Valášek, Michal; Šembera, Filip; Janoušek, Zbyněk; Michl, Josef
2014-01-01
Roč. 108, č. 4 (2014), s. 394-397 ISSN 0009-2770 Institutional support: RVO:61388963 Keywords : carboranes * fluorine * hydrogen fluoride Subject RIV: CC - Organic Chemistry Impact factor: 0.272, year: 2014
78 FR 72064 - Request for Comments on Methods for Studying the Diversity of Patent Applicants
2013-12-02
..., Expert Advisor, Office of Chief Economist, United States Patent and Trademark Office, Mail Stop External..., Office of Chief Economist, by telephone at (571) 272-6900, or by email at [email protected
‘Vanishing cities’: can urban costs explain deindustrialization?
Czech Academy of Sciences Publication Activity Database
Goryunov, Maxim; Kokovin, S.
2016-01-01
Roč. 95, č. 3 (2016), s. 633-651 ISSN 1056-8190 Institutional support: RVO:67985998 Keywords : city size * urban hierarchies * agglomeration Subject RIV: AH - Economics Impact factor: 1.272, year: 2016
Review: Sabelo J. Ndlovu-Gatsheni, Empire, Global Coloniality and African Subjectivity (2013
Directory of Open Access Journals (Sweden)
Tinashe Nyamunda
2014-01-01
Full Text Available Review of the monograph:Sabelo J. Ndlovu-Gatsheni, Empire, Global Coloniality and African Subjectivity, New York and Oxford: Berghahn Books, 2013, ISBN 978-0-85745-951-0, 272 pages
Czech Academy of Sciences Publication Activity Database
Aguilera, A.; Komárek, Jiří; Echenique, R. O.
2016-01-01
Roč. 272, č. 3 (2016), s. 173-183 ISSN 1179-3155 Institutional support: RVO:67985939 Keywords : biodiversity * cyanobacterial blooms * Argentine Subject RIV: EA - Cell Biology Impact factor: 1.240, year: 2016
Význam kapra v rybničním hospodářství
Czech Academy of Sciences Publication Activity Database
Matěna, Josef; Flajšhans, Martin
2013-01-01
Roč. 61, č. 6 (2013), s. 272-274 ISSN 0044-4812 Institutional support: RVO:60077344 ; RVO:67985904 Keywords : Cyprinus carpio * fish production * pond ecosystem * Czech Republic Subject RIV: EH - Ecology, Behaviour
Alzheimer's Disease Facts and Figures
Full Text Available alz.org | Find Your Chapter 24/7 Helpline: 1.800.272.3900 Find your chapter: search by state In My Area | Alzheimer's & Dementia | Life with ALZ | Research | Professionals
Czech Academy of Sciences Publication Activity Database
Hnídková, Vendula
2008-01-01
Roč. 87, č. 4 (2008), s. 270-272 E-ISSN 1214-4029 Institutional research plan: CEZ:AV0Z80330511 Keywords : contemporary architecture * Peter Zumthor Subject RIV: AL - Art, Architecture, Cultural Heritage
‘Vanishing cities’: can urban costs explain deindustrialization?
Czech Academy of Sciences Publication Activity Database
Goryunov, Maxim; Kokovin, S.
2016-01-01
Roč. 95, č. 3 (2016), s. 633-651 ISSN 1056-8190 Institutional support: PRVOUK-P23 Keywords : city size * urban hierarchies * agglomeration Subject RIV: AH - Economics Impact factor: 1.272, year: 2016
Stabat Mater. Chant gregorien / Patric Wiklacz
Wiklacz, Patric
1997-01-01
Uuest heliplaadist "Stabat Mater. Chant gregorien. Palestrina: Stabat Mater a 8; Pärt: Stabat Mater; Browne: Stabat Mater dolorosa a 6. Fretwork (concort de violes)". Virgin Classics 545 272-2 (CD: 167F)
Czech Academy of Sciences Publication Activity Database
Šebesta, O.; Gelbič, Ivan
2015-01-01
Roč. 51, č. 3 (2015), s. 272-280 ISSN 0037-9271 Institutional support: RVO:60077344 Keywords : Anopheles hyrcanus * Culex modestus * vector Subject RIV: EH - Ecology, Behaviour Impact factor: 0.575, year: 2015
Samaras, Anastasios; Madesis, Panagiotis; Karaoglanidis, George S
2016-01-01
Botrytis cinerea , is a high risk pathogen for fungicide resistance development. Pathogen' resistance to SDHIs is associated with several mutations in sdh gene. The diversity of mutations and their differential effect on cross-resistance patterns among SDHIs and the fitness of resistant strains necessitate the availability of a tool for their rapid identification. This study was initiated to develop and validate a high-resolution melting (HRM) analysis for the identification of P225H/F/L//T, N230I, and H272L/R/Y mutations. Based on the sequence of sdh B subunit of resistant and sensitive isolates, a universal primer pair was designed. The specificity of the HRM analysis primers was verified to ensure against the cross-reaction with other fungal species and its sensitivity was evaluated using concentrations of known amounts of mutant's DNA. The melting curve analysis generated nine distinct curve profiles, enabling the discrimination of all the four mutations located at codon 225, the N230I mutation, the three mutations located in codon 272, and the non-mutated isolates (isolates of wild-type sensitivity). Similar results were obtained when DNA was extracted directly from artificially inoculated strawberry fruit. The method was validated by monitoring the presence of sdh B mutations in samples of naturally infected strawberry fruits and stone fruit rootstock seedling plants showing damping-off symptoms. HRM analysis data were compared with a standard PIRA-PCR technique and an absolute agreement was observed suggesting that in both populations the H272R mutation was the predominant one, while H272Y, N230I, and P225H were detected in lower frequencies. The results of the study suggest that HRM analysis can be a useful tool for sensate, accurate, and rapid identification of several sdh B mutations in B. cinerea and it is expected to contribute in routine fungicide resistance monitoring or assessments of the effectiveness of anti-resistance strategies implemented in
Directory of Open Access Journals (Sweden)
Anastasios Samaras
2016-11-01
Full Text Available Botrytis cinerea, is a high-risk pathogen for fungicide resistance development. Pathogen` resistance to SDHIs is associated with several mutations in sdh gene. The diversity of mutations and their differential effect on cross-resistance patterns among SDHIs and the fitness of resistant strains necessitate the availability of a tool for their rapid identification. This study was initiated to develop and validate a high-resolution melting (HRM analysis for the identification of P225H/F/L//T, N230I and H272L/R/Y mutations. Based on the sequence of sdhB subunit of resistant and sensitive isolates, a universal primer pair was designed. The specificity of the HRM analysis primers was verified to ensure against the cross-reaction with other fungal species and its sensitivity was evaluated using concentrations of known amounts of mutant`s DNA. The melting curve analysis generated nine distinct curve profiles, enabling the discrimination of all the 4 mutations located at codon 225, the N230I mutation, the 3 mutations located in codon 272 and the non mutated isolates (isolates of wild type sensitivity. Similar results were obtained when DNA was extracted directly from artificially inoculated strawberry fruit. The method was validated by monitoring the presence of sdhB mutations in samples of naturally infected strawberry fruits and stone fruit rootstock seedling plants showing damping off symptoms. HRM analysis data were compared with a standard PIRA-PCR technique and an absolute agreement was observed suggesting that in both populations the H272R mutation was the predominant one, while H272Y, N230I and P225H were detected in lower frequencies. The results of the study suggest that HRM analysis can be a useful tool for sensate, accurate and rapid identification of several sdhB mutations in B. cinerea and it is expected to contribute in routine fungicide resistance monitoring or assessments of the effectiveness of antiresistance strategies implemented in
Directory of Open Access Journals (Sweden)
Fabian C Franzeck
Full Text Available BACKGROUND: Co-infection with hepatitis B virus (HBV is highly prevalent in people living with HIV in Sub-Saharan Africa. Screening for HBV surface antigen (HBsAg before initiation of combination antiretroviral therapy (cART is recommended. However, it is not part of diagnostic routines in HIV programs in many resource-limited countries although patients could benefit from optimized antiretroviral therapy covering both infections. Screening could be facilitated by rapid diagnostic tests for HBsAg. Operating experience with these point of care devices in HIV-positive patients in Sub-Saharan Africa is largely lacking. We determined the prevalence of HBV and Hepatitis C virus (HCV infection as well as the diagnostic accuracy of the rapid test device Determine HBsAg in an HIV cohort in rural Tanzania. METHODS: Prospectively collected blood samples from adult, HIV-1 positive and antiretroviral treatment-naïve patients in the Kilombero and Ulanga antiretroviral cohort (KIULARCO in rural Tanzania were analyzed at the point of care with Determine HBsAg, a reference HBsAg EIA and an anti-HCV EIA. RESULTS: Samples of 272 patients were included. Median age was 38 years (interquartile range [IQR] 32-47, 169/272 (63% subjects were females and median CD4+ count was 250 cells/µL (IQR 97-439. HBsAg was detected in 25/272 (9.2%, 95% confidence interval [CI] 6.2-13.0% subjects. Of these, 7/25 (28% were positive for HBeAg. Sensitivity of Determine HBsAg was rated at 96% (95% CI 82.8-99.6% and specificity at 100% (95% CI, 98.9-100%. Antibodies to HCV (anti-HCV were found in 10/272 (3.7%, 95% CI 2.0-6.4% of patients. CONCLUSION: This study reports a high prevalence of HBV in HIV-positive patients in a rural Tanzanian setting. The rapid diagnostic test Determine HBsAg is an accurate assay for screening for HBsAg in HIV-1 infected patients at the point of care and may further help to guide cART in Sub-Saharan Africa.
: tous les projets | Page 272 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
Les mégapoles côtières situées dans des basses terres, déjà aux prises avec une croissance démographique rapide et d'autres problèmes d'ordre économique, social, sanitaire et culturel, doivent en outre faire face à la menace que font peser sur elles les changements climatiques. Date de début : 1 mars 2011. End Date: ...
40 CFR 272.1751 - North Dakota State-administered program: Final authorization.
2010-07-01
... EPA effective on October 19, 1984. Subsequent program revision applications were approved effective on... program. However, EPA retains the authority to exercise its inspection and enforcement authorities in... “Department of Health” Section 23-01-04.1, (except (6)). (iii) North Dakota Century Code, Volume 4A, 2002...
40 CFR 272.2101 - South Dakota State-Administered Program: Final Authorization.
2010-07-01
...) introductory paragraph, 1-26-1(8)(a), 1-26-2, 1-26-6.6, 1-26-16 through 1-26-19, 1-26-19.1, 1-26-19.2, 1-26-27... introductory paragraph and 22-6-1(6). (vi) SDCL, as amended, effective July 1, 2004, Title 23, Law Enforcement... first sentence; Chapter 23-6, Criminal Statistics, section 23-6-4. (vii) SDCL, as amended, effective...
Sud du Sahara | Page 272 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
Sud du Sahara. Read more about Decentralization, Local Politics and the Construction of Women's Citizenship (Uganda, Kenya and Tanzania) - Phase I. Langue English. Read more ... Read more about Monitoring Progress Toward the Information Society : Digital Divide Index. Langue English. Read more about Réforme ...
34 CFR 272.12 - What geographic regions do the DACs serve?
2010-07-01
... Hampshire, Rhode Island, Vermont. (b) New York, New Jersey, Puerto Rico, Virgin Islands. (c) Delaware..., Kentucky, Mississippi, North Carolina, South Carolina, Tennessee. (e) Illinois, Indiana, Michigan...
Protein expression of Myt272-3 recombinant clone and in silico ...
African Journals Online (AJOL)
Usman et al. Trop J Pharm Res, July ... silico prediction of a possible vaccine candidate against .... standard methods described by Bringans et al. [12]. ..... Payan J, Francisco-Cruz A, Valdivia JA, Hernández- ... Nat Protoc 2006; 1: 16-. 22. 12.
27 CFR 24.272 - Payment of tax by electronic fund transfer.
2010-04-01
... States Customs Service for payment of excise tax on imported wine. (Sec. 201, Pub. L. 85-859, 72 Stat... TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Removal, Return and Receipt of Wine... year any proprietor who is liable for a gross amount of wine excise tax equal to or exceeding $5...
... in the chromosome 20 gene coding the biological blueprint for prion protein. People who develop familial CJD ... other dementias, and help you find local support services. Call our 24/7 Helpline at 800.272. ...
ggj^artiment of Speech Language Pathology M^oraltv of the ...
African Journals Online (AJOL)
The process of becoming bilingual is complex and there are many different ..... Proficiency of Dual Language Children. Unpublished ... Frames of Mind: The Theory of Multiple. Ijvt^llgences. ... Canadian Journal of Psychology, 13,. |66-272 .
2012 USACE Post Sandy Topographic LiDAR: Rhode Island and Massachusetts Coast
National Oceanic and Atmospheric Administration, Department of Commerce — This topographic elevation point data derived from multiple return light detection and ranging (LiDAR) represents 354.272 square miles of coastline for Rhode Island...
Assessment of Healthcare Waste Generation Rate and Its ...
African Journals Online (AJOL)
2018-03-01
Mar 1, 2018 ... reliable records of the quantity and nature of healthcare wastes ... construction, and 224 health posts, totally 272 health facilities ..... Procedia - Social and Behavioral. Sciences. 2012 ... Asian Journal Of Applied Science And.
Nízkomolekulární inhibitory replikace enterovirů
Czech Academy of Sciences Publication Activity Database
Nencka, Radim; Hřebabecký, Hubert; Šála, Michal; Dejmek, Milan
2014-01-01
Roč. 108, č. 4 (2014), s. 326-334 ISSN 0009-2770 Institutional support: RVO:61388963 Keywords : enteroviruses * antivirals * inhibitors of virus replication Subject RIV: CC - Organic Chemistry Impact factor: 0.272, year: 2014
ORF Alignment: NC_004431 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available erichia coli CFT073] gb|AAN81970.1| Agmatinase ... [Escherichia coli CFT073] sp|Q8FE36|SPEB_ECOL6 ... Agmatinase (Agmat...ine ureohydrolase) (AUH) ... Length = 272 ... Query: 34 ... DWVITGVPFDMATSGRAGGRHG
CRISPR/Cas9-mediated targeted gene correction in amyotrophic lateral sclerosis patient iPSCs.
Wang, Lixia; Yi, Fei; Fu, Lina; Yang, Jiping; Wang, Si; Wang, Zhaoxia; Suzuki, Keiichiro; Sun, Liang; Xu, Xiuling; Yu, Yang; Qiao, Jie; Belmonte, Juan Carlos Izpisua; Yang, Ze; Yuan, Yun; Qu, Jing; Liu, Guang-Hui
2017-05-01
Amyotrophic lateral sclerosis (ALS) is a complex neurodegenerative disease with cellular and molecular mechanisms yet to be fully described. Mutations in a number of genes including SOD1 and FUS are associated with familial ALS. Here we report the generation of induced pluripotent stem cells (iPSCs) from fibroblasts of familial ALS patients bearing SOD1 +/A272C and FUS +/G1566A mutations, respectively. We further generated gene corrected ALS iPSCs using CRISPR/Cas9 system. Genome-wide RNA sequencing (RNA-seq) analysis of motor neurons derived from SOD1 +/A272C and corrected iPSCs revealed 899 aberrant transcripts. Our work may shed light on discovery of early biomarkers and pathways dysregulated in ALS, as well as provide a basis for novel therapeutic strategies to treat ALS.
Jolivet: Complete Flute Music, Vol. 2 / Guy S. Rickards
Rickards, Guy S.
1996-01-01
Uuest heliplaadist "Jolivet: Complete Flute Music, Vol. 2. Kroumata Percussion Ensemble, Tapiola Sinfonietta, Paavo Järvi". BIS CD 739 (64 minutes: DDD). Item marked from CD630 (6/94), CD272, remainder new to UK
Indian Academy of Sciences (India)
user
2007 Chemistry Nobel Prize (6) 548 (GA). 2007 Physics Nobel Prize .... Integrated open-ended experiments (1) 54 (GA) ... On the tendency of varieties to depart .... The Scientific Enterprise: Attitudes and ... Undergraduate teaching (3) 272 (CR).
75 FR 67233 - Federal Motor Vehicle Safety Standards; Head Restraints
2010-11-02
... passenger vehicles, and vans). Of these whiplash injuries, 272,464 occurred as a result of rear impacts. For... approximately 18.5 inches with respect to the seat pan * * *. It appeared that an occupant whose sitting...
O použití Einsteinových rovnic v kosmologii
Czech Academy of Sciences Publication Activity Database
Křížek, Michal
2015-01-01
Roč. 60, č. 3 (2015), s. 255-272 ISSN 0032-2423 Institutional support: RVO:67985840 Keywords : dark matter * dark energy * Friedmann equation Subject RIV: BA - General Mathematics http://hdl.handle.net/10338.dmlcz/144419
National Oceanic and Atmospheric Administration, Department of Commerce — The effect of salinity on utilization of shallow-water nursery habitats by aquatic fauna was assessed in San Antonio Bay, Texas. Overall, 272 samples were collected...
"Haunting experiences: Ghosts in contemporary folklore," by Diane E. Goldstein et al.
Directory of Open Access Journals (Sweden)
Linda Levitt
2010-03-01
Full Text Available Diane E. Goldstein, Sylvia Ann Grider, and Jeannie Banks Thomas. Haunting experiences: Ghosts in contemporary folklore. Logan: Utah State University Press, 2007, paperback, $24.95 (272p ISBN 978-0-87421-636-3.
Vibrační optická aktivita: Experimentální zázemí a počítačové simulace
Czech Academy of Sciences Publication Activity Database
Hudecová, Jana; Bouř, Petr
2014-01-01
Roč. 108, č. 4 (2014), s. 285-292 ISSN 0009-2770 Institutional support: RVO:61388963 Keywords : vibrational optical activity * circular dichroism * DFT calculations Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.272, year: 2014
International Nuclear Information System (INIS)
Toulet, J.; Tabernat, J.
1959-01-01
General principles of external decontamination with elements of practical organisation in a centre of nuclear studies. Reprint of a paper published in 'Archives des Maladies Professionnelles', Tome 20, n. 3, 1959, p. 272-282
Report #10-4-0001, October 5, 2009. EBCI does not have a conflict of interest and its SF 272s are correct and prepared in compliance with federal requirements, EPA policies, and grant terms and conditions.
Over-the-counter pain relievers
... Waltham, MA: Elsevier; 2016:236-272. Dinakar P. Principles of pain management. In: Daroff RB, Jankovic J, Mazziotta JC, Pomeroy SL, eds. Bradley's Neurology in Clinical Practice . 7th ed. Philadelphia, PA: Elsevier; 2016:chap 54.
2013-02-27
... the implementation of sec. 1012 of the USA PATRIOT Act (Pub. L. 107-56, 115 Stat. 272, 396, Oct. 26... history, and criminal history; and fingerprints. In addition, 49 CFR part 1572 requires States to maintain...
Is Rorty a linguistic idealist?
Czech Academy of Sciences Publication Activity Database
Marvan, Tomáš
2011-01-01
Roč. 21, č. 3 (2011), s. 272-279 ISSN 1210-3055 Institutional research plan: CEZ:AV0Z90090514 Keywords : Rorty * linguistic idealism * internal realism * intrinsic structure of reality * representation Subject RIV: AA - Philosophy ; Religion
Czech Academy of Sciences Publication Activity Database
Jahn, Emanuela; Durand, T.; Galano, J. M.; Jahn, Ullrich
2014-01-01
Roč. 108, č. 4 (2014), s. 301-319 ISSN 0009-2770 Institutional support: RVO:61388963 Keywords : lipids * oxidative stress * phytoprostanes * isoprostanes * neuroprostanes * total synthesis Subject RIV: CC - Organic Chemistry Impact factor: 0.272, year: 2014
The young and the digital, by S. Craig Watkins [book review
Melanie E. S. Kohnen
2011-01-01
Review of S. Craig Watkins, The young and the digital: What migration to social-networking sites, games, and anytime, anywhere media means for our future. Boston: Beacon Press, 2009, paperback, $18 (272p) ISBN 978-0807006160.
Alzheimer's Disease Facts and Figures
Full Text Available ... on the latest news and advances in Alzheimer's treatments, care and research. Get tips for living with ... dementia What is Alzheimer's 7 stages of Alzheimer's Treatments Contact us 24/7 Helpline: 1-800-272- ...
Caustic addition system operability test procedure
International Nuclear Information System (INIS)
Parazin, R.E.
1994-11-01
This test procedure provides instructions for performing operational testing of the major components of the 241-AN-107 Caustic Addition System by WHC and Kaiser personnel at the Rotating Equipment Shop run-in pit (Bldg. 272E)
Caustic addition system operability test procedure
Energy Technology Data Exchange (ETDEWEB)
Parazin, R.E.
1994-11-01
This test procedure provides instructions for performing operational testing of the major components of the 241-AN-107 Caustic Addition System by WHC and Kaiser personnel at the Rotating Equipment Shop run-in pit (Bldg. 272E).
Alzheimer's Disease Facts and Figures
Full Text Available ... 272.3900 Donate Alzheimer's & Dementia What Is Alzheimer's? Brain Tour Younger/Early Onset Risk Factors Genetics Myths ... Dementia Korsakoff Syndrome Related Conditions CTE MCI Traumatic Brain Injury Facts and Figures Know the 10 Signs ...
Alzheimer's Disease Facts and Figures
Full Text Available ... is Alzheimer's 7 stages of Alzheimer's Treatments Contact us 24/7 Helpline: 1-800-272-3900 Find ... Walk to End Alzheimer's Become an advocate About Us | News | Events | Press | About this Site | Privacy Policy | ...
Bjudzhet obrazovanija na novõi god / Mailis Reps
Reps, Mailis, 1975-
2006-01-01
Ülevaade haridus- ja teadusministeeriumi 2007. aasta eelarvest. Kokku on haridus- ja teadustegevusele riigieelarvest eraldatud 8,272 miljardit krooni, mis on 1,45 miljardit krooni rohkem kui 2006. aastal. Tabel: Haridus- ja teadusministeeriumi finantseerimine aastate lõikes
Expression and purification of the non-tagged LipL32 of pathogenic Leptospira
Directory of Open Access Journals (Sweden)
P. Hauk
2011-04-01
Full Text Available Leptospirosis is a reemerging infectious disease and the most disseminated zoonosis worldwide. A leptospiral surface protein, LipL32, only occurs in pathogenic Leptospira, and is the most abundant protein on the bacterial surface, being described as an important factor in host immunogenic response and also in bacterial infection. We describe here an alternative and simple purification protocol for non-tagged recombinant LipL32. The recombinant LipL32(21-272 was expressed in Escherichia coli without His-tag or any other tag used to facilitate recombinant protein purification. The recombinant protein was expressed in the soluble form, and the purification was based on ion exchange (anionic and cationic and hydrophobic interactions. The final purification yielded 3 mg soluble LipL32(21-272 per liter of the induced culture. Antiserum produced against the recombinant protein was effective to detect native LipL32 from cell extracts of several Leptospira serovars. The purified recombinant LipL32(21-272 produced by this protocol can be used for structural, biochemical and functional studies and avoids the risk of possible interactions and interferences of the tags commonly used as well as the time consuming and almost always inefficient methods to cleave these tags when a tag-free LipL32 is needed. Non-tagged LipL32 may represent an alternative antigen for biochemical studies, for serodiagnosis and for the development of a vaccine against leptospirosis.
Genome sequence of three Psychrobacter sp. strains with potential applications in bioremediation
Directory of Open Access Journals (Sweden)
Aide Lasa
2017-06-01
Full Text Available To date, the genus Psychrobacter consists of 37 recognized species isolated from different sources, however they are more frequently found in cold and other non-polar environments of low water activity. Some strains belonging to the genus have shown different enzymatic activities with potential applications in bioremediation or food industry. In the present study, the whole genome sequences of three Psychrobacter-like strains (C 20.9, Cmf 22.2 and Rd 27.2 isolated from reared clams in Galicia (Spain are described. The sequenced genomes resulted in an assembly size of 3,143,782 bp for C 20.9 isolate, 3,168,467 bp for Cmf 22.2 isolate and 3,028,386 bp for Rd 27.2 isolate. Among the identified coding sequences of the genomes, mercury detoxification and biogeochemistry genes were found, as well as genes related to heavy metals and antibiotic resistance. Also virulence-related features were identified such as the siderophore vibrioferrin or an aerobactin-like siderophore. The phylogenetic analysis of the 16S rRNA gene suggested that these strains may represent novel species of the Psychrobacter genus. The genome sequences of the Psychrobacter sp. strains have been deposited at DDBJ/EMBL/GenBank under the accession numbers MRYA00000000 (Cmf 22.2, MRYB00000000 (Rd 27.2 and MRYC00000000 (C 20.9, and the sequences could be found at the site https://www.ncbi.nlm.nih.gov/bioproject/PRJNA353858.
Expression and purification of the non-tagged LipL32 of pathogenic Leptospira.
Hauk, P; Carvalho, E; Ho, P L
2011-04-01
Leptospirosis is a reemerging infectious disease and the most disseminated zoonosis worldwide. A leptospiral surface protein, LipL32, only occurs in pathogenic Leptospira, and is the most abundant protein on the bacterial surface, being described as an important factor in host immunogenic response and also in bacterial infection. We describe here an alternative and simple purification protocol for non-tagged recombinant LipL32. The recombinant LipL32(21-272) was expressed in Escherichia coli without His-tag or any other tag used to facilitate recombinant protein purification. The recombinant protein was expressed in the soluble form, and the purification was based on ion exchange (anionic and cationic) and hydrophobic interactions. The final purification yielded 3 mg soluble LipL32(21-272) per liter of the induced culture. Antiserum produced against the recombinant protein was effective to detect native LipL32 from cell extracts of several Leptospira serovars. The purified recombinant LipL32(21-272) produced by this protocol can be used for structural, biochemical and functional studies and avoids the risk of possible interactions and interferences of the tags commonly used as well as the time consuming and almost always inefficient methods to cleave these tags when a tag-free LipL32 is needed. Non-tagged LipL32 may represent an alternative antigen for biochemical studies, for serodiagnosis and for the development of a vaccine against leptospirosis.
Výuka chemie pro nechemické obory na vysokých školách
Czech Academy of Sciences Publication Activity Database
Jaklová Dytrtová, Jana; Dytrtová, R.; Jakl, M.; Navrátil, Tomáš; Petr, M.; Šteffl, M.
2014-01-01
Roč. 108, č. 12 (2014), s. 1172-1178 ISSN 0009-2770 Institutional support: RVO:61388963 ; RVO:61388955 Keywords : teaching methods * study forms * syllabus * attention * efficiency Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.272, year: 2014
National Heart, Lung, and Blood Institute National Asthma Education and Prevention Program
... www.aanma.org American Academy of Allergy, Asthma & Immunology 414–272–6071 www.aaaai.org American Academy ... www.aasa.org American College of Allergy, Asthma & Immunology 847–427–1200 www.acaai.org American Lung ...
African Journals Online (AJOL)
both formal and informal) in culture and social theory. CRITICAL ARTS aims to challenge and ... Book Review: Brian McNair, An Introduction to Political Communication (3rd edition), London: Routledge, 2003, ISBN 0415307082, 272pp. Phil Joffe ...
Efektivita přeměn energie - Možnosti dokonalejší přeměny
Czech Academy of Sciences Publication Activity Database
Luxa, Martin; Synáč, J.
2013-01-01
Roč. 92, č. 5 (2013), s. 272-275 ISSN 0042-4544 Institutional support: RVO:61388998 Keywords : steam turbine * long blade * aerodynamic laboratory * CFD * interferometry Subject RIV: BK - Fluid Dynamics http://www.vesmir.cz/clanek/efektivita-premen-energie
Point-contact properties of cubic YbCu .sub.5./sub. prepared by melt spinning technique
Czech Academy of Sciences Publication Activity Database
Reiffers, M.; Idzikowski, B.; Ilkovič, S.; Zorkovská, A.; Šebek, Josef; Müller, K. H.
272-276, - (2004), s. 209-210 ISSN 0304-8853 Institutional research plan: CEZ:AV0Z1010914 Keywords : heavy-fermion * pont-contact * YbCu 5 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.031, year: 2004
Book Review: Evolutionary Ecology of Birds: Life Histories, Mating ...
African Journals Online (AJOL)
Abstract. Book Title: Evolutionary Ecology of Birds: Life Histories, Mating Systems and Extinction. Book Authors: P.M. Bennett & I.P.F. Owens. Oxford University. Press. 2002. Pp. 272. Price £24.95 (paperback). ISBN 0 19 851089 6.
1/41 ADMINISTRATIVE BIAS IN SOUTH AFRICA E S Nwauche 1 ...
African Journals Online (AJOL)
Administrator
the one that enables a lower threshold for finding administrative bias. This ... 9 Rose v Johannesburg Local Road Transportation Board 1947 (4) SA 272 (W). ...... issue of whether buildings erected in the Green Belt could be considered from.
Bilateral synchronous benign ovarian neoplasm: A rare occurrence
African Journals Online (AJOL)
right ovarian mass, which revealed a left ovarian benign cystic teratoma and a right ovarian ... Women's reproductive health rights need to be encouraged and possibly legislated in our setting. ..... Med J Armed Forces India 2011;67(3):272-.
Heimerdinger, Arli; Olivo, Clair J; Molento, Marcelo B; Agnolin, Carlos A; Ziech, Magnos F; Scaravelli, Luciene Fernanda B; Skonieski, Fernando R; Both, José F; Charão, Pablo S
2006-01-01
The objective of this study was to determine the effect of lemongrass (Cymbopogon citratus) alcoholic extracts on the control of Boophilus microplus in naturally infested Holstein cows. Twelve animals were allocated in three groups of four animals. Group 1 was treated with amitraz at 0.025%, Group 2 was treated with lemongrass extracts at 1.36% and Group 3 with the same product at 2.72% of the plant. Engorged ticks were evaluated on animals with length superior to 4.0 mm, before (mean of days -3, -2, -1) and at 1, 2, 3, 4, 5, 6, 7 and 14 days after treatment. The mean efficacy of amitraz was 97.93%. Lemongrass extract at 2.72% reduced tick infestation by 40.3, 46.6 and 41.5% on day 3, 7 and 14 post-treatment, respectively.
Nova espécie de Bronia Gray, 1845, do Estado do Tocantins, Brasil (Squamata: Amphisbaenidae
Directory of Open Access Journals (Sweden)
Carolina Castro-Mello
2003-01-01
Full Text Available Bronia saxosa, sp. n., localidade tipo UHE Luis Eduardo Magalhães, Estado do Tocantins, difere das demais espécies de Bronia Gray, 1865, principalmente por possuir nasais pequenas separadas pela rostral. A nova espécie possui 4 poros, 253-272 anéis corporais, 17-21 anéis caudais, 18-24/1621 segmentos em um anel no meio do corpo.Bronia saxosa, sp. n. from the state of Tocantins, Brasil, (Hydroelectric Dam Luis Eduardo Magalhães, 09°45'S, 48°21'W, a cerrado area, differs from the remainining species of the genus mainly by having small nasals scutes separated by the rostral. It has (82 specimens 4 preanal pores, 253-272 body annuli, 17-21 tail annuli and 18-24/16-21 segments to a midbody annulus.
CRISPR/Cas9-mediated targeted gene correction in amyotrophic lateral sclerosis patient iPSCs
Directory of Open Access Journals (Sweden)
Lixia Wang
2017-04-01
Full Text Available Abstract Amyotrophic lateral sclerosis (ALS is a complex neurodegenerative disease with cellular and molecular mechanisms yet to be fully described. Mutations in a number of genes including SOD1 and FUS are associated with familial ALS. Here we report the generation of induced pluripotent stem cells (iPSCs from fibroblasts of familial ALS patients bearing SOD1 +/A272C and FUS +/G1566A mutations, respectively. We further generated gene corrected ALS iPSCs using CRISPR/Cas9 system. Genome-wide RNA sequencing (RNA-seq analysis of motor neurons derived from SOD1 +/A272C and corrected iPSCs revealed 899 aberrant transcripts. Our work may shed light on discovery of early biomarkers and pathways dysregulated in ALS, as well as provide a basis for novel therapeutic strategies to treat ALS.
Orr, J M; Farrell, K; Abbott, F S; Ferguson, S; Godolphin, W J
1983-01-01
The pharmacokinetics of valproic acid (VPA) have been studied during peritoneal dialysis in a uremic male epileptic child following a single 500 mg dose and after multiple doses over 5 months (700 mg daily) of valproic acid as the syrup. Serum level decline was biphasic in both instances with a terminal half-life of 27.2 after the single dose and 10.2 h at steady-state. Total serum clearance was 0.0236 l/h/kg after the single dose and increased to 0.0408 l/h/kg after 5 months. Free (intrinsic) serum clearances were 0.1489 and 0.1518 l/h/kg and serum free fractions were 0.224 and 0.272 respectively for the single dose and steady-state studies. Peritoneal dialysis for periods of 12 or 24 h removed an average of 4.5% of the VPA dose.
Sigmund Freud a první aplikace psychoanalýzy na literární dílo
Czech Academy of Sciences Publication Activity Database
Švanda, Martin
2005-01-01
Roč. 49, č. 3 (2005), s. 272-279 ISSN 0009-062X R&D Projects: GA AV ČR IAA7025402 Keywords : psychology of literature * author * literary work Subject RIV: AN - Psychology Impact factor: 0.241, year: 2005
Czech Academy of Sciences Publication Activity Database
Svobodová, Ivana
2006-01-01
Roč. 89, č. 5 (2006), s. 270-272 ISSN 0027-8203 R&D Projects: GA AV ČR 1ET200610406 Institutional research plan: CEZ:AV0Z90610518 Keywords : adjectives * word formation * orthography Subject RIV: AI - Linguistics
The Large Scale Structure: Polarization Aspects R. F. Pizzo
Indian Academy of Sciences (India)
ized radio sources in galaxy clusters and at their outskirts, emphasizing the crucial information provided by the polarized signal on the origin and evolution ..... Evrard, A. E., Gioia, I. M. 2002, in Astrophysics and Space Science Library, Vol. 272,.
Sociolinguistic Bibliography of European Countries for 2008: CZ
Czech Academy of Sciences Publication Activity Database
Kaderka, Petr
2010-01-01
Roč. 24, č. 1 (2010), s. 267-272 ISSN 0933-1883 R&D Projects: GA ČR GA405/09/2028 Institutional research plan: CEZ:AV0Z90610518 Keywords : sociolinguistics * bibliography * Czech Republic Subject RIV: AI - Linguistics
The efficient physiological strategy of a tomato landrace in response to short-term salinity stress
Czech Academy of Sciences Publication Activity Database
Moles, T. M.; Pompeiano, Antonio; Reyes, T. H.; Scartazza, A.; Guglielminetti, L.
2016-01-01
Roč. 109, dec (2016), s. 262-272 ISSN 0981-9428 Institutional support: RVO:67179843 Keywords : Salt tolerance * Tomato landrace * Chlorophyll a fluorescence * Gas exchange * Soluble sugars * Antioxidants Subject RIV: EH - Ecology, Behaviour Impact factor: 2.724, year: 2016
Test Procedure - pumping system for caustic addition project
International Nuclear Information System (INIS)
Leshikar, G.A.
1994-01-01
This test procedure provides the requirements for sub-system testing and integrated operational testing of the submersible mixer pump and caustic addition equipment by WHC and Kaiser personnel at the Rotating Equipment Shop run-in pit (Bldg. 272E)
2010-03-08
...) Applications Data Quality--Non-Numeric Requirements Data Quality--Numeric Requirements Guidance Materials... Applications Numerical Requirements Guidance Materials Data Quality Wednesday, April 14 Continuation of... Planning SC-214 Requirements Review and Response Planning Thursday, April 15 Document Agreements DO-272...
7 CFR 273.10 - Determining household eligibility and benefit levels.
2010-01-01
... merely because of changes in mailing cycles or pay dates or because weekends or holidays cause additional... for urban, rural I, and rural II Alaska as defined in § 272.7(c). The TFPs for Guam and the Virgin...
Alzheimer's Disease Facts and Figures
Full Text Available ... date on the latest news and advances in Alzheimer's treatments, care and research. Get tips for living with ... is dementia What is Alzheimer's 7 stages of Alzheimer's Treatments Contact us 24/7 Helpline: 1-800-272- ...
The young and the digital, by S. Craig Watkins [book review
Directory of Open Access Journals (Sweden)
Melanie E. S. Kohnen
2011-11-01
Full Text Available Review of S. Craig Watkins, The young and the digital: What migration to social-networking sites, games, and anytime, anywhere media means for our future. Boston: Beacon Press, 2009, paperback, $18 (272p ISBN 978-0807006160.
Digital Repository Service at National Institute of Oceanography (India)
Jagtap, T.G.; Untawale, A.G.
January and February to nil. The alga prefers diffused light, fairly high temperatures, high nutrients and optimum salinity ranging between 10 ppt to 20 ppt. Major metabolites showed 272.75 mg/g dry weight was recorded in September. Organic carbon ranged...
Gebed en die vorming van Christelike identiteit in Openbaring
African Journals Online (AJOL)
31 Jul 2015 ... 111.3 – Johns 2003). Deur die ... David Aune (2006:107) merk tereg op dat ... Stevenson 1995:257–272). ... sien Stevenson (2001:234). 6. ...... McKinnon, J., 1987, Music in early chrisfian worship, Cambridge University Press,.
Dysmorphic features and developmental outcome of 2-year-old children
Seggers, Jorien; Haadsma, Maaike L.; Bos, Arend F.; Heineman, Maas Jan; Middelburg, Karin J.; van den Heuvel, Edwin R.; Hadders-Algra, Mijna
2014-01-01
The aim of this study was to assess the associations between dysmorphic features and neurological, mental, psychomotor, and behavioural development in order to improve our understanding of aetiological pathways leading to minor developmental problems. In our cross-sectional study, 272 generally
Fen Bilimlerinde ve Beşeri bilimlerde öykülerin rolü
Czech Academy of Sciences Publication Activity Database
Sládek, Ondřej; Dervişcemaloğlu, B.
2011-01-01
Roč. 2011, č. 20 (2011), s. 263-272 ISSN 1300-5715 R&D Projects: GA ČR GAP406/10/1911 Institutional research plan: CEZ:AV0Z90560517 Keywords : narrative * science * humanities Subject RIV: AJ - Letters, Mass-media, Audiovision
Thermodynamic study of selected monoterpenes II
Czech Academy of Sciences Publication Activity Database
Štejfa, V.; Fulem, Michal; Růžička, K.; Červinka, C.
2014-01-01
Roč. 79, Dec (2014), 272-279 ISSN 0021-9614 Institutional support: RVO:68378271 Keywords : monoterpenes * vapor pressure * heat capacity * ideal - gas thermodynamic properties * vaporization and sublimation enthalpy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.679, year: 2014
Cloning and functional analysis in transgenic tobacco of a tapetum ...
African Journals Online (AJOL)
Jane
2010-10-11
Oct 11, 2010 ... “anther-box”, have been already used for genetic engineering of ... tabacum var. NC89) was used for transformation in Murashige and ..... 265-272. Koltunow AM, Truettner T, Cox KH, Wallroth M, Goldberg RB (1990). Different ...
Biology as an Integrating Natural Science Domain
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 13; Issue 3. Biology as an Integrating Natural Science Domain: A Proposal for BSc (Hons) in Integrated Biology. Kambadur Muralidhar. Classroom Volume 13 Issue 3 March 2008 pp 272-276 ...
African Journals Online (AJOL)
Items 1 - 50 of 272 ... Vol 12, No 2 (2014), Cryptosporidium infection in cattle in Ogun state, ... Vol 7, No 1 (2008), An overview of mastitis in Sokoto red goat, Nigeria ... trypanosoma brucei brucei infection, treatment and re-infection, Abstract PDF.
African Journals Online (AJOL)
Items 101 - 150 of 272 ... Vol 14, No 4 (2008), Evaluation of primary mental health care in North West ... disorder symptoms) in undergraduate university students from 26 low-, ... Vol 10, No 1 (2004), Factor analysis of the Children's Behaviour ...
National Oceanic and Atmospheric Administration, Department of Commerce — This side scan sonar image of the sea floor was mosaiced from data collected in August 2004 onboard the NOAA vesselTatoosh. An EG&G 272 side scan system was used...
Solid-State Field-Assisted Ag Diffusion in Ge-Ga-Sb-S Glasses
Czech Academy of Sciences Publication Activity Database
Stepanov, B.; Ren, J.; Wágner, T.; Lorinčík, Jan; Frumar, M.; Churbanov, M.
2011-01-01
Roč. 94, č. 6 (2011), s. 1756-1760 ISSN 0002-7820 Institutional research plan: CEZ:AV0Z20670512 Keywords : Ag diffusion * Diffusion method * Diffusion temperature Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 2.272, year: 2011
Katepsinové proteasy v patologii
Czech Academy of Sciences Publication Activity Database
Horn, Martin; Jílková, Adéla; Mareš, Michael
2014-01-01
Roč. 108, č. 4 (2014), s. 358-363 ISSN 0009-2770 R&D Projects: GA ČR(CZ) GAP302/11/1481 Institutional support: RVO:61388963 Keywords : cathepsins * proteases * proteolysis Subject RIV: CE - Biochemistry Impact factor: 0.272, year: 2014
Not a Pound for Air-To-Ground: A Historiographical Analysis on the Genesis of the Multi-Role Fighter
2015-04-01
Robert M. Quadrennial Defense Review Report. Washington D.C.: Department of Defense, 2010. http://www.defense.gov/qdr/images...dvs=1417624228343~272 (accessed 2 Dec 2014) Stevens, Donald, Bruce Davis, William Stanley, Daniel Norton, Rae Starr, Dnaiel Raymer , John Gibson
Czech Academy of Sciences Publication Activity Database
Wisniewski, T.; Mroczek, P.; Rodzik, J.; Zagórski, P.; Wilczyński, J.; Nývltová Fišáková, Miriam
2012-01-01
Roč. 272, č. 2012 (2012), s. 308-321 ISSN 1040-6182 Institutional research plan: CEZ:AV0Z80010507 Keywords : Magdalénien * Seasonality * open - air site Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 1.962, year: 2012
Nucleotide binding to Na+/K+-ATPase
Czech Academy of Sciences Publication Activity Database
Kubala, Martin; Lánský, Zdeněk; Ettrich, R.; Plášek, J.; Teisinger, Jan; Amler, Evžen
2005-01-01
Roč. 272, č. S1 (2005), s. 191-191 E-ISSN 1742-4658. [FEBS Congress /30./ and IUBMB Conference /9./. 02.07.2005-07.07.2005, Budapest] Keywords : Na+/K+- ATPase * ATP binding * TNP-ATP Subject RIV: BO - Biophysics
Fish diversity in the Niokolo Koba National Park, middle Gambia River basin, Senegal
Czech Academy of Sciences Publication Activity Database
Blažek, Radim; Ondračková, Markéta; Vošlajerová Bímová, Barbora; Vetešník, Lukáš; Petrášová, Ivona; Reichard, Martin
2012-01-01
Roč. 23, č. 3 (2012), s. 263-272 ISSN 0936-9902 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:68081766 Keywords : West Africa * estuary * assemblages Subject RIV: EH - Ecology, Behaviour Impact factor: 1.648, year: 2012
Bulk study of a DyNiAl single crystal
Czech Academy of Sciences Publication Activity Database
Prchal, J.; Andreev, Alexander V.; Javorský, P.; Honda, F.; Jurek, Karel
272-276, - (2004), e419-e420 ISSN 0304-8853 R&D Projects: GA ČR GA106/02/0943 Keywords : rare-earth * DyNiAl * magnetic anisotropy * single crystal Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.031, year: 2004
Antimikrobiální peptidy izolované z hmyzu
Czech Academy of Sciences Publication Activity Database
Čeřovský, Václav
2014-01-01
Roč. 108, č. 4 (2014), s. 344-353 ISSN 0009-2770 R&D Projects: GA ČR GA203/08/0536 Institutional support: RVO:61388963 Keywords : antimicrobial peptides * analogues * insect * lucifensin Subject RIV: CC - Organic Chemistry Impact factor: 0.272, year: 2014
Pb–Pb zircon ages of Archaean metasediments and gneisses from ...
Indian Academy of Sciences (India)
eastern parts of the Dharwar craton took place over similar time interval starting in the Mesoarchaean at ca. .... the age of the Bababudan Group between 2.91 and. 2.72 Ga. ..... All the samples were processed using a standard technique to ...
Inferring the Presence of Reverse Proxies Through Timing Analysis
2015-06-01
primary platforms from which Internet attacks are launched today. Attacks such as Distributed Denial of Service (DDoS), spam, phishing , and identity...7,272,642. [23] Google Maps. (2014, August). Planetlabs. [24] vmware. (2015, May). [Online]. Available: http://kb.vmware.com/selfservice/ microsites
The Role of Individuals in the System of the Culture of a Small Ethnographic Region
Czech Academy of Sciences Publication Activity Database
Pospíšilová, Jana
2017-01-01
Roč. 65, č. 2 (2017), s. 255-272 ISSN 0350-0861 Institutional support: RVO:68378076 Keywords : Local culture * bearer * generational transmission * a chronicler Josef Káňa (1929 - 1994) * the Czech Republic Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Antropology, ethnology
Dysmorphic features and developmental outcome of 2-year-old children
Seggers, Jorien; Haadsma, Maaike L.; Bos, Arend F.; Heineman, Maas Jan; Middelburg, Karin J.; Van den Heuvel, Edwin R.; Hadders-Algra, Mijna
2014-01-01
AimThe aim of this study was to assess the associations between dysmorphic features and neurological, mental, psychomotor, and behavioural development in order to improve our understanding of aetiological pathways leading to minor developmental problems. MethodIn our cross-sectional study, 272
The presence of Echinococcus multilocularis in the red fox (vulpes vulpes) in the Netherlands
van der Giessen JWB; Rombout Y; Limper L; van der Veen; Moolenbeek C; Franchimont H; Homan W; MGB
1998-01-01
Er zijn onderzoekingen gedaan naar het voorkomen van Echinococcus multilocularis bij vossen in Nederland van 1996 tot 1998. Deze parasiet is de oorzaak van alveolaire echinococcose, een ernstige parasitaire zoonose. Hiervoor zijn eerst 272 vossen onderzocht in het grensgebied met Duitsland en
Differential operators admitting various rates of spectral projection growth
Czech Academy of Sciences Publication Activity Database
Mityagin, B.; Siegl, Petr; Viola, J.
2017-01-01
Roč. 272, č. 8 (2017), s. 3129-3175 ISSN 0022-1236 Institutional support: RVO:61389005 Keywords : harmonic and anharmonic oscillators * Hennite functions * spectral projections * Riesz basis Subject RIV: BE - Theoretical Physics OBOR OECD: Pure mathematics Impact factor: 1.254, year: 2016
Routine pre-admission screening for a medical illness in aggressive ...
African Journals Online (AJOL)
2009-10-03
Oct 3, 2009 ... can be a symptom of a psychiatric illness or a medical illness.2,3. Psychiatric .... reported a 27.2% prevalence of physical illness in psychiatric inpatients in Nigeria, Janse ..... Results in a state mental health system. Arch Gen ...
Unwrapping ADMM: Efficient Distributed Computing via Transpose Reduction
2016-05-11
applications of the Split Bregman method: Segmen- tation and surface reconstruction. J. Sci. Comput., 45:272– 293, October 2010. [17] Stephen Boyd and...Garcia, Gretchen Greene, Fabrizia Guglielmetti, Christopher Hanley, George Hawkins , et al. The second-generation guide star cata- log: description
Archivace sociálněvědních dat: principy, technologie, standardy
Czech Academy of Sciences Publication Activity Database
Krejčí, Jindřich; Vávra, Martin; Čížek, Tomáš
2011-01-01
Roč. 61, č. 3 (2011), s. 245-272 ISSN 0004-0398 R&D Projects: GA MŠk LA09010 Institutional research plan: CEZ:AV0Z70280505 Keywords : archiving social science data * data management * Nesstar software Subject RIV: AO - Sociology, Demography
Solid State Field-Assisted Diffusion of Copper in Multi-Component Tellurite Glass
Czech Academy of Sciences Publication Activity Database
Stepanov, B.; Ren, J.; Wágner, T.; Lorinčík, Jan; Frumar, M.; Churbanov, M.; Chigirinsky, Y.
2011-01-01
Roč. 94, č. 7 (2011), 1986-1988 ISSN 0002-7820 Institutional research plan: CEZ:AV0Z20670512 Keywords : Solid state diffusion * Secondary Ion Mass Spectrometry * Tellurite glass Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 2.272, year: 2011
2010-01-05
... 1974; United States Citizenship and Immigration Services--010 Asylum Information and Pre-Screening... system of records to the Department of Homeland Security's inventory, entitled Unites States Citizenship... Citizenship and Immigration Services (202-272-1663), 20 Massachusetts Avenue, NW., 3rd Floor, Washington, DC...
2011-06-24
... Park, Richmond, California. The fireworks display is meant for entertainment purposes. This temporary... 13211. Technical Standards The National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272..., disestablishing, or changing Regulated Navigation Areas and security or safety zones. An environmental analysis...
75 FR 39166 - Safety Zone; San Francisco Giants Baseball Game Promotion, San Francisco, CA
2010-07-08
... San Francisco, CA. The fireworks display is meant for entertainment purposes. This safety zone is... National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies to use...), of the Instruction. This rule involves establishing, disestablishing, or changing Regulated...
... is dementia What is Alzheimer's 7 stages of Alzheimer's Treatments Contact us 24/7 Helpline: 1-800-272-3900 Find Your Local Chapter Get Involved Make a donation to fight Alz Walk to End Alzheimer's Become an advocate About Us | News | Events | Press | ...
Integrase of Mason-Pfizer monkey virus
Czech Academy of Sciences Publication Activity Database
Snášel, Jan; Krejčík, Zdeněk; Jenčová, Věra; Rosenberg, Ivan; Ruml, Tomáš; Alexandratos, J.; Gustchina, A.; Pichová, Iva
2005-01-01
Roč. 272, č. 1 (2005), s. 203-216 ISSN 1742-464X R&D Projects: GA AV ČR(CZ) IAA4055304 Institutional research plan: CEZ:AV0Z4055905 Keywords : integrase * Mason-Pfizer monkey virus * HIV-1 Subject RIV: CE - Biochemistry
Czech Academy of Sciences Publication Activity Database
Mach, K.; Teodoridis, V.; Matys Grygar, Tomáš; Kvaček, Z.; Suhr, P.; Standke, G.
2014-01-01
Roč. 272, č. 1 (2014), s. 13-45 ISSN 0077-7749 R&D Projects: GA ČR(CZ) GAP210/11/1357 Institutional support: RVO:61388980 Keywords : palaeogeography * geochemistry * floras * Most Basin Subject RIV: DD - Geochemistry Impact factor: 0.519, year: 2014
Spheroidal models of the exterior gravitational field of Asteroids Bennu and Castalia
Czech Academy of Sciences Publication Activity Database
Sebera, Josef; Bezděk, Aleš; Pešek, I.; Henych, Tomáš
2016-01-01
Roč. 272, July (2016), s. 70-79 ISSN 0019-1035 R&D Projects: GA MŠk LH13071 Institutional support: RVO:67985815 Keywords : asteroids surfaces * near-Earth objects * geophysics Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.131, year: 2016
Fulbright project focuses on rehabilitation technician education and ...
African Journals Online (AJOL)
Rehabilitation technician education and physiotherapy practice 272. Fulbright project focuses on ... particularly those qualified to mentor and teach entry-level learners, there are ... to reinforce classroom didactic knowledge as ongoing learning .... utilization of limited resources, and development of linkages with professional ...
Complaints of Poor Sleep and Risk of Traffic Accidents: A Population-Based Case-Control Study.
Philip, Pierre; Chaufton, Cyril; Orriols, Ludivine; Lagarde, Emmanuel; Amoros, Emmanuelle; Laumon, Bernard; Akerstedt, Torbjorn; Taillard, Jacques; Sagaspe, Patricia
2014-01-01
This study aimed to determine the sleepiness-related factors associated with road traffic accidents. A population based case-control study was conducted in 2 French agglomerations. 272 road accident cases hospitalized in emergency units and 272 control drivers matched by time of day and randomly stopped by police forces were included in the study. Odds ratios were calculated for the risk of road traffic accidents. As expected, the main predictive factor for road traffic accidents was having a sleep episode at the wheel just before the accident (OR 9.97, CI 95%: 1.57-63.50, ptraffic accidents was 3.35 times higher in subjects who reported very poor quality sleep during the last 3 months (CI 95%: 1.30-8.63, ptraffic accidents. Physicians should be attentive to complaints of poor sleep quality and quantity, symptoms of anxiety-nervousness and/or drug consumption in regular car drivers.
Nuclear structure studies towards superheavy elements and perspectives with AGATA
International Nuclear Information System (INIS)
Korichi, A.
2005-01-01
A variety of theoretical approaches have been used to calculate the shell closure of spherical Super Heavy Elements (SHE) but the predictions of the location of the 'island of stability' vary from Z=114 to 120 and 126, with neutron numbers around N=172 or N=184 depending on the model employed. A deformed minimum around Z=108 and N=162 is predicted and an increase of the half-life of Hassium (Z=108) is experimentally observed when approaching the neutron number N=162. Super heavy nuclei are produced with very low cross-section (a few picobarns) and this makes their spectroscopic study impossible with today's beam intensities and detectors. However, important information can be obtained from the structure of mid-shell deformed nuclei (Z∼104) where selected single particle orbitals, which lie close to the spherical shell gap in SHE, are close to the Fermi level. The information will come from decay and in-beam spectroscopy. A promising area of progress, using the state-of-the art instruments, is represented by the observation of rotational gamma-ray transitions in No and Fm isotopes showing the deformed character of these nuclei. One of the objectives and focus of the nuclear structure community is related to the investigation of Single particle excitations beyond the N=152 neutron gap and collective properties of heavier systems towards Z∼104. The IN2P3-JINR collaboration has launched a project of electron and gamma-ray spectroscopy studies of heavy nuclei at the FLNR. This project benefits from the radioactive actinide targets uniquely available at Dubna and from the very intense stable beams provided by the U400 cyclotron. This offers a unique opportunity for the study of nuclei above Z=100 along an isotopic chain approaching N=162. In this contribution, the emphasis will be on the GABRIELA project and its issues. I will finally point out the perspectives with the new generation of gamma detectors such as AGATA
14 CFR 272.10 - Conditions applicable to carriers serving a subsidized market.
2010-01-01
... TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS ESSENTIAL AIR SERVICE TO THE FREELY ASSOCIATED STATES... precondition to the payment of compensation necessary to maintain essential air service, whether or not the affected carrier is itself receiving subsidy compensation in the market, if it finds that: (1) Essential...
Relative protection from ischaemic heart disease in beta-thalassaemia carriers
International Nuclear Information System (INIS)
Bozdar, M.; Ahmed, S.; Anwar, J.
2010-01-01
To compare the frequency of beta thalassaemia trait in individuals with Ischaemic Heart Disease (IHD) and a control population without IHD. Study Design: Case control study. Place and Duration of Study: Department of Haematology, Armed Forces Institute of Pathology (AFIP), Rawalpindi, from September 2007 to May 2009. Methodology: Using non-probability consecutive sampling, a total of 544 subjects were selected, including 272 IHD patients and an equal number of age and gender matched normal controls. The subjects were tested for the presence of b-thalassaemia trait by performing their blood counts, haemoglobin electrophoresis and Haemoglobin A2 (HbA2) estimation. Proportions were compared using chi-square test. Odds ratio was also calculated. Results: The frequency of b-thalassaemia trait was determined in IHD patients and was compared to the frequency in normal Pakistani population. Six out of the 272 control subjects (2.2%) had b-thalassaemia trait and one of the control subject had Haemoglobin D trait. In contrast, none of the 272 IHD patients had b-thalassaemia trait. The calculated odds ratio was less than 1, which shows a significant negative association of b-thalassaemia trait with IHD. The difference in the frequency of b-thalassaemia trait in the two groups was statistically significant (p=0.033). Conclusion: The results suggest that b-thalassaemia carriers have some protection against IHD, though it is not an absolute cardio protection due to the role of other risk factors in IHD. This beneficial information may be communicated to the concerned individuals in their counselling sessions and as part of general awareness on thalassaemia. (author)
Directory of Open Access Journals (Sweden)
Dönhöfer Alexandra
2011-04-01
Full Text Available Abstract Background In an acidic and lysine-rich environment Escherichia coli induces expression of the cadBA operon which encodes CadA, the lysine decarboxylase, and CadB, the lysine/cadaverine antiporter. cadBA expression is dependent on CadC, a membrane-integrated transcriptional activator which belongs to the ToxR-like protein family. Activation of CadC requires two stimuli, lysine and low pH. Whereas lysine is detected by an interplay between CadC and the lysine-specific transporter LysP, pH alterations are sensed by CadC directly. Crystal structural analyses revealed a close proximity between two periplasmic cysteines, Cys208 and Cys272. Results Substitution of Cys208 and/or Cys272 by alanine resulted in CadC derivatives that were active in response to only one stimulus, either lysine or pH 5.8. Differential in vivo thiol trapping revealed a disulfide bond between these two residues at pH 7.6, but not at pH 5.8. When Cys208 and Cys272 were replaced by aspartate and lysine, respectively, virtually wild-type behavior was restored indicating that the disulfide bond could be mimicked by a salt bridge. Conclusion A disulfide bond was found in the periplasmic domain of CadC that supports an inactive state of CadC at pH 7.6. At pH 5.8 disulfide bond formation is prevented which transforms CadC into a semi-active state. These results provide new insights into the function of a pH sensor.
Bakhtiar, R; Abdolmohammadi, A; Hajarian, H; Nikousefat, Z; Kalantar-Neyestanaki, D
2017-12-01
In this study, semen samples were collected from 96 Sanjabi rams in order to investigate the IGF-1 gene polymorphisms and their relationship with the characteristics of semen quality and testicular size. The dimensions of scrotal length, width and circumference were measured during autumn and spring over two years. Blood samples were simultaneously collected from jugular vein to extract DNA. PCR was performed using specific primers to amplify 294 and 272bp fragments including 5' regulatory region and exon 3 of IGF-1 gene, respectively. PCR products were digested by BFOI and Eco88l restriction enzymes, respectively. Two genotypes including AA (194 and 100bp), AB (294, 194 and 100bp) and all possible genotypes including CC (182 and 90bp), CT (272, 182, and 90bp) and TT (272bp) were observed for 5' flanking region and exon 3 of IGF-1 gene, respectively. The significant differences among IGF-1 genotypes for testicular dimensions were not observed. However, the polymorphism of 5' flanking region in the studied population had significant effect on individual motility and percent morphology traits. Animals with AB genotype had significantly higher individual motility compared with AA genotype (P IGF-1 gene had significant effect on individual motility, concentration, morphology and water test traits. Animals with CT genotype had the highest sperm concentration (P IGF-1 genotypes. It might be concluded that polymorphisms in IGF-1gene can be considered to develop male fertility in future and for using in selection process of better animals under masker assisted selection programs. Copyright © 2017 Elsevier Inc. All rights reserved.
Dicty_cDB: Contig-U05606-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available odium falciparum 3D7 chromosome 13. 34 8.3 17 ( FG295791 ) 1108770741540 New World Screwworm Larvae 9387 EST...... 42 8.3 2 ( FG293345 ) 1108770669958 New World Screwworm Larvae 9387 EST... 42 8.3 2 ( GO218251 ) CAGB272
Manipulating the autolytic pathway of a Bacillus protease
VandenBurg, B; Eijsink, VGH; Vriend, G; Veltman, OR; Venema, G; HopsuHavu, VK; Jarvinen, M; Kirschke, H
1997-01-01
Autolytic degradation of Bacillus subtilis thermolysin-like proteinase (TLP-sub) is responsible for the irreversible inactivation of the enzyme at elevated temperatures. Previously, we reported five autolysis sites in B. subtilis neutral protease (Van den Burg et al., 1990, Biochem. J. 272:93-97).
Agro-Science Journal of Tropical Agriculture, Food, Environment ...
African Journals Online (AJOL)
PC USER
Results on chemical properties showed that the per cent protein in the yoghurt samples were Tito yoghurt. (27.2), Final yoghurt ... The total crude fat of yoghurt was determined by .... be due to the milk used as base raw material and at least due ...
Rainfall simulation experiments in the Southwestern USA using the Walnut Gulch rainfall simulator
The dataset contains hydrological, erosion, vegetation, ground cover, and other supplementary information from 272 rainfall simulation experiments conducted on 23 semi-arid rangeland locations in Arizona and Nevada between 2002 and 2013. On 30% of the plots simulations were conducted up to five time...
Transnational System Building Across Geopolitical Shifts. The Danube-Oder-Elbe Canal, 1901-2015
Czech Academy of Sciences Publication Activity Database
Janáč, Jiří; van der Vleuten, E.
2016-01-01
Roč. 9, č. 2 (2016), s. 272-291 ISSN 1965-0175 R&D Projects: GA ČR GA15-04902S Institutional support: RVO:68378114 Keywords : large technical systems * water politics * environmental history Subject RIV: AB - History Impact factor: 2.500, year: 2016
75 FR 63791 - Fisheries of the Northeastern United States; Atlantic Herring Fishery; Amendment 4
2010-10-18
... submit Confidential Business Information or otherwise sensitive or protected information. NMFS will..., uncertainty related to expected catch of herring in the New Brunswick weir fishery and discard [[Page 63793... vessels issued Limited Access Incidental Catch Permits, and 2,272 vessels issued Open Access Permits...
Assignment of the porcine SKI and GABRD genes to chromosome 6q22-q23
Czech Academy of Sciences Publication Activity Database
Stratil, Antonín; Knorr, C.; Knoll, Aleš; Kubíčková, S.; Musilová, P.; Van Poucke, M.; Rubeš, J.; Brenig, B.; Peelman, L. J.
2005-01-01
Roč. 36, - (2005), s. 272-273 ISSN 0268-9146 R&D Projects: GA ČR GA523/03/0858 Institutional research plan: CEZ:AV0Z50450515 Keywords : SKI gene * GABRD gene Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.437, year: 2005
Anorexigenní neuropeptid CART v regulaci příjmu potravy
Czech Academy of Sciences Publication Activity Database
Nagelová, Veronika; Železná, Blanka; Maletínská, Lenka
2014-01-01
Roč. 108, č. 4 (2014), s. 354-357 ISSN 0009-2770 R&D Projects: GA ČR GAP303/10/1368 Institutional support: RVO:61388963 Keywords : CART * cocaine and amphetamine regulated transcript * anorexigenic neuropeptide Subject RIV: CE - Biochemistry Impact factor: 0.272, year: 2014
Review of Raffaele Simone and Francesca Masini: Word classes: Nature, typology and representations
DEFF Research Database (Denmark)
Shibuya, Yoshikata; Jensen, Kim Ebensgaard
2016-01-01
Review of Raffaele Simone and Francesca Masini (eds.). Word classes: Nature, typology and representations. Current Issues in Linguistic Theory [CILT] 332. Amsterdam/ Philadelphia: John Benjamins Publishing Company, 2014, 293 + vii pp., ISBN: 1978-90-272-4851-0. Hardback and E-book 99.00 EUR / 149...
Risk factors for type 2 diabetes mellitus in adolescents secondary ...
African Journals Online (AJOL)
Background: The prevalence of Type 2 diabetes mellitus (T2 DM) in children and ... had none of the risk factors while 272(30.9%) had at least one risk factor. Using the American Diabetes Association criteria for identification of those at risk for ...
Protective double-layer coatings prepared by plasma enhanced chemical vapor deposition on tool steel
Czech Academy of Sciences Publication Activity Database
Muresan, M.; Charvátová Campbell, A.; Ondračka, P.; Buršíková, V.; Peřina, Vratislav; Polcar, T.; Reuter, S.; Hammer, M. U.; Valtr, M.; Zajíčková, L.
2015-01-01
Roč. 272, JUN (2015), s. 229-238 ISSN 0257-8972 R&D Projects: GA MŠk LM2011019 Institutional support: RVO:61389005 Keywords : PECVD * DLC * amorphous carbon * hardness Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 2.139, year: 2015
Molekuly a ionty v pohybu: Počítačové simulace biochemických a biofyzikálních procesů
Czech Academy of Sciences Publication Activity Database
Jungwirth, Pavel
2014-01-01
Roč. 108, č. 4 (2014), s. 278-284 ISSN 0009-2770 R&D Projects: GA ČR GBP208/12/G016 Institutional support: RVO:61388963 Keywords : molecular dynamics * proteins * ions * membranes Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.272, year: 2014
Role acyklických nukleosidfosfonátů jako potenciálních antimalarik
Czech Academy of Sciences Publication Activity Database
Janeba, Zlatko; Hocková, Dana
2014-01-01
Roč. 108, č. 4 (2014), s. 335-343 ISSN 0009-2770 R&D Projects: GA ČR GAP207/11/0108 Institutional support: RVO:61388963 Keywords : acyclic nucleoside phosphonates * prodrugs * antivirals * antimalarials Subject RIV: CC - Organic Chemistry Impact factor: 0.272, year: 2014
Data of evolutionary structure change: 1AIFB-2AI0K [Confc[Archive
Lifescience Database Archive (English)
Full Text Available ignment> 0 n> 1AIF n>B 1AI... CA 272 n> 2AI0 n>K ...n>2AI0Kn> VAHPASSTKVD EEE EEEE...1AIFB-2AI0K 1AIF 2AI0 B K EVKLQESGGGLVQPGGSMKLSCVASGFTFNNYWMSWVRQ...SCAASGFTFRNYGMSWVRQTPEKRLEWVAAIS--GNSLYTSYPDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYFCARH
2011-08-19
... Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those... Promulgation of Air Quality Implementation Plans; Maryland; Adoption of Plastic Parts and Business Machines..., Plastic Parts and Business Machines Coating. Maryland's SIP revision meets the requirement to adopt...
2012-04-13
... Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those... reasonably available control technology (RACT) controls on emission sources covered by EPA's control..., i.e., confidential business information (CBI) or other information whose disclosure is restricted by...
2012-05-14
... Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those... Technology (RACT) for sources covered by EPA's Control Techniques Guidelines (CTG) for offset lithographic..., unless the comment includes information claimed to be Confidential Business Information (CBI) or other...
Metody zápisu nanostruktur rastrovací sondou
Czech Academy of Sciences Publication Activity Database
Urbánek, Michal; Krátký, Stanislav; Matějka, Milan; Kolařík, Vladimír; Horáček, Miroslav
2014-01-01
Roč. 108, č. 10 (2014), s. 937-941 ISSN 0009-2770 R&D Projects: GA MŠk(CZ) LO1212 Keywords : scanning probe lithography * local anodic oxidation * nanoscratching * atomic force microscopy Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.272, year: 2014
Chemie fosfonátových analogů nukleotidů a oligonukleotidů - stručná reminiscence a současnost
Czech Academy of Sciences Publication Activity Database
Rosenberg, Ivan
2014-01-01
Roč. 108, č. 4 (2014), s. 375-386 ISSN 0009-2770 R&D Projects: GA ČR GA13-26526S Institutional support: RVO:61388963 Keywords : oligonucleotides * phosphonates * RNase H * RNase L Subject RIV: CC - Organic Chemistry Impact factor: 0.272, year: 2014
75 FR 34376 - Safety Zone; City of Pittsburg Independence Day Celebration, Pittsburg, CA
2010-06-17
... display is meant for entertainment purposes. This safety zone is issued to establish a temporary... 13211. Technical Standards The National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272..., disestablishing, or changing Regulated Navigation Areas and security or safety zones. An environmental analysis...
Diode array pumped, non-linear mirror Q-switched and mode-locked ...
Indian Academy of Sciences (India)
A non-linear mirror consisting of a lithium triborate crystal and a dichroic ... effects such as all-optical switching [7,8], nearly degenerate four-wave mixing [9,10], .... is driven by a radio frequency signal of 27.2MHz with a modulation available in.
Využití meandrového mikroreaktoru ke studiu enzymově katalyzované glycerolýzy
Czech Academy of Sciences Publication Activity Database
Drhová, Magdalena; Šabata, Stanislav; Sýkora, Jan; Hetflejš, Jiří; Křišťál, Jiří; Kuncová, Gabriela
2014-01-01
Roč. 108, č. 11 (2014), s. 1058-1066 ISSN 0009-2770 R&D Projects: GA AV ČR(CZ) IAAX08240901 Institutional support: RVO:67985858 Keywords : enzymatic glycerolysis * meandr microreactor * novozym 435 Subject RIV: CC - Organic Chemistry Impact factor: 0.272, year: 2014
PŘÍRODNÍ LÁTKY SVÍRAVÉ A TRPKÉ CHUTI
Czech Academy of Sciences Publication Activity Database
Čopíková, J.; Wimmer, Zdeněk; Lapčík, O.; Cahlíková, L.; Opletal, L.; Moravcová, J.; Drašar, P.
2014-01-01
Roč. 108, č. 11 (2014), s. 1053-1057 ISSN 0009-2770 Institutional support: RVO:61389030 Keywords : OBJECTIVE EVALUATION * PHENOLIC-COMPOUNDS * TASTE INTENSITIES Subject RIV: GM - Food Processing Impact factor: 0.272, year: 2014 http://www.chemicke-listy.cz/docs/full/2014_11_1053-1057.pdf
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Earth System Science; Volume 121; Issue 2. Impact of continental meteorology and atmospheric circulation in the modulation of Aerosol Optical Depth over the Arabian Sea. Sandhya K Nair S Sijikumar S S Prijith. Volume 121 Issue 2 April 2012 pp 263-272 ...
A novel one-pot synthesis of spirooxindole derivatives catalyzed by ...
African Journals Online (AJOL)
Nano zinc oxide was explored as a heterogeneous and reusable catalyst for the one-pot synthesis of spirooxindoles via three-component reaction between urea, isatin, and 1,3-dicarbonyl compounds. KEY WORDS: Nano-ZnO, Spirooxindoles, Isatin. Bull. Chem. Soc. Ethiop. 2013, 27(2), 309-314.
Anodic Stripping Voltammetry for Arsenic Determination on Composite Gold Electrode
Czech Academy of Sciences Publication Activity Database
Navrátil, Tomáš; Kopanica, M.; Krista, J.
2003-01-01
Roč. 48, č. 2 (2003), s. 265-272 ISSN 0009-2223 Grant - others:GIT(AR) 101/02/U111/CZ Institutional research plan: CEZ:AV0Z4040901 Keywords : arsenic determination * stripping voltammetry * composite gold electrode Subject RIV: CG - Electrochemistry Impact factor: 0.415, year: 2003
2012-01-31
... local educational agencies (LEAs) that participate in the NSLP and/or School Breakfast Program to... performance benchmarks for directly certifying for free school meals those children who are members of... requirements, School breakfast and lunch programs. 7 CFR Part 272 Alaska, Civil rights, Claims, Food stamps...
DEFF Research Database (Denmark)
Ehret, Georg B; Ferreira, Teresa; Chasman, Daniel I
2016-01-01
To dissect the genetic architecture of blood pressure and assess effects on target organ damage, we analyzed 128,272 SNPs from targeted and genome-wide arrays in 201,529 individuals of European ancestry, and genotypes from an additional 140,886 individuals were used for validation. We identified ...
Pyogenic liver abscess mimicking pleural effusion
African Journals Online (AJOL)
2011-07-02
Jul 2, 2011 ... the liver.2 The annual incidence of liver abscess in children varies widely in different regions of the world, occurring more commonly in .... 103/µl (27.2%), monocytes 0.9 x 103/µl(7.6%), eosinophil. 0.5 x 103/µl (4.0%).
Pokroky ve studiu interakce inzulinu s jeho receptorem
Czech Academy of Sciences Publication Activity Database
Žáková, Lenka; Jiráček, Jiří
2014-01-01
Roč. 108, č. 4 (2014), s. 368-374 ISSN 0009-2770 R&D Projects: GA ČR GPP207/11/P430 Institutional support: RVO:61388963 Keywords : insulin * insulin receptor * crystal structure * NMR structure * complex * diabetes Subject RIV: CE - Biochemistry Impact factor: 0.272, year: 2014
2012-05-30
..., electronic, and other liquid-based (water or eco-celli) barometers. At least eight States have banned the..., Manometers, Hygrometers, and Psychrometers. Washington, DC. OPPT/Economics, Exposure and Technology Division...) of the National Technology Transfer and Advancement Act (NTTAA), 15 U.S.C. 272 note, does not apply...
Nanodiamanty - fluorescenční a zobrazovací nanosondy
Czech Academy of Sciences Publication Activity Database
Šlegerová, Jitka; Cígler, Petr
2014-01-01
Roč. 108, č. 4 (2014), s. 387-393 ISSN 0009-2770 R&D Projects: GA ČR GAP108/12/0640; GA MŠk(CZ) LH11027 Institutional support: RVO:61388963 Keywords : nanodiamond * fluorescence * biocompatibility Subject RIV: CC - Organic Chemistry Impact factor: 0.272, year: 2014
Females solicit sneakers to improve fertilization success in the bitterling fish (Rhodeus sericeus)
Czech Academy of Sciences Publication Activity Database
Smith, C.; Reichard, Martin
2005-01-01
Roč. 272, č. 1573 (2005), s. 1683-1688 ISSN 0962-8452 R&D Projects: GA AV ČR(CZ) KJB600930501 Institutional research plan: CEZ:AV0Z60930519 Keywords : extra-pair copulations * bitterling * strategic ejaculation Subject RIV: EG - Zoology Impact factor: 3.510, year: 2005
Psychometric evaluation of the Dutch version of the Subjective Opiate Withdrawal Scale (SOWS)
Dijkstra, B.A.G.; Krabbe, P.F.M.; Riezebos, T.G.M.; Staak, C.P.F. van der; Jong, C.A.J. de
2007-01-01
AIM: To evaluate the psychometric properties of the Dutch version of the 16-item Subjective Opiate Withdrawal Scale (SOWS). The SOWS measures withdrawal symptoms at the time of assessment. METHODS: The Dutch SOWS was repeatedly administered to a sample of 272 opioid-dependent inpatients of four
Van den Burg, B; Eijsink, VGH; Vriend, G; Veltman, OR; Venema, G
Autolytic degradation of the thermolysin-like proteinase of Bacillus subtilis (TLP-sub) is responsible for the irreversible inactivation of the enzyme at elevated temperatures. Previously we have reported five cleavage sites in Tip-sub [Van den Burg et al, (1990) Biochem. J. 272, 93-97]. In an
2011-06-07
... for OMB Review; Comment Request; Grain Handling Facilities ACTION: Notice. SUMMARY: The Department of... collection request (ICR) titled, ``Grain Handling Facilities (29 CFR 1910.272),'' to the Office of Management... directed toward assuring the safety of workers in grain handling through development of a housekeeping plan...
75 FR 61619 - Safety Zone; IJSBA World Finals, Lower Colorado River, Lake Havasu, AZ
2010-10-06
... Sports Boating Association (IJSBA) World Finals. This temporary safety zone is necessary to provide for... International Jet Sports Boating Association (IJSBA) is sponsoring the IJSBA World Finals. The event will... 13211. Technical Standards The National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272...
G.B. Ehret (Georg); T. Ferreira (Teresa); D.I. Chasman (Daniel); A.U. Jackson (Anne); E.M. Schmidt (Ellen); T. Johnson (Toby); G. Thorleifsson (Gudmar); J. Luan (Jian'An); L.A. Donnelly (Louise); S. Kanoni (Stavroula); A.K. Petersen; V. Pihur (Vasyl); R.J. Strawbridge (Rona); D. Shungin (Dmitry); Hughes, M.F. (Maria F.); O. Meirelles; M. Kaakinen (Marika); N. Bouatia-Naji (Nabila); K. Kristiansson (Kati); S. Shah (Sonia); M.E. Kleber (Marcus); X. Guo (Xiuqing); L.-P. Lyytikäinen (Leo-Pekka); C. Fava (Cristiano); N. Eriksson (Niclas); I.M. Nolte (Ilja); P.K. Magnusson (Patrik); E. Salfati (Elias); L.S. Rallidis (Loukianos); Theusch, E. (Elizabeth); A.J.P. Smith; L. Folkersen (Lasse); H.E. Witkowska (Ewa); T.H. Pers (Tune); R. Joehanes (Roby); Kim, S.K. (Stuart K.); L. Lataniotis (Lazaros); R. Jansen; A.D. Johnson (Andrew); H. Warren (Helen); Y.J. Kim; Zhao, W. (Wei); Y. Wu (Ying); B. Tayo (Bamidele); M. Bochud (Murielle); D. Absher (Devin); L.S. Adair (Linda); N. Amin (Najaf); D.E. Arking (Dan); T. Axelsson (Tomas); D. Baldassarre (Damiano); B. Balkau (Beverley); S. Bandinelli (Stefania); M.J. Barnes (Michael); I.E. Barroso (Inês); Bevan, S. (Stephen); J.C. Bis (Joshua); Bjornsdottir, G. (Gyda); M. Boehnke (Michael); E.A. Boerwinkle (Eric); L.L. Bonnycastle (Lori); D.I. Boomsma (Dorret); S.R. Bornstein (Stefan); M.J. Brown (Morris); M. Burnier (Michel); Cabrera, C.P. (Claudia P.); J.C. Chambers (John); Chang, I.-S. (I-Shou); Cheng, C.-Y. (Ching-Yu); P.S. Chines (Peter); Chung, R.-H. (Ren-Hua); F.S. Collins (Francis); Connell, J.M. (John M.); A. Döring (Angela); J. Dallongeville; J. Danesh (John); U. de Faire (Ulf); G. Delgado; A. Dominiczak (Anna); A.S.F. Doney (Alex); F. Drenos (Fotios); T. Edkins (Ted); Eicher, J.D. (John D.); R. Elosua (Roberto); S. Enroth (Stefan); J. Erdmann (Jeanette); P. Eriksson (Per); T. Esko (Tõnu); E. Evangelou (Evangelos); A. Evans (Alun); M. Fall (Magnus); M. Farrall (Martin); J.F. Felix (Janine); J. Ferrieres (Jean); L. Ferrucci (Luigi); M. Fornage (Myriam); T. Forrester (Terrence); N. Franceschini (Nora); O.H. Franco (Oscar); A. Franco-Cereceda (Anders); R.M. Fraser (Ross); S.K. Ganesh (Santhi); Gao, H. (He); K. Gertow (Karl); F. Gianfagna (Francesco); B. Gigante (Bruna); F. Giulianini (Franco); A. Goel (Anuj); A.H. Goodall (Alison); M. Goodarzi (Mark); M. Gorski (Mathias); J. Gräßler (Jürgen); C.J. Groves (Christopher); V. Gudnason (Vilmundur); U. Gyllensten (Ulf); G. Hallmans (Göran); A.L. Hartikainen; Hassinen, M. (Maija); A.S. Havulinna (Aki); C. Hayward (Caroline); S. Hercberg (Serge); K.H. Herzig; A.A. Hicks (Andrew); A. Hingorani (Aroon); J.N. Hirschhorn (Joel); Hofman, A. (Albert); Holmen, J. (Jostein); O.L. Holmen (Oddgeir); J.J. Hottenga (Jouke Jan); P. Howard (Philip); Hsiung, C.A. (Chao A.); S.C. Hunt (Steven); M.K. Ikram (Kamran); T. Illig (Thomas); C. Iribarren (Carlos); Jensen, R.A. (Richard A.); M. Kähönen (Mika); H.M. Kang (Hyun Min); S. Kathiresan (Sekar); J. Keating (John); K.T. Khaw; Y.K. Kim (Yun Kyoung); E. Kim (Eric); M. Kivimaki (Mika); N. Klopp (Norman); Kolovou, G. (Genovefa); P. Komulainen (Pirjo); J.S. Kooner (Jaspal S.); Kosova, G. (Gulum); R.M. Krauss (Ronald); D. Kuh (Diana); Z. Kutalik (Zoltán); J. Kuusisto (Johanna); K. Kvaløy (Kirsti); T.A. Lakka (Timo); N.R. Lee (Nanette); I.T. Lee; W.-J. Lee (Wen-Jane); D. Levy (Daniel); X. Li (Xiaohui); Liang, K.-W. (Kae-Woei); Lin, H. (Honghuang); Lin, L. (Li); J. Lindström (Jaana); S. Lobbens (Stéphane); S. Männistö (Satu); G. Müller (Gabriele); M. Müller-Nurasyid (Martina); F. MacH (François); H.S. Markus (Hugh); E. Marouli (Eirini); M.I. McCarthy (Mark); C.A. McKenzie (Colin); P. Meneton (Pierre); C. Menni (Cristina); A. Metspalu (Andres); Mijatovic, V. (Vladan); L. Moilanen (Leena); M.E. Montasser (May E.); A.D. Morris (Andrew); A.C. Morrison (Alanna); Mulas, A. (Antonella); R. Nagaraja (Ramaiah); N. Narisu (Narisu); K. Nikus (Kjell); C.J. O'Donnell (Christopher); P.F. O'Reilly (Paul); K.K. Ong (Ken); Paccaud, F. (Fred); C. Palmer (Cameron); A. Parsa (Afshin); N.L. Pedersen (Nancy); B.W.J.H. Penninx (Brenda); M. Perola (Markus); A. Peters (Annette); N.R. Poulter (Neil); P.P. Pramstaller (Peter Paul); B.M. Psaty (Bruce); T. Quertermous (Thomas); D.C. Rao (Dabeeru C.); A. Rasheed (Asif); N.W. Rayner (Nigel William); F. Renström (Frida); R. Rettig (Rainer); K.M. Rice (Kenneth); R. Roberts (Robert); L.M. Rose (Lynda); Rossouw, J. (Jacques); N.J. Samani (Nilesh); S. Sanna (Serena); J. Saramies (Jouko); H. Schunkert (Heribert); S. Sebert (Sylvain); Sheu, W.H.-H. (Wayne H.-H.); Shin, Y.-A. (Young-Ah); X. Sim (Xueling); G.D. Smith; A.V. Smith (Albert Vernon); M.X. Sosa (Maria X.); T.D. Spector (Timothy); A. Stancáková (Alena); A. Stanton (Alice); K. Stirrups (Kathy); H.M. Stringham (Heather); Sundstrom, J. (Johan); A.J. Swift (Amy); A.C. Syvänen; Tai, E.-S. (E-Shyong); T. Tanaka (Toshiko); K.V. Tarasov (Kirill); A. Teumer (Alexander); U. Thorsteinsdottir (Unnur); M.D. Tobin (Martin); E. Tremoli (Elena); Uitterlinden, A.G. (Andre G.); M. Uusitupa (Matti); A. Vaez (Ahmad); D. Vaidya (Dhananjay); Van Duijn, C.M. (Cornelia M.); E.P.A. van Iperen (Erik); Vasan, R.S. (Ramachandran S.); G.C. Verwoert (Germaine); J. Virtamo (Jarmo); Vitart, V. (Veronique); B.F. Voight (Benjamin); P. Vollenweider (Peter); Wagner, A. (Aline); Wain, L.V. (Louise V.); N.J. Wareham (Nick); H. Watkins (Hugh); A.B. Weder (Alan); H.J. Westra (Harm-Jan); Wilks, R. (Rainford); T. Wilsgaard (Tom); J.F. Wilson (James F.); Wong, T.Y. (Tien Y.); T.-P. Yang (Tsun-Po); J. Yao (Jiefen); L. Yengo (Loic); W. Zhang (Weihua); J.H. Zhao (Jing Hua); X. Zhu (Xiaofeng); P. Bovet (Pascal); Cooper, R.S. (Richard S.); K.L. Mohlke (Karen); Saleheen, D. (Danish); J.-Y. Lee (Jong-Young); P. Elliott (Paul); L.M. Gierman (Lobke); C.J. Willer (Cristen); L. Franke (Lude); G. Kees Hovingh; K.D. Taylor (Kent); G.V. Dedoussis (George); P. Sever (Peter); A. Wong (Andrew); W.H.L. Kao (Wen); T.L. Assimes (Themistocles); I. Njølstad (Inger); P.E.H. Schwarz (Peter); C. Langenberg (Claudia); H. Snieder (Harold); M. Caulfield (Mark); O. Melander (Olle); M. Laakso (Markku); J. Saltevo (Juha); R. Rauramaa (Rainer); J. Tuomilehto (Jaakko); Ingelsson, E. (Erik); T. Lehtimäki (Terho); K. Hveem (Kristian); W. Palmas (Walter); W. März (Winfried); M. Kumari (Meena); V. Salomaa (Veikko); Y.D. Chen (Y.); Rotter, J.I. (Jerome I.); P. Froguel (Philippe); M.-R. Jarvelin (Marjo-Riitta); E. Lakatta (Edward); K. Kuulasmaa (Kari); P.W. Franks (Paul); A. Hamsten (Anders); H.E. Wichmann (Heinz Erich); C.N.A. Palmer (Colin); Stefansson, K. (Kari); P.M. Ridker (Paul); R.J.F. Loos (Ruth); A. Chakravarti (Aravinda); P. Deloukas (Panagiotis); A.P. Morris (Andrew); C. Newton-Cheh (C.); P. Munroe (Patricia)
2016-01-01
textabstractTo dissect the genetic architecture of blood pressure and assess effects on target organ damage, we analyzed 128,272 SNPs from targeted and genome-wide arrays in 201,529 individuals of European ancestry, and genotypes from an additional 140,886 individuals were used for validation. We
Self-Efficacy Beliefs as Shapers of Children's Aspirations and Career Trajectories.
Bandura, Albert; Barbaranelli, Claudio; Caprara, Gian Vittorio; Pastorelli, Concetta
2001-01-01
Tested a structural model of the network of sociocognitive influences shaping children's career aspirations and trajectories among 272 early adolescents. Found that subjects' perceived efficacy rather than their actual academic achievement was the key determinant of their perceived occupational self-efficacy and preferred choice of worklife.…
Modeling Ballistic Response of Ultra-High-Molecular-Weight Polyethylene (UHMWPE)
2016-07-01
in high-speed penetration problems , the material would fail and erode, and the regular contact algorithm cannot update the contact surfaces...High velocity impact and armour design. Express Polymer Letters. 2011;5(3):262–272. 14. Chocron S, King N, Walker JD, Heisserer U, Werff H
NtGNL1a ARF-GEF acts in endocytosis in tobacco cells
Czech Academy of Sciences Publication Activity Database
Jelínková, Adriana; Müller, Karel; Pařezová, Markéta; Petrášek, Jan
2015-01-01
Roč. 15, NOV 5 (2015), s. 272 ISSN 1471-2229 R&D Projects: GA ČR GPP305/11/P797 Institutional support: RVO:61389030 Keywords : Endocytosis * PIN1 protein trafficking * Inhibitors of endomembrane trafficking Subject RIV: EA - Cell Biology Impact factor: 3.631, year: 2015
Nanovýroba v přírodovědném vzdělávání
Czech Academy of Sciences Publication Activity Database
Hájková, Zdeňka; Šmejkal, P.
2014-01-01
Roč. 108, MAR (2014), s. 892-896 ISSN 0009-2770 Institutional support: RVO:68378271 Keywords : nanotechnology * nanofabrication * nanocar * top-down * bottom-up * demonstration * education Subject RIV: AM - Education Impact factor: 0.272, year: 2014 http://www.chemicke-listy.cz/docs/full/2014_09_892-896.pdf
2012-12-06
... Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those... Best Available Retrofit Technology (BART) determination for NO X for the TransAlta Centralia Generation... Business Information or other information whose disclosure is restricted by statute. Certain other material...
2011-10-17
... National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those... Plastic Parts and Business Machines Coatings AGENCY: Environmental Protection Agency (EPA). ACTION: Final....19.07-2, Plastic Parts and Business Machines Coating. Maryland's SIP revision meets the requirement...
2012-09-20
... Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those...-volume reports), and some may not be available in either location (e.g., confidential business information (CBI)). To inspect the hard copy materials, please schedule an appointment during normal business...
2012-11-29
... Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those... either location (e.g., confidential business information (CBI)). To inspect the hard copy materials, please schedule an appointment during normal business hours with the contact listed in the FOR FURTHER...
2012-04-30
... National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those..., unless the comment includes Confidential Business Information (CBI) or other information whose disclosure... during normal business hours with the contact listed in the FOR FURTHER INFORMATION CONTACT section. FOR...
2012-02-06
... Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those... either location (e.g., confidential business information (CBI)). To inspect the hard copy materials, please schedule an appointment during normal business hours with the contact listed in the FOR FURTHER...
2013-01-07
... Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those...-volume reports), and some may not be available in either location (e.g., confidential business information (CBI)). To inspect the hard copy materials, please schedule an appointment during normal business...
75 FR 33694 - Safety Zone; Delta Independence Day Foundation Celebration, Mandeville Island, CA
2010-06-15
... Mandeville Island, CA. The fireworks display is meant for entertainment purposes. This safety zone is issued... National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies to use... (34)(g), of the Instruction. This rule involves establishing, disestablishing, or changing Regulated...
76 FR 61259 - Safety Zone; Monte Foundation Fireworks Extravaganza, Aptos, CA
2011-10-04
... meant for entertainment purposes. This safety zone is issued to establish a temporary [[Page 61260... Standards The National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies... changing Regulated Navigation Areas and security or safety zones. An environmental analysis checklist and a...
Teacher Judgment, Student Motivation, and the Mediating Effect of Attributions
Zhou, Ji; Urhahne, Detlef
2013-01-01
Based on Weiner's attributional theory of intrapersonal motivation, the mediating effect of attributions between teacher judgment and student motivation was examined. In two studies, 144 German and 272 Chinese fourth-grade elementary school students were tested on their mathematical achievement, causal ascriptions for success and failure,…
Photoacoustic Detection of Terahertz Radiation for Chemical Sensing and Imaging Applications
2013-03-01
ISSN 2229-5518 [39] Jingle Liu, Benjamin Clough, and X. C. Zhang, “Enhancement of photoacoustic emission through terahertz-field driven electron...materials,” Journal of Electroceramics, vol. 2: p. 257-272, 2009. [47] Jingle Liu, Benjamin Clough, and X. C. Zhang, “Enhancement of photoacoustic
Study of fluid flow in baffled vessels stirred by a Rushton standard impeller
Czech Academy of Sciences Publication Activity Database
Chára, Zdeněk; Kysela, Bohuš; Konfršt, Jiří; Fořt, I.
2016-01-01
Roč. 272, č. 3 (2016), s. 614-628 ISSN 0096-3003 R&D Projects: GA ČR GAP101/12/2274 Institutional support: RVO:67985874 Keywords : trailing vortices * rushton impeller * PIV measurements * DES * numerical simulation Subject RIV: BK - Fluid Dynamics Impact factor: 1.738, year: 2016
Dispersal in Mastomys natalensis mice
DEFF Research Database (Denmark)
Van Hooft, Pim; Cosson, J F; Vibe-Petersen, Solveig
2008-01-01
Mastomys natalensis is the major pest rodent in sub-Saharan Africa. In this study, population genetic techniques were used to gain new insights into its dispersal behaviour, a critical parameter in pest management. Using 11 microsatellites, 272 individuals from a 300 ha area in Tanzania were geno...
Chen, Yajie; Kang, Chuanhong; Wang, Ruihong; Ren, Zhiyu; Fu, Huiying; Xiao, Yuting; Tian, Guohui
2018-06-01
The CoP/WS2 nanoflake composites were synthesized via the sulfuration and subsequent phosphidation using the pre-prepared WO2.72 nanowires as precursors. Originally, WO2.72 nanowires were prepared and followed by sulfuration to obtain WS2 nanoflakes. The as-prepared WS2 nanoflakes were used as substrates, on which the Co3O4 nanoparticles were uniformly anchored to construct the Co3O4/WS2 nanoflakes. Finally, the Co3O4/WS2 composites were subjected to phosphidation and in-situ converted into CoP/WS2 nanoflakes. Because of the dual functionalities of both CoP and WS2, the abundant interfaces as well as their synergy, the CoP/WS2 nanoflakes exhibited much higher electrocatalytic activity, smaller overpotential (-81 mV), lower Tafel slope (62 mV decade-1), and higher stability toward hydrogen-evolution reaction than those for the single CoP and WS2.
Manganese oxide micro-supercapacitors with ultra-high areal capacitance
Wang, Xu; Myers, Benjamin D.; Yan, Jian; Shekhawat, Gajendra; Dravid, Vinayak; Lee, Pooi See
2013-05-01
A symmetric micro-supercapacitor is constructed by electrochemically depositing manganese oxide onto micro-patterned current collectors. High surface-to-volume ratio of manganese oxide and short diffusion distance between electrodes give an ultra-high areal capacitance of 56.3 mF cm-2 at a current density of 27.2 μA cm-2.A symmetric micro-supercapacitor is constructed by electrochemically depositing manganese oxide onto micro-patterned current collectors. High surface-to-volume ratio of manganese oxide and short diffusion distance between electrodes give an ultra-high areal capacitance of 56.3 mF cm-2 at a current density of 27.2 μA cm-2. Electronic supplementary information (ESI) available: Experimental procedures; optical images of micro-supercapacitors; areal capacitances of samples M-0.3C, M-0.6C and M-0.9C; illustration of interdigital finger electrodes; Nyquist plot of Co(OH)2 deposited on micro-electrodes. See DOI: 10.1039/c3nr00210a
The international development of forensic science standards - A review.
Wilson-Wilde, Linzi
2018-04-16
Standards establish specifications and procedures designed to ensure products, services and systems are safe, reliable and consistently perform as intended. Standards can be used in the accreditation of forensic laboratories or facilities and in the certification of products and services. In recent years there have been various international activities aiming at developing forensic science standards and guidelines. The most significant initiative currently underway within the global forensic community is the development of International Organization for Standardization (ISO) standards. This paper reviews the main bodies working on standards for forensic science, the processes used and the implications for accreditation. This paper specifically discusses the work of ISO Technical Committee TC272, the future TC272 work program for the development of forensic science standards and associated timelines. Also discussed, are the lessons learnt to date in navigating the complex environment of multi-country stakeholder deliberations in standards development. Crown Copyright © 2018. Published by Elsevier B.V. All rights reserved.
Wang, K.; Zhang, C. Y.; Jönsson, P.; Si, R.; Zhao, X. H.; Chen, Z. B.; Guo, X. L.; Chen, C. Y.; Yan, J.
2018-03-01
Employing two state-of-the-art methods, multiconfiguration Dirac-Hartree-Fock and second-order many-body perturbation theory, highly accurate calculations are performed for the lowest 272 fine-structure levels arising from the 2s22p3, 2s2p4, 2p5, 2s22p23l (l = s , p , d), 2s2p33l (l = s , p , d), and 2p43l (l = s , p , d) configurations in nitrogen-like Ge XXVI. Complete and consistent atomic data, including excitation energies, lifetimes, wavelengths, hyperfine structures, Landé gJ-factors, and E1, E2, M1, M2 line strengths, oscillator strengths, and transition rates among these 272 levels are provided. Comparisons are made between the present two data sets, as well as with other available experimental and theoretical values. The present data are accurate enough for identification and deblending of emission lines involving the n = 3 levels, and are also useful for modeling and diagnosing fusion plasmas.
The Greenland shark (Somniosus microcephalus)
DEFF Research Database (Denmark)
Nielsen, Julius
radiocarbon dating and a Bayesian calibration model to estimate longevity of the Greenland shark. The analyzed tissue stems from the eye lens nucleus – unique material which presumably reflects age 0 of the shark, as it has not undergone metabolic changes during the animal’s life. By studying 28 Greenland...... shark females between 81 cm and 502 cm, I estimate the oldest shark to be between 272 years and 512 years. With an estimated lifespan of at least 272 years, the Greenland shark is the longest living vertebrate animal in the world. In order to produce these age estimates, it has been necessary to study...... continental shelf waters in southern Greenland at depths between 200 and 550 m and fed primarily on cod, redfish and seals. From previous investigations of predatory sharks and whales in the north Atlantic, bomb radiocarbon has been widely applied, and I argue that a similar calibration approach is valid...
Dembeck, Lauren M; Böröczky, Katalin; Huang, Wen; Schal, Coby; Anholt, Robert R H; Mackay, Trudy F C
2015-11-14
Insect cuticular hydrocarbons (CHCs) prevent desiccation and serve as chemical signals that mediate social interactions. Drosophila melanogaster CHCs have been studied extensively, but the genetic basis for individual variation in CHC composition is largely unknown. We quantified variation in CHC profiles in the D. melanogaster Genetic Reference Panel (DGRP) and identified novel CHCs. We used principal component (PC) analysis to extract PCs that explain the majority of CHC variation and identified polymorphisms in or near 305 and 173 genes in females and males, respectively, associated with variation in these PCs. In addition, 17 DGRP lines contain the functional Desat2 allele characteristic of African and Caribbean D. melanogaster females (more 5,9-C27:2 and less 7,11-C27:2, female sex pheromone isomers). Disruption of expression of 24 candidate genes affected CHC composition in at least one sex. These genes are associated with fatty acid metabolism and represent mechanistic targets for individual variation in CHC composition.
Scoping paper on new CDM baseline methodology for cross-border power trade
Energy Technology Data Exchange (ETDEWEB)
NONE
2011-07-01
Poeyry has been sub-contracted by Carbon Limits, under the African Development Bank CDM Support Programme, to prepare a new CDM baseline methodology for cross border trade, based on a transmission line from Ethiopia to Kenya. The first step in that process is to review the response of the UNFCCC, particularly the Methodologies Panel ('Meth Panel') of the CDM Executive Board, to the various proposals on cross-border trade and interconnection of grids. This report reviews the Methodology Panel and Executive Board decisions on 4 requests for revisions of ACM2 'Consolidated baseline methodology for grid-connected electricity generation from renewable sources', and 5 proposed new baseline methodologies (NM255, NM269, NM272, NM318, NM342), all of which were rejected. We analyse the reasons the methodologies were rejected, and whether the proposed draft Approved Methodology (AM) that the Methodology Panel created in response to NM269 and NM272 is a suitable basis for a new methodology proposal.(auth)
Burnout and health of primary school educators in the North West ...
African Journals Online (AJOL)
Burnout and health of primary school educators in the North West Province. Amanda Montgomery, Karina Mostert, Leon Jackson. Abstract. No Abstract. South African journal of Education Vol. 25(4) 2005: 266-272. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL ...
Questioning territorial cohesion: (Un)equal access to services of general interest
Czech Academy of Sciences Publication Activity Database
Malý, Jiří
-, August 2016 (2016), s. 1-21 ISSN 1056-8190 Institutional support: RVO:68145535 Keywords : territorial cohesion * services of general interest * accessibility * spatial justice * Czech Republic Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 1.272, year: 2016 http://onlinelibrary.wiley.com/doi/10.1111/pirs.12250/full
Journal for Language Teaching - Vol 36, No 3-4 (2002)
African Journals Online (AJOL)
Shortcomings of the written survey questionnaire for discovering language learner perceptions: reflections of a researcher · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Gary P. Barkhuizen, 259-272. http://dx.doi.org/10.4314/jlt.v36i3-4.5991 ...
2013-09-17
... spotted owls in many portions of the northern spotted owl's range (Pearson and Livezey 2003, p. 272... populations. Barred owls displace spotted owls from high-quality habitat (Kelley et al. 2003, p. 51; Pearson... management intervention, it is reasonable to expect that competition from barred owls may cause extirpation...
CLIMODE Subsurface Mooring Report: November 2005 - November 2007
2013-03-01
from magnetic north to true north using a geomagnetic model. Each point was converted individually to correct for the temporal change in magnetic...OPTIONAL FORM 272 (4-77) (Formerly NTIS-35) Department of Commerce (See ANSI-Z39.18) See Instructions on Reverse UNCLASSIFIED WHOI-2013-03 CLIMODE
2012-03-15
... National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies to use...] RIN 1625-AA08, AA00 Special Local Regulations and Safety Zone; War of 1812 Bicentennial Commemorations... Chesapeake Bay and Port of Baltimore, Maryland for War of 1812 Bicentennial Commemorations activities. This...
The outcome of familial adenomatous polyposis in the absence of a ...
African Journals Online (AJOL)
S Afr Med J 1995; 85: 272-276. Familial adenomatous polyposis (FAP) almost always leads to large-bowel cancer unless prophylactic surgery is performed. The results of treating large numbers of patients with FAP are usually reported from polyposis registries. Such registries have two main functions. Firstly they identify,.
Level of Farmers' Participation In The International Institute Of ...
African Journals Online (AJOL)
SproDell
( X =2.68), while consumers had link with farmers ( X =2.72). The major ... objectives, motivation, extension approaches and sources of funding. This means ... actors and the organizational and institutional learning behaviors and practices .... more the consumers rice preference is satisfied, the stronger their link with farmers ...
2008-07-01
genes in higher organisms— Homo sapiens gene INDO, encoding indole- amine-pyrrole 2,3 dioxygenase. Available from http://www.ncbi.nlm.nih.gov/IEB...Farnesyltransferase inhibitors alter the prenylation and growth-stimulating function of RhoB. J Biol Chem 1997; 272:15591–4. 25. Routhier EL , Donover PS
Czech Academy of Sciences Publication Activity Database
Vodička, R.; Mantič, V.; Roubíček, Tomáš
2017-01-01
Roč. 315, May (2017), s. 249-272 ISSN 0377-0427 Institutional support: RVO:61388998 Keywords : contact mechanics * evolution variational inequalities * numerical approximation Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 1.357, year: 2016 http://www.sciencedirect.com/science/article/pii/S037704271630499X
Czech Academy of Sciences Publication Activity Database
Zhou, Y. M.; Li, X.; Švejnar, Jan
2011-01-01
Roč. 17, č. 2 (2011), s. 272-287 ISSN 0929-1199 R&D Projects: GA ČR GAP402/10/2130; GA MŠk LC542 Institutional research plan: CEZ:MSM0021620846 Keywords : divestiture * corporate restructuring * financial constraints Subject RIV: AH - Economics Impact factor: 1.447, year: 2011
Czech Academy of Sciences Publication Activity Database
Janoušková, Martina; Pavlíková, D.; Macek, Tomáš; Vosátka, Miroslav
2005-01-01
Roč. 272, - (2005), s. 29-40 ISSN 0032-079X R&D Projects: GA ČR(CZ) GA526/02/0293 Institutional research plan: CEZ:AV0Z60050516 Keywords : CUP1 gene * heavy metals * soil microflora Subject RIV: EF - Botanics Impact factor: 1.703, year: 2005
Trichomonas vaginalis infection among adolescent girls in some ...
African Journals Online (AJOL)
Trichomonasvaginalisis the most common non-viral sexually transmitted disease (STD) and one of the neglected parasitic infections. This study aimed to determine the prevalence of T. vaginalisinfection among adolescent girls in some secondary schools in Edo State, Nigeria. A total of 272 girls were recruited in this study.
The Influence of Work-Related Stressors on Clergy Husbands and Their Wives.
Morris, Michael Lane; Blanton, Priscilla White
1994-01-01
Assessed predictive power of 5 work-related stressors identified in clergy family literature on criterion variables of marital, parent, and life satisfaction among 272 clergy husbands and their wives from 6 denominations. Findings supported hypotheses that work-related stressors were inversely related to marital, parental, and life satisfaction…
Ehret, Georg B.; Ferreira, Teresa; Chasman, Daniel I.; Jackson, Anne U.; Schmidt, Ellen M.; Johnson, Toby; Thorleifsson, Gudmar; Luan, Jian'an; Donnelly, Louise A.; Kanoni, Stavroula; Petersen, Ann-Kristin; Pihur, Vasyl; Strawbridge, Rona J.; Shungin, Dmitry; Hughes, Maria F.; Meirelles, Osorio; Kaakinen, Marika; Bouatia-Naji, Nabila; Kristiansson, Kati; Shah, Sonia; Kleber, Marcus E.; Guo, Xiuqing; Lyytikäinen, Leo-Pekka; Fava, Cristiano; Eriksson, Niclas; Nolte, Ilja M.; Magnusson, Patrik K.; Salfati, Elias L.; Rallidis, Loukianos S.; Theusch, Elizabeth; Smith, Andrew J. P.; Folkersen, Lasse; Witkowska, Kate; Pers, Tune H.; Joehanes, Roby; Kim, Stuart K.; Lataniotis, Lazaros; Jansen, Rick; Johnson, Andrew D.; Warren, Helen; Kim, Young Jin; Zhao, Wei; Wu, Ying; Tayo, Bamidele O.; Bochud, Murielle; Absher, Devin; Adair, Linda S.; Amin, Najaf; Arking, Dan E.; Axelsson, Tomas; Baldassarre, Damiano; Balkau, Beverley; Bandinelli, Stefania; Barnes, Michael R.; Barroso, Inês; Bevan, Stephen; Bis, Joshua C.; Bjornsdottir, Gyda; Boehnke, Michael; Boerwinkle, Eric; Bonnycastle, Lori L.; Boomsma, Dorret I.; Bornstein, Stefan R.; Brown, Morris J.; Burnier, Michel; Cabrera, Claudia P.; Chambers, John C.; Chang, I.-Shou; Cheng, Ching-Yu; Chines, Peter S.; Chung, Ren-Hua; Collins, Francis S.; Connell, John M.; Döring, Angela; Dallongeville, Jean; Danesh, John; de Faire, Ulf; Delgado, Graciela; Dominiczak, Anna F.; Doney, Alex S. F.; Drenos, Fotios; Edkins, Sarah; Eicher, John D.; Elosua, Roberto; Enroth, Stefan; Erdmann, Jeanette; Eriksson, Per; Esko, Tonu; Evangelou, Evangelos; Evans, Alun; Fall, Tove; Farrall, Martin; Felix, Janine F.; Ferrières, Jean; Ferrucci, Luigi; Fornage, Myriam; Forrester, Terrence; Franceschini, Nora; Franco, Oscar H.; Franco-Cereceda, Anders; Fraser, Ross M.; Ganesh, Santhi K.; Gao, He; Gertow, Karl; Gianfagna, Francesco; Gigante, Bruna; Giulianini, Franco; Goel, Anuj; Goodall, Alison H.; Goodarzi, Mark O.; Gorski, Mathias; Gräßler, Jürgen; Groves, Christopher J.; Gudnason, Vilmundur; Gyllensten, Ulf; Hallmans, Göran; Hartikainen, Anna-Liisa; Hassinen, Maija; Havulinna, Aki S.; Hayward, Caroline; Hercberg, Serge; Herzig, Karl-Heinz; Hicks, Andrew A.; Hingorani, Aroon D.; Hirschhorn, Joel N.; Hofman, Albert; Holmen, Jostein; Holmen, Oddgeir Lingaas; Hottenga, Jouke-Jan; Howard, Phil; Hsiung, Chao A.; Hunt, Steven C.; Ikram, M. Arfan; Illig, Thomas; Iribarren, Carlos; Jensen, Richard A.; Kähönen, Mika; Kang, Hyun Min; Kathiresan, Sekar; Keating, Brendan J.; Khaw, Kay-Tee; Kim, Yun Kyoung; Kim, Eric; Kivimaki, Mika; Klopp, Norman; Kolovou, Genovefa; Komulainen, Pirjo; Kooner, Jaspal S.; Kosova, Gulum; Krauss, Ronald M.; Kuh, Diana; Kutalik, Zoltan; Kuusisto, Johanna; Kvaløy, Kirsti; Lakka, Timo A.; Lee, Nanette R.; Lee, I.-Te; Lee, Wen-Jane; Levy, Daniel; Li, Xiaohui; Liang, Kae-Woei; Lin, Honghuang; Lin, Li; Lindström, Jaana; Lobbens, Stéphane; Männistö, Satu; Müller, Gabriele; Müller-Nurasyid, Martina; Mach, François; Markus, Hugh S.; Marouli, Eirini; McCarthy, Mark I.; McKenzie, Colin A.; Meneton, Pierre; Menni, Cristina; Metspalu, Andres; Mijatovic, Vladan; Moilanen, Leena; Montasser, May E.; Morris, Andrew D.; Morrison, Alanna C.; Mulas, Antonella; Nagaraja, Ramaiah; Narisu, Narisu; Nikus, Kjell; O'Donnell, Christopher J.; O'Reilly, Paul F.; Ong, Ken K.; Paccaud, Fred; Palmer, Cameron D.; Parsa, Afshin; Pedersen, Nancy L.; Penninx, Brenda W.; Perola, Markus; Peters, Annette; Poulter, Neil; Pramstaller, Peter P.; Psaty, Bruce M.; Quertermous, Thomas; Rao, Dabeeru C.; Rasheed, Asif; Rayner, N. William; Renström, Frida; Rettig, Rainer; Rice, Kenneth M.; Roberts, Robert; Rose, Lynda M.; Rossouw, Jacques; Samani, Nilesh J.; Sanna, Serena; Saramies, Jouko; Schunkert, Heribert; Sebert, Sylvain; Sheu, Wayne H.-H.; Shin, Young-Ah; Sim, Xueling; Smit, Johannes H.; Smith, Albert V.; Sosa, Maria X.; Spector, Tim D.; Stančáková, Alena; Stanton, Alice V.; Stirrups, Kathleen E.; Stringham, Heather M.; Sundstrom, Johan; Swift, Amy J.; Syvänen, Ann-Christine; Tai, E.-Shyong; Tanaka, Toshiko; Tarasov, Kirill V.; Teumer, Alexander; Thorsteinsdottir, Unnur; Tobin, Martin D.; Tremoli, Elena; Uitterlinden, Andre G.; Uusitupa, Matti; Vaez, Ahmad; Vaidya, Dhananjay; van Duijn, Cornelia M.; van Iperen, Erik P. A.; Vasan, Ramachandran S.; Verwoert, Germaine C.; Virtamo, Jarmo; Vitart, Veronique; Voight, Benjamin F.; Vollenweider, Peter; Wagner, Aline; Wain, Louise V.; Wareham, Nicholas J.; Watkins, Hugh; Weder, Alan B.; Westra, Harm-Jan; Wilks, Rainford; Wilsgaard, Tom; Wilson, James F.; Wong, Tien Y.; Yang, Tsun-Po; Yao, Jie; Yengo, Loic; Zhang, Weihua; Zhao, Jing Hua; Zhu, Xiaofeng; Bovet, Pascal; Cooper, Richard S.; Mohlke, Karen L.; Saleheen, Danish; Lee, Jong-Young; Elliott, Paul; Gierman, Hinco J.; Willer, Cristen J.; Franke, Lude; Hovingh, G. Kees; Taylor, Kent D.; Dedoussis, George; Sever, Peter; Wong, Andrew; Lind, Lars; Assimes, Themistocles L.; Njølstad, Inger; Schwarz, Peter E. H.; Langenberg, Claudia; Snieder, Harold; Caulfield, Mark J.; Melander, Olle; Laakso, Markku; Saltevo, Juha; Rauramaa, Rainer; Tuomilehto, Jaakko; Ingelsson, Erik; Lehtimäki, Terho; Hveem, Kristian; Palmas, Walter; März, Winfried; Kumari, Meena; Salomaa, Veikko; Chen, Yii-der I.; Rotter, Jerome I.; Froguel, Philippe; Jarvelin, Marjo-Riitta; Lakatta, Edward G.; Kuulasmaa, Kari; Franks, Paul W.; Hamsten, Anders; Wichmann, H.-Erich; Palmer, Colin N. A.; Stefansson, Kari; Ridker, Paul M.; Loos, Ruth J. F.; Chakravarti, Aravinda; Deloukas, Panos; Morris, Andrew P.; Newton-Cheh, Christopher; Munroe, Patricia B.
2016-01-01
To dissect the genetic architecture of blood pressure and assess effects on target organ damage, we analyzed 128,272 SNPs from targeted and genome-wide arrays in 201,529 individuals of European ancestry, and genotypes from an additional 140,886 individuals were used for validation. We identified 66
Browse Title Index - African Journals Online
African Journals Online (AJOL)
... 7 (2016), Protein expression of Myt272-3 recombinant clone and in silico prediction of a possible vaccine candidate against Mycobacterium tuberculosis, Abstract PDF .... Vol 17, No 1 (2018), Regulation of MicroRNA-378 expression in mature human adipose tissue cells by adiponectin, free fatty acids and dexamethasone ...
2011-06-20
... National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies to use... heavy metals. An extensive history and background of the cleanup project can be found on the EPA's Web... entities'' comprises small businesses, not-for-profit organizations that are independently owned and...
78 FR 40963 - Regulated Navigation Areas; Bars Along the Coasts of Oregon and Washington
2013-07-09
... Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies to use voluntary... comments and documents C. Privacy Act D. Public meeting II. Abbreviations III. Regulatory History and... individual submitting the comment (or signing the comment, if submitted on behalf of an association, business...
77 FR 37326 - Safety Zone; Grand Hotel 125th Anniversary Fireworks Celebration, Mackinaw Island, MI
2012-06-21
... National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies to use... Rulemaking A. Regulatory History and Information The Coast Guard is issuing this temporary final rule without.... Assistance for Small Entities Under section 213(a) of the Small Business Regulatory Enforcement Fairness Act...
76 FR 77458 - Amendment to Agency Rules of Practice
2011-12-13
... Advancement Act (Technical Standards) The National Technology Transfer and Advancement Act (15 U.S.C. 272 note... forwarders it determines are reincarnations of other entities with a history of failing to comply with..., if submitted on behalf of an association, business, labor union, etc.). You may review the Department...
78 FR 14444 - Drawbridge Operation Regulation; Lake Champlain, Swanton, VT
2013-03-06
... Standards The National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies.... Regulatory History and Information On November 9, 2012, we published a notice of proposed rulemaking (NPRM... regulations on small entities during rulemaking. The Coast Guard received no comments from the Small Business...
77 FR 27123 - Safety Zone; Baltimore Air Show, Patapsco River, Baltimore, MD
2012-05-09
... National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies to use.... Background and Purpose The U.S. Navy History & Heritage Command, Office of Commemorations, is planning to... businesses, not-for-profit organizations that are independently owned and operated and are not [[Page 27124...
Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array
DEFF Research Database (Denmark)
Eeles, Rosalind A; Olama, Ali Amin Al; Benlloch, Sara
2013-01-01
Prostate cancer is the most frequently diagnosed cancer in males in developed countries. To identify common prostate cancer susceptibility alleles, we genotyped 211,155 SNPs on a custom Illumina array (iCOGS) in blood DNA from 25,074 prostate cancer cases and 24,272 controls from the internationa...
Knowledge, Attitude and Practice of Emergency Contraceptives ...
African Journals Online (AJOL)
About 309 (46.8%) of the students had heard about emergency contraceptives and from those who heard emergency contraceptives, 27.2% had good knowledge. Majority, four hundred fifteen (62.9%) of the students had positive attitude towards it. However, only 31(4.7%) had used emergency contraceptive methods.
Increasing selectivity of a heterogeneous ion-exchange membrane
Czech Academy of Sciences Publication Activity Database
Křivčík, J.; Neděla, D.; Hadrava, J.; Brožová, Libuše
2015-01-01
Roč. 56, č. 12 (2015), s. 3160-3166 ISSN 1944-3994. [International Conference on Membrane and Electromembrane Processes - MELPRO 2014. Prague, 18.05.2014-21.05.2014] Institutional support: RVO:61389013 Keywords : ion-exchange membrane * selectivity * permselectivity Subject RIV: JP - Industrial Processing Impact factor: 1.272, year: 2015
Processing-improved properties and morphology of PP/COC blends
Czech Academy of Sciences Publication Activity Database
Vacková, Taťana; Šlouf, Miroslav; Nevoralová, Martina; Kaprálková, Ludmila
2011-01-01
Roč. 122, č. 2 (2011), s. 1168-1175 ISSN 0021-8995 R&D Projects: GA ČR GP106/09/P272 Institutional research plan: CEZ:AV0Z40500505 Keywords : polymer blend * phase morphology * fiber Subject RIV: JI - Composite Materials Impact factor: 1.289, year: 2011
Human MT2 melatonin receptor and its melatonin recognition site: a structural model
Czech Academy of Sciences Publication Activity Database
Luley, Ladislav; Stockner, T; Sovová, Žofie; Mazna, Petr; Ettrich, Rüdiger; Teisinger, Jan
Roč.272, č.S1 (2005), s. 222-223 ISSN 1474-3833. [FEBS Congress /30./ and IUBMB Conference /9./. 02.07.2005-07.07.2005, Budapest] Institutional research plan: CEZ:AV0Z50110509; CEZ:AV0Z60870520 Keywords : melatonin receptor * model * structure Subject RIV: BO - Biophysics
76 FR 61261 - Safety Zone; IJSBA World Finals; Lower Colorado River, Lake Havasu, AZ
2011-10-04
... navigable waters of Lake Havasu on the lower Colorado River in support of the International Jet Sports... The International Jet Sports Boating Association is sponsoring the IJSBA World Finals. The event will... National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies to use...
Prins, M.; van Leeuwen, M.W.; Teske, E.
2009-01-01
Tijdschr Diergeneeskd. 2009 Apr 1;134(7):272-8. Stability and reproducibility of ADVIA 120-measured red blood cell and platelet parameters in dogs, cats, and horses, and the use of reticulocyte haemoglobin content (CH(R)) in the diagnosis of iron deficiency. Prins M, van Leeuwen MW, Teske E.
76 FR 62002 - Revisions to the California State Implementation Plan
2011-10-06
... requirements of Section 12(d) of the National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272... Confidential Business Information (CBI) or other information whose disclosure is restricted by statute... normal business hours with the contact listed in the FOR FURTHER INFORMATION CONTACT section. FOR FURTHER...
2011-08-29
... National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those... available in either location (e.g., confidential business information (CBI)). To inspect the hard copy materials, please schedule an appointment during normal business hours with the contact listed in the FOR...
2012-11-09
... requirements of Section 12(d) of the National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272... includes Confidential Business Information (CBI) or other information whose disclosure is restricted by... appointment during normal business hours with the contact listed in the FOR FURTHER INFORMATION CONTACT...
2012-04-27
... requirements of Section 12(d) of the National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272... information provided, unless the comment includes Confidential Business Information (CBI) or other information... the hard copy materials, please schedule an appointment during normal business hours with the contact...
2012-02-13
... National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those... some may not be available in either location (e.g., confidential business information (CBI)). To inspect the hard copy materials, please schedule an appointment during normal business hours with the...
DEFF Research Database (Denmark)
Olumi, Aria F; Nordestgaard, Børge G.
2014-01-01
Prostate cancer is the most frequently diagnosed cancer in males in developed countries. To identify common prostate cancer susceptibility alleles, we genotyped 211,155 SNPs on a custom Illumina array (iCOGS) in blood DNA from 25,074 prostate cancer cases and 24,272 controls from the internationa...
Czech Academy of Sciences Publication Activity Database
Nováková, Kateřina; Navrátil, Tomáš; Šestáková, Ivana; Mareček, Vladimír; Chýlková, J.
2014-01-01
Roč. 108, č. 3 (2014), s. 219-225 ISSN 0009-2770 R&D Projects: GA ČR(CZ) GAP208/12/1645; GA ČR GA13-21704S Institutional support: RVO:61388955 Keywords : lecitine * cholesterol * biological membranes Subject RIV: CG - Electrochemistry Impact factor: 0.272, year: 2014
Direct Detection of the Asteroidal YORP Effect
Czech Academy of Sciences Publication Activity Database
Lowry, S.C.; Fitzsimmons, A.; Pravec, Petr; Vokrouhlický, D.; Boehnhardt, H.; Taylor, P.A.; Margot, J. L.; Galád, Adrián; Irwin, M.; Irwin, J.; Kušnirák, Peter
2007-01-01
Roč. 316, č. 5822 (2007), s. 272-274 ISSN 0036-8075 R&D Projects: GA AV ČR IAA3003204 Institutional research plan: CEZ:AV0Z10030501 Keywords : asteroids rotation * near- Earth objects Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 26.372, year: 2007
African Journals Online (AJOL)
USER
soluble organic matter (SOM) and genetic potential (GP) values ranged from 0.52 – 0.82wt%, 455.64 – 1003.04 ppm and ... These values suggested organic matter deposited under anoxic to suboxic conditions. ...... Dayo Sonibare of Chemistry Department, ... Nature Vol. 272, No. ... Molecular organic geochemistry of the.
After the First Shots: Managing Escalation in Northeast Asia
2015-01-01
Control: A Pro- posed Strategy for an Unlikely Conflict, INSS Strategic Forum No. 278 (Washington, DC: NDU Press, June 2012). 7 On North Korean...Cross-Domain Operations: Where Do Space and Cyber Fit? INSS Strategic Forum No. 272 (Washington, DC: NDU Press, December 2011). 33 For a discussion of
Mothers' Perception of Fever Management in Children
African Journals Online (AJOL)
Alasia Datonye
range 19 years to 54 years with mean of 31.4±5.7SD. .... unemployed, 41 (27.2%) were traders, 7 (4.6%) were fashion designers and 7 (4.6%) were undergraduates. Fifty eight. (38.4%) mothers had one child each, 38 (25.2%) had two children ...
Detection Performance of an Operator Using Lofar
1976-04-01
Blur on Perimetric Thresholds," Aroh. of Opthalmology , 68:2, pp. 240-51 (1962). 15. Ferree, C.E., Rand, G., Hardy, C, "Refraction for the...Static Perimetric Technique Believed to Test Receptive Field Properties III Clinical Trials," Am. Jour. Opthalmology , 70:2, pp. 244-272 (Aug. 1970
Czech Academy of Sciences Publication Activity Database
Martan, A.; Mašata, J.; Švabík, K.; Drahorádová, P.; Halaška, M.; Voigt, R.; Pavlíková, Markéta
2004-01-01
Roč. 69, č. 4 (2004), s. 267-272 ISSN 1210-7832 R&D Projects: GA MZd NH7378 Keywords : inkontinence moči u žen * maximální uzávěrový tlak uretry * Valsalva leak -point pressure Subject RIV: FK - Gynaecology, Childbirth
Czech Academy of Sciences Publication Activity Database
Uhlířová, Miroslava; Foy, B. D.; Beaty, B. J.; Olson, K. E.; Riddiford, L. M.; Jindra, Marek
2003-01-01
Roč. 100, č. 26 (2003), s. 15607-15612 ISSN 0027-8424 R&D Projects: GA AV ČR IAA5007305 Institutional research plan: CEZ:AV0Z5007907 Keywords : Green fluorescent protein-steroid-hormone ecdysone Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 10.272, year: 2003
Estrada, Joey Nuñez, Jr.; Gilreath, Tamika D.; Astor, Ron Avi; Benbenishty, Rami
2014-01-01
There is insufficient empirical evidence exploring associations between gang membership and school violence behaviors. Using a sample of 272,863 high school students, this study employs a structural equation model to examine how school risk and protective behaviors and attitudes mediate effects of gang members' involvement with school violence…
Redbank and Fancher Creeks, California: General Design Memorandum
1986-02-01
48.1/ 6.5-8.52/ 4 feet!/ Phytoplankton Analysis Biomass on the surface Dominate genus mg/L 272 Anacystis 104 < 1.5 Anacystis None...to preclude the Government from pursuing any other remedy at law or equity to assure faithful performance pursuant to this agreement. ARTICLE 7
2013-02-22
..., national origin, gender, age, disability, marital or family status. Regulations at 7 CFR 272.6.... Discrimination in any aspect of the program administration is prohibited by these regulations, according to the... SNAP benefits at the location, store inventory, and the SNAP history of the store owners. For example...
Heat shock protein (Hsp) 40 mutants inhibit Hsp70 in mammalian cells
Michels, AA; Kanon, B; Bensaude, O; Kampinga, HH
1999-01-01
Heat shock protein (Hsp) 70 and Hsp40 expressed in mammalian cells had been previously shown to cooperate in accelerating the reactivation of heat-denatured firefly luciferase (Michels, A. A., Kanon, B., Konings, A. W. T., Ohtsuka, K,, Bensaude, O., and Kampinga, H. H. (1997) J. Biol. Chem. 272,
Czech Academy of Sciences Publication Activity Database
Wang, T.; Španěl, Patrik; Smith, D.
2008-01-01
Roč. 272, č. 1 (2008), s. 78-85 ISSN 1387-3806 R&D Projects: GA ČR GA202/06/0776 Institutional research plan: CEZ:AV0Z40400503 Keywords : ketone bodies * SIFT-MS * urine * breath Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.445, year: 2008
Determination of higenamine in dietary supplements by UHPLC/MS/MS method.
Stajić, A; Anđelković, M; Dikić, N; Rašić, J; Vukašinović-Vesić, M; Ivanović, D; Jančić-Stojanović, B
2017-11-30
From 1st January 2017 higenamine was added on the WADA (World Anti-doping Agency) Prohibited list under S3 group beta-2 agonists as at all times banned substance for the athletes. The main origine of higenamine (or norcoclaurine) are different plants including Nandina domestica, Aconitum carmichaelii, Asarum heterotropioides, Galium divaricatum, Annona squamosa, Nelumbo nucifera etc. Higenamine main use is related to weight loss and it could be found (un)labeled in different dietary supplements. The objective of this study was development of sensitive and reliable UHPLC/MS/MS method for determination of higenamine in various dietary supplement samples. In order to obtain high method sensitivity, hydrophilic interaction liquid chromatography (HILIC) mode was applied. Separation was carried out on UHPLC Acquity BEH HILIC analytical column (2.1mm×100mm, 1.7μm particle size). Mobile phase consisted of 0.1% formic acid in water and acetonitrile, respectively, was mixed in ratio of 30:70, v/v. Flow rate was set at 0.2mLmin -1 . Quercetin was used as an internal standard. ESI (+) source ionization mode using multi reaction monitoring (MRM) mode was utilized and three ion transitions of higenamine were followed 272.08→107.01, 272.08→161.07 and 272.08→77.08. Developed method was fully validated and applied for identification and quantification of higenamine in different dietary supplements. According to the results, the most of investigated supplements were free of higenamine, and on the other hand, presence of higenamine was confirmed in some samples while it was not declared on the label. Copyright © 2017 Elsevier B.V. All rights reserved.
Lesly, Shera; Bandura, Jennifer L; Calvi, Brian R
2017-11-01
Problems with DNA replication cause cancer and developmental malformations. It is not fully understood how DNA replication is coordinated with development and perturbed in disease. We had previously identified the Drosophila gene humpty dumpty ( hd ), and showed that null alleles cause incomplete DNA replication, tissue undergrowth, and lethality. Animals homozygous for the missense allele, hd 272-9 , were viable, but adult females had impaired amplification of eggshell protein genes in the ovary, resulting in the maternal effects of thin eggshells and embryonic lethality. Here, we show that expression of an hd transgene in somatic cells of the ovary rescues amplification and eggshell synthesis but not embryo viability. The germline of these mothers remain mutant for the hd 272-9 allele, resulting in reduced maternal Hd protein and embryonic arrest during mitosis of the first few S/M nuclear cleavage cycles with chromosome instability and chromosome bridges. Epistasis analysis of hd with the rereplication mutation plutonium indicates that the chromosome bridges of hd embryos are the result of a failed attempt to segregate incompletely replicated sister chromatids. This study reveals that maternally encoded Humpty dumpty protein is essential for DNA replication and genome integrity during the little-understood embryonic S/M cycles. Moreover, the two hd 272-9 maternal-effect phenotypes suggest that ovarian gene amplification and embryonic cleavage are two time periods in development that are particularly sensitive to mild deficits in DNA replication function. This last observation has broader relevance for interpreting why mild mutations in the human ortholog of humpty dumpty and other DNA replication genes cause tissue-specific malformations of microcephalic dwarfisms. Copyright © 2017 by the Genetics Society of America.
A novel ICK mutation causes ciliary disruption and lethal endocrine-cerebro-osteodysplasia syndrome.
Oud, Machteld M; Bonnard, Carine; Mans, Dorus A; Altunoglu, Umut; Tohari, Sumanty; Ng, Alvin Yu Jin; Eskin, Ascia; Lee, Hane; Rupar, C Anthony; de Wagenaar, Nathalie P; Wu, Ka Man; Lahiry, Piya; Pazour, Gregory J; Nelson, Stanley F; Hegele, Robert A; Roepman, Ronald; Kayserili, Hülya; Venkatesh, Byrappa; Siu, Victoria M; Reversade, Bruno; Arts, Heleen H
2016-01-01
Endocrine-cerebro-osteodysplasia (ECO) syndrome [MIM:612651] caused by a recessive mutation (p.R272Q) in Intestinal cell kinase (ICK) shows significant clinical overlap with ciliary disorders. Similarities are strongest between ECO syndrome, the Majewski and Mohr-Majewski short-rib thoracic dysplasia (SRTD) with polydactyly syndromes, and hydrolethalus syndrome. In this study, we present a novel homozygous ICK mutation in a fetus with ECO syndrome and compare the effect of this mutation with the previously reported ICK variant on ciliogenesis and cilium morphology. Through homozygosity mapping and whole-exome sequencing, we identified a second variant (c.358G > T; p.G120C) in ICK in a Turkish fetus presenting with ECO syndrome. In vitro studies of wild-type and mutant mRFP-ICK (p.G120C and p.R272Q) revealed that, in contrast to the wild-type protein that localizes along the ciliary axoneme and/or is present in the ciliary base, mutant proteins rather enrich in the ciliary tip. In addition, immunocytochemistry revealed a decreased number of cilia in ICK p.R272Q-affected cells. Through identification of a novel ICK mutation, we confirm that disruption of ICK causes ECO syndrome, which clinically overlaps with the spectrum of ciliopathies. Expression of ICK-mutated proteins result in an abnormal ciliary localization compared to wild-type protein. Primary fibroblasts derived from an individual with ECO syndrome display ciliogenesis defects. In aggregate, our findings are consistent with recent reports that show that ICK regulates ciliary biology in vitro and in mice, confirming that ECO syndrome is a severe ciliopathy.
75 FR 24400 - Drawbridge Operation Regulation; CSX Railroad, Trout River, Mile 0.9, Jacksonville, FL
2010-05-05
... an assessment of potential costs and benefits under section 6(a)(3) of that Order. The Office of... 13211. Technical Standards The National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272... position, displaying green lights to indicate that vessels may pass. (c) As a train approaches, provided...
2012-04-03
... National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies to use...] RIN 1625-AA00; 1625-AA08 Special Local Regulation and Security Zone: War of 1812 Bicentennial..., and after the War of 1812 Bicentennial Commemoration events in the Port of Boston, Massachusetts, to...
75 FR 51392 - New York: Incorporation by Reference of State Hazardous Waste Management Program
2010-08-20
... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 272 [EPA-R02-RCRA-2010-0249; FRL-9178-8] New York: Incorporation by Reference of State Hazardous Waste Management Program Correction In rule document 2010-18927 beginning on page 45489 in the issue of Tuesday, August 3, 2010, make the following correction: Appendix A...
2016-06-22
socio-technical limitations that restrict the free flow of information and communications (e.g., Bateman , 1996). The flow of information among the...networks. Phys. A Stat. Mech. Appl. 272, 173–187. doi: 10.1016/S0378- 4371(99)00291-5 Bateman , R. L. (1996). Force XXI and the death of
Magnetic, magnetoelastic and other electronic properties of a UIrAl single crystal
Czech Academy of Sciences Publication Activity Database
Andreev, Alexander V.; Mushnikov, N. V.; Honda, F.; Sechovyský, V.; Javorský, P.; Goto, T.
272-276, - (2004), e337-e339 ISSN 0304-8853 R&D Projects: GA ČR GA106/02/0943 Institutional research plan: CEZ:AV0Z1010914 Keywords : uranium intermetallics * UIrAl * UPtAl * ferromagnetism * pressure effects Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.031, year: 2004
2011-08-25
... discovers that an applicant submitted false or inaccurate information, the application may be denied. 49 CFR... information submitted in its annual renewal statement is true and correct. Any RI making a false or inaccurate... U.S.C. 272) directs NHTSA to use voluntary consensus standards in its regulatory activities unless...
Milevsky, Avidan; Schlechter, Melissa; Netter, Sarah; Keehn, Danielle
2007-01-01
Our study examined variations in adolescent adjustment as a function of maternal and paternal parenting styles. Participants included 272 students in grades 9 and 11 from a public high school in a metropolitan area of the Northeastern US. Participants completed measures of maternal and paternal parenting styles and indices of psychological…
Odkaz díla Václava Machka soudobé slavistice
Czech Academy of Sciences Publication Activity Database
Janyšková, Ilona; Karlíková, Helena
2014-01-01
Roč. 50, č. 4 (2014), s. 63-69 ISSN 0557-272X. [Zilele culturilor slave in Romania . Bucuresti, 02.10.2014-04.10.2014] R&D Projects: GA ČR GA13-17435S Institutional support: RVO:68378092 Keywords : Slavistics * Slavonic languages * etymology * Václav Machek Subject RIV: AI - Linguistics
Journal of Genetics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Genetics. P. V. Ramchander. Articles written in Journal of Genetics. Volume 88 Issue 3 December 2009 pp 267-272 Research Article. GJB2 and GJB6 gene mutations found in Indian probands with congenital hearing impairment · G. Padma P. V. Ramchander U. V. Nandur T. Padma.
76 FR 78571 - Approval and Promulgation of State Implementation Plans: Oregon
2011-12-19
... Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those...: Rule 0010, What is the Employee Commute Options Program?; Rule 0020, Who is Subject to ECO?; Rule 0030, What Does ECO require?; Rule 0040, How Does the Department Enforce ECO?; Rule 0050, Definitions of...
DEFF Research Database (Denmark)
Holsgaard-Larsen, Anders; Jensen, Carsten; Aagaard, Per
2014-01-01
) subscales (Sport/Rec and QOL) in ACL-reconstructed patients. METHODS: 23 hamstring auto-graft ACL-reconstructed men (mean age: 27.2 standard deviation 7.5years, BMI: 25.4 standard deviation 3.2 time since surgery: 27 standard deviation 7months) completed KOOS-questionnaire and an objective test-battery: (i...
Influence of stress on the permeability of coal and sedimentary rocks of the Upper Silesian Basin
Czech Academy of Sciences Publication Activity Database
Konečný, Pavel; Kožušníková, Alena
2011-01-01
Roč. 48, č. 2 (2011), s. 347-352 ISSN 1365-1609 Institutional research plan: CEZ:AV0Z30860518 Keywords : permeability * triaxial test * coal and sedimentary rocks Subject RIV: DH - Mining, incl. Coal Mining Impact factor: 1.272, year: 2011 http://www.sciencedirect.com/science/article/pii/S1365160910002194
41 CFR 101-27.206 - Procurement of shelf-life materials.
2010-07-01
... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Procurement of shelf-life materials. 101-27.206 Section 101-27.206 Public Contracts and Property Management Federal Property... MANAGEMENT 27.2-Management of Shelf-Life Materials § 101-27.206 Procurement of shelf-life materials. ...
Organizational Structures, Processes, and Problems: A Literature Review and Taxonomy
1984-05-01
and the reserves system in Israel." Archives Europeennes de Sociologie , 1974, 15 (2), 262-272. Ruber, G. P., Ullman, J., & Leifer, R. "Optimum...34 Archives Europeennes de Sociologie , 1977, 18 (1), 29-54. Maynard, C. D., & Blalock, A. B. "The welfare-state within the military." Journal of
78 FR 72020 - Drawbridge Operation Regulation; Passaic River, Kearney and Newark, NJ
2013-12-02
... National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies to use... Proposed Rulemaking Sec. Section Symbol U.S.C. United States Code A. Regulatory History and Information On... rulemaking. The Coast Guard received no comments from the Small Business Administration on this rule. The...
78 FR 35787 - Safety Zones; Revolution 3 Triathlon, Lake Erie, Sandusky Bay, Cedar Point, OH
2013-06-14
... Standards The National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies... comment, if submitted on behalf of an association, business, labor union, etc.). You may review a Privacy... time and place announced by a later notice in the Federal Register. B. Regulatory History and...
Liu, Junsheng; Chen, Xinyin; Zhou, Ying; Li, Dan; Fu, Rui; Coplan, Robert J.
2017-01-01
This study examined how shyness-sensitivity and unsociability were associated with social, school, and psychological adjustment in Chinese children and adolescents. Participants included 564 children (272 boys, M[subscript age] = 9 years) and 462 adolescents (246 boys, M[subscript age] = 13 years) in a suburban region in China. Data were obtained…
2010-02-08
... NUCLEAR REGULATORY COMMISSION [Docket Nos. 50-272, 50-311 and 50-354; NRC-2010-0043] PSEG Nuclear LLC; Hope Creek Generating Station and Salem Nuclear Generating Station, Unit Nos. 1 and 2...-70, and DPR-75, issued to PSEG Nuclear LLC (PSEG, the licensee), for operation of the Hope Creek...
2011-01-28
... adverse comments on this action during the public comment period. However, EPA is making note of two... Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those... notes that it will not impose substantial direct costs on tribal governments or preempt tribal law. The...
Czech Academy of Sciences Publication Activity Database
Brožová, Libuše; Křivčík, J.; Neděla, D.; Kysela, V.; Žitka, Jan
2015-01-01
Roč. 56, č. 12 (2015), s. 3228-3232 ISSN 1944-3994. [International Conference on Membrane and Electromembrane Processes - MELPRO 2014. Prague, 18.05.2014-21.05.2014] Institutional support: RVO:61389013 Keywords : heterogeneous ion-exchange membranes * electrochemical properties * activation Subject RIV: JP - Industrial Processing Impact factor: 1.272, year: 2015
Civil-Military Relations: A Selected Bibliography
2011-05-01
Society 29, no. 3 (Spring 2003): 373-391. Sage Rosen , Frederik. "Third-Generation Civil-Military Relations: Moving Beyond the Security- Development Nexus... Barak , Oren. The Lebanese Army: A National Institution in a Divided Society. Albany: State University of New York Press, 2009. 272pp. (UA853 .L4B37
2011-11-14
.... Discussion the differences between AIXM and the Modeling Effort for Terrain and Obstacles within the... structure'' in DO-272. Determine if and how to re-write Appendix E. Review work on Temporality. ASRN V&V... to space availability. With the approval of the chairman, members of the public may present oral...
2012-03-12
... Modeling Effort for Terrain and Obstacles within the Committee [ssquf] Decided on a method for addressing the use of the term ``obstacle'' in DO-276 and ``vertical structure'' in DO-272. [ssquf] Determine if... Meeting Adjourn Attendance is open to the interested public but limited to space availability. With the...
DEFF Research Database (Denmark)
Gupta, Nidhi; Christiansen, Caroline Stordal; Hanisch, Christiana
2017-01-01
with questionnaire-based siting time and other self-reported predictors to predict accelerometer-based sitting time. Results Questionnaire-based and accelerometer-based average sitting times were ≈272 and ≈476min/day, respectively. A low Pearson correlation (r=0.32), high mean bias (204.1min) and wide limits...
African Journals Online (AJOL)
Caffeine was extracted from 19 different types of non-alcoholic beverages and prepared teas sampled from supermarkets in ... use of HPLC-UV detector at the wavelength of 272nm, Supelco HS C18 .... tor (Shimadzu Corporation, Kyoto Japan) was ... for the analysis of caffeine content in non- .... Diabetes Technology and.
Beck, Kenneth H.; Summons, Terry G.
1985-01-01
Surveyed college students (N=272) and convicted DWI offenders (N=261). The results revealed that DWI offenders tend to drink in their own home, alone, and to relieve stress; whereas college students are more likely to drink at a party, for the enjoyment of taste, and to get drunk. (JAC)
South African Journal of Higher Education - Vol 18, No 1 (2004)
African Journals Online (AJOL)
Selection for the Science Foundation Programme (University of Natal): the development of a selection instrument · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. S Grussendorff, M Liebenberg, J Houston, 265-272. http://dx.doi.org/10.4314/sajhe.v18i1.25442 ...
Chromosomal study in newborn infants with congenital anomalies in ...
African Journals Online (AJOL)
Congenital anomalies were found in 103 cases with a prevalence of 2.06% with male to female ratio of 1.7:1. Skeletal system anomalies had the highestfrequency (37.9%), followed in descending order by chromosomal abnormalities (27.2%), circulatory system anomalies (22.3%), central nervous system (CNS) anomalies ...
Photoinduced centers in PbZr.sub.1-x./sub.Ti.sub.x./sub.O.sub.3./sub. single crystals
Czech Academy of Sciences Publication Activity Database
Bykov, I. P.; Glinchuk, M. D.; Laguta, V. V.; Nokhrin, S. N.; Jastrabík, Lubomír; Smotrakov, V.; Hrabovský, Miroslav; Eremkin, V.
2002-01-01
Roč. 272, - (2002), s. 167-172 ISSN 0015-0193 R&D Projects: GA MŠk LN00A015 Institutional research plan: CEZ:AV0Z1010914 Keywords : sinle-crystal * g-tensor * paramagnetic ions * UV illumination Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.408, year: 2002
76 FR 11404 - Oregon: Tentative Approval of State Underground Storage Tank Program
2011-03-02
... Order 12866. 9. National Technology Transfer and Advancement Act Section 12(d) of the National Technology Transfer and Advancement Act of 1995 (``NTTAA''), Public Law 104-113, section 12(d) (15 U.S.C. 272... Confidential Business Information (CBI) or other information whose disclosure is restricted by statute. Do not...
2011-11-16
... requirements of Section 12(d) of the National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272...-volume reports), and some may not be available in either location (e.g., confidential business information (CBI)). To inspect the hard copy materials, please schedule an appointment during normal business...
2013-01-31
... requirements of Section 12(d) of the National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272..., multi- volume reports), and some may not be available in either location (e.g., confidential business information (CBI)). To inspect the hard copy materials, please schedule an appointment during normal business...
2011-11-01
... requirements of Section 12(d) of the National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272... available in either location (e.g., confidential business information (CBI)). To inspect the hard copy materials, please schedule an appointment during normal business hours with the contact listed in the FOR...
2013-08-29
... requirements of Section 12(d) of the National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272... reports), and some may not be available in either location (e.g., confidential business information (CBI)). To inspect the hard copy materials, please schedule an appointment during normal business hours with...
78 FR 20035 - Adequacy of Oregon Municipal Solid Waste Landfill Permit Program
2013-04-03
... Executive Order 12866. 9. National Technology Transfer and Advancement Act Section 12(d) of the National Technology Transfer and Advancement Act of 1995 (``NTTAA''), Public Law 104-113, section 12(d) (15 U.S.C. 272... information claimed to be Confidential Business Information (CBI) or claimed to be other information whose...
40 CFR 721.10094 - Decene, branched and linear.
2010-07-01
... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Decene, branched and linear. 721.10094... Substances § 721.10094 Decene, branched and linear. (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as decene, branched and linear (PMN P-03-272; CAS...
AFRICAN JOURNAL OF ECONOMIC REVIEW
African Journals Online (AJOL)
Dr Kazungu
African Journal of Economic Review, Volume IV, Issue 2, July 2016. 92. Reaching the ..... children in AIDS. Clinical AIDS identified through home- ..... 0.11. Bilharzias. 0.68 pregnancy related problems. 2.72. Dental. 0.89 intentional injury. 0.61 ..... international in collaboration with: research triangle institute (rti), the centre for.
2013-12-26
... overall mobile source emissions from cars and trucks and generally small area source contributions in the... solid fuel burning device is the sole source of heat. Because the residential woodstove burn ban program... National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those...
Abd-Elmotaleb, Moustafa; Saha, Sudhir K.
2013-01-01
This study examines the mediating influence of academic self-efficacy on the link between perceived academic climate and academic performance among university students. The participants in the study consist of 272 undergraduate students at the University of Assiut, Assiut, Egypt. A scale to measure perceived academic climate, was developed. To…
Longitudinal Modeling of Adolescent Normative Beliefs and Substance Initiation
Lillehoj, Catherine J.; Trudeau, Linda; Spoth, Richard
2005-01-01
Pstudy investigated the effects of baseline levels of academic achievement and longitudinal trends in normative beliefs on adolescent substance initiation across a 42-month time period. Participants were 272 rural adolescents who were an average of 12.3 years old at the baseline assessment. Academic achievement positively predicted the intercept…
2012-06-11
... of cumulative data only. Background The Office of Management and Budget has consolidated the Financial Status Report (FSR or SF-269/SF-269A) and the Federal Cash Transaction Report (FCTR or SF-272/SF..., 2010, CDC grantees have been required to report cash transaction data via the Payment Management System...
Laserový systém pro odměřování reliéfu MIEMS vytvářeného metodou hlubokého reaktivního leptání
Czech Academy of Sciences Publication Activity Database
Maňka, Tadeáš; Šerý, Mojmír; Lazar, Josef; Číp, Ondřej; Krátký, Stanislav; Zemánek, Pavel
2017-01-01
Roč. 62, č. 10 (2017), s. 270-272 ISSN 0447-6441 R&D Projects: GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : laser interferometry * reactive ion etching * micro electro-mechanical system Subject RIV: BH - Optics, Masers, Lasers OBOR OECD: Optics (including laser optics and quantum optics)
Cerebrospinal fluid markers for differential dementia diagnosis in a large memory clinic cohort.
Schoonenboom, N.S.M.; Reesink, F.E.; Verwey, N.A.; Kester, M.I.; Teunissen, C.E.; van de Ven, P.M.; Pijnenburg, Y.A.L.; Blankenstein, M.A.; Rozemuller, J.M.; Scheltens, P.; van der Flier, W.M.
2012-01-01
Objective: To determine how amyloid β 42 (Aβ42), total tau (t-tau), and phosphorylated tau (p-tau) levels in CSF behave in a large cohort of patients with different types of dementia. Methods: Baseline CSF was collected from 512 patients with Alzheimer disease (AD) and 272 patients with other types
2010-12-29
... display is for entertainment purposes. From 11 a.m. until 11 p.m. on December 31, 2010, pyrotechnics will... Standards The National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies... changing Regulated Navigation Areas and security or safety zones. An environmental analysis checklist and a...
2010-06-17
... entertainment purposes. The purpose of the safety zone is to establish a temporary restricted area on the waters... National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies to use... changing Regulated Navigation Areas and security or safety zones. An environmental analysis checklist and a...
Relationship Between Perception And Role Of Local Leaders In ...
African Journals Online (AJOL)
The study examined the relationship between perception of local leaders and their role in rural development in Delta State, Nigeria. A multi-stage sampling technique was used to collect data from 272 respondents in 30 communities. Means and simple regression were used to analyze data collected. Findings revealed that ...
Children's and Adolescents' Developing Perceptions of Gender Inequality
Neff, Kristin D.; Cooper, Carey E.; Woodruff, Althea L.
2007-01-01
Two studies examined children's and adolescents' developing perceptions of gender inequality. The first study examined perceptions of inequality among 272 early, middle, and late adolescents, focusing on the spheres of politics, business, and the home. Results indicated an age-related increase in perceptions of male dominance. Men were seen to…
2013-12-27
...] Grant of Interim Extension of the Term of U.S. Patent No. 5,496,801; Recombinant Human Parathyroid...,801. FOR FURTHER INFORMATION CONTACT: Mary C. Till by telephone at (571) 272-7755; by mail marked to... No. 5,496,801. The patent claims the human biological product recombinant human parathyroid hormone...
1957-01-01
R. H. Morgan, "Screen Intensification Systems and Their Lirnita- tions," Amtvican J w n u l of Roenlgenology and Radizcm Therapy , Vol. LXII, No...443. (1 10) Kurt Matthaes, " Magneto -Inductive Testing of Stcel," Zeitschrgt filr Melnll- kunde, Vol. 39, September, 1948, p]). 257- 272. (1 11
EST Table: FS913950 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available FS913950 E_FL_fufe_30M22_F_0 10/09/28 87 %/272 aa ref|NP_001098702.1| nanos-like pr...otein [Bombyx mori] gb|ABS17681.1| nanos-like protein [Bombyx mori] 10/09/12 low homology 10/08/29 n.h 10/09
14 CFR 1260.152 - Financial reporting.
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Financial reporting. 1260.152 Section 1260... Higher Education, Hospitals, and Other Non-Profit Organizations Reports and Records § 1260.152 Financial reporting. (a) When funds are advanced to recipients, each recipient is required to submit the SF 272...
77 FR 25592 - Safety Zone; Patapsco River, Northwest and Inner Harbors, Baltimore, MD
2012-05-01
... National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies to use... historic sloop-of-war USS CONSTELLATION on May 24, 2012. This action is necessary to provide for the safety...-of-war USS CONSTELLATION in Baltimore, Maryland on May 24, 2012. Planned events include a three- hour...
48 CFR 11.101 - Order of precedence for requirements documents.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Order of precedence for... A-119, “Federal Participation in the Development and Use of Voluntary Consensus Standards and in... of 1995, Pub. L. 104-113 (15 U.S.C. 272 note), agencies must use voluntary consensus standards, when...
International Nuclear Information System (INIS)
Magnea, N.; Pautrat, J.L.; Saminadayar, K.; Martin, P.; Bontemps, A.
1979-01-01
Gold is characterized in pure ZnTe by capacitance, luminescence and infra-red absorption experiments. The position of gold in the lattice is analysed by channeling of charged particles. We show that gold is principally introduced in substitutional position (Ausub(Zn)) and give a simple acceptor level at Esub(V) + 272 meV
Hollenbeck, John R.; And Others
1987-01-01
Explored utility of adopting supply-side approach to understanding the nature of wage differentials between men and women using job applicants (N=272) as subjects. Results suggested much of the wage gap can be explained by evaluations of outcomes other than pay, and gender-related differences in expectancies, instrumentalities, and valences with…
Does smoking increase sick-leaves? Evidence using register data on Swedish workers
Lundborg, N.
2007-01-01
Objective: To examine the effect of smoking on sick leave. Methods: Nationally representative data on 14 272 workers aged 16-65 years from the 1988-91 waves of the Swedish Survey of Living Conditions were used for the analyses. The data are linked to register-based data, on the annual number of
41 CFR 101-27.209 - Utilization and distribution of shelf-life items.
2010-07-01
... distribution of shelf-life items. 101-27.209 Section 101-27.209 Public Contracts and Property Management... PROCUREMENT 27-INVENTORY MANAGEMENT 27.2-Management of Shelf-Life Materials § 101-27.209 Utilization and distribution of shelf-life items. Where it is determined that specified quantities of both Type I and Type II...
Directory of Open Access Journals (Sweden)
J. Valsa
2016-09-01
Level of calcium (27.2 mg/dl and magnesium (13.54 mg/dl in seminal plasma did not show any significant changes during study period from that of at ½ h. The study concluded that electrolytes under study were not responsible for the decrease in motility during study period.
78 FR 70218 - Drawbridge Operation Regulation; Hackensack River, Kearney and Jersey City, NJ
2013-11-25
... National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies to use.... United States Code A. Regulatory History and Information On August 28, 2013, we published a notice of... Small Business Administration on this rule. The Coast Guard certifies under 5 U.S.C. 605(b) that this...
2011-04-06
... NUCLEAR REGULATORY COMMISSION [Docket Nos. 50-272, 50-311, 50-354; NRC-2009-0390 and NRC-2009-0391] PSEG Nuclear, LLC, Hope Creek Generating Station and Salem Nuclear Generating Station, Units 1 and 2..., DPR-70, and DPR-75 for an additional 20 years of operation for the Hope Creek Generating Station (HCGS...
African Journals Online (AJOL)
Items 101 - 150 of 272 ... Vol 7, No 2 (2008), Haematology of dogs infected with canine distemper virus, Abstract PDF. MCO Ezeibe, RI Udegbunam. Vol 15, No 3 (2017), Haemogram and hormonal profile of WAD bucks treated with leaf ethanolic extract of Spondias mombin, Abstract PDF. AA Oloye, OE Ola-Davies, MO ...
International study on inter-reader variability for circulating tumor cells in breast cancer
Ignatiadis, Michail; Riethdorf, Sabine; Bidard, François-Clement; Vaucher, Isabelle; Khazour, Mustapha; Rothe, Francoise; Metallo, Jessica; Rouas, Ghizlane; Payne, Rachel E.; Coombes, Raoul Charles; Teufel, Ingrid; Andergassen, Ulrich; Apostolaki, Stella; Politaki, Eleni; Mavroudis, Dimitris; Bessi, Silvia; Pestrin, Martta; di Leo, Angelo; Campion, Michael; Reinholz, Monica; Perez, Edith; Piccart, Martine; Borgen, Elin; Naume, Bjorn; Jimenez, Jose; Aura, Claudia Monica; Zorzino, Laura; Cassatella, Maria Cristina; Sandri, Maria Teresa; Mostert, Bianca; Sleijfer, Stefan; Kraan, Jaco; Janni, Wolfgang; Fehm, Tanja; Rack, Brigitte; Terstappen, Leonardus Wendelinus Mathias Marie; Repollet, Madeline; Pierga, Jean-Yves; Miller, Craig; Sotiriou, Christos; Michiels, Stefan; Pantel, Klaus
2014-01-01
IntroductionCirculating tumor cells (CTCs) have been studied in breast cancer with the CellSearch® system. Given the low CTC counts in non-metastatic breast cancer, it is important to evaluate the inter-reader agreement. MethodsCellSearch® images (N = 272) of either CTCs or white blood cells or
Fundamental relations of mineral specific magnetic carriers for paleointensity determination
Czech Academy of Sciences Publication Activity Database
Kletetschka, Günther; Wieczorek, M. A.
2017-01-01
Roč. 272, November 2017 (2017), s. 44-49 ISSN 0031-9201 Institutional support: RVO:67985831 Keywords : Paleofield determination * TRM * Planetary magnetic anomalies * Néel’s theory of magnetism * Magnetic acquisition * Moon * Mars Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics OBOR OECD: Particles and field physics Impact factor: 2.075, year: 2016
Collective motion in hot superheavy nuclei
Tveter, TS; Gaardhoje, JJ; Maj, A; Ramsoy, T; Atac, A; Bacelar, J; Bracco, A; Buda, A; Camera, F; Herskind, B; Korten, W; Krolas, W; Menthe, A; Million, B; Nifenecker, H; Pignanelli, M; Pinston, JA; vanderPloeg, H; Schussler, F; Sletten, G
1996-01-01
The superheavy nucleus (272)(108)Hs and its evaporation daughters have been produced using the reaction Th-232(Ar-40,gamma xn) with beam energies 10.5 and 15.0 MeV/A. The Giant Dipole Resonance gamma-radiation from the hot conglomerate system prior to fission has been isolated using a differential
2015-07-13
dimensional simulations were performed using the unsteady ignition and combustion with reactions ( UNICORN ) model [28,33–36]. UNICORN only requires the inflow...Katta VR. 1998 Role of flow visualization in the development of UNICORN . J. Vis. 2, 257–272. (doi:10.1007/BF03181442) 34. Katta VR, Goss LP, Roquemore WM
Acute effects of ghrelin administration on glucose and lipid metabolism
DEFF Research Database (Denmark)
Vestergaard, Esben Thyssen; Djurhuus, Christian Born; Gjedsted, Jakob
2007-01-01
-blind, placebo-controlled two-period crossover study. SETTING: The study was performed in a university clinical research laboratory. PARTICIPANTS: Eight healthy men aged 27.2 +/- 0.9 yr with a body mass index of 23.4 +/- 0.5 kg/m(2) were included in the study. INTERVENTION: Subjects received infusion of ghrelin...
Differential immunodominance hierarchy of CD8+ T-cell responses in HLA-B*27
DEFF Research Database (Denmark)
Adland, Emily; Hill, Matilda; Lavandier, Nora
2018-01-01
The well-characterized association between HLA-B*27:05 and protection against HIV disease progression has been linked to immunodominant HLA-B*27:05- restricted CD8+ T-cell responses toward the conserved Gag KK10 (residues 263 to 272) and polymerase (Pol) KY9 (residues 901 to 909) epitopes. We stu...
Tambyraja, Sherine R.; Schmitt, Mary Beth; Farquharson, Kelly; Justice, Laura M.
2015-01-01
Purpose: The present study focused on the identification and stability of language and literacy profiles of primary school children receiving school-based language therapy over the course of one academic year. Method: Participants included 272 early elementary school-age children (144 boys, 128 girls) who had been clinically identified as having a…
Warburg effect—damping of electromagnetic oscillations
Czech Academy of Sciences Publication Activity Database
Pokorný, Jiří; Pokorný, Jan; Borodavka, Fedir
2017-01-01
Roč. 36, č. 3 (2017), s. 270-278 ISSN 1536-8378 R&D Projects: GA ČR GA16-12757S Institutional support: RVO:68378271 Keywords : Warburg effect * mitochondrial dysfunction * water ordering * mitochondrial membrane potential * biological electromagnetic activity * cancer Subject RIV: BO - Biophysics OBOR OECD: Biophysics Impact factor: 1.272, year: 2016
Elektrochemická oxidace přírodních barviv používaných na uměleckých památkách
Czech Academy of Sciences Publication Activity Database
Ramešová, Šárka; Sokolová, Romana
2014-01-01
Roč. 108, č. 5 (2014), s. 507-512 ISSN 0009-2770 Grant - others:Rada Programu interní podpory projektů mezinárodní spolupráce AV ČR M200401201 Program:M Institutional support: RVO:61388955 Keywords : flavonoids * spectroelectrochemistry * oxidation Subject RIV: CG - Electrochemistry Impact factor: 0.272, year: 2014
Mental Health in Danish Domestic and International Adoptees as Young Adults
DEFF Research Database (Denmark)
Olsen, Rikke Fuglsang
This study examines psychiatric contacts and a range of psychiatric disorders among domestic and international adoptees in Denmark using register data on all non-kin adoptees from the birth cohorts of 1989–1994 (N=3.180) and their non-adopted peers (N=418,272). The odds of an adoptee having a psy...
Effect of Mahogany (Khaya senegalensis L) Leaf Extract on Root ...
African Journals Online (AJOL)
acer
Available online at http://ajol.info/index.php/njbas/index. Nigerian Journal of Basic and Applied Science (2010), 18(2): 272-276. ISSN 0794-5698. Effect of Mahogany (Khaya senegalensis L) Leaf Extract on Root-Knot Nematode of. Tomatoes (Lycopersicum esculentum L.) B. Liman. 1. , M. Ibrahim. 1. , N.T. Ibrahim. 1.
2012-03-15
... 2500 Revolutions per Minute (RPM) tests. The TSI test is a tailpipe test which checks the vehicle's... of the program and technology changes that were implemented in the years following the 80 percent... requirements of Section 12(d) of the National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272...
Mellard, Daryl F.; Anthony, Jason L.; Woods, Kari L.
2012-01-01
This study extends the literature on the component skills involved in oral reading fluency. Dominance analysis was applied to assess the relative importance of seven reading-related component skills in the prediction of the oral reading fluency of 272 adult literacy learners. The best predictors of oral reading fluency when text difficulty was…
Environmental Resource Management Issues in Agronomy: A Lecture/Laboratory Course
Munn, D. A.
2004-01-01
Environmental Sciences Technology T272 is a course with a laboratory addressing problems in soil and water quality and organic wastes utilization to serve students from associate degree programs in laboratory science and environmental resources management at a 2-year technical college. Goals are to build basic lab skills and understand the role…
Czech Academy of Sciences Publication Activity Database
Hejtmánek, Jiří; Jirák, Zdeněk; Knížek, Karel; Pollert, Emil; Martin, C.; Maignan, A.
272-276, - (2004), e287-e288 ISSN 0304-8853 R&D Projects: GA AV ČR IAA1010202; GA ČR GA203/03/0924 Institutional research plan: CEZ:AV0Z1010914 Keywords : phase separation * colossal magnetoresistance Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.031, year: 2004
Sorption of Sr(II) onto nanocomposites of graphene oxide-polymeric matrix
Czech Academy of Sciences Publication Activity Database
Bubeníková, M.; Ecorchard, Petra; Szatmáry, L.; Mrózek, Ondřej; Salačová, P.; Tolasz, Jakub
2018-01-01
Roč. 315, č. 2 (2018), s. 263-272 ISSN 0236-5731 R&D Projects: GA TA ČR(CZ) TA04020222 Institutional support: RVO:61388980 Keywords : Graphene oxide * Nanocomposite * PA66 * Polystyrene * Radiostrontium removal Subject RIV: CA - Inorganic Chemistry OBOR OECD: Inorganic and nuclear chemistry Impact factor: 1.282, year: 2016
Automated Laser Ultrasonic Testing (ALUT) of Hybrid Arc Welds for Pipeline Construction, #272
2009-12-22
One challenge in developing new gas reserves is the high cost of pipeline construction. Welding costs are a major component of overall construction costs. Industry continues to seek advanced pipeline welding technologies to improve productivity and s...
Crystal structure of spinach major light-harvesting complex at 2.72Å resolution
Liu, Zhenfeng; Yan, Hanchi; Wang, Kebin; Kuang, Tingyun; Zhang, Jiping; Gui, Lulu; An, Xiaomin; Chang, Wenrui
2004-03-01
The major light-harvesting complex of photosystem II (LHC-II) serves as the principal solar energy collector in the photosynthesis of green plants and presumably also functions in photoprotection under high-light conditions. Here we report the first X-ray structure of LHC-II in icosahedral proteoliposome assembly at atomic detail. One asymmetric unit of a large R32 unit cell contains ten LHC-II monomers. The 14 chlorophylls (Chl) in each monomer can be unambiguously distinguished as eight Chla and six Chlb molecules. Assignment of the orientation of the transition dipole moment of each chlorophyll has been achieved. All Chlb are located around the interface between adjacent monomers, and together with Chla they are the basis for efficient light harvesting. Four carotenoid-binding sites per monomer have been observed. The xanthophyll-cycle carotenoid at the monomer-monomer interface may be involved in the non-radiative dissipation of excessive energy, one of the photoprotective strategies that have evolved in plants.
46 CFR 272.41 - Requirements for examination and allocation of M&R expenses.
2010-10-01
... such repairs does not exceed the franchise or deductible of the policy, or (ii) The date of the... requirements contained in paragraph (d) introductory text were approved by the Office of Management and Budget...
Mutational analysis of Glu272 in elongation factor 1A of E. coli
DEFF Research Database (Denmark)
Mansilla, Francisco; Knudsen, Charlotte Rohde; Clark, Brian F. C.
1998-01-01
In our previous work (Mansilla et al. (1997) Protein Eng. 10, 927-934) we showed that Arg7 of Escherichia coli elongation factor Tu (EF1A) plays an essential role in aminoacyl-tRNA (aa-tRNA) binding. Substitution of Arg7 by Ala or Glu lost this activity. We proposed that Arg7 forms a salt bridge...
Mutational analysis of Glu272 in elongation factor 1A of E. coli
DEFF Research Database (Denmark)
Mansilla, Francisco; Knudsen, Charlotte Rohde; Clark, Brian F. C.
1998-01-01
In our previous work (Mansilla et al. (1997) Protein Eng. 10, 927-934) we showed that Arg7 of Escherichia coli elongation factor Tu (EF1A) plays an essential role in aminoacyl-tRNA (aa-tRNA) binding. Substitution of Arg7 by Ala or Glu lost this activity. We proposed that Arg7 forms a salt bridge ...
The Effect of HLRs on Nitrogen Removal by Using a Pilot-scale Aerated Steel Slag System
Directory of Open Access Journals (Sweden)
Hamdan R.
2017-01-01
Full Text Available Discharge from domestic wastewater treatment plant amongst the main sources of nitrogen pollution in the environment. However, to remove nitrogen conventionally in domestic wastewater require high cost and complex chemical treatment method. Vertical flow aerated rock filter emerged as one of attractive alternative wastewater treatment method due to simplicity and compactness of the system. However, the application is yet to be developed in warm climate countries in particular Malaysia. Therefore, this study was conducted to investigate the effect of hydraulic loading rate (HLR to the performance of a pilot-scale Vertical Flow Aerated Rock Filter (VFARF in removing nitrogen from domestic wastewater using pilot-scale VFARF systems with steel slag as the filter media. Furthermore, this study has been designed to focus on the effects of two HLRs; 2.72 and 1.04 m3/m3.day. Influent and effluent of the filter systems were monitored biweekly basis for 11 weeks and analyzed for selected parameters. Results from this study shows that the VFARF with HLR 1.04 m3/m3.day has performed better in terms of removal ammonium-nitrogen and TKN as the system able to remove 90.4 ± 6.9%, 86.2 ± 10.7%, whilst the VFARF with 2.72 m3/m3.day remove 87.4 ± 9.9%, 80 ± 11.7%, respectively. From the observation, it can be concluded that nitrogen removal does affect by HLR as the removal in lower HLR system was higher due to high DO level in the VFARF system with 1.04 m3/m3.day which range from 4.5 to 5.1 mg/L whilst the DO level was slightly lower in the VFARF system with 2.72 m3/m3.day in the range of 3.7 to 4.5 mg/L.
Cleyrat, Cédric; Girard, Romain; Choi, Eun H; Jeziorski, Éric; Lavabre-Bertrand, Thierry; Hermouet, Sylvie; Carillo, Serge; Wilson, Bridget S
2017-09-26
Thrombopoietin (Tpo) and its receptor (Mpl) are the principal regulators of early and late thrombopoiesis and hematopoietic stem cell maintenance. Mutations in MPL can drastically impair its function and be a contributing factor in multiple hematologic malignancies, including congenital amegakaryocytic thrombocytopenia (CAMT). CAMT is characterized by severe thrombocytopenia at birth, which progresses to bone marrow failure and pancytopenia. Here we report unique familial cases of CAMT that presented with a previously unreported MPL mutation: T814C (W272R) in the background of the activating MPL G117T (K39N or Baltimore) mutation. Confocal microscopy, proliferation and surface biotinylation assays, co-immunoprecipitation, and western blotting analysis were used to elucidate the function and trafficking of Mpl mutants. Results showed that Mpl protein bearing the W272R mutation, alone or together with the K39N mutation, lacks detectable surface expression while being strongly colocalized with the endoplasmic reticulum (ER) marker calreticulin. Both WT and K39N-mutated Mpl were found to be signaling competent, but single or double mutants bearing W272R were unresponsive to Tpo. Function of the deficient Mpl receptor could be rescued by using 2 separate approaches: (1) GRASP55 overexpression, which partially restored Tpo-induced signaling of mutant Mpl by activating an autophagy-dependent secretory pathway and thus forcing ER-trapped immature receptors to traffic to the cell surface; and (2) CRISPR-Cas9 gene editing used to repair MPL T814C mutation in transfected cell lines and primary umbilical cord blood-derived CD34 + cells. We demonstrate proof of principle for rescue of mutant Mpl function by using gene editing of primary hematopoietic stem cells, which indicates direct therapeutic applications for CAMT patients.